F490804
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1146 | 456 | 2292 | 472 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0030744|Ga0501034_0030744_1378_2946 |
| Length | 522 |
| Sequence | MAVIVDPLRLNGHYGRHDWGEDIVHQGTLSAALAGCKPALDGPWLQRQFPHELETAMNLAAKPSRDRKAAIDALTAAFGNRVVTSQAVREQHGNTVTWLPNEPPDAVVFPQSTQDVQQIVGMCAEHNMPIVPFGTGSSLEGHVNAPFGGVSIDFRDMNKVLAVHAEDLDCVIEPGLTRKALNEYLRASGVFFPIDPGADASLGGMTATRASGTNAVRYGTMKDNVLALKVVMPNGELMTTARRAKKTSAGYDLTRLMVGSEGTLGVITELTLKLHGIPEAISGGTCPFPSVEACCNTAIQTIQTGIPIARIELLDALQVRAVNLHSKLGLPETPMLFLEFHGTEASVAEQSQRFGEIAAEFGGGPFQWTTKQEERTKLWDARHHAAFSNFALRPGSHMIATDVCVPISRLAECVTQTQADIAESKLVAPIVGHIGDGNFHLTLLIDMNDADEIARAKALNERLVQRALSMDGTCTGEHGVGQGKMKYLKAEHGAPALAAMAAIKRALDPQNIMNPGKMIPLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 256 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 264 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 281 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 287 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 288 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 292 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 293 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 294 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 295 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 296 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 363 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 366 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 367 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 368 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 371 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 372 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 373 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 374 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 375 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 376 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 377 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 378 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 413 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 414 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 430 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 432 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 437 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 438 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 439 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 440 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 441 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 442 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 443 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 444 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 445 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 446 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 447 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 448 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 449 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 450 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 451 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 452 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 453 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 454 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 455 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 456 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.25 |
| Metatranscriptomes | 0 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.4 |
| Nodule | 1.05 |
| Rhizoplane | 8.46 |
| Rhizosphere | 85.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0030744 | 3300049571 | Bacteria | 5457 |
| 2 | 2214884074 | 2209111006 | Bacteria | 7920 |
| 3 | ARcpr5oldR_c000047 | 3300000041 | Bacteria | 22345 |
| 4 | ARSoilYngRDRAFT_c00157 | 3300000042 | Bacteria | 11648 |
| 5 | ARcpr5yngRDRAFT_c000017 | 3300000043 | Bacteria | 27988 |
| 6 | ARSoilOldRDRAFT_c000006 | 3300000044 | Bacteria | 57169 |
| 7 | ARCol0oldRDRAFT_c00394 | 3300000045 | Unclassified | 4195 |
| 8 | ARCol0yngRDRAFT_1000410 | 3300000652 | Bacteria | 5697 |
| 9 | JGI24032J14994_100449 | 3300001430 | Unclassified | 2142 |
| 10 | JGI24746J21847_1001205 | 3300001977 | Unclassified | 4101 |
| 11 | JGI24739J22299_10012522 | 3300001989 | Unclassified | 3112 |
| 12 | JGI24743J22301_10001864 | 3300001991 | Bacteria | 3053 |
| 13 | JGI24743J22301_10001874 | 3300001991 | Unclassified | 3045 |
| 14 | JGI24750J21931_1000171 | 3300002070 | Bacteria | 10831 |
| 15 | JGI24745J21846_1000238 | 3300002073 | Unclassified | 4527 |
| 16 | JGI24738J21930_10001962 | 3300002075 | Bacteria | 5541 |
| 17 | JGI24749J21850_1000164 | 3300002076 | Bacteria | 10551 |
| 18 | JGI24744J21845_10007217 | 3300002077 | Unclassified | 2296 |
| 19 | JGI24742J22300_10001863 | 3300002244 | Unclassified | 3354 |
| 20 | JGI25153J46596_10003929 | 3300003215 | Bacteria | 8151 |
| 21 | Ga0055526_1003135 | 3300003771 | Bacteria | 10710 |
| 22 | Ga0055524_1000020 | 3300003775 | Bacteria | 227971 |
| 23 | Ga0065165_1000141 | 3300005262 | Bacteria | 125536 |
| 24 | Ga0065716_1001609 | 3300005277 | Bacteria | 5289 |
| 25 | Ga0065712_10008755 | 3300005290 | Bacteria | 2185 |
| 26 | Ga0065712_10073346 | 3300005290 | Bacteria | 4422 |
| 27 | Ga0065712_10095088 | 3300005290 | Bacteria | 2231 |
| 28 | Ga0065707_10111240 | 3300005295 | Bacteria | 2401 |
| 29 | Ga0070658_10001206 | 3300005327 | Bacteria | 22151 |
| 30 | Ga0070658_10131161 | 3300005327 | Bacteria | 2089 |
| 31 | Ga0070676_10008970 | 3300005328 | Bacteria | 5409 |
| 32 | Ga0070676_10056584 | 3300005328 | Bacteria | 2318 |
| 33 | Ga0070683_100007236 | 3300005329 | Bacteria | 9366 |
| 34 | Ga0070683_100054816 | 3300005329 | Bacteria | 3697 |
| 35 | Ga0070683_100139939 | 3300005329 | Bacteria | 2293 |
| 36 | Ga0070690_100002695 | 3300005330 | Bacteria | 9575 |
| 37 | Ga0070690_100007439 | 3300005330 | Bacteria | 6275 |
| 38 | Ga0070670_100023880 | 3300005331 | Bacteria | 5260 |
| 39 | Ga0070677_10000354 | 3300005333 | Bacteria | 16037 |
| 40 | Ga0070677_10006029 | 3300005333 | Bacteria | 4017 |
| 41 | Ga0068869_100000203 | 3300005334 | Bacteria | 31014 |
| 42 | Ga0068869_100016314 | 3300005334 | Bacteria | 5004 |
| 43 | Ga0070666_10003118 | 3300005335 | Bacteria | 10068 |
| 44 | Ga0070666_10045931 | 3300005335 | Bacteria | 2928 |
| 45 | Ga0070680_100002314 | 3300005336 | Bacteria | 14060 |
| 46 | Ga0070680_100008076 | 3300005336 | Bacteria | 8038 |
| 47 | Ga0070680_100018551 | 3300005336 | Bacteria | 5499 |
| 48 | Ga0070680_100089192 | 3300005336 | Bacteria | 2552 |
| 49 | Ga0070682_100000935 | 3300005337 | Bacteria | 17035 |
| 50 | Ga0070682_100048701 | 3300005337 | Bacteria | 2639 |
| 51 | Ga0068868_100002681 | 3300005338 | Bacteria | 12350 |
| 52 | Ga0068868_100085147 | 3300005338 | Bacteria | 2539 |
| 53 | Ga0068868_100086567 | 3300005338 | Bacteria | 2519 |
| 54 | Ga0070660_100002042 | 3300005339 | Bacteria | 13931 |
| 55 | Ga0070660_100039578 | 3300005339 | Bacteria | 3584 |
| 56 | Ga0070689_100010750 | 3300005340 | Bacteria | 6536 |
| 57 | Ga0070689_100012497 | 3300005340 | Bacteria | 6118 |
| 58 | Ga0070689_100104060 | 3300005340 | Bacteria | 2250 |
| 59 | Ga0070691_10000067 | 3300005341 | Bacteria | 28711 |
| 60 | Ga0070691_10020556 | 3300005341 | Bacteria | 3050 |
| 61 | Ga0070687_100077210 | 3300005343 | Bacteria | 1806 |
| 62 | Ga0070661_100001273 | 3300005344 | Bacteria | 17718 |
| 63 | Ga0070661_100066329 | 3300005344 | Bacteria | 2652 |
| 64 | Ga0070692_10000279 | 3300005345 | Bacteria | 14346 |
| 65 | Ga0070692_10011554 | 3300005345 | Bacteria | 4057 |
| 66 | Ga0070668_100001472 | 3300005347 | Bacteria | 17006 |
| 67 | Ga0070668_100043745 | 3300005347 | Bacteria | 3434 |
| 68 | Ga0070668_100076963 | 3300005347 | Bacteria | 2607 |
| 69 | Ga0070668_100094048 | 3300005347 | Bacteria | 2366 |
| 70 | Ga0070669_100001453 | 3300005353 | Bacteria | 17173 |
| 71 | Ga0070669_100177205 | 3300005353 | Bacteria | 1666 |
| 72 | Ga0070675_100000701 | 3300005354 | Bacteria | 23221 |
| 73 | Ga0070671_100001883 | 3300005355 | Bacteria | 16034 |
| 74 | Ga0070671_100047421 | 3300005355 | Bacteria | 3573 |
| 75 | Ga0070674_100008500 | 3300005356 | Bacteria | 6115 |
| 76 | Ga0070674_100010760 | 3300005356 | Bacteria | 5547 |
| 77 | Ga0070673_100000855 | 3300005364 | Bacteria | 17061 |
| 78 | Ga0070673_100040814 | 3300005364 | Bacteria | 3563 |
| 79 | Ga0070688_100002458 | 3300005365 | Bacteria | 9366 |
| 80 | Ga0070688_100005328 | 3300005365 | Bacteria | 6760 |
| 81 | Ga0070688_100009226 | 3300005365 | Bacteria | 5384 |
| 82 | Ga0070688_100017152 | 3300005365 | Bacteria | 4154 |
| 83 | Ga0070659_100002844 | 3300005366 | Bacteria | 12316 |
| 84 | Ga0070659_100042026 | 3300005366 | Bacteria | 3574 |
| 85 | Ga0070667_100002230 | 3300005367 | Bacteria | 17055 |
| 86 | Ga0070667_100045305 | 3300005367 | Bacteria | 3697 |
| 87 | Ga0070667_100193441 | 3300005367 | Bacteria | 1803 |
| 88 | Ga0070709_10000219 | 3300005434 | Bacteria | 37061 |
| 89 | Ga0070709_10010596 | 3300005434 | Bacteria | 5110 |
| 90 | Ga0070709_10041879 | 3300005434 | Bacteria | 2824 |
| 91 | Ga0070714_100011112 | 3300005435 | Bacteria | 7135 |
| 92 | Ga0070714_100024143 | 3300005435 | Bacteria | 5001 |
| 93 | Ga0070714_100111314 | 3300005435 | Bacteria | 2424 |
| 94 | Ga0070713_100000224 | 3300005436 | Bacteria | 37679 |
| 95 | Ga0070713_100054191 | 3300005436 | Bacteria | 3326 |
| 96 | Ga0070713_100074935 | 3300005436 | Bacteria | 2869 |
| 97 | Ga0070710_10000956 | 3300005437 | Bacteria | 13707 |
| 98 | Ga0070701_10000732 | 3300005438 | Bacteria | 11634 |
| 99 | Ga0070711_100075313 | 3300005439 | Bacteria | 2389 |
| 100 | Ga0070711_100193408 | 3300005439 | Bacteria | 1565 |
| 101 | Ga0070705_100002431 | 3300005440 | Bacteria | 9366 |
| 102 | Ga0070705_100065255 | 3300005440 | Bacteria | 2179 |
| 103 | Ga0070700_100011866 | 3300005441 | Bacteria | 4840 |
| 104 | Ga0070700_100026381 | 3300005441 | Bacteria | 3430 |
| 105 | Ga0070708_100006477 | 3300005445 | Bacteria | 9315 |
| 106 | Ga0070663_100003237 | 3300005455 | Bacteria | 9366 |
| 107 | Ga0070663_100079771 | 3300005455 | Bacteria | 2403 |
| 108 | Ga0070663_100125422 | 3300005455 | Bacteria | 1944 |
| 109 | Ga0070678_100001091 | 3300005456 | Bacteria | 14198 |
| 110 | Ga0070678_100020981 | 3300005456 | Bacteria | 4297 |
| 111 | Ga0070678_100081860 | 3300005456 | Bacteria | 2449 |
| 112 | Ga0070662_100037125 | 3300005457 | Bacteria | 3452 |
| 113 | Ga0070681_10006073 | 3300005458 | Bacteria | 11714 |
| 114 | Ga0070681_10013953 | 3300005458 | Bacteria | 7993 |
| 115 | Ga0070681_10059673 | 3300005458 | Bacteria | 3794 |
| 116 | Ga0070681_10085943 | 3300005458 | Bacteria | 3098 |
| 117 | Ga0070681_10089352 | 3300005458 | Bacteria | 3032 |
| 118 | Ga0070681_10128583 | 3300005458 | Bacteria | 2466 |
| 119 | Ga0068867_100000679 | 3300005459 | Bacteria | 22540 |
| 120 | Ga0068867_100010686 | 3300005459 | Bacteria | 6475 |
| 121 | Ga0068867_100131739 | 3300005459 | Bacteria | 1944 |
| 122 | Ga0070685_10001017 | 3300005466 | Bacteria | 15078 |
| 123 | Ga0070706_100034715 | 3300005467 | Bacteria | 4658 |
| 124 | Ga0070698_100001178 | 3300005471 | Bacteria | 29022 |
| 125 | Ga0070699_100014629 | 3300005518 | Bacteria | 6749 |
| 126 | Ga0070679_100002677 | 3300005530 | Bacteria | 16220 |
| 127 | Ga0070679_100072165 | 3300005530 | Bacteria | 3444 |
| 128 | Ga0070679_100179538 | 3300005530 | Bacteria | 2089 |
| 129 | Ga0070684_100000693 | 3300005535 | Bacteria | 23221 |
| 130 | Ga0070684_100078587 | 3300005535 | Bacteria | 2915 |
| 131 | Ga0070684_100141498 | 3300005535 | Bacteria | 2175 |
| 132 | Ga0070684_100160910 | 3300005535 | Bacteria | 2037 |
| 133 | Ga0070697_100104754 | 3300005536 | Bacteria | 2352 |
| 134 | Ga0070672_100004245 | 3300005543 | Bacteria | 9369 |
| 135 | Ga0070672_100021286 | 3300005543 | Bacteria | 4743 |
| 136 | Ga0070672_100050976 | 3300005543 | Bacteria | 3226 |
| 137 | Ga0070672_100096548 | 3300005543 | Bacteria | 2391 |
| 138 | Ga0070686_100001302 | 3300005544 | Bacteria | 14092 |
| 139 | Ga0070686_100002564 | 3300005544 | Bacteria | 10020 |
| 140 | Ga0070686_100007632 | 3300005544 | Bacteria | 6043 |
| 141 | Ga0070686_100028997 | 3300005544 | Bacteria | 3361 |
| 142 | Ga0070695_100002461 | 3300005545 | Bacteria | 10663 |
| 143 | Ga0070695_100009173 | 3300005545 | Bacteria | 5882 |
| 144 | Ga0070696_100001783 | 3300005546 | Bacteria | 14106 |
| 145 | Ga0070696_100007358 | 3300005546 | Bacteria | 7353 |
| 146 | Ga0070696_100057982 | 3300005546 | Bacteria | 2704 |
| 147 | Ga0070693_100001926 | 3300005547 | Bacteria | 9497 |
| 148 | Ga0070693_100047279 | 3300005547 | Bacteria | 2448 |
| 149 | Ga0070665_100042474 | 3300005548 | Bacteria | 4570 |
| 150 | Ga0070704_100031373 | 3300005549 | Bacteria | 3574 |
| 151 | Ga0068855_100010931 | 3300005563 | Bacteria | 10955 |
| 152 | Ga0068855_100077988 | 3300005563 | Bacteria | 3843 |
| 153 | Ga0068855_100163518 | 3300005563 | Bacteria | 2525 |
| 154 | Ga0070664_100006539 | 3300005564 | Bacteria | 9399 |
| 155 | Ga0070664_100117084 | 3300005564 | Bacteria | 2330 |
| 156 | Ga0068857_100000534 | 3300005577 | Bacteria | 27500 |
| 157 | Ga0068857_100025817 | 3300005577 | Bacteria | 5173 |
| 158 | Ga0068857_100054713 | 3300005577 | Bacteria | 3542 |
| 159 | Ga0068854_100003403 | 3300005578 | Bacteria | 9917 |
| 160 | Ga0068854_100073166 | 3300005578 | Bacteria | 2511 |
| 161 | Ga0068854_100148241 | 3300005578 | Bacteria | 1806 |
| 162 | Ga0068856_100008075 | 3300005614 | Bacteria | 10274 |
| 163 | Ga0068856_100157777 | 3300005614 | Bacteria | 2279 |
| 164 | Ga0070702_100001579 | 3300005615 | Bacteria | 9391 |
| 165 | Ga0070702_100020797 | 3300005615 | Bacteria | 3443 |
| 166 | Ga0070702_100037145 | 3300005615 | Bacteria | 2704 |
| 167 | Ga0068852_100003393 | 3300005616 | Bacteria | 11127 |
| 168 | Ga0068852_100014120 | 3300005616 | Bacteria | 6133 |
| 169 | Ga0068852_100041022 | 3300005616 | Bacteria | 3909 |
| 170 | Ga0068852_100072068 | 3300005616 | Bacteria | 3035 |
| 171 | Ga0068859_100003965 | 3300005617 | Bacteria | 15100 |
| 172 | Ga0068859_100031525 | 3300005617 | Bacteria | 5323 |
| 173 | Ga0068859_100037505 | 3300005617 | Bacteria | 4864 |
| 174 | Ga0068859_100067082 | 3300005617 | Bacteria | 3622 |
| 175 | Ga0068864_100004544 | 3300005618 | Bacteria | 11395 |
| 176 | Ga0068864_100013878 | 3300005618 | Bacteria | 6678 |
| 177 | Ga0068864_100083229 | 3300005618 | Bacteria | 2810 |
| 178 | Ga0068866_10000252 | 3300005718 | Bacteria | 25051 |
| 179 | Ga0068861_100001032 | 3300005719 | Bacteria | 17052 |
| 180 | Ga0068861_100071527 | 3300005719 | Bacteria | 2689 |
| 181 | Ga0068870_10013347 | 3300005840 | Bacteria | 3859 |
| 182 | Ga0068863_100000150 | 3300005841 | Bacteria | 72968 |
| 183 | Ga0068863_100084827 | 3300005841 | Bacteria | 3002 |
| 184 | Ga0068863_100093117 | 3300005841 | Bacteria | 2860 |
| 185 | Ga0068863_100177821 | 3300005841 | Bacteria | 2042 |
| 186 | Ga0068858_100003904 | 3300005842 | Bacteria | 14725 |
| 187 | Ga0068858_100013222 | 3300005842 | Bacteria | 7777 |
| 188 | Ga0068858_100019307 | 3300005842 | Bacteria | 6373 |
| 189 | Ga0068858_100212920 | 3300005842 | Bacteria | 1829 |
| 190 | Ga0068860_100003148 | 3300005843 | Bacteria | 17055 |
| 191 | Ga0068860_100049421 | 3300005843 | Unclassified | 4005 |
| 192 | Ga0068862_100006993 | 3300005844 | Bacteria | 9366 |
| 193 | Ga0068862_100009738 | 3300005844 | Bacteria | 7944 |
| 194 | Ga0081455_10000185 | 3300005937 | Bacteria | 78750 |
| 195 | Ga0081455_10002539 | 3300005937 | Bacteria | 21666 |
| 196 | Ga0081455_10003484 | 3300005937 | Bacteria | 18077 |
| 197 | Ga0081455_10005197 | 3300005937 | Bacteria | 14318 |
| 198 | Ga0081455_10011999 | 3300005937 | Bacteria | 8671 |
| 199 | Ga0081455_10017717 | 3300005937 | Bacteria | 6815 |
| 200 | Ga0081538_10000638 | 3300005981 | Bacteria | 38813 |
| 201 | Ga0081538_10017029 | 3300005981 | Bacteria | 5539 |
| 202 | Ga0081538_10065488 | 3300005981 | Bacteria | 2045 |
| 203 | Ga0081538_10071988 | 3300005981 | Bacteria | 1898 |
| 204 | Ga0081540_1000925 | 3300005983 | Bacteria | 26377 |
| 205 | Ga0081540_1004357 | 3300005983 | Bacteria | 10826 |
| 206 | Ga0081540_1081091 | 3300005983 | Bacteria | 1460 |
| 207 | Ga0081539_10002542 | 3300005985 | Bacteria | 25354 |
| 208 | Ga0081539_10002695 | 3300005985 | Bacteria | 24099 |
| 209 | Ga0070717_10000285 | 3300006028 | Bacteria | 34330 |
| 210 | Ga0070717_10026319 | 3300006028 | Bacteria | 4640 |
| 211 | Ga0075365_10039163 | 3300006038 | Bacteria | 3085 |
| 212 | Ga0075364_10029445 | 3300006051 | Bacteria | 3521 |
| 213 | Ga0075432_10000240 | 3300006058 | Bacteria | 14777 |
| 214 | Ga0070715_10001307 | 3300006163 | Bacteria | 7164 |
| 215 | Ga0070716_100011132 | 3300006173 | Bacteria | 4527 |
| 216 | Ga0070716_100023971 | 3300006173 | Bacteria | 3244 |
| 217 | Ga0070712_100020468 | 3300006175 | Bacteria | 4329 |
| 218 | Ga0070712_100054255 | 3300006175 | Bacteria | 2802 |
| 219 | Ga0075362_10014565 | 3300006177 | Bacteria | 3176 |
| 220 | Ga0075362_10019606 | 3300006177 | Bacteria | 2815 |
| 221 | Ga0075367_10012684 | 3300006178 | Bacteria | 4506 |
| 222 | Ga0075367_10088361 | 3300006178 | Bacteria | 1883 |
| 223 | Ga0097621_100000544 | 3300006237 | Bacteria | 26555 |
| 224 | Ga0097621_100004712 | 3300006237 | Bacteria | 9530 |
| 225 | Ga0097621_100025145 | 3300006237 | Bacteria | 4657 |
| 226 | Ga0075370_10009286 | 3300006353 | Bacteria | 5103 |
| 227 | Ga0075370_10064015 | 3300006353 | Bacteria | 2097 |
| 228 | Ga0068871_100001366 | 3300006358 | Bacteria | 16355 |
| 229 | Ga0068871_100003497 | 3300006358 | Bacteria | 10802 |
| 230 | Ga0068871_100174820 | 3300006358 | Bacteria | 1843 |
| 231 | Ga0075428_100000205 | 3300006844 | Bacteria | 56652 |
| 232 | Ga0075428_100019769 | 3300006844 | Bacteria | 7453 |
| 233 | Ga0075428_100082405 | 3300006844 | Bacteria | 3510 |
| 234 | Ga0075428_100102778 | 3300006844 | Bacteria | 3117 |
| 235 | Ga0075428_100201860 | 3300006844 | Bacteria | 2149 |
| 236 | Ga0075430_100000012 | 3300006846 | Bacteria | 94359 |
| 237 | Ga0075430_100004858 | 3300006846 | Bacteria | 11310 |
| 238 | Ga0075430_100068023 | 3300006846 | Bacteria | 2989 |
| 239 | Ga0075431_100000266 | 3300006847 | Bacteria | 40349 |
| 240 | Ga0075431_100005460 | 3300006847 | Bacteria | 12559 |
| 241 | Ga0075431_100014481 | 3300006847 | Bacteria | 7978 |
| 242 | Ga0075431_100022527 | 3300006847 | Bacteria | 6441 |
| 243 | Ga0075431_100072901 | 3300006847 | Bacteria | 3543 |
| 244 | Ga0075431_100098627 | 3300006847 | Bacteria | 3016 |
| 245 | Ga0075431_100248972 | 3300006847 | Bacteria | 1806 |
| 246 | Ga0075433_10000338 | 3300006852 | Bacteria | 29055 |
| 247 | Ga0075433_10004462 | 3300006852 | Bacteria | 10906 |
| 248 | Ga0075433_10012596 | 3300006852 | Bacteria | 6840 |
| 249 | Ga0075433_10080536 | 3300006852 | Bacteria | 2871 |
| 250 | Ga0075434_100000373 | 3300006871 | Bacteria | 32610 |
| 251 | Ga0075434_100009082 | 3300006871 | Bacteria | 9258 |
| 252 | Ga0075434_100009842 | 3300006871 | Bacteria | 8940 |
| 253 | Ga0075434_100012045 | 3300006871 | Bacteria | 8184 |
| 254 | Ga0075434_100027939 | 3300006871 | Bacteria | 5538 |
| 255 | Ga0075434_100133652 | 3300006871 | Bacteria | 2500 |
| 256 | Ga0075429_100002160 | 3300006880 | Bacteria | 16411 |
| 257 | Ga0075429_100022260 | 3300006880 | Bacteria | 5498 |
| 258 | Ga0075429_100160193 | 3300006880 | Bacteria | 1971 |
| 259 | Ga0068865_100000190 | 3300006881 | Bacteria | 34392 |
| 260 | Ga0068865_100044980 | 3300006881 | Bacteria | 3024 |
| 261 | Ga0068865_100168964 | 3300006881 | Bacteria | 1675 |
| 262 | Ga0075436_100000443 | 3300006914 | Bacteria | 26527 |
| 263 | Ga0097620_100003965 | 3300006931 | Bacteria | 15100 |
| 264 | Ga0097620_100031525 | 3300006931 | Bacteria | 5323 |
| 265 | Ga0097620_100037508 | 3300006931 | Bacteria | 4864 |
| 266 | Ga0097620_100067084 | 3300006931 | Bacteria | 3622 |
| 267 | Ga0075435_100013108 | 3300007076 | Bacteria | 6158 |
| 268 | Ga0075435_100134915 | 3300007076 | Bacteria | 2067 |
| 269 | Ga0075435_100173393 | 3300007076 | Bacteria | 1820 |
| 270 | Ga0099794_10007253 | 3300007265 | Bacteria | 4543 |
| 271 | Ga0105250_10010395 | 3300009092 | Bacteria | 3880 |
| 272 | Ga0105250_10023450 | 3300009092 | Bacteria | 2486 |
| 273 | Ga0105240_10003481 | 3300009093 | Bacteria | 24428 |
| 274 | Ga0105240_10070736 | 3300009093 | Bacteria | 4316 |
| 275 | Ga0105240_10160426 | 3300009093 | Bacteria | 2671 |
| 276 | Ga0111539_10000299 | 3300009094 | Bacteria | 60010 |
| 277 | Ga0111539_10005091 | 3300009094 | Bacteria | 17061 |
| 278 | Ga0111539_10005821 | 3300009094 | Bacteria | 15939 |
| 279 | Ga0111539_10025137 | 3300009094 | Bacteria | 7300 |
| 280 | Ga0111539_10080025 | 3300009094 | Bacteria | 3844 |
| 281 | Ga0111539_10179589 | 3300009094 | Bacteria | 2472 |
| 282 | Ga0105245_10000543 | 3300009098 | Bacteria | 34420 |
| 283 | Ga0105245_10017080 | 3300009098 | Bacteria | 6332 |
| 284 | Ga0105245_10178269 | 3300009098 | Bacteria | 2028 |
| 285 | Ga0105247_10026146 | 3300009101 | Bacteria | 3523 |
| 286 | Ga0105247_10034263 | 3300009101 | Bacteria | 3093 |
| 287 | Ga0105247_10104703 | 3300009101 | Bacteria | 1813 |
| 288 | Ga0114129_10000640 | 3300009147 | Bacteria | 43706 |
| 289 | Ga0114129_10016895 | 3300009147 | Bacteria | 10390 |
| 290 | Ga0114129_10019077 | 3300009147 | Bacteria | 9768 |
| 291 | Ga0114129_10106391 | 3300009147 | Bacteria | 3875 |
| 292 | Ga0105243_10014840 | 3300009148 | Bacteria | 5895 |
| 293 | Ga0105243_10020519 | 3300009148 | Bacteria | 5009 |
| 294 | Ga0105243_10216149 | 3300009148 | Bacteria | 1691 |
| 295 | Ga0105241_10002875 | 3300009174 | Bacteria | 12867 |
| 296 | Ga0105241_10016416 | 3300009174 | Bacteria | 5431 |
| 297 | Ga0105241_10045570 | 3300009174 | Bacteria | 3328 |
| 298 | Ga0105242_10001766 | 3300009176 | Bacteria | 17062 |
| 299 | Ga0105242_10004776 | 3300009176 | Bacteria | 10490 |
| 300 | Ga0105242_10020801 | 3300009176 | Bacteria | 5147 |
| 301 | Ga0105248_10000501 | 3300009177 | Bacteria | 44646 |
| 302 | Ga0105248_10010945 | 3300009177 | Bacteria | 10011 |
| 303 | Ga0105248_10017190 | 3300009177 | Bacteria | 7969 |
| 304 | Ga0105248_10040194 | 3300009177 | Bacteria | 5244 |
| 305 | Ga0105248_10095011 | 3300009177 | Bacteria | 3356 |
| 306 | Ga0105238_10024549 | 3300009551 | Bacteria | 6144 |
| 307 | Ga0105238_10116235 | 3300009551 | Bacteria | 2654 |
| 308 | Ga0105249_10006521 | 3300009553 | Bacteria | 10153 |
| 309 | Ga0105239_10005329 | 3300010375 | Bacteria | 15087 |
| 310 | Ga0105239_10019260 | 3300010375 | Bacteria | 7538 |
| 311 | Ga0105239_10035309 | 3300010375 | Bacteria | 5491 |
| 312 | Ga0105239_10110589 | 3300010375 | Bacteria | 3046 |
| 313 | Ga0105239_10127527 | 3300010375 | Bacteria | 2829 |
| 314 | Ga0105246_10009901 | 3300011119 | Bacteria | 5878 |
| 315 | Ga0105246_10064351 | 3300011119 | Bacteria | 2561 |
| 316 | Ga0105246_10082067 | 3300011119 | Bacteria | 2300 |
| 317 | Ga0157373_10060401 | 3300013100 | Bacteria | 2686 |
| 318 | Ga0157371_10042393 | 3300013102 | Bacteria | 3243 |
| 319 | Ga0157370_10026677 | 3300013104 | Bacteria | 5701 |
| 320 | Ga0157370_10030889 | 3300013104 | Bacteria | 5246 |
| 321 | Ga0157369_10048634 | 3300013105 | Bacteria | 4601 |
| 322 | Ga0157369_10232379 | 3300013105 | Bacteria | 1928 |
| 323 | Ga0171462_1032 | 3300013250 | Bacteria | 98473 |
| 324 | Ga0157374_10013556 | 3300013296 | Bacteria | 7118 |
| 325 | Ga0157374_10067536 | 3300013296 | Bacteria | 3361 |
| 326 | Ga0157378_10003057 | 3300013297 | Bacteria | 14869 |
| 327 | Ga0163162_10004207 | 3300013306 | Bacteria | 13834 |
| 328 | Ga0163162_10083860 | 3300013306 | Bacteria | 3261 |
| 329 | Ga0163162_10236195 | 3300013306 | Bacteria | 1958 |
| 330 | Ga0157372_10028637 | 3300013307 | Bacteria | 6082 |
| 331 | Ga0157375_10002141 | 3300013308 | Bacteria | 17061 |
| 332 | Ga0157375_10009534 | 3300013308 | Bacteria | 8523 |
| 333 | Ga0157375_10011822 | 3300013308 | Bacteria | 7718 |
| 334 | Ga0157375_10289737 | 3300013308 | Bacteria | 1800 |
| 335 | Ga0163163_10003931 | 3300014325 | Bacteria | 12675 |
| 336 | Ga0163163_10010114 | 3300014325 | Bacteria | 8461 |
| 337 | Ga0163163_10187720 | 3300014325 | Bacteria | 2115 |
| 338 | Ga0157380_10000049 | 3300014326 | Bacteria | 71296 |
| 339 | Ga0157380_10117233 | 3300014326 | Bacteria | 2249 |
| 340 | Ga0182008_10048537 | 3300014497 | Bacteria | 2108 |
| 341 | Ga0157377_10002000 | 3300014745 | Bacteria | 8928 |
| 342 | Ga0157377_10013212 | 3300014745 | Bacteria | 4175 |
| 343 | Ga0157379_10035738 | 3300014968 | Bacteria | 4430 |
| 344 | Ga0157379_10080671 | 3300014968 | Bacteria | 2914 |
| 345 | Ga0157376_10000099 | 3300014969 | Bacteria | 62912 |
| 346 | Ga0157376_10148915 | 3300014969 | Bacteria | 2109 |
| 347 | Ga0163161_10000081 | 3300017792 | Bacteria | 97213 |
| 348 | Ga0163161_10075725 | 3300017792 | Bacteria | 2470 |
| 349 | Ga0163161_10140989 | 3300017792 | Bacteria | 1825 |
| 350 | Ga0213876_10001399 | 3300021384 | Bacteria | 15040 |
| 351 | Ga0213876_10070589 | 3300021384 | Bacteria | 1845 |
| 352 | Ga0213875_10004329 | 3300021388 | Bacteria | 7821 |
| 353 | Ga0209233_1012396 | 3300025261 | Bacteria | 2475 |
| 354 | Ga0207666_1000167 | 3300025271 | Bacteria | 10172 |
| 355 | Ga0209130_1000178 | 3300025284 | Bacteria | 90293 |
| 356 | Ga0207673_1000367 | 3300025290 | Bacteria | 4557 |
| 357 | Ga0209675_1000692 | 3300025291 | Bacteria | 23450 |
| 358 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 359 | Ga0209025_1002015 | 3300025294 | Bacteria | 23178 |
| 360 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 361 | Ga0209758_1007060 | 3300025297 | Bacteria | 7790 |
| 362 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 363 | Ga0209256_1000200 | 3300025299 | Bacteria | 112931 |
| 364 | Ga0207426_1023081 | 3300025302 | Bacteria | 2126 |
| 365 | Ga0207653_10000843 | 3300025885 | Bacteria | 10205 |
| 366 | Ga0207682_10000046 | 3300025893 | Bacteria | 51587 |
| 367 | Ga0207682_10000637 | 3300025893 | Bacteria | 16334 |
| 368 | Ga0207692_10000988 | 3300025898 | Bacteria | 10376 |
| 369 | Ga0207642_10001252 | 3300025899 | Bacteria | 7870 |
| 370 | Ga0207710_10000850 | 3300025900 | Bacteria | 16454 |
| 371 | Ga0207710_10009377 | 3300025900 | Bacteria | 4121 |
| 372 | Ga0207710_10010799 | 3300025900 | Bacteria | 3846 |
| 373 | Ga0207688_10001056 | 3300025901 | Bacteria | 14080 |
| 374 | Ga0207688_10001343 | 3300025901 | Bacteria | 12782 |
| 375 | Ga0207680_10002036 | 3300025903 | Bacteria | 9466 |
| 376 | Ga0207680_10007258 | 3300025903 | Bacteria | 5390 |
| 377 | Ga0207680_10048876 | 3300025903 | Bacteria | 2515 |
| 378 | Ga0207647_10007296 | 3300025904 | Bacteria | 8002 |
| 379 | Ga0207647_10079370 | 3300025904 | Bacteria | 1970 |
| 380 | Ga0207685_10002344 | 3300025905 | Bacteria | 4314 |
| 381 | Ga0207685_10014730 | 3300025905 | Bacteria | 2455 |
| 382 | Ga0207699_10000312 | 3300025906 | Bacteria | 25999 |
| 383 | Ga0207699_10037876 | 3300025906 | Bacteria | 2759 |
| 384 | Ga0207645_10000162 | 3300025907 | Bacteria | 52720 |
| 385 | Ga0207645_10037726 | 3300025907 | Bacteria | 3101 |
| 386 | Ga0207643_10000025 | 3300025908 | Bacteria | 101583 |
| 387 | Ga0207643_10001138 | 3300025908 | Bacteria | 15810 |
| 388 | Ga0207654_10001641 | 3300025911 | Bacteria | 11696 |
| 389 | Ga0207654_10033211 | 3300025911 | Bacteria | 2859 |
| 390 | Ga0207707_10002255 | 3300025912 | Bacteria | 17449 |
| 391 | Ga0207707_10010884 | 3300025912 | Bacteria | 7907 |
| 392 | Ga0207707_10012619 | 3300025912 | Bacteria | 7342 |
| 393 | Ga0207707_10073899 | 3300025912 | Bacteria | 2973 |
| 394 | Ga0207707_10149927 | 3300025912 | Bacteria | 2039 |
| 395 | Ga0207671_10010591 | 3300025914 | Bacteria | 7591 |
| 396 | Ga0207693_10006436 | 3300025915 | Bacteria | 9731 |
| 397 | Ga0207693_10036605 | 3300025915 | Bacteria | 3868 |
| 398 | Ga0207693_10039616 | 3300025915 | Bacteria | 3711 |
| 399 | Ga0207693_10040965 | 3300025915 | Bacteria | 3648 |
| 400 | Ga0207663_10050345 | 3300025916 | Bacteria | 2588 |
| 401 | Ga0207663_10076825 | 3300025916 | Bacteria | 2171 |
| 402 | Ga0207660_10001243 | 3300025917 | Bacteria | 17069 |
| 403 | Ga0207662_10016220 | 3300025918 | Bacteria | 4201 |
| 404 | Ga0207662_10016564 | 3300025918 | Bacteria | 4161 |
| 405 | Ga0207662_10107287 | 3300025918 | Bacteria | 1738 |
| 406 | Ga0207657_10039151 | 3300025919 | Bacteria | 4215 |
| 407 | Ga0207649_10000048 | 3300025920 | Bacteria | 110714 |
| 408 | Ga0207652_10003743 | 3300025921 | Bacteria | 12479 |
| 409 | Ga0207652_10019346 | 3300025921 | Bacteria | 5599 |
| 410 | Ga0207652_10023862 | 3300025921 | Bacteria | 5072 |
| 411 | Ga0207652_10042464 | 3300025921 | Bacteria | 3870 |
| 412 | Ga0207652_10081384 | 3300025921 | Bacteria | 2832 |
| 413 | Ga0207681_10000131 | 3300025923 | Bacteria | 61025 |
| 414 | Ga0207694_10057921 | 3300025924 | Bacteria | 3013 |
| 415 | Ga0207650_10002321 | 3300025925 | Bacteria | 13259 |
| 416 | Ga0207650_10053527 | 3300025925 | Bacteria | 2992 |
| 417 | Ga0207650_10140014 | 3300025925 | Bacteria | 1901 |
| 418 | Ga0207659_10000040 | 3300025926 | Bacteria | 91375 |
| 419 | Ga0207659_10048887 | 3300025926 | Bacteria | 2998 |
| 420 | Ga0207659_10117466 | 3300025926 | Bacteria | 2033 |
| 421 | Ga0207687_10000090 | 3300025927 | Bacteria | 66310 |
| 422 | Ga0207687_10007813 | 3300025927 | Bacteria | 7014 |
| 423 | Ga0207700_10000231 | 3300025928 | Bacteria | 33501 |
| 424 | Ga0207700_10040992 | 3300025928 | Bacteria | 3384 |
| 425 | Ga0207700_10080333 | 3300025928 | Bacteria | 2543 |
| 426 | Ga0207700_10139355 | 3300025928 | Bacteria | 1991 |
| 427 | Ga0207664_10026272 | 3300025929 | Bacteria | 4399 |
| 428 | Ga0207664_10182187 | 3300025929 | Bacteria | 1804 |
| 429 | Ga0207644_10000473 | 3300025931 | Bacteria | 25907 |
| 430 | Ga0207644_10007385 | 3300025931 | Bacteria | 7160 |
| 431 | Ga0207690_10000173 | 3300025932 | Bacteria | 50054 |
| 432 | Ga0207706_10005557 | 3300025933 | Bacteria | 11754 |
| 433 | Ga0207706_10048639 | 3300025933 | Bacteria | 3750 |
| 434 | Ga0207706_10060198 | 3300025933 | Bacteria | 3344 |
| 435 | Ga0207686_10002985 | 3300025934 | Bacteria | 9120 |
| 436 | Ga0207686_10003177 | 3300025934 | Bacteria | 8843 |
| 437 | Ga0207686_10025401 | 3300025934 | Bacteria | 3445 |
| 438 | Ga0207709_10000585 | 3300025935 | Bacteria | 30473 |
| 439 | Ga0207709_10064941 | 3300025935 | Bacteria | 2293 |
| 440 | Ga0207670_10002222 | 3300025936 | Bacteria | 10152 |
| 441 | Ga0207670_10002465 | 3300025936 | Bacteria | 9706 |
| 442 | Ga0207670_10076952 | 3300025936 | Bacteria | 2323 |
| 443 | Ga0207669_10000102 | 3300025937 | Bacteria | 42874 |
| 444 | Ga0207669_10004690 | 3300025937 | Bacteria | 6046 |
| 445 | Ga0207704_10000097 | 3300025938 | Bacteria | 49151 |
| 446 | Ga0207704_10006584 | 3300025938 | Bacteria | 5432 |
| 447 | Ga0207704_10012115 | 3300025938 | Bacteria | 4271 |
| 448 | Ga0207665_10000487 | 3300025939 | Bacteria | 26772 |
| 449 | Ga0207665_10000745 | 3300025939 | Bacteria | 21939 |
| 450 | Ga0207665_10049274 | 3300025939 | Bacteria | 2829 |
| 451 | Ga0207691_10001237 | 3300025940 | Bacteria | 25472 |
| 452 | Ga0207691_10007973 | 3300025940 | Bacteria | 10188 |
| 453 | Ga0207691_10012219 | 3300025940 | Bacteria | 8230 |
| 454 | Ga0207711_10000847 | 3300025941 | Bacteria | 29585 |
| 455 | Ga0207711_10001975 | 3300025941 | Bacteria | 18574 |
| 456 | Ga0207711_10057697 | 3300025941 | Bacteria | 3338 |
| 457 | Ga0207711_10189442 | 3300025941 | Bacteria | 1874 |
| 458 | Ga0207689_10000677 | 3300025942 | Bacteria | 32501 |
| 459 | Ga0207689_10003052 | 3300025942 | Bacteria | 15417 |
| 460 | Ga0207689_10004233 | 3300025942 | Bacteria | 13052 |
| 461 | Ga0207689_10052095 | 3300025942 | Bacteria | 3373 |
| 462 | Ga0207661_10000204 | 3300025944 | Bacteria | 38344 |
| 463 | Ga0207661_10111725 | 3300025944 | Bacteria | 2312 |
| 464 | Ga0207679_10000090 | 3300025945 | Bacteria | 79412 |
| 465 | Ga0207667_10018822 | 3300025949 | Bacteria | 7733 |
| 466 | Ga0207667_10098381 | 3300025949 | Bacteria | 3019 |
| 467 | Ga0207667_10122143 | 3300025949 | Bacteria | 2684 |
| 468 | Ga0207667_10267315 | 3300025949 | Bacteria | 1748 |
| 469 | Ga0207651_10000017 | 3300025960 | Bacteria | 100256 |
| 470 | Ga0207651_10017251 | 3300025960 | Bacteria | 4260 |
| 471 | Ga0207712_10000114 | 3300025961 | Bacteria | 87261 |
| 472 | Ga0207712_10009218 | 3300025961 | Bacteria | 6250 |
| 473 | Ga0207712_10067021 | 3300025961 | Bacteria | 2568 |
| 474 | Ga0207668_10000139 | 3300025972 | Bacteria | 49764 |
| 475 | Ga0207668_10011937 | 3300025972 | Bacteria | 5301 |
| 476 | Ga0207668_10016242 | 3300025972 | Bacteria | 4642 |
| 477 | Ga0207668_10084432 | 3300025972 | Bacteria | 2314 |
| 478 | Ga0207640_10000221 | 3300025981 | Bacteria | 40097 |
| 479 | Ga0207640_10109641 | 3300025981 | Bacteria | 1953 |
| 480 | Ga0207640_10115559 | 3300025981 | Bacteria | 1911 |
| 481 | Ga0207658_10001766 | 3300025986 | Bacteria | 16236 |
| 482 | Ga0207658_10024367 | 3300025986 | Bacteria | 4234 |
| 483 | Ga0207658_10062170 | 3300025986 | Bacteria | 2794 |
| 484 | Ga0207658_10080747 | 3300025986 | Bacteria | 2492 |
| 485 | Ga0207658_10138949 | 3300025986 | Bacteria | 1963 |
| 486 | Ga0207658_10174420 | 3300025986 | Unclassified | 1774 |
| 487 | Ga0207677_10023458 | 3300026023 | Bacteria | 3813 |
| 488 | Ga0207677_10044776 | 3300026023 | Bacteria | 2950 |
| 489 | Ga0207703_10001230 | 3300026035 | Bacteria | 23955 |
| 490 | Ga0207703_10006478 | 3300026035 | Bacteria | 9348 |
| 491 | Ga0207703_10011650 | 3300026035 | Bacteria | 6839 |
| 492 | Ga0207703_10165148 | 3300026035 | Bacteria | 1942 |
| 493 | Ga0207703_10180100 | 3300026035 | Bacteria | 1865 |
| 494 | Ga0207639_10001275 | 3300026041 | Bacteria | 17013 |
| 495 | Ga0207678_10010483 | 3300026067 | Bacteria | 8140 |
| 496 | Ga0207708_10001855 | 3300026075 | Bacteria | 15567 |
| 497 | Ga0207708_10040517 | 3300026075 | Bacteria | 3551 |
| 498 | Ga0207708_10133814 | 3300026075 | Bacteria | 1940 |
| 499 | Ga0207702_10000198 | 3300026078 | Bacteria | 71277 |
| 500 | Ga0207641_10000417 | 3300026088 | Bacteria | 49719 |
| 501 | Ga0207641_10044363 | 3300026088 | Bacteria | 3739 |
| 502 | Ga0207641_10240009 | 3300026088 | Bacteria | 1688 |
| 503 | Ga0207648_10000483 | 3300026089 | Bacteria | 44295 |
| 504 | Ga0207648_10015227 | 3300026089 | Bacteria | 7075 |
| 505 | Ga0207648_10027045 | 3300026089 | Bacteria | 5094 |
| 506 | Ga0207648_10098232 | 3300026089 | Unclassified | 2563 |
| 507 | Ga0207676_10000372 | 3300026095 | Bacteria | 38295 |
| 508 | Ga0207676_10001984 | 3300026095 | Bacteria | 14895 |
| 509 | Ga0207676_10015557 | 3300026095 | Bacteria | 5490 |
| 510 | Ga0207674_10009004 | 3300026116 | Bacteria | 11470 |
| 511 | Ga0207674_10035884 | 3300026116 | Bacteria | 5172 |
| 512 | Ga0207674_10116617 | 3300026116 | Bacteria | 2641 |
| 513 | Ga0207675_100005906 | 3300026118 | Bacteria | 11682 |
| 514 | Ga0207675_100053176 | 3300026118 | Bacteria | 3779 |
| 515 | Ga0207683_10000141 | 3300026121 | Bacteria | 59587 |
| 516 | Ga0207683_10003008 | 3300026121 | Bacteria | 14733 |
| 517 | Ga0207683_10007416 | 3300026121 | Bacteria | 9407 |
| 518 | Ga0207683_10024647 | 3300026121 | Bacteria | 5182 |
| 519 | Ga0207683_10026401 | 3300026121 | Bacteria | 5012 |
| 520 | Ga0207683_10045434 | 3300026121 | Bacteria | 3841 |
| 521 | Ga0207698_10005863 | 3300026142 | Bacteria | 7634 |
| 522 | Ga0207698_10270873 | 3300026142 | Bacteria | 1565 |
| 523 | Ga0207698_10277801 | 3300026142 | Bacteria | 1547 |
| 524 | Ga0209971_1002132 | 3300027682 | Bacteria | 4814 |
| 525 | Ga0209998_10007120 | 3300027717 | Bacteria | 2320 |
| 526 | Ga0209998_10008001 | 3300027717 | Bacteria | 2194 |
| 527 | Ga0209974_10042219 | 3300027876 | Bacteria | 1518 |
| 528 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 529 | Ga0207428_10001115 | 3300027907 | Bacteria | 29201 |
| 530 | Ga0207428_10002874 | 3300027907 | Bacteria | 17069 |
| 531 | Ga0268266_10002234 | 3300028379 | Bacteria | 21139 |
| 532 | Ga0268266_10024665 | 3300028379 | Bacteria | 5117 |
| 533 | Ga0268266_10028466 | 3300028379 | Bacteria | 4749 |
| 534 | Ga0268265_10003432 | 3300028380 | Bacteria | 11404 |
| 535 | Ga0268265_10043620 | 3300028380 | Bacteria | 3335 |
| 536 | Ga0268265_10226512 | 3300028380 | Bacteria | 1640 |
| 537 | Ga0268264_10000412 | 3300028381 | Bacteria | 60566 |
| 538 | Ga0265337_1010903 | 3300028556 | Bacteria | 3159 |
| 539 | Ga0265330_10036549 | 3300031235 | Bacteria | 2189 |
| 540 | Ga0265332_10000849 | 3300031238 | Bacteria | 18521 |
| 541 | Ga0265325_10000036 | 3300031241 | Bacteria | 96858 |
| 542 | Ga0265325_10000464 | 3300031241 | Bacteria | 29365 |
| 543 | Ga0265325_10007651 | 3300031241 | Bacteria | 6456 |
| 544 | Ga0265325_10047190 | 3300031241 | Bacteria | 2230 |
| 545 | Ga0265340_10004313 | 3300031247 | Bacteria | 7968 |
| 546 | Ga0265340_10038095 | 3300031247 | Bacteria | 2379 |
| 547 | Ga0265339_10001612 | 3300031249 | Bacteria | 16687 |
| 548 | Ga0265339_10004115 | 3300031249 | Bacteria | 10026 |
| 549 | Ga0265339_10007937 | 3300031249 | Bacteria | 6807 |
| 550 | Ga0265331_10014085 | 3300031250 | Bacteria | 4272 |
| 551 | Ga0265331_10018026 | 3300031250 | Bacteria | 3670 |
| 552 | Ga0265316_10028221 | 3300031344 | Bacteria | 4632 |
| 553 | Ga0265316_10118153 | 3300031344 | Bacteria | 2004 |
| 554 | Ga0265313_10000513 | 3300031595 | Bacteria | 40580 |
| 555 | Ga0265313_10001147 | 3300031595 | Bacteria | 25315 |
| 556 | Ga0265313_10001570 | 3300031595 | Bacteria | 21191 |
| 557 | Ga0265313_10003857 | 3300031595 | Bacteria | 11830 |
| 558 | Ga0265313_10013620 | 3300031595 | Bacteria | 4865 |
| 559 | Ga0265313_10026302 | 3300031595 | Bacteria | 3067 |
| 560 | Ga0265313_10066220 | 3300031595 | Bacteria | 1675 |
| 561 | Ga0265314_10007314 | 3300031711 | Bacteria | 9589 |
| 562 | Ga0265314_10024700 | 3300031711 | Bacteria | 4550 |
| 563 | Ga0265314_10034461 | 3300031711 | Bacteria | 3701 |
| 564 | Ga0265314_10120567 | 3300031711 | Bacteria | 1652 |
| 565 | Ga0265342_10000360 | 3300031712 | Bacteria | 50461 |
| 566 | Ga0265342_10002687 | 3300031712 | Bacteria | 15127 |
| 567 | Ga0265342_10010083 | 3300031712 | Bacteria | 6587 |
| 568 | Ga0265342_10017720 | 3300031712 | Bacteria | 4625 |
| 569 | Ga0265342_10030918 | 3300031712 | Bacteria | 3314 |
| 570 | Ga0265342_10049630 | 3300031712 | Bacteria | 2510 |
| 571 | Ga0307411_10103866 | 3300032005 | Bacteria | 2017 |
| 572 | Ga0373930_0000011 | 3300034816 | Bacteria | 18016 |
| 573 | Ga0373948_0000241 | 3300034817 | Bacteria | 6519 |
| 574 | Ga0373950_0002353 | 3300034818 | Bacteria | 2594 |
| 575 | Ga0373958_0000313 | 3300034819 | Bacteria | 5848 |
| 576 | Ga0373959_0005453 | 3300034820 | Bacteria | 2086 |
| 577 | Ga0373938_0000404 | 3300034957 | Bacteria | 6956 |
| 578 | Ga0373926_0013686 | 3300035083 | Bacteria | 2754 |
| 579 | Ga0373926_0017166 | 3300035083 | Bacteria | 2482 |
| 580 | Ga0373928_0000880 | 3300035084 | Bacteria | 5888 |
| 581 | Ga0373929_0000816 | 3300035085 | Bacteria | 6065 |
| 582 | Ga0373940_0000619 | 3300035088 | Bacteria | 5660 |
| 583 | Ga0373944_0010711 | 3300035089 | Bacteria | 2503 |
| 584 | Ga0373951_0000312 | 3300035091 | Bacteria | 15385 |
| 585 | Ga0373951_0006275 | 3300035091 | Unclassified | 2722 |
| 586 | Ga0373952_0000253 | 3300035092 | Bacteria | 8714 |
| 587 | Ga0373952_0003999 | 3300035092 | Bacteria | 2664 |
| 588 | Ga0373923_0015576 | 3300035111 | Bacteria | 2873 |
| 589 | Ga0373923_0054353 | 3300035111 | Bacteria | 1685 |
| 590 | Ga0373932_0001887 | 3300035112 | Bacteria | 5600 |
| 591 | Ga0373932_0008193 | 3300035112 | Bacteria | 2497 |
| 592 | Ga0373932_0008544 | 3300035112 | Bacteria | 2449 |
| 593 | Ga0373936_0048268 | 3300035113 | Bacteria | 1718 |
| 594 | Ga0373939_0000502 | 3300035114 | Bacteria | 9837 |
| 595 | Ga0373939_0000832 | 3300035114 | Bacteria | 7638 |
| 596 | Ga0373939_0002168 | 3300035114 | Bacteria | 4660 |
| 597 | Ga0373941_0000330 | 3300035115 | Bacteria | 9276 |
| 598 | Ga0373945_0004542 | 3300035116 | Bacteria | 4411 |
| 599 | Ga0373945_0007082 | 3300035116 | Bacteria | 3628 |
| 600 | Ga0373945_0010369 | 3300035116 | Bacteria | 3068 |
| 601 | Ga0373953_0017789 | 3300035117 | Bacteria | 2619 |
| 602 | Ga0373953_0025159 | 3300035117 | Bacteria | 2271 |
| 603 | Ga0373954_0000753 | 3300035118 | Bacteria | 12522 |
| 604 | Ga0373956_0001330 | 3300035119 | Bacteria | 10205 |
| 605 | Ga0373956_0015305 | 3300035119 | Bacteria | 3210 |
| 606 | Ga0373957_0006863 | 3300035120 | Bacteria | 3611 |
| 607 | Ga0373957_0008264 | 3300035120 | Bacteria | 3365 |
| 608 | Ga0373960_0000137 | 3300035121 | Bacteria | 12098 |
| 609 | Ga0373943_0003107 | 3300035170 | Bacteria | 7543 |
| 610 | Ga0373946_0001852 | 3300035171 | Bacteria | 7383 |
| 611 | Ga0373946_0002090 | 3300035171 | Bacteria | 7018 |
| 612 | Ga0373946_0013540 | 3300035171 | Bacteria | 3068 |
| 613 | Ga0373946_0023809 | 3300035171 | Bacteria | 2394 |
| 614 | Ga0373955_0000158 | 3300035172 | Bacteria | 27228 |
| 615 | Ga0373955_0002098 | 3300035172 | Bacteria | 8610 |
| 616 | Ga0373961_0000492 | 3300035241 | Bacteria | 15342 |
| 617 | Ga0373961_0003857 | 3300035241 | Bacteria | 3659 |
| 618 | Ga0373962_0000279 | 3300035242 | Bacteria | 10997 |
| 619 | Ga0316574_0023419 | 3300035398 | Bacteria | 3686 |
| 620 | Ga0373924_0007302 | 3300035410 | Bacteria | 3985 |
| 621 | Ga0373931_0000131 | 3300035691 | Bacteria | 34406 |
| 622 | Ga0373931_0005561 | 3300035691 | Bacteria | 5841 |
| 623 | Ga0373931_0011848 | 3300035691 | Bacteria | 4216 |
| 624 | Ga0373931_0063546 | 3300035691 | Unclassified | 1995 |
| 625 | Ga0373935_0000026 | 3300035692 | Bacteria | 58851 |
| 626 | Ga0373927_0006909 | 3300035695 | Bacteria | 7711 |
| 627 | Ga0373927_0023307 | 3300035695 | Bacteria | 4054 |
| 628 | Ga0373927_0042130 | 3300035695 | Bacteria | 2959 |
| 629 | Ga0373927_0069958 | 3300035695 | Bacteria | 2271 |
| 630 | Ga0373933_0001665 | 3300035724 | Bacteria | 12922 |
| 631 | Ga0373933_0011017 | 3300035724 | Bacteria | 4967 |
| 632 | Ga0373947_0004512 | 3300035725 | Bacteria | 8165 |
| 633 | Ga0373947_0016533 | 3300035725 | Bacteria | 4239 |
| 634 | Ga0373947_0054904 | 3300035725 | Bacteria | 2405 |
| 635 | Ga0373937_0002145 | 3300036401 | Bacteria | 16512 |
| 636 | Ga0373937_0003289 | 3300036401 | Bacteria | 13564 |
| 637 | Ga0373937_0005585 | 3300036401 | Bacteria | 10787 |
| 638 | Ga0373937_0011521 | 3300036401 | Bacteria | 7761 |
| 639 | Ga0373937_0030958 | 3300036401 | Bacteria | 4845 |
| 640 | Ga0373937_0075764 | 3300036401 | Bacteria | 3107 |
| 641 | Ga0373937_0213011 | 3300036401 | Bacteria | 1818 |
| 642 | Ga0316584_0011236 | 3300036712 | Bacteria | 6285 |
| 643 | Ga0373925_0000034 | 3300037068 | Bacteria | 144257 |
| 644 | Ga0373925_0001381 | 3300037068 | Bacteria | 21133 |
| 645 | Ga0373925_0006934 | 3300037068 | Bacteria | 8288 |
| 646 | Ga0373925_0007514 | 3300037068 | Bacteria | 7944 |
| 647 | Ga0373925_0027906 | 3300037068 | Bacteria | 4133 |
| 648 | Ga0373925_0036449 | 3300037068 | Bacteria | 3630 |
| 649 | Ga0373925_0080847 | 3300037068 | Bacteria | 2471 |
| 650 | Ga0395899_0078953 | 3300037312 | Bacteria | 2398 |
| 651 | Ga0395899_0141107 | 3300037312 | Bacteria | 1714 |
| 652 | Ga0395900_0007587 | 3300037418 | Bacteria | 11203 |
| 653 | Ga0395900_0023602 | 3300037418 | Bacteria | 6292 |
| 654 | Ga0395900_0093408 | 3300037418 | Bacteria | 3090 |
| 655 | Ga0395898_0006512 | 3300037466 | Bacteria | 12478 |
| 656 | Ga0395898_0028469 | 3300037466 | Bacteria | 5597 |
| 657 | Ga0395898_0061182 | 3300037466 | Bacteria | 3658 |
| 658 | Ga0395898_0108979 | 3300037466 | Bacteria | 2655 |
| 659 | Ga0395898_0175469 | 3300037466 | Bacteria | 2048 |
| 660 | Ga0436364_0308859 | 3300037853 | Bacteria | 7431 |
| 661 | Ga0436364_0631135 | 3300037853 | Bacteria | 32086 |
| 662 | Ga0395901_0005082 | 3300038443 | Bacteria | 13285 |
| 663 | Ga0395901_0010709 | 3300038443 | Bacteria | 9296 |
| 664 | Ga0395901_0018368 | 3300038443 | Bacteria | 7139 |
| 665 | Ga0395901_0173895 | 3300038443 | Bacteria | 2259 |
| 666 | Ga0436365_0174563 | 3300039437 | Bacteria | 17649 |
| 667 | Ga0436365_0231168 | 3300039437 | Bacteria | 6346 |
| 668 | Ga0436365_1231055 | 3300039437 | Bacteria | 2961 |
| 669 | Ga0436361_0164715 | 3300039447 | Bacteria | 1770 |
| 670 | Ga0436361_0377742 | 3300039447 | Bacteria | 7150 |
| 671 | Ga0436363_0874280 | 3300039450 | Bacteria | 11837 |
| 672 | Ga0436362_0837885 | 3300039453 | Bacteria | 10424 |
| 673 | Ga0439441_005457 | 3300042001 | Bacteria | 1978 |
| 674 | Ga0466969_0073136 | 3300044656 | Bacteria | 1645 |
| 675 | Ga0466966_0053978 | 3300044684 | Bacteria | 2548 |
| 676 | Ga0466963_0072116 | 3300044694 | Bacteria | 2326 |
| 677 | Ga0466963_0148797 | 3300044694 | Bacteria | 1625 |
| 678 | Ga0466957_0051372 | 3300044842 | Bacteria | 2509 |
| 679 | Ga0451576_0017698 | 3300045051 | Bacteria | 7831 |
| 680 | Ga0495592_0000031 | 3300046454 | Bacteria | 128596 |
| 681 | Ga0495592_0001425 | 3300046454 | Bacteria | 16601 |
| 682 | Ga0495603_0002046 | 3300046455 | Bacteria | 11869 |
| 683 | Ga0495603_0013789 | 3300046455 | Bacteria | 4890 |
| 684 | Ga0495603_0018444 | 3300046455 | Bacteria | 4221 |
| 685 | Ga0495629_0001317 | 3300046459 | Bacteria | 19520 |
| 686 | Ga0495629_0011658 | 3300046459 | Bacteria | 6378 |
| 687 | Ga0495638_0005408 | 3300046460 | Bacteria | 9506 |
| 688 | Ga0495651_0000200 | 3300046462 | Bacteria | 45618 |
| 689 | Ga0495651_0001028 | 3300046462 | Bacteria | 21603 |
| 690 | Ga0495651_0006877 | 3300046462 | Bacteria | 8692 |
| 691 | Ga0495651_0034700 | 3300046462 | Bacteria | 3932 |
| 692 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 693 | Ga0495580_0012176 | 3300046472 | Bacteria | 6610 |
| 694 | Ga0495580_0027217 | 3300046472 | Bacteria | 4161 |
| 695 | Ga0495580_0081889 | 3300046472 | Bacteria | 2249 |
| 696 | Ga0495582_0002161 | 3300046473 | Bacteria | 10999 |
| 697 | Ga0495582_0008114 | 3300046473 | Bacteria | 5799 |
| 698 | Ga0495582_0038565 | 3300046473 | Bacteria | 2629 |
| 699 | Ga0495639_0007711 | 3300046475 | Bacteria | 4628 |
| 700 | Ga0495662_0005794 | 3300046476 | Bacteria | 6180 |
| 701 | Ga0495662_0009602 | 3300046476 | Bacteria | 4743 |
| 702 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 703 | Ga0495664_0009525 | 3300046477 | Bacteria | 5437 |
| 704 | Ga0495584_0013764 | 3300046491 | Bacteria | 4126 |
| 705 | Ga0495584_0034654 | 3300046491 | Bacteria | 2552 |
| 706 | Ga0495585_0002983 | 3300046492 | Bacteria | 11691 |
| 707 | Ga0495594_0004109 | 3300046499 | Bacteria | 7487 |
| 708 | Ga0495594_0023399 | 3300046499 | Bacteria | 3310 |
| 709 | Ga0495594_0120822 | 3300046499 | Bacteria | 1481 |
| 710 | Ga0495607_0033049 | 3300046501 | Bacteria | 3150 |
| 711 | Ga0495606_0005478 | 3300046507 | Bacteria | 12151 |
| 712 | Ga0495608_0000005 | 3300046511 | Bacteria | 350726 |
| 713 | Ga0495608_0011395 | 3300046511 | Bacteria | 6187 |
| 714 | Ga0495608_0011757 | 3300046511 | Bacteria | 6088 |
| 715 | Ga0495608_0046951 | 3300046511 | Bacteria | 2872 |
| 716 | Ga0495616_0029782 | 3300046513 | Bacteria | 2878 |
| 717 | Ga0495618_0000024 | 3300046514 | Bacteria | 122536 |
| 718 | Ga0495618_0015603 | 3300046514 | Bacteria | 4636 |
| 719 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 720 | Ga0495628_0032380 | 3300046516 | Bacteria | 4220 |
| 721 | Ga0495628_0048931 | 3300046516 | Bacteria | 3348 |
| 722 | Ga0495628_0103738 | 3300046516 | Bacteria | 2192 |
| 723 | Ga0495630_0000433 | 3300046517 | Bacteria | 31976 |
| 724 | Ga0495630_0072327 | 3300046517 | Bacteria | 2595 |
| 725 | Ga0495644_0026755 | 3300046523 | Bacteria | 2187 |
| 726 | Ga0495666_0021525 | 3300046526 | Bacteria | 3192 |
| 727 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 728 | Ga0495652_0006243 | 3300046529 | Bacteria | 11114 |
| 729 | Ga0495665_0008064 | 3300046531 | Bacteria | 5711 |
| 730 | Ga0495665_0047533 | 3300046531 | Bacteria | 2276 |
| 731 | Ga0495665_0075077 | 3300046531 | Bacteria | 1780 |
| 732 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 733 | Ga0495640_0022609 | 3300046533 | Bacteria | 4592 |
| 734 | Ga0495640_0066862 | 3300046533 | Bacteria | 2423 |
| 735 | Ga0495587_0000016 | 3300046536 | Bacteria | 185585 |
| 736 | Ga0495587_0012035 | 3300046536 | Bacteria | 5464 |
| 737 | Ga0495598_0001760 | 3300046537 | Bacteria | 4349 |
| 738 | Ga0495598_0006198 | 3300046537 | Bacteria | 2691 |
| 739 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 740 | Ga0495645_0008421 | 3300046543 | Bacteria | 7204 |
| 741 | Ga0495622_0006154 | 3300046557 | Bacteria | 5577 |
| 742 | Ga0495633_0047131 | 3300046558 | Bacteria | 2037 |
| 743 | Ga0495667_0000007 | 3300046559 | Bacteria | 234736 |
| 744 | Ga0495667_0004749 | 3300046559 | Bacteria | 9187 |
| 745 | Ga0495667_0017859 | 3300046559 | Bacteria | 4793 |
| 746 | Ga0495667_0123335 | 3300046559 | Bacteria | 1672 |
| 747 | Ga0495656_0002224 | 3300046615 | Bacteria | 6412 |
| 748 | Ga0495634_0000637 | 3300046642 | Bacteria | 34135 |
| 749 | Ga0495634_0059015 | 3300046642 | Bacteria | 2556 |
| 750 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 751 | Ga0495635_0003581 | 3300046663 | Bacteria | 10750 |
| 752 | Ga0495635_0084095 | 3300046663 | Bacteria | 2178 |
| 753 | Ga0495635_0086692 | 3300046663 | Bacteria | 2142 |
| 754 | Ga0495659_0002344 | 3300046664 | Bacteria | 6116 |
| 755 | Ga0495588_0001979 | 3300046674 | Bacteria | 8763 |
| 756 | Ga0495588_0010900 | 3300046674 | Bacteria | 4249 |
| 757 | Ga0495657_0000628 | 3300046675 | Bacteria | 31950 |
| 758 | Ga0495657_0015907 | 3300046675 | Bacteria | 5492 |
| 759 | Ga0495657_0018234 | 3300046675 | Bacteria | 5085 |
| 760 | Ga0495599_0000005 | 3300046678 | Bacteria | 300169 |
| 761 | Ga0495599_0005324 | 3300046678 | Bacteria | 7680 |
| 762 | Ga0495599_0068953 | 3300046678 | Bacteria | 2208 |
| 763 | Ga0495623_0000016 | 3300046679 | Bacteria | 113454 |
| 764 | Ga0495623_0000554 | 3300046679 | Bacteria | 24925 |
| 765 | Ga0495646_0000002 | 3300046680 | Bacteria | 310568 |
| 766 | Ga0495647_0002658 | 3300046681 | Bacteria | 5670 |
| 767 | Ga0495658_0004985 | 3300046683 | Bacteria | 6518 |
| 768 | Ga0495658_0006650 | 3300046683 | Bacteria | 5684 |
| 769 | Ga0495658_0007896 | 3300046683 | Bacteria | 5267 |
| 770 | Ga0495658_0015425 | 3300046683 | Bacteria | 3919 |
| 771 | Ga0495669_0064220 | 3300046684 | Bacteria | 1666 |
| 772 | Ga0495613_0003637 | 3300046689 | Bacteria | 11546 |
| 773 | Ga0495613_0054770 | 3300046689 | Bacteria | 2931 |
| 774 | Ga0495624_0013261 | 3300046690 | Bacteria | 5619 |
| 775 | Ga0495624_0044384 | 3300046690 | Bacteria | 2833 |
| 776 | Ga0495670_0010273 | 3300046691 | Bacteria | 4600 |
| 777 | Ga0495670_0038246 | 3300046691 | Bacteria | 2392 |
| 778 | Ga0495600_0000018 | 3300046809 | Bacteria | 102683 |
| 779 | Ga0495600_0000989 | 3300046809 | Bacteria | 15327 |
| 780 | Ga0495660_0083899 | 3300046810 | Bacteria | 1667 |
| 781 | Ga0495581_0006932 | 3300047315 | Bacteria | 6564 |
| 782 | Ga0495581_0011122 | 3300047315 | Bacteria | 5200 |
| 783 | Ga0495581_0035026 | 3300047315 | Bacteria | 2905 |
| 784 | Ga0495604_0000020 | 3300047317 | Bacteria | 171989 |
| 785 | Ga0495604_0007911 | 3300047317 | Bacteria | 8420 |
| 786 | Ga0495604_0008426 | 3300047317 | Bacteria | 8143 |
| 787 | Ga0495604_0162420 | 3300047317 | Bacteria | 1577 |
| 788 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 789 | Ga0495674_0042306 | 3300047319 | Bacteria | 4065 |
| 790 | Ga0495676_0017061 | 3300047321 | Bacteria | 6423 |
| 791 | Ga0495676_0060276 | 3300047321 | Bacteria | 2975 |
| 792 | Ga0495680_0001158 | 3300047322 | Bacteria | 29075 |
| 793 | Ga0495680_0001832 | 3300047322 | Bacteria | 22412 |
| 794 | Ga0495680_0007696 | 3300047322 | Bacteria | 9835 |
| 795 | Ga0495680_0022544 | 3300047322 | Bacteria | 5245 |
| 796 | Ga0495680_0047732 | 3300047322 | Bacteria | 3366 |
| 797 | Ga0495680_0083674 | 3300047322 | Bacteria | 2405 |
| 798 | Ga0495675_0000284 | 3300047444 | Bacteria | 36681 |
| 799 | Ga0495675_0000625 | 3300047444 | Bacteria | 22516 |
| 800 | Ga0495684_0000017 | 3300047471 | Bacteria | 160663 |
| 801 | Ga0495684_0000517 | 3300047471 | Bacteria | 31334 |
| 802 | Ga0495684_0019009 | 3300047471 | Bacteria | 5290 |
| 803 | Ga0495684_0053566 | 3300047471 | Bacteria | 3078 |
| 804 | Ga0495593_0000759 | 3300047673 | Bacteria | 18716 |
| 805 | Ga0495593_0011494 | 3300047673 | Bacteria | 5083 |
| 806 | Ga0495593_0019161 | 3300047673 | Bacteria | 3840 |
| 807 | Ga0495593_0041222 | 3300047673 | Bacteria | 2483 |
| 808 | Ga0495602_0000040 | 3300048088 | Bacteria | 127280 |
| 809 | Ga0495602_0017182 | 3300048088 | Bacteria | 7254 |
| 810 | Ga0495602_0035207 | 3300048088 | Bacteria | 4671 |
| 811 | Ga0495602_0052529 | 3300048088 | Bacteria | 3619 |
| 812 | Ga0495614_0002673 | 3300048089 | Bacteria | 7926 |
| 813 | Ga0495614_0018347 | 3300048089 | Bacteria | 3031 |
| 814 | Ga0495614_0024776 | 3300048089 | Bacteria | 2590 |
| 815 | Ga0496100_0001217 | 3300048903 | Bacteria | 12503 |
| 816 | Ga0496100_0001822 | 3300048903 | Bacteria | 10654 |
| 817 | Ga0496100_0007937 | 3300048903 | Bacteria | 5896 |
| 818 | Ga0496100_0017190 | 3300048903 | Bacteria | 4265 |
| 819 | Ga0496100_0036333 | 3300048903 | Bacteria | 3106 |
| 820 | Ga0496101_0000800 | 3300048904 | Bacteria | 18616 |
| 821 | Ga0496101_0001253 | 3300048904 | Bacteria | 15192 |
| 822 | Ga0496101_0001810 | 3300048904 | Bacteria | 12876 |
| 823 | Ga0496101_0035739 | 3300048904 | Bacteria | 3515 |
| 824 | Ga0496102_0002101 | 3300048905 | Bacteria | 17126 |
| 825 | Ga0496102_0023824 | 3300048905 | Bacteria | 5439 |
| 826 | Ga0496102_0167895 | 3300048905 | Bacteria | 2065 |
| 827 | Ga0496102_0196536 | 3300048905 | Bacteria | 1901 |
| 828 | Ga0496103_0003368 | 3300048906 | Bacteria | 9769 |
| 829 | Ga0496103_0004504 | 3300048906 | Bacteria | 8442 |
| 830 | Ga0496103_0005932 | 3300048906 | Bacteria | 7302 |
| 831 | Ga0496103_0017251 | 3300048906 | Bacteria | 4318 |
| 832 | Ga0496103_0019471 | 3300048906 | Bacteria | 4077 |
| 833 | Ga0496103_0063198 | 3300048906 | Bacteria | 2305 |
| 834 | Ga0496104_0000055 | 3300048907 | Bacteria | 124267 |
| 835 | Ga0496104_0001184 | 3300048907 | Bacteria | 22438 |
| 836 | Ga0496104_0003351 | 3300048907 | Bacteria | 13834 |
| 837 | Ga0496104_0017343 | 3300048907 | Bacteria | 6554 |
| 838 | Ga0496104_0023547 | 3300048907 | Bacteria | 5662 |
| 839 | Ga0496104_0033443 | 3300048907 | Bacteria | 4789 |
| 840 | Ga0496104_0043386 | 3300048907 | Bacteria | 4224 |
| 841 | Ga0496104_0056436 | 3300048907 | Bacteria | 3714 |
| 842 | Ga0496104_0081672 | 3300048907 | Bacteria | 3082 |
| 843 | Ga0496104_0099014 | 3300048907 | Bacteria | 2791 |
| 844 | Ga0496104_0158430 | 3300048907 | Bacteria | 2172 |
| 845 | Ga0496105_0000918 | 3300048908 | Bacteria | 20094 |
| 846 | Ga0496105_0004894 | 3300048908 | Bacteria | 10124 |
| 847 | Ga0496105_0010872 | 3300048908 | Bacteria | 7166 |
| 848 | Ga0496105_0015814 | 3300048908 | Bacteria | 6019 |
| 849 | Ga0496105_0027859 | 3300048908 | Bacteria | 4619 |
| 850 | Ga0496105_0168117 | 3300048908 | Bacteria | 1798 |
| 851 | Ga0496106_0000317 | 3300048909 | Bacteria | 33879 |
| 852 | Ga0496106_0013398 | 3300048909 | Bacteria | 6054 |
| 853 | Ga0496106_0023257 | 3300048909 | Bacteria | 4604 |
| 854 | Ga0496106_0031823 | 3300048909 | Bacteria | 3931 |
| 855 | Ga0496106_0039870 | 3300048909 | Bacteria | 3517 |
| 856 | Ga0496107_0000272 | 3300048910 | Bacteria | 27458 |
| 857 | Ga0496107_0011403 | 3300048910 | Bacteria | 6190 |
| 858 | Ga0496107_0015091 | 3300048910 | Bacteria | 5412 |
| 859 | Ga0496107_0024456 | 3300048910 | Bacteria | 4272 |
| 860 | Ga0496107_0038665 | 3300048910 | Bacteria | 3421 |
| 861 | Ga0496107_0069882 | 3300048910 | Bacteria | 2549 |
| 862 | Ga0496107_0150840 | 3300048910 | Bacteria | 1719 |
| 863 | Ga0496108_0000333 | 3300048911 | Bacteria | 39976 |
| 864 | Ga0496108_0002477 | 3300048911 | Bacteria | 14777 |
| 865 | Ga0496108_0015151 | 3300048911 | Bacteria | 6290 |
| 866 | Ga0496108_0041814 | 3300048911 | Bacteria | 3827 |
| 867 | Ga0496108_0043056 | 3300048911 | Bacteria | 3770 |
| 868 | Ga0496108_0086804 | 3300048911 | Bacteria | 2656 |
| 869 | Ga0496108_0092288 | 3300048911 | Bacteria | 2574 |
| 870 | Ga0496109_0000812 | 3300048912 | Bacteria | 26052 |
| 871 | Ga0496109_0005773 | 3300048912 | Bacteria | 10358 |
| 872 | Ga0496109_0018601 | 3300048912 | Bacteria | 6104 |
| 873 | Ga0496109_0022601 | 3300048912 | Bacteria | 5571 |
| 874 | Ga0496109_0027809 | 3300048912 | Bacteria | 5053 |
| 875 | Ga0496109_0036508 | 3300048912 | Bacteria | 4436 |
| 876 | Ga0496109_0051967 | 3300048912 | Bacteria | 3733 |
| 877 | Ga0496109_0091894 | 3300048912 | Bacteria | 2807 |
| 878 | Ga0496110_0004023 | 3300048913 | Bacteria | 11334 |
| 879 | Ga0496110_0028476 | 3300048913 | Bacteria | 4798 |
| 880 | Ga0496110_0029025 | 3300048913 | Bacteria | 4755 |
| 881 | Ga0496110_0057529 | 3300048913 | Bacteria | 3423 |
| 882 | Ga0496110_0076083 | 3300048913 | Bacteria | 2984 |
| 883 | Ga0496110_0086278 | 3300048913 | Bacteria | 2802 |
| 884 | Ga0496110_0232298 | 3300048913 | Bacteria | 1677 |
| 885 | Ga0496111_0001052 | 3300048914 | Bacteria | 15204 |
| 886 | Ga0496111_0005383 | 3300048914 | Bacteria | 8190 |
| 887 | Ga0496111_0006334 | 3300048914 | Bacteria | 7673 |
| 888 | Ga0496111_0011787 | 3300048914 | Bacteria | 5903 |
| 889 | Ga0496111_0020826 | 3300048914 | Bacteria | 4571 |
| 890 | Ga0496112_0000838 | 3300048915 | Bacteria | 21919 |
| 891 | Ga0496112_0002948 | 3300048915 | Bacteria | 13879 |
| 892 | Ga0496112_0084814 | 3300048915 | Bacteria | 3134 |
| 893 | Ga0496112_0134520 | 3300048915 | Bacteria | 2443 |
| 894 | Ga0496113_0000693 | 3300048916 | Bacteria | 17195 |
| 895 | Ga0496113_0002078 | 3300048916 | Bacteria | 11521 |
| 896 | Ga0496113_0016912 | 3300048916 | Bacteria | 5049 |
| 897 | Ga0496113_0020421 | 3300048916 | Bacteria | 4656 |
| 898 | Ga0496113_0023896 | 3300048916 | Bacteria | 4339 |
| 899 | Ga0496113_0034483 | 3300048916 | Bacteria | 3692 |
| 900 | Ga0496113_0159288 | 3300048916 | Bacteria | 1784 |
| 901 | Ga0496114_0003697 | 3300048917 | Bacteria | 11773 |
| 902 | Ga0496114_0009608 | 3300048917 | Bacteria | 7682 |
| 903 | Ga0496114_0011582 | 3300048917 | Bacteria | 7048 |
| 904 | Ga0496114_0011924 | 3300048917 | Bacteria | 6955 |
| 905 | Ga0496114_0026852 | 3300048917 | Bacteria | 4717 |
| 906 | Ga0496115_0008581 | 3300048918 | Bacteria | 7564 |
| 907 | Ga0496115_0026529 | 3300048918 | Bacteria | 4522 |
| 908 | Ga0496115_0029394 | 3300048918 | Bacteria | 4316 |
| 909 | Ga0496115_0045335 | 3300048918 | Bacteria | 3509 |
| 910 | Ga0496115_0084107 | 3300048918 | Bacteria | 2594 |
| 911 | Ga0496115_0149071 | 3300048918 | Bacteria | 1931 |
| 912 | Ga0496117_0069747 | 3300048920 | Bacteria | 2365 |
| 913 | Ga0496123_0077248 | 3300048926 | Bacteria | 2045 |
| 914 | Ga0501032_0009993 | 3300049569 | Bacteria | 6853 |
| 915 | Ga0501032_0062656 | 3300049569 | Bacteria | 2491 |
| 916 | Ga0501033_0023629 | 3300049570 | Bacteria | 4636 |
| 917 | Ga0501033_0098467 | 3300049570 | Bacteria | 2135 |
| 918 | Ga0501034_0000197 | 3300049571 | Bacteria | 114088 |
| 919 | Ga0501034_0001247 | 3300049571 | Bacteria | 34598 |
| 920 | Ga0501034_0001484 | 3300049571 | Bacteria | 30939 |
| 921 | Ga0501034_0009010 | 3300049571 | Bacteria | 10481 |
| 922 | Ga0501034_0022549 | 3300049571 | Bacteria | 6416 |
| 923 | Ga0501034_0048161 | 3300049571 | Bacteria | 4302 |
| 924 | Ga0501034_0071341 | 3300049571 | Bacteria | 3483 |
| 925 | Ga0501034_0072575 | 3300049571 | Bacteria | 3450 |
| 926 | Ga0501034_0149834 | 3300049571 | Bacteria | 2309 |
| 927 | Ga0501034_0174344 | 3300049571 | Bacteria | 2117 |
| 928 | Ga0501034_0185427 | 3300049571 | Bacteria | 2044 |
| 929 | Ga0501034_0210554 | 3300049571 | Bacteria | 1899 |
| 930 | Ga0501036_0005919 | 3300049572 | Bacteria | 9907 |
| 931 | Ga0501036_0014217 | 3300049572 | Bacteria | 6622 |
| 932 | Ga0501036_0023090 | 3300049572 | Bacteria | 5235 |
| 933 | Ga0501036_0024606 | 3300049572 | Bacteria | 5077 |
| 934 | Ga0501036_0055574 | 3300049572 | Bacteria | 3354 |
| 935 | Ga0501037_0007042 | 3300049573 | Bacteria | 8212 |
| 936 | Ga0501037_0012566 | 3300049573 | Bacteria | 6238 |
| 937 | Ga0501037_0026037 | 3300049573 | Bacteria | 4322 |
| 938 | Ga0501037_0053216 | 3300049573 | Bacteria | 2961 |
| 939 | Ga0501037_0105255 | 3300049573 | Bacteria | 2033 |
| 940 | Ga0501038_0007088 | 3300049574 | Bacteria | 10352 |
| 941 | Ga0501038_0008817 | 3300049574 | Bacteria | 9250 |
| 942 | Ga0501038_0022499 | 3300049574 | Bacteria | 5647 |
| 943 | Ga0501038_0037071 | 3300049574 | Bacteria | 4277 |
| 944 | Ga0501038_0084138 | 3300049574 | Bacteria | 2677 |
| 945 | Ga0501039_0013196 | 3300049575 | Bacteria | 6314 |
| 946 | Ga0501039_0068437 | 3300049575 | Bacteria | 2757 |
| 947 | Ga0501040_0005271 | 3300049576 | Bacteria | 8359 |
| 948 | Ga0501040_0050270 | 3300049576 | Bacteria | 2851 |
| 949 | Ga0501041_0033375 | 3300049577 | Bacteria | 3114 |
| 950 | Ga0501041_0039968 | 3300049577 | Bacteria | 2847 |
| 951 | Ga0501042_0009123 | 3300049578 | Bacteria | 6594 |
| 952 | Ga0501042_0035498 | 3300049578 | Bacteria | 3537 |
| 953 | Ga0501043_0006297 | 3300049579 | Bacteria | 9530 |
| 954 | Ga0501043_0015583 | 3300049579 | Bacteria | 5957 |
| 955 | Ga0501043_0015624 | 3300049579 | Bacteria | 5952 |
| 956 | Ga0501043_0032179 | 3300049579 | Bacteria | 4122 |
| 957 | Ga0501043_0135173 | 3300049579 | Bacteria | 1932 |
| 958 | Ga0501046_0025250 | 3300049580 | Bacteria | 4864 |
| 959 | Ga0501046_0032639 | 3300049580 | Bacteria | 4215 |
| 960 | Ga0501046_0162587 | 3300049580 | Bacteria | 1678 |
| 961 | Ga0501047_0001499 | 3300049581 | Bacteria | 22761 |
| 962 | Ga0501047_0022488 | 3300049581 | Bacteria | 6055 |
| 963 | Ga0501047_0046860 | 3300049581 | Bacteria | 4176 |
| 964 | Ga0501047_0126099 | 3300049581 | Bacteria | 2440 |
| 965 | Ga0501047_0144977 | 3300049581 | Bacteria | 2252 |
| 966 | Ga0501048_0000856 | 3300049582 | Bacteria | 22438 |
| 967 | Ga0501048_0005853 | 3300049582 | Bacteria | 9350 |
| 968 | Ga0501067_0015236 | 3300049583 | Bacteria | 4257 |
| 969 | Ga0501067_0015989 | 3300049583 | Bacteria | 4151 |
| 970 | Ga0501068_0003005 | 3300049584 | Bacteria | 8989 |
| 971 | Ga0501068_0010125 | 3300049584 | Bacteria | 5290 |
| 972 | Ga0501068_0040713 | 3300049584 | Bacteria | 2790 |
| 973 | Ga0501069_0001041 | 3300049585 | Bacteria | 13260 |
| 974 | Ga0501070_0005480 | 3300049586 | Bacteria | 10830 |
| 975 | Ga0501070_0009844 | 3300049586 | Bacteria | 8083 |
| 976 | Ga0501070_0018733 | 3300049586 | Bacteria | 5808 |
| 977 | Ga0501070_0023917 | 3300049586 | Bacteria | 5119 |
| 978 | Ga0501070_0031183 | 3300049586 | Bacteria | 4466 |
| 979 | Ga0501070_0034636 | 3300049586 | Bacteria | 4220 |
| 980 | Ga0501070_0090512 | 3300049586 | Bacteria | 2532 |
| 981 | Ga0501070_0111438 | 3300049586 | Bacteria | 2262 |
| 982 | Ga0501071_0021040 | 3300049587 | Bacteria | 4541 |
| 983 | Ga0501071_0076439 | 3300049587 | Bacteria | 2446 |
| 984 | Ga0501072_0011866 | 3300049588 | Bacteria | 6656 |
| 985 | Ga0501072_0031660 | 3300049588 | Bacteria | 4143 |
| 986 | Ga0501072_0032646 | 3300049588 | Bacteria | 4078 |
| 987 | Ga0501072_0032742 | 3300049588 | Bacteria | 4071 |
| 988 | Ga0501072_0041202 | 3300049588 | Bacteria | 3627 |
| 989 | Ga0501072_0112278 | 3300049588 | Bacteria | 2170 |
| 990 | Ga0501073_0021662 | 3300049589 | Bacteria | 4630 |
| 991 | Ga0501073_0055594 | 3300049589 | Bacteria | 2769 |
| 992 | Ga0501074_0022407 | 3300049590 | Bacteria | 4588 |
| 993 | Ga0501074_0059241 | 3300049590 | Bacteria | 2759 |
| 994 | Ga0501075_0015464 | 3300049591 | Bacteria | 5477 |
| 995 | Ga0501075_0074712 | 3300049591 | Bacteria | 2564 |
| 996 | Ga0501076_0006991 | 3300049592 | Bacteria | 8199 |
| 997 | Ga0501076_0032446 | 3300049592 | Bacteria | 4076 |
| 998 | Ga0501076_0042538 | 3300049592 | Bacteria | 3577 |
| 999 | Ga0501076_0124488 | 3300049592 | Bacteria | 2088 |
| 1000 | Ga0501077_0022260 | 3300049593 | Bacteria | 4015 |
| 1001 | Ga0501077_0070230 | 3300049593 | Bacteria | 2220 |
| 1002 | Ga0501077_0070722 | 3300049593 | Bacteria | 2211 |
| 1003 | Ga0501079_0013648 | 3300049741 | Bacteria | 6195 |
| 1004 | Ga0501079_0034801 | 3300049741 | Bacteria | 3876 |
| 1005 | Ga0501079_0038466 | 3300049741 | Bacteria | 3689 |
| 1006 | Ga0501079_0063709 | 3300049741 | Bacteria | 2844 |
| 1007 | Ga0501079_0067352 | 3300049741 | Bacteria | 2763 |
| 1008 | Ga0501079_0126523 | 3300049741 | Bacteria | 1988 |
| 1009 | Ga0501080_0053915 | 3300049742 | Bacteria | 3745 |
| 1010 | Ga0501080_0059890 | 3300049742 | Bacteria | 3543 |
| 1011 | Ga0501080_0082526 | 3300049742 | Bacteria | 2985 |
| 1012 | Ga0501080_0084847 | 3300049742 | Bacteria | 2943 |
| 1013 | Ga0501080_0205923 | 3300049742 | Bacteria | 1804 |
| 1014 | Ga0501080_0216580 | 3300049742 | Bacteria | 1753 |
| 1015 | Ga0501081_0006174 | 3300049743 | Bacteria | 7760 |
| 1016 | Ga0501081_0008015 | 3300049743 | Bacteria | 6855 |
| 1017 | Ga0501081_0027992 | 3300049743 | Bacteria | 3801 |
| 1018 | Ga0501081_0038505 | 3300049743 | Bacteria | 3267 |
| 1019 | Ga0501083_0017096 | 3300049744 | Bacteria | 5061 |
| 1020 | Ga0501083_0022117 | 3300049744 | Bacteria | 4413 |
| 1021 | Ga0501083_0064214 | 3300049744 | Bacteria | 2447 |
| 1022 | Ga0501083_0095636 | 3300049744 | Bacteria | 1960 |
| 1023 | Ga0501083_0103568 | 3300049744 | Bacteria | 1875 |
| 1024 | Ga0501035_0003255 | 3300049822 | Bacteria | 15561 |
| 1025 | Ga0501035_0042607 | 3300049822 | Bacteria | 4094 |
| 1026 | Ga0501035_0058650 | 3300049822 | Bacteria | 3429 |
| 1027 | Ga0501035_0081216 | 3300049822 | Bacteria | 2861 |
| 1028 | Ga0501044_0000708 | 3300049823 | Bacteria | 40261 |
| 1029 | Ga0501044_0003448 | 3300049823 | Bacteria | 17811 |
| 1030 | Ga0501044_0023822 | 3300049823 | Bacteria | 6506 |
| 1031 | Ga0501044_0138283 | 3300049823 | Bacteria | 2425 |
| 1032 | Ga0501044_0211490 | 3300049823 | Bacteria | 1893 |
| 1033 | Ga0501044_0229647 | 3300049823 | Bacteria | 1804 |
| 1034 | Ga0501045_0031096 | 3300049824 | Bacteria | 3866 |
| 1035 | Ga0501045_0116135 | 3300049824 | Bacteria | 1986 |
| 1036 | Ga0501045_0164173 | 3300049824 | Bacteria | 1653 |
| 1037 | nmdc:mga03683_8170_c2 | 3300050489 | Bacteria | 3085 |
| 1038 | nmdc:mga00v17_17587_c1 | 3300050491 | Bacteria | 4050 |
| 1039 | nmdc:mga0yw44_24491_c1 | 3300050492 | Bacteria | 3416 |
| 1040 | nmdc:mga0yw44_36543_c1 | 3300050492 | Bacteria | 2895 |
| 1041 | nmdc:mga0yw44_6036_c1 | 3300050492 | Bacteria | 5803 |
| 1042 | nmdc:mga06z11_27068_c1 | 3300050494 | Bacteria | 2738 |
| 1043 | nmdc:mga06z11_56833_c1 | 3300050494 | Bacteria | 2025 |
| 1044 | nmdc:mga07m45_15749_c1 | 3300050496 | Bacteria | 4040 |
| 1045 | nmdc:mga07m45_79108_c1 | 3300050496 | Bacteria | 1876 |
| 1046 | nmdc:mga05p37_178457_c1 | 3300050507 | Bacteria | 2586 |
| 1047 | nmdc:mga05p37_187410_c1 | 3300050507 | Bacteria | 2515 |
| 1048 | nmdc:mga05p37_335814_c1 | 3300050507 | Bacteria | 1783 |
| 1049 | nmdc:mga05p37_39331_c1 | 3300050507 | Bacteria | 5806 |
| 1050 | nmdc:mga05p37_6218_c1 | 3300050507 | Bacteria | 14054 |
| 1051 | nmdc:mga05p37_675_c1 | 3300050507 | Bacteria | 37726 |
| 1052 | nmdc:mga05p37_9875_c1 | 3300050507 | Bacteria | 11327 |
| 1053 | nmdc:mga09592_11427_c1 | 3300050508 | Bacteria | 7221 |
| 1054 | nmdc:mga09592_12884_c1 | 3300050508 | Bacteria | 6819 |
| 1055 | nmdc:mga0qj67_229_c1 | 3300050509 | Bacteria | 38215 |
| 1056 | nmdc:mga0qj67_267_c1 | 3300050509 | Bacteria | 35925 |
| 1057 | nmdc:mga0qj67_41899_c1 | 3300050509 | Bacteria | 3603 |
| 1058 | nmdc:mga0qj67_82604_c1 | 3300050509 | Bacteria | 2576 |
| 1059 | nmdc:mga06r32_122772_c1 | 3300050510 | Bacteria | 2563 |
| 1060 | nmdc:mga06r32_147605_c1 | 3300050510 | Bacteria | 2329 |
| 1061 | nmdc:mga06r32_21208_c1 | 3300050510 | Bacteria | 5996 |
| 1062 | nmdc:mga06r32_36012_c1 | 3300050510 | Bacteria | 4673 |
| 1063 | nmdc:mga06r32_4977_c1 | 3300050510 | Bacteria | 11971 |
| 1064 | nmdc:mga06r32_64_c1 | 3300050510 | Bacteria | 67984 |
| 1065 | nmdc:mga08y16_1152_c1 | 3300050511 | Bacteria | 26044 |
| 1066 | nmdc:mga08y16_148802_c1 | 3300050511 | Bacteria | 2434 |
| 1067 | nmdc:mga08y16_6860_c1 | 3300050511 | Bacteria | 11941 |
| 1068 | nmdc:mga08y16_8101_c1 | 3300050511 | Bacteria | 10988 |
| 1069 | nmdc:mga08y16_906_c1 | 3300050511 | Bacteria | 28665 |
| 1070 | nmdc:mga0n895_14204_c1 | 3300050512 | Bacteria | 7222 |
| 1071 | nmdc:mga0n895_24792_c1 | 3300050512 | Bacteria | 5658 |
| 1072 | nmdc:mga0n895_2947_c1 | 3300050512 | Bacteria | 13508 |
| 1073 | nmdc:mga0n895_3362_c1 | 3300050512 | Bacteria | 12865 |
| 1074 | nmdc:mga0n895_55579_c1 | 3300050512 | Bacteria | 3896 |
| 1075 | nmdc:mga0n895_73_c1 | 3300050512 | Bacteria | 57709 |
| 1076 | nmdc:mga0n895_9100_c1 | 3300050512 | Bacteria | 8666 |
| 1077 | nmdc:mga0rr50_138021_c1 | 3300050513 | Bacteria | 1959 |
| 1078 | nmdc:mga0rr50_747_c1 | 3300050513 | Bacteria | 14216 |
| 1079 | nmdc:mga08x19_66_c1 | 3300050514 | Bacteria | 105609 |
| 1080 | nmdc:mga0a205_16585_c1 | 3300050515 | Bacteria | 6900 |
| 1081 | nmdc:mga0a205_214946_c1 | 3300050515 | Bacteria | 1810 |
| 1082 | nmdc:mga0a205_29219_c1 | 3300050515 | Bacteria | 5275 |
| 1083 | nmdc:mga0a205_30916_c1 | 3300050515 | Bacteria | 5129 |
| 1084 | nmdc:mga0a205_4115_c1 | 3300050515 | Bacteria | 13018 |
| 1085 | nmdc:mga0a205_59_c1 | 3300050515 | Bacteria | 60447 |
| 1086 | nmdc:mga0sz30_3395_c1 | 3300050516 | Bacteria | 5732 |
| 1087 | Ga0495601_0000018 | 3300053077 | Bacteria | 171665 |
| 1088 | Ga0495601_0000357 | 3300053077 | Bacteria | 23996 |
| 1089 | Ga0495601_0000555 | 3300053077 | Bacteria | 19790 |
| 1090 | Ga0495601_0022810 | 3300053077 | Bacteria | 3845 |
| 1091 | Ga0495612_0000011 | 3300053078 | Bacteria | 224729 |
| 1092 | Ga0495612_0000539 | 3300053078 | Bacteria | 15250 |
| 1093 | Ga0495612_0014087 | 3300053078 | Bacteria | 3219 |
| 1094 | Ga0495612_0016752 | 3300053078 | Bacteria | 2935 |
| 1095 | Ga0495612_0027133 | 3300053078 | Bacteria | 2302 |
| 1096 | Ga0495655_0000451 | 3300053083 | Bacteria | 6920 |
| 1097 | Ga0495595_0000016 | 3300053084 | Bacteria | 134329 |
| 1098 | Ga0495595_0000939 | 3300053084 | Bacteria | 11212 |
| 1099 | Ga0495595_0001313 | 3300053084 | Bacteria | 9655 |
| 1100 | Ga0495595_0002410 | 3300053084 | Bacteria | 7299 |
| 1101 | Ga0495595_0019761 | 3300053084 | Bacteria | 2926 |
| 1102 | Ga0495595_0069748 | 3300053084 | Bacteria | 1660 |
| 1103 | Ga0495619_0000014 | 3300053085 | Bacteria | 261449 |
| 1104 | Ga0495619_0000085 | 3300053085 | Bacteria | 70073 |
| 1105 | Ga0495619_0000380 | 3300053085 | Bacteria | 30640 |
| 1106 | Ga0495619_0000636 | 3300053085 | Bacteria | 23148 |
| 1107 | Ga0495619_0002427 | 3300053085 | Bacteria | 12237 |
| 1108 | Ga0495619_0003404 | 3300053085 | Bacteria | 10276 |
| 1109 | Ga0495619_0009386 | 3300053085 | Bacteria | 6172 |
| 1110 | Ga0495619_0064422 | 3300053085 | Bacteria | 2443 |
| 1111 | Ga0500651_0053147 | 3300053093 | Bacteria | 2540 |
| 1112 | Ga0500641_0000932 | 3300053096 | Bacteria | 10439 |
| 1113 | Ga0500641_0002842 | 3300053096 | Bacteria | 6135 |
| 1114 | Ga0500641_0008319 | 3300053096 | Bacteria | 3699 |
| 1115 | Ga0500595_000024 | 3300053119 | Bacteria | 144160 |
| 1116 | Ga0500616_0000458 | 3300053153 | Bacteria | 53402 |
| 1117 | Ga0500645_000874 | 3300053730 | Bacteria | 17538 |
| 1118 | Ga0501084_0038702 | 3300054114 | Bacteria | 3987 |
| 1119 | Ga0501084_0232500 | 3300054114 | Bacteria | 1556 |
| 1120 | Ga0501082_0004773 | 3300060353 | Bacteria | 11829 |
| 1121 | Ga0501082_0011414 | 3300060353 | Bacteria | 7644 |
| 1122 | Ga0501082_0044248 | 3300060353 | Bacteria | 3840 |
| 1123 | Ga0530510_0029715 | 3300061734 | Bacteria | 3923 |
| 1124 | Ga0530510_0036852 | 3300061734 | Bacteria | 3524 |
| 1125 | Ga0530510_0064081 | 3300061734 | Bacteria | 2662 |
| 1126 | Ga0530510_0080846 | 3300061734 | Bacteria | 2365 |
| 1127 | 2508729266 | 2508501050 | Bacteria | 9633614 |
| 1128 | 2509077924 | 2508501114 | Bacteria | 7082538 |
| 1129 | 2513590344 | 2513237087 | Bacteria | 5817514 |
| 1130 | 2545673131 | 2545555834 | Bacteria | 8130841 |
| 1131 | 2643755202 | 2643221547 | Bacteria | 4740017 |
| 1132 | 2644735000 | 2643221734 | Bacteria | 5365412 |
| 1133 | 2774870261 | 2773857925 | Bacteria | 6472445 |
| 1134 | 2776258787 | 2775506901 | Bacteria | 9631051 |
| 1135 | 2819719552 | 2818991467 | Bacteria | 5893227 |
| 1136 | 2835312888 | 2835312727 | Bacteria | 7413381 |
| 1137 | 2841760930 | 2841760612 | Bacteria | 6454112 |
| 1138 | 2844106587 | 2844104063 | Bacteria | 6440972 |
| 1139 | 2851183739 | 2851182111 | Bacteria | 6047226 |
| 1140 | 2851246943 | 2851246043 | Bacteria | 6439203 |
| 1141 | 2882457992 | 2882456835 | Bacteria | 6863978 |
| 1142 | 2894242386 | 2894232714 | Bacteria | 8834183 |
| 1143 | 2917704791 | 2917699015 | Bacteria | 7043791 |
| 1144 | 3003670267 | 3003665799 | Bacteria | 7279786 |
| 1145 | 641642265 | 641522639 | Bacteria | 7737025 |
| 1146 | 8057530848 | 8057529695 | Bacteria | 6306553 |
| 1147 | Ga0501034_0030744 | |||
| 1148 | 2214884074 | |||
| 1149 | ARcpr5oldR_c000047 | |||
| 1150 | ARSoilYngRDRAFT_c00157 | |||
| 1151 | ARcpr5yngRDRAFT_c000017 | |||
| 1152 | ARSoilOldRDRAFT_c000006 | |||
| 1153 | ARCol0oldRDRAFT_c00394 | |||
| 1154 | ARCol0yngRDRAFT_1000410 | |||
| 1155 | JGI24032J14994_100449 | |||
| 1156 | JGI24746J21847_1001205 | |||
| 1157 | JGI24739J22299_10012522 | |||
| 1158 | JGI24743J22301_10001864 | |||
| 1159 | JGI24743J22301_10001874 | |||
| 1160 | JGI24750J21931_1000171 | |||
| 1161 | JGI24745J21846_1000238 | |||
| 1162 | JGI24738J21930_10001962 | |||
| 1163 | JGI24749J21850_1000164 | |||
| 1164 | JGI24744J21845_10007217 | |||
| 1165 | JGI24742J22300_10001863 | |||
| 1166 | JGI25153J46596_10003929 | |||
| 1167 | Ga0055526_1003135 | |||
| 1168 | Ga0055524_1000020 | |||
| 1169 | Ga0065165_1000141 | |||
| 1170 | Ga0065716_1001609 | |||
| 1171 | Ga0065712_10008755 | |||
| 1172 | Ga0065712_10073346 | |||
| 1173 | Ga0065712_10095088 | |||
| 1174 | Ga0065707_10111240 | |||
| 1175 | Ga0070658_10001206 | |||
| 1176 | Ga0070658_10131161 | |||
| 1177 | Ga0070676_10008970 | |||
| 1178 | Ga0070676_10056584 | |||
| 1179 | Ga0070683_100007236 | |||
| 1180 | Ga0070683_100054816 | |||
| 1181 | Ga0070683_100139939 | |||
| 1182 | Ga0070690_100002695 | |||
| 1183 | Ga0070690_100007439 | |||
| 1184 | Ga0070670_100023880 | |||
| 1185 | Ga0070677_10000354 | |||
| 1186 | Ga0070677_10006029 | |||
| 1187 | Ga0068869_100000203 | |||
| 1188 | Ga0068869_100016314 | |||
| 1189 | Ga0070666_10003118 | |||
| 1190 | Ga0070666_10045931 | |||
| 1191 | Ga0070680_100002314 | |||
| 1192 | Ga0070680_100008076 | |||
| 1193 | Ga0070680_100018551 | |||
| 1194 | Ga0070680_100089192 | |||
| 1195 | Ga0070682_100000935 | |||
| 1196 | Ga0070682_100048701 | |||
| 1197 | Ga0068868_100002681 | |||
| 1198 | Ga0068868_100085147 | |||
| 1199 | Ga0068868_100086567 | |||
| 1200 | Ga0070660_100002042 | |||
| 1201 | Ga0070660_100039578 | |||
| 1202 | Ga0070689_100010750 | |||
| 1203 | Ga0070689_100012497 | |||
| 1204 | Ga0070689_100104060 | |||
| 1205 | Ga0070691_10000067 | |||
| 1206 | Ga0070691_10020556 | |||
| 1207 | Ga0070687_100077210 | |||
| 1208 | Ga0070661_100001273 | |||
| 1209 | Ga0070661_100066329 | |||
| 1210 | Ga0070692_10000279 | |||
| 1211 | Ga0070692_10011554 | |||
| 1212 | Ga0070668_100001472 | |||
| 1213 | Ga0070668_100043745 | |||
| 1214 | Ga0070668_100076963 | |||
| 1215 | Ga0070668_100094048 | |||
| 1216 | Ga0070669_100001453 | |||
| 1217 | Ga0070669_100177205 | |||
| 1218 | Ga0070675_100000701 | |||
| 1219 | Ga0070671_100001883 | |||
| 1220 | Ga0070671_100047421 | |||
| 1221 | Ga0070674_100008500 | |||
| 1222 | Ga0070674_100010760 | |||
| 1223 | Ga0070673_100000855 | |||
| 1224 | Ga0070673_100040814 | |||
| 1225 | Ga0070688_100002458 | |||
| 1226 | Ga0070688_100005328 | |||
| 1227 | Ga0070688_100009226 | |||
| 1228 | Ga0070688_100017152 | |||
| 1229 | Ga0070659_100002844 | |||
| 1230 | Ga0070659_100042026 | |||
| 1231 | Ga0070667_100002230 | |||
| 1232 | Ga0070667_100045305 | |||
| 1233 | Ga0070667_100193441 | |||
| 1234 | Ga0070709_10000219 | |||
| 1235 | Ga0070709_10010596 | |||
| 1236 | Ga0070709_10041879 | |||
| 1237 | Ga0070714_100011112 | |||
| 1238 | Ga0070714_100024143 | |||
| 1239 | Ga0070714_100111314 | |||
| 1240 | Ga0070713_100000224 | |||
| 1241 | Ga0070713_100054191 | |||
| 1242 | Ga0070713_100074935 | |||
| 1243 | Ga0070710_10000956 | |||
| 1244 | Ga0070701_10000732 | |||
| 1245 | Ga0070711_100075313 | |||
| 1246 | Ga0070711_100193408 | |||
| 1247 | Ga0070705_100002431 | |||
| 1248 | Ga0070705_100065255 | |||
| 1249 | Ga0070700_100011866 | |||
| 1250 | Ga0070700_100026381 | |||
| 1251 | Ga0070708_100006477 | |||
| 1252 | Ga0070663_100003237 | |||
| 1253 | Ga0070663_100079771 | |||
| 1254 | Ga0070663_100125422 | |||
| 1255 | Ga0070678_100001091 | |||
| 1256 | Ga0070678_100020981 | |||
| 1257 | Ga0070678_100081860 | |||
| 1258 | Ga0070662_100037125 | |||
| 1259 | Ga0070681_10006073 | |||
| 1260 | Ga0070681_10013953 | |||
| 1261 | Ga0070681_10059673 | |||
| 1262 | Ga0070681_10085943 | |||
| 1263 | Ga0070681_10089352 | |||
| 1264 | Ga0070681_10128583 | |||
| 1265 | Ga0068867_100000679 | |||
| 1266 | Ga0068867_100010686 | |||
| 1267 | Ga0068867_100131739 | |||
| 1268 | Ga0070685_10001017 | |||
| 1269 | Ga0070706_100034715 | |||
| 1270 | Ga0070698_100001178 | |||
| 1271 | Ga0070699_100014629 | |||
| 1272 | Ga0070679_100002677 | |||
| 1273 | Ga0070679_100072165 | |||
| 1274 | Ga0070679_100179538 | |||
| 1275 | Ga0070684_100000693 | |||
| 1276 | Ga0070684_100078587 | |||
| 1277 | Ga0070684_100141498 | |||
| 1278 | Ga0070684_100160910 | |||
| 1279 | Ga0070697_100104754 | |||
| 1280 | Ga0070672_100004245 | |||
| 1281 | Ga0070672_100021286 | |||
| 1282 | Ga0070672_100050976 | |||
| 1283 | Ga0070672_100096548 | |||
| 1284 | Ga0070686_100001302 | |||
| 1285 | Ga0070686_100002564 | |||
| 1286 | Ga0070686_100007632 | |||
| 1287 | Ga0070686_100028997 | |||
| 1288 | Ga0070695_100002461 | |||
| 1289 | Ga0070695_100009173 | |||
| 1290 | Ga0070696_100001783 | |||
| 1291 | Ga0070696_100007358 | |||
| 1292 | Ga0070696_100057982 | |||
| 1293 | Ga0070693_100001926 | |||
| 1294 | Ga0070693_100047279 | |||
| 1295 | Ga0070665_100042474 | |||
| 1296 | Ga0070704_100031373 | |||
| 1297 | Ga0068855_100010931 | |||
| 1298 | Ga0068855_100077988 | |||
| 1299 | Ga0068855_100163518 | |||
| 1300 | Ga0070664_100006539 | |||
| 1301 | Ga0070664_100117084 | |||
| 1302 | Ga0068857_100000534 | |||
| 1303 | Ga0068857_100025817 | |||
| 1304 | Ga0068857_100054713 | |||
| 1305 | Ga0068854_100003403 | |||
| 1306 | Ga0068854_100073166 | |||
| 1307 | Ga0068854_100148241 | |||
| 1308 | Ga0068856_100008075 | |||
| 1309 | Ga0068856_100157777 | |||
| 1310 | Ga0070702_100001579 | |||
| 1311 | Ga0070702_100020797 | |||
| 1312 | Ga0070702_100037145 | |||
| 1313 | Ga0068852_100003393 | |||
| 1314 | Ga0068852_100014120 | |||
| 1315 | Ga0068852_100041022 | |||
| 1316 | Ga0068852_100072068 | |||
| 1317 | Ga0068859_100003965 | |||
| 1318 | Ga0068859_100031525 | |||
| 1319 | Ga0068859_100037505 | |||
| 1320 | Ga0068859_100067082 | |||
| 1321 | Ga0068864_100004544 | |||
| 1322 | Ga0068864_100013878 | |||
| 1323 | Ga0068864_100083229 | |||
| 1324 | Ga0068866_10000252 | |||
| 1325 | Ga0068861_100001032 | |||
| 1326 | Ga0068861_100071527 | |||
| 1327 | Ga0068870_10013347 | |||
| 1328 | Ga0068863_100000150 | |||
| 1329 | Ga0068863_100084827 | |||
| 1330 | Ga0068863_100093117 | |||
| 1331 | Ga0068863_100177821 | |||
| 1332 | Ga0068858_100003904 | |||
| 1333 | Ga0068858_100013222 | |||
| 1334 | Ga0068858_100019307 | |||
| 1335 | Ga0068858_100212920 | |||
| 1336 | Ga0068860_100003148 | |||
| 1337 | Ga0068860_100049421 | |||
| 1338 | Ga0068862_100006993 | |||
| 1339 | Ga0068862_100009738 | |||
| 1340 | Ga0081455_10000185 | |||
| 1341 | Ga0081455_10002539 | |||
| 1342 | Ga0081455_10003484 | |||
| 1343 | Ga0081455_10005197 | |||
| 1344 | Ga0081455_10011999 | |||
| 1345 | Ga0081455_10017717 | |||
| 1346 | Ga0081538_10000638 | |||
| 1347 | Ga0081538_10017029 | |||
| 1348 | Ga0081538_10065488 | |||
| 1349 | Ga0081538_10071988 | |||
| 1350 | Ga0081540_1000925 | |||
| 1351 | Ga0081540_1004357 | |||
| 1352 | Ga0081540_1081091 | |||
| 1353 | Ga0081539_10002542 | |||
| 1354 | Ga0081539_10002695 | |||
| 1355 | Ga0070717_10000285 | |||
| 1356 | Ga0070717_10026319 | |||
| 1357 | Ga0075365_10039163 | |||
| 1358 | Ga0075364_10029445 | |||
| 1359 | Ga0075432_10000240 | |||
| 1360 | Ga0070715_10001307 | |||
| 1361 | Ga0070716_100011132 | |||
| 1362 | Ga0070716_100023971 | |||
| 1363 | Ga0070712_100020468 | |||
| 1364 | Ga0070712_100054255 | |||
| 1365 | Ga0075362_10014565 | |||
| 1366 | Ga0075362_10019606 | |||
| 1367 | Ga0075367_10012684 | |||
| 1368 | Ga0075367_10088361 | |||
| 1369 | Ga0097621_100000544 | |||
| 1370 | Ga0097621_100004712 | |||
| 1371 | Ga0097621_100025145 | |||
| 1372 | Ga0075370_10009286 | |||
| 1373 | Ga0075370_10064015 | |||
| 1374 | Ga0068871_100001366 | |||
| 1375 | Ga0068871_100003497 | |||
| 1376 | Ga0068871_100174820 | |||
| 1377 | Ga0075428_100000205 | |||
| 1378 | Ga0075428_100019769 | |||
| 1379 | Ga0075428_100082405 | |||
| 1380 | Ga0075428_100102778 | |||
| 1381 | Ga0075428_100201860 | |||
| 1382 | Ga0075430_100000012 | |||
| 1383 | Ga0075430_100004858 | |||
| 1384 | Ga0075430_100068023 | |||
| 1385 | Ga0075431_100000266 | |||
| 1386 | Ga0075431_100005460 | |||
| 1387 | Ga0075431_100014481 | |||
| 1388 | Ga0075431_100022527 | |||
| 1389 | Ga0075431_100072901 | |||
| 1390 | Ga0075431_100098627 | |||
| 1391 | Ga0075431_100248972 | |||
| 1392 | Ga0075433_10000338 | |||
| 1393 | Ga0075433_10004462 | |||
| 1394 | Ga0075433_10012596 | |||
| 1395 | Ga0075433_10080536 | |||
| 1396 | Ga0075434_100000373 | |||
| 1397 | Ga0075434_100009082 | |||
| 1398 | Ga0075434_100009842 | |||
| 1399 | Ga0075434_100012045 | |||
| 1400 | Ga0075434_100027939 | |||
| 1401 | Ga0075434_100133652 | |||
| 1402 | Ga0075429_100002160 | |||
| 1403 | Ga0075429_100022260 | |||
| 1404 | Ga0075429_100160193 | |||
| 1405 | Ga0068865_100000190 | |||
| 1406 | Ga0068865_100044980 | |||
| 1407 | Ga0068865_100168964 | |||
| 1408 | Ga0075436_100000443 | |||
| 1409 | Ga0097620_100003965 | |||
| 1410 | Ga0097620_100031525 | |||
| 1411 | Ga0097620_100037508 | |||
| 1412 | Ga0097620_100067084 | |||
| 1413 | Ga0075435_100013108 | |||
| 1414 | Ga0075435_100134915 | |||
| 1415 | Ga0075435_100173393 | |||
| 1416 | Ga0099794_10007253 | |||
| 1417 | Ga0105250_10010395 | |||
| 1418 | Ga0105250_10023450 | |||
| 1419 | Ga0105240_10003481 | |||
| 1420 | Ga0105240_10070736 | |||
| 1421 | Ga0105240_10160426 | |||
| 1422 | Ga0111539_10000299 | |||
| 1423 | Ga0111539_10005091 | |||
| 1424 | Ga0111539_10005821 | |||
| 1425 | Ga0111539_10025137 | |||
| 1426 | Ga0111539_10080025 | |||
| 1427 | Ga0111539_10179589 | |||
| 1428 | Ga0105245_10000543 | |||
| 1429 | Ga0105245_10017080 | |||
| 1430 | Ga0105245_10178269 | |||
| 1431 | Ga0105247_10026146 | |||
| 1432 | Ga0105247_10034263 | |||
| 1433 | Ga0105247_10104703 | |||
| 1434 | Ga0114129_10000640 | |||
| 1435 | Ga0114129_10016895 | |||
| 1436 | Ga0114129_10019077 | |||
| 1437 | Ga0114129_10106391 | |||
| 1438 | Ga0105243_10014840 | |||
| 1439 | Ga0105243_10020519 | |||
| 1440 | Ga0105243_10216149 | |||
| 1441 | Ga0105241_10002875 | |||
| 1442 | Ga0105241_10016416 | |||
| 1443 | Ga0105241_10045570 | |||
| 1444 | Ga0105242_10001766 | |||
| 1445 | Ga0105242_10004776 | |||
| 1446 | Ga0105242_10020801 | |||
| 1447 | Ga0105248_10000501 | |||
| 1448 | Ga0105248_10010945 | |||
| 1449 | Ga0105248_10017190 | |||
| 1450 | Ga0105248_10040194 | |||
| 1451 | Ga0105248_10095011 | |||
| 1452 | Ga0105238_10024549 | |||
| 1453 | Ga0105238_10116235 | |||
| 1454 | Ga0105249_10006521 | |||
| 1455 | Ga0105239_10005329 | |||
| 1456 | Ga0105239_10019260 | |||
| 1457 | Ga0105239_10035309 | |||
| 1458 | Ga0105239_10110589 | |||
| 1459 | Ga0105239_10127527 | |||
| 1460 | Ga0105246_10009901 | |||
| 1461 | Ga0105246_10064351 | |||
| 1462 | Ga0105246_10082067 | |||
| 1463 | Ga0157373_10060401 | |||
| 1464 | Ga0157371_10042393 | |||
| 1465 | Ga0157370_10026677 | |||
| 1466 | Ga0157370_10030889 | |||
| 1467 | Ga0157369_10048634 | |||
| 1468 | Ga0157369_10232379 | |||
| 1469 | Ga0171462_1032 | |||
| 1470 | Ga0157374_10013556 | |||
| 1471 | Ga0157374_10067536 | |||
| 1472 | Ga0157378_10003057 | |||
| 1473 | Ga0163162_10004207 | |||
| 1474 | Ga0163162_10083860 | |||
| 1475 | Ga0163162_10236195 | |||
| 1476 | Ga0157372_10028637 | |||
| 1477 | Ga0157375_10002141 | |||
| 1478 | Ga0157375_10009534 | |||
| 1479 | Ga0157375_10011822 | |||
| 1480 | Ga0157375_10289737 | |||
| 1481 | Ga0163163_10003931 | |||
| 1482 | Ga0163163_10010114 | |||
| 1483 | Ga0163163_10187720 | |||
| 1484 | Ga0157380_10000049 | |||
| 1485 | Ga0157380_10117233 | |||
| 1486 | Ga0182008_10048537 | |||
| 1487 | Ga0157377_10002000 | |||
| 1488 | Ga0157377_10013212 | |||
| 1489 | Ga0157379_10035738 | |||
| 1490 | Ga0157379_10080671 | |||
| 1491 | Ga0157376_10000099 | |||
| 1492 | Ga0157376_10148915 | |||
| 1493 | Ga0163161_10000081 | |||
| 1494 | Ga0163161_10075725 | |||
| 1495 | Ga0163161_10140989 | |||
| 1496 | Ga0213876_10001399 | |||
| 1497 | Ga0213876_10070589 | |||
| 1498 | Ga0213875_10004329 | |||
| 1499 | Ga0209233_1012396 | |||
| 1500 | Ga0207666_1000167 | |||
| 1501 | Ga0209130_1000178 | |||
| 1502 | Ga0207673_1000367 | |||
| 1503 | Ga0209675_1000692 | |||
| 1504 | Ga0209025_1000008 | |||
| 1505 | Ga0209025_1002015 | |||
| 1506 | Ga0209564_1000049 | |||
| 1507 | Ga0209758_1007060 | |||
| 1508 | Ga0209256_1000014 | |||
| 1509 | Ga0209256_1000200 | |||
| 1510 | Ga0207426_1023081 | |||
| 1511 | Ga0207653_10000843 | |||
| 1512 | Ga0207682_10000046 | |||
| 1513 | Ga0207682_10000637 | |||
| 1514 | Ga0207692_10000988 | |||
| 1515 | Ga0207642_10001252 | |||
| 1516 | Ga0207710_10000850 | |||
| 1517 | Ga0207710_10009377 | |||
| 1518 | Ga0207710_10010799 | |||
| 1519 | Ga0207688_10001056 | |||
| 1520 | Ga0207688_10001343 | |||
| 1521 | Ga0207680_10002036 | |||
| 1522 | Ga0207680_10007258 | |||
| 1523 | Ga0207680_10048876 | |||
| 1524 | Ga0207647_10007296 | |||
| 1525 | Ga0207647_10079370 | |||
| 1526 | Ga0207685_10002344 | |||
| 1527 | Ga0207685_10014730 | |||
| 1528 | Ga0207699_10000312 | |||
| 1529 | Ga0207699_10037876 | |||
| 1530 | Ga0207645_10000162 | |||
| 1531 | Ga0207645_10037726 | |||
| 1532 | Ga0207643_10000025 | |||
| 1533 | Ga0207643_10001138 | |||
| 1534 | Ga0207654_10001641 | |||
| 1535 | Ga0207654_10033211 | |||
| 1536 | Ga0207707_10002255 | |||
| 1537 | Ga0207707_10010884 | |||
| 1538 | Ga0207707_10012619 | |||
| 1539 | Ga0207707_10073899 | |||
| 1540 | Ga0207707_10149927 | |||
| 1541 | Ga0207671_10010591 | |||
| 1542 | Ga0207693_10006436 | |||
| 1543 | Ga0207693_10036605 | |||
| 1544 | Ga0207693_10039616 | |||
| 1545 | Ga0207693_10040965 | |||
| 1546 | Ga0207663_10050345 | |||
| 1547 | Ga0207663_10076825 | |||
| 1548 | Ga0207660_10001243 | |||
| 1549 | Ga0207662_10016220 | |||
| 1550 | Ga0207662_10016564 | |||
| 1551 | Ga0207662_10107287 | |||
| 1552 | Ga0207657_10039151 | |||
| 1553 | Ga0207649_10000048 | |||
| 1554 | Ga0207652_10003743 | |||
| 1555 | Ga0207652_10019346 | |||
| 1556 | Ga0207652_10023862 | |||
| 1557 | Ga0207652_10042464 | |||
| 1558 | Ga0207652_10081384 | |||
| 1559 | Ga0207681_10000131 | |||
| 1560 | Ga0207694_10057921 | |||
| 1561 | Ga0207650_10002321 | |||
| 1562 | Ga0207650_10053527 | |||
| 1563 | Ga0207650_10140014 | |||
| 1564 | Ga0207659_10000040 | |||
| 1565 | Ga0207659_10048887 | |||
| 1566 | Ga0207659_10117466 | |||
| 1567 | Ga0207687_10000090 | |||
| 1568 | Ga0207687_10007813 | |||
| 1569 | Ga0207700_10000231 | |||
| 1570 | Ga0207700_10040992 | |||
| 1571 | Ga0207700_10080333 | |||
| 1572 | Ga0207700_10139355 | |||
| 1573 | Ga0207664_10026272 | |||
| 1574 | Ga0207664_10182187 | |||
| 1575 | Ga0207644_10000473 | |||
| 1576 | Ga0207644_10007385 | |||
| 1577 | Ga0207690_10000173 | |||
| 1578 | Ga0207706_10005557 | |||
| 1579 | Ga0207706_10048639 | |||
| 1580 | Ga0207706_10060198 | |||
| 1581 | Ga0207686_10002985 | |||
| 1582 | Ga0207686_10003177 | |||
| 1583 | Ga0207686_10025401 | |||
| 1584 | Ga0207709_10000585 | |||
| 1585 | Ga0207709_10064941 | |||
| 1586 | Ga0207670_10002222 | |||
| 1587 | Ga0207670_10002465 | |||
| 1588 | Ga0207670_10076952 | |||
| 1589 | Ga0207669_10000102 | |||
| 1590 | Ga0207669_10004690 | |||
| 1591 | Ga0207704_10000097 | |||
| 1592 | Ga0207704_10006584 | |||
| 1593 | Ga0207704_10012115 | |||
| 1594 | Ga0207665_10000487 | |||
| 1595 | Ga0207665_10000745 | |||
| 1596 | Ga0207665_10049274 | |||
| 1597 | Ga0207691_10001237 | |||
| 1598 | Ga0207691_10007973 | |||
| 1599 | Ga0207691_10012219 | |||
| 1600 | Ga0207711_10000847 | |||
| 1601 | Ga0207711_10001975 | |||
| 1602 | Ga0207711_10057697 | |||
| 1603 | Ga0207711_10189442 | |||
| 1604 | Ga0207689_10000677 | |||
| 1605 | Ga0207689_10003052 | |||
| 1606 | Ga0207689_10004233 | |||
| 1607 | Ga0207689_10052095 | |||
| 1608 | Ga0207661_10000204 | |||
| 1609 | Ga0207661_10111725 | |||
| 1610 | Ga0207679_10000090 | |||
| 1611 | Ga0207667_10018822 | |||
| 1612 | Ga0207667_10098381 | |||
| 1613 | Ga0207667_10122143 | |||
| 1614 | Ga0207667_10267315 | |||
| 1615 | Ga0207651_10000017 | |||
| 1616 | Ga0207651_10017251 | |||
| 1617 | Ga0207712_10000114 | |||
| 1618 | Ga0207712_10009218 | |||
| 1619 | Ga0207712_10067021 | |||
| 1620 | Ga0207668_10000139 | |||
| 1621 | Ga0207668_10011937 | |||
| 1622 | Ga0207668_10016242 | |||
| 1623 | Ga0207668_10084432 | |||
| 1624 | Ga0207640_10000221 | |||
| 1625 | Ga0207640_10109641 | |||
| 1626 | Ga0207640_10115559 | |||
| 1627 | Ga0207658_10001766 | |||
| 1628 | Ga0207658_10024367 | |||
| 1629 | Ga0207658_10062170 | |||
| 1630 | Ga0207658_10080747 | |||
| 1631 | Ga0207658_10138949 | |||
| 1632 | Ga0207658_10174420 | |||
| 1633 | Ga0207677_10023458 | |||
| 1634 | Ga0207677_10044776 | |||
| 1635 | Ga0207703_10001230 | |||
| 1636 | Ga0207703_10006478 | |||
| 1637 | Ga0207703_10011650 | |||
| 1638 | Ga0207703_10165148 | |||
| 1639 | Ga0207703_10180100 | |||
| 1640 | Ga0207639_10001275 | |||
| 1641 | Ga0207678_10010483 | |||
| 1642 | Ga0207708_10001855 | |||
| 1643 | Ga0207708_10040517 | |||
| 1644 | Ga0207708_10133814 | |||
| 1645 | Ga0207702_10000198 | |||
| 1646 | Ga0207641_10000417 | |||
| 1647 | Ga0207641_10044363 | |||
| 1648 | Ga0207641_10240009 | |||
| 1649 | Ga0207648_10000483 | |||
| 1650 | Ga0207648_10015227 | |||
| 1651 | Ga0207648_10027045 | |||
| 1652 | Ga0207648_10098232 | |||
| 1653 | Ga0207676_10000372 | |||
| 1654 | Ga0207676_10001984 | |||
| 1655 | Ga0207676_10015557 | |||
| 1656 | Ga0207674_10009004 | |||
| 1657 | Ga0207674_10035884 | |||
| 1658 | Ga0207674_10116617 | |||
| 1659 | Ga0207675_100005906 | |||
| 1660 | Ga0207675_100053176 | |||
| 1661 | Ga0207683_10000141 | |||
| 1662 | Ga0207683_10003008 | |||
| 1663 | Ga0207683_10007416 | |||
| 1664 | Ga0207683_10024647 | |||
| 1665 | Ga0207683_10026401 | |||
| 1666 | Ga0207683_10045434 | |||
| 1667 | Ga0207698_10005863 | |||
| 1668 | Ga0207698_10270873 | |||
| 1669 | Ga0207698_10277801 | |||
| 1670 | Ga0209971_1002132 | |||
| 1671 | Ga0209998_10007120 | |||
| 1672 | Ga0209998_10008001 | |||
| 1673 | Ga0209974_10042219 | |||
| 1674 | Ga0207428_10000058 | |||
| 1675 | Ga0207428_10001115 | |||
| 1676 | Ga0207428_10002874 | |||
| 1677 | Ga0268266_10002234 | |||
| 1678 | Ga0268266_10024665 | |||
| 1679 | Ga0268266_10028466 | |||
| 1680 | Ga0268265_10003432 | |||
| 1681 | Ga0268265_10043620 | |||
| 1682 | Ga0268265_10226512 | |||
| 1683 | Ga0268264_10000412 | |||
| 1684 | Ga0265337_1010903 | |||
| 1685 | Ga0265330_10036549 | |||
| 1686 | Ga0265332_10000849 | |||
| 1687 | Ga0265325_10000036 | |||
| 1688 | Ga0265325_10000464 | |||
| 1689 | Ga0265325_10007651 | |||
| 1690 | Ga0265325_10047190 | |||
| 1691 | Ga0265340_10004313 | |||
| 1692 | Ga0265340_10038095 | |||
| 1693 | Ga0265339_10001612 | |||
| 1694 | Ga0265339_10004115 | |||
| 1695 | Ga0265339_10007937 | |||
| 1696 | Ga0265331_10014085 | |||
| 1697 | Ga0265331_10018026 | |||
| 1698 | Ga0265316_10028221 | |||
| 1699 | Ga0265316_10118153 | |||
| 1700 | Ga0265313_10000513 | |||
| 1701 | Ga0265313_10001147 | |||
| 1702 | Ga0265313_10001570 | |||
| 1703 | Ga0265313_10003857 | |||
| 1704 | Ga0265313_10013620 | |||
| 1705 | Ga0265313_10026302 | |||
| 1706 | Ga0265313_10066220 | |||
| 1707 | Ga0265314_10007314 | |||
| 1708 | Ga0265314_10024700 | |||
| 1709 | Ga0265314_10034461 | |||
| 1710 | Ga0265314_10120567 | |||
| 1711 | Ga0265342_10000360 | |||
| 1712 | Ga0265342_10002687 | |||
| 1713 | Ga0265342_10010083 | |||
| 1714 | Ga0265342_10017720 | |||
| 1715 | Ga0265342_10030918 | |||
| 1716 | Ga0265342_10049630 | |||
| 1717 | Ga0307411_10103866 | |||
| 1718 | Ga0373930_0000011 | |||
| 1719 | Ga0373948_0000241 | |||
| 1720 | Ga0373950_0002353 | |||
| 1721 | Ga0373958_0000313 | |||
| 1722 | Ga0373959_0005453 | |||
| 1723 | Ga0373938_0000404 | |||
| 1724 | Ga0373926_0013686 | |||
| 1725 | Ga0373926_0017166 | |||
| 1726 | Ga0373928_0000880 | |||
| 1727 | Ga0373929_0000816 | |||
| 1728 | Ga0373940_0000619 | |||
| 1729 | Ga0373944_0010711 | |||
| 1730 | Ga0373951_0000312 | |||
| 1731 | Ga0373951_0006275 | |||
| 1732 | Ga0373952_0000253 | |||
| 1733 | Ga0373952_0003999 | |||
| 1734 | Ga0373923_0015576 | |||
| 1735 | Ga0373923_0054353 | |||
| 1736 | Ga0373932_0001887 | |||
| 1737 | Ga0373932_0008193 | |||
| 1738 | Ga0373932_0008544 | |||
| 1739 | Ga0373936_0048268 | |||
| 1740 | Ga0373939_0000502 | |||
| 1741 | Ga0373939_0000832 | |||
| 1742 | Ga0373939_0002168 | |||
| 1743 | Ga0373941_0000330 | |||
| 1744 | Ga0373945_0004542 | |||
| 1745 | Ga0373945_0007082 | |||
| 1746 | Ga0373945_0010369 | |||
| 1747 | Ga0373953_0017789 | |||
| 1748 | Ga0373953_0025159 | |||
| 1749 | Ga0373954_0000753 | |||
| 1750 | Ga0373956_0001330 | |||
| 1751 | Ga0373956_0015305 | |||
| 1752 | Ga0373957_0006863 | |||
| 1753 | Ga0373957_0008264 | |||
| 1754 | Ga0373960_0000137 | |||
| 1755 | Ga0373943_0003107 | |||
| 1756 | Ga0373946_0001852 | |||
| 1757 | Ga0373946_0002090 | |||
| 1758 | Ga0373946_0013540 | |||
| 1759 | Ga0373946_0023809 | |||
| 1760 | Ga0373955_0000158 | |||
| 1761 | Ga0373955_0002098 | |||
| 1762 | Ga0373961_0000492 | |||
| 1763 | Ga0373961_0003857 | |||
| 1764 | Ga0373962_0000279 | |||
| 1765 | Ga0316574_0023419 | |||
| 1766 | Ga0373924_0007302 | |||
| 1767 | Ga0373931_0000131 | |||
| 1768 | Ga0373931_0005561 | |||
| 1769 | Ga0373931_0011848 | |||
| 1770 | Ga0373931_0063546 | |||
| 1771 | Ga0373935_0000026 | |||
| 1772 | Ga0373927_0006909 | |||
| 1773 | Ga0373927_0023307 | |||
| 1774 | Ga0373927_0042130 | |||
| 1775 | Ga0373927_0069958 | |||
| 1776 | Ga0373933_0001665 | |||
| 1777 | Ga0373933_0011017 | |||
| 1778 | Ga0373947_0004512 | |||
| 1779 | Ga0373947_0016533 | |||
| 1780 | Ga0373947_0054904 | |||
| 1781 | Ga0373937_0002145 | |||
| 1782 | Ga0373937_0003289 | |||
| 1783 | Ga0373937_0005585 | |||
| 1784 | Ga0373937_0011521 | |||
| 1785 | Ga0373937_0030958 | |||
| 1786 | Ga0373937_0075764 | |||
| 1787 | Ga0373937_0213011 | |||
| 1788 | Ga0316584_0011236 | |||
| 1789 | Ga0373925_0000034 | |||
| 1790 | Ga0373925_0001381 | |||
| 1791 | Ga0373925_0006934 | |||
| 1792 | Ga0373925_0007514 | |||
| 1793 | Ga0373925_0027906 | |||
| 1794 | Ga0373925_0036449 | |||
| 1795 | Ga0373925_0080847 | |||
| 1796 | Ga0395899_0078953 | |||
| 1797 | Ga0395899_0141107 | |||
| 1798 | Ga0395900_0007587 | |||
| 1799 | Ga0395900_0023602 | |||
| 1800 | Ga0395900_0093408 | |||
| 1801 | Ga0395898_0006512 | |||
| 1802 | Ga0395898_0028469 | |||
| 1803 | Ga0395898_0061182 | |||
| 1804 | Ga0395898_0108979 | |||
| 1805 | Ga0395898_0175469 | |||
| 1806 | Ga0436364_0308859 | |||
| 1807 | Ga0436364_0631135 | |||
| 1808 | Ga0395901_0005082 | |||
| 1809 | Ga0395901_0010709 | |||
| 1810 | Ga0395901_0018368 | |||
| 1811 | Ga0395901_0173895 | |||
| 1812 | Ga0436365_0174563 | |||
| 1813 | Ga0436365_0231168 | |||
| 1814 | Ga0436365_1231055 | |||
| 1815 | Ga0436361_0164715 | |||
| 1816 | Ga0436361_0377742 | |||
| 1817 | Ga0436363_0874280 | |||
| 1818 | Ga0436362_0837885 | |||
| 1819 | Ga0439441_005457 | |||
| 1820 | Ga0466969_0073136 | |||
| 1821 | Ga0466966_0053978 | |||
| 1822 | Ga0466963_0072116 | |||
| 1823 | Ga0466963_0148797 | |||
| 1824 | Ga0466957_0051372 | |||
| 1825 | Ga0451576_0017698 | |||
| 1826 | Ga0495592_0000031 | |||
| 1827 | Ga0495592_0001425 | |||
| 1828 | Ga0495603_0002046 | |||
| 1829 | Ga0495603_0013789 | |||
| 1830 | Ga0495603_0018444 | |||
| 1831 | Ga0495629_0001317 | |||
| 1832 | Ga0495629_0011658 | |||
| 1833 | Ga0495638_0005408 | |||
| 1834 | Ga0495651_0000200 | |||
| 1835 | Ga0495651_0001028 | |||
| 1836 | Ga0495651_0006877 | |||
| 1837 | Ga0495651_0034700 | |||
| 1838 | Ga0495653_0000012 | |||
| 1839 | Ga0495580_0012176 | |||
| 1840 | Ga0495580_0027217 | |||
| 1841 | Ga0495580_0081889 | |||
| 1842 | Ga0495582_0002161 | |||
| 1843 | Ga0495582_0008114 | |||
| 1844 | Ga0495582_0038565 | |||
| 1845 | Ga0495639_0007711 | |||
| 1846 | Ga0495662_0005794 | |||
| 1847 | Ga0495662_0009602 | |||
| 1848 | Ga0495664_0000004 | |||
| 1849 | Ga0495664_0009525 | |||
| 1850 | Ga0495584_0013764 | |||
| 1851 | Ga0495584_0034654 | |||
| 1852 | Ga0495585_0002983 | |||
| 1853 | Ga0495594_0004109 | |||
| 1854 | Ga0495594_0023399 | |||
| 1855 | Ga0495594_0120822 | |||
| 1856 | Ga0495607_0033049 | |||
| 1857 | Ga0495606_0005478 | |||
| 1858 | Ga0495608_0000005 | |||
| 1859 | Ga0495608_0011395 | |||
| 1860 | Ga0495608_0011757 | |||
| 1861 | Ga0495608_0046951 | |||
| 1862 | Ga0495616_0029782 | |||
| 1863 | Ga0495618_0000024 | |||
| 1864 | Ga0495618_0015603 | |||
| 1865 | Ga0495628_0000001 | |||
| 1866 | Ga0495628_0032380 | |||
| 1867 | Ga0495628_0048931 | |||
| 1868 | Ga0495628_0103738 | |||
| 1869 | Ga0495630_0000433 | |||
| 1870 | Ga0495630_0072327 | |||
| 1871 | Ga0495644_0026755 | |||
| 1872 | Ga0495666_0021525 | |||
| 1873 | Ga0495652_0000002 | |||
| 1874 | Ga0495652_0006243 | |||
| 1875 | Ga0495665_0008064 | |||
| 1876 | Ga0495665_0047533 | |||
| 1877 | Ga0495665_0075077 | |||
| 1878 | Ga0495640_0000001 | |||
| 1879 | Ga0495640_0022609 | |||
| 1880 | Ga0495640_0066862 | |||
| 1881 | Ga0495587_0000016 | |||
| 1882 | Ga0495587_0012035 | |||
| 1883 | Ga0495598_0001760 | |||
| 1884 | Ga0495598_0006198 | |||
| 1885 | Ga0495645_0000002 | |||
| 1886 | Ga0495645_0008421 | |||
| 1887 | Ga0495622_0006154 | |||
| 1888 | Ga0495633_0047131 | |||
| 1889 | Ga0495667_0000007 | |||
| 1890 | Ga0495667_0004749 | |||
| 1891 | Ga0495667_0017859 | |||
| 1892 | Ga0495667_0123335 | |||
| 1893 | Ga0495656_0002224 | |||
| 1894 | Ga0495634_0000637 | |||
| 1895 | Ga0495634_0059015 | |||
| 1896 | Ga0495635_0000002 | |||
| 1897 | Ga0495635_0003581 | |||
| 1898 | Ga0495635_0084095 | |||
| 1899 | Ga0495635_0086692 | |||
| 1900 | Ga0495659_0002344 | |||
| 1901 | Ga0495588_0001979 | |||
| 1902 | Ga0495588_0010900 | |||
| 1903 | Ga0495657_0000628 | |||
| 1904 | Ga0495657_0015907 | |||
| 1905 | Ga0495657_0018234 | |||
| 1906 | Ga0495599_0000005 | |||
| 1907 | Ga0495599_0005324 | |||
| 1908 | Ga0495599_0068953 | |||
| 1909 | Ga0495623_0000016 | |||
| 1910 | Ga0495623_0000554 | |||
| 1911 | Ga0495646_0000002 | |||
| 1912 | Ga0495647_0002658 | |||
| 1913 | Ga0495658_0004985 | |||
| 1914 | Ga0495658_0006650 | |||
| 1915 | Ga0495658_0007896 | |||
| 1916 | Ga0495658_0015425 | |||
| 1917 | Ga0495669_0064220 | |||
| 1918 | Ga0495613_0003637 | |||
| 1919 | Ga0495613_0054770 | |||
| 1920 | Ga0495624_0013261 | |||
| 1921 | Ga0495624_0044384 | |||
| 1922 | Ga0495670_0010273 | |||
| 1923 | Ga0495670_0038246 | |||
| 1924 | Ga0495600_0000018 | |||
| 1925 | Ga0495600_0000989 | |||
| 1926 | Ga0495660_0083899 | |||
| 1927 | Ga0495581_0006932 | |||
| 1928 | Ga0495581_0011122 | |||
| 1929 | Ga0495581_0035026 | |||
| 1930 | Ga0495604_0000020 | |||
| 1931 | Ga0495604_0007911 | |||
| 1932 | Ga0495604_0008426 | |||
| 1933 | Ga0495604_0162420 | |||
| 1934 | Ga0495674_0000002 | |||
| 1935 | Ga0495674_0042306 | |||
| 1936 | Ga0495676_0017061 | |||
| 1937 | Ga0495676_0060276 | |||
| 1938 | Ga0495680_0001158 | |||
| 1939 | Ga0495680_0001832 | |||
| 1940 | Ga0495680_0007696 | |||
| 1941 | Ga0495680_0022544 | |||
| 1942 | Ga0495680_0047732 | |||
| 1943 | Ga0495680_0083674 | |||
| 1944 | Ga0495675_0000284 | |||
| 1945 | Ga0495675_0000625 | |||
| 1946 | Ga0495684_0000017 | |||
| 1947 | Ga0495684_0000517 | |||
| 1948 | Ga0495684_0019009 | |||
| 1949 | Ga0495684_0053566 | |||
| 1950 | Ga0495593_0000759 | |||
| 1951 | Ga0495593_0011494 | |||
| 1952 | Ga0495593_0019161 | |||
| 1953 | Ga0495593_0041222 | |||
| 1954 | Ga0495602_0000040 | |||
| 1955 | Ga0495602_0017182 | |||
| 1956 | Ga0495602_0035207 | |||
| 1957 | Ga0495602_0052529 | |||
| 1958 | Ga0495614_0002673 | |||
| 1959 | Ga0495614_0018347 | |||
| 1960 | Ga0495614_0024776 | |||
| 1961 | Ga0496100_0001217 | |||
| 1962 | Ga0496100_0001822 | |||
| 1963 | Ga0496100_0007937 | |||
| 1964 | Ga0496100_0017190 | |||
| 1965 | Ga0496100_0036333 | |||
| 1966 | Ga0496101_0000800 | |||
| 1967 | Ga0496101_0001253 | |||
| 1968 | Ga0496101_0001810 | |||
| 1969 | Ga0496101_0035739 | |||
| 1970 | Ga0496102_0002101 | |||
| 1971 | Ga0496102_0023824 | |||
| 1972 | Ga0496102_0167895 | |||
| 1973 | Ga0496102_0196536 | |||
| 1974 | Ga0496103_0003368 | |||
| 1975 | Ga0496103_0004504 | |||
| 1976 | Ga0496103_0005932 | |||
| 1977 | Ga0496103_0017251 | |||
| 1978 | Ga0496103_0019471 | |||
| 1979 | Ga0496103_0063198 | |||
| 1980 | Ga0496104_0000055 | |||
| 1981 | Ga0496104_0001184 | |||
| 1982 | Ga0496104_0003351 | |||
| 1983 | Ga0496104_0017343 | |||
| 1984 | Ga0496104_0023547 | |||
| 1985 | Ga0496104_0033443 | |||
| 1986 | Ga0496104_0043386 | |||
| 1987 | Ga0496104_0056436 | |||
| 1988 | Ga0496104_0081672 | |||
| 1989 | Ga0496104_0099014 | |||
| 1990 | Ga0496104_0158430 | |||
| 1991 | Ga0496105_0000918 | |||
| 1992 | Ga0496105_0004894 | |||
| 1993 | Ga0496105_0010872 | |||
| 1994 | Ga0496105_0015814 | |||
| 1995 | Ga0496105_0027859 | |||
| 1996 | Ga0496105_0168117 | |||
| 1997 | Ga0496106_0000317 | |||
| 1998 | Ga0496106_0013398 | |||
| 1999 | Ga0496106_0023257 | |||
| 2000 | Ga0496106_0031823 | |||
| 2001 | Ga0496106_0039870 | |||
| 2002 | Ga0496107_0000272 | |||
| 2003 | Ga0496107_0011403 | |||
| 2004 | Ga0496107_0015091 | |||
| 2005 | Ga0496107_0024456 | |||
| 2006 | Ga0496107_0038665 | |||
| 2007 | Ga0496107_0069882 | |||
| 2008 | Ga0496107_0150840 | |||
| 2009 | Ga0496108_0000333 | |||
| 2010 | Ga0496108_0002477 | |||
| 2011 | Ga0496108_0015151 | |||
| 2012 | Ga0496108_0041814 | |||
| 2013 | Ga0496108_0043056 | |||
| 2014 | Ga0496108_0086804 | |||
| 2015 | Ga0496108_0092288 | |||
| 2016 | Ga0496109_0000812 | |||
| 2017 | Ga0496109_0005773 | |||
| 2018 | Ga0496109_0018601 | |||
| 2019 | Ga0496109_0022601 | |||
| 2020 | Ga0496109_0027809 | |||
| 2021 | Ga0496109_0036508 | |||
| 2022 | Ga0496109_0051967 | |||
| 2023 | Ga0496109_0091894 | |||
| 2024 | Ga0496110_0004023 | |||
| 2025 | Ga0496110_0028476 | |||
| 2026 | Ga0496110_0029025 | |||
| 2027 | Ga0496110_0057529 | |||
| 2028 | Ga0496110_0076083 | |||
| 2029 | Ga0496110_0086278 | |||
| 2030 | Ga0496110_0232298 | |||
| 2031 | Ga0496111_0001052 | |||
| 2032 | Ga0496111_0005383 | |||
| 2033 | Ga0496111_0006334 | |||
| 2034 | Ga0496111_0011787 | |||
| 2035 | Ga0496111_0020826 | |||
| 2036 | Ga0496112_0000838 | |||
| 2037 | Ga0496112_0002948 | |||
| 2038 | Ga0496112_0084814 | |||
| 2039 | Ga0496112_0134520 | |||
| 2040 | Ga0496113_0000693 | |||
| 2041 | Ga0496113_0002078 | |||
| 2042 | Ga0496113_0016912 | |||
| 2043 | Ga0496113_0020421 | |||
| 2044 | Ga0496113_0023896 | |||
| 2045 | Ga0496113_0034483 | |||
| 2046 | Ga0496113_0159288 | |||
| 2047 | Ga0496114_0003697 | |||
| 2048 | Ga0496114_0009608 | |||
| 2049 | Ga0496114_0011582 | |||
| 2050 | Ga0496114_0011924 | |||
| 2051 | Ga0496114_0026852 | |||
| 2052 | Ga0496115_0008581 | |||
| 2053 | Ga0496115_0026529 | |||
| 2054 | Ga0496115_0029394 | |||
| 2055 | Ga0496115_0045335 | |||
| 2056 | Ga0496115_0084107 | |||
| 2057 | Ga0496115_0149071 | |||
| 2058 | Ga0496117_0069747 | |||
| 2059 | Ga0496123_0077248 | |||
| 2060 | Ga0501032_0009993 | |||
| 2061 | Ga0501032_0062656 | |||
| 2062 | Ga0501033_0023629 | |||
| 2063 | Ga0501033_0098467 | |||
| 2064 | Ga0501034_0000197 | |||
| 2065 | Ga0501034_0001247 | |||
| 2066 | Ga0501034_0001484 | |||
| 2067 | Ga0501034_0009010 | |||
| 2068 | Ga0501034_0022549 | |||
| 2069 | Ga0501034_0048161 | |||
| 2070 | Ga0501034_0071341 | |||
| 2071 | Ga0501034_0072575 | |||
| 2072 | Ga0501034_0149834 | |||
| 2073 | Ga0501034_0174344 | |||
| 2074 | Ga0501034_0185427 | |||
| 2075 | Ga0501034_0210554 | |||
| 2076 | Ga0501036_0005919 | |||
| 2077 | Ga0501036_0014217 | |||
| 2078 | Ga0501036_0023090 | |||
| 2079 | Ga0501036_0024606 | |||
| 2080 | Ga0501036_0055574 | |||
| 2081 | Ga0501037_0007042 | |||
| 2082 | Ga0501037_0012566 | |||
| 2083 | Ga0501037_0026037 | |||
| 2084 | Ga0501037_0053216 | |||
| 2085 | Ga0501037_0105255 | |||
| 2086 | Ga0501038_0007088 | |||
| 2087 | Ga0501038_0008817 | |||
| 2088 | Ga0501038_0022499 | |||
| 2089 | Ga0501038_0037071 | |||
| 2090 | Ga0501038_0084138 | |||
| 2091 | Ga0501039_0013196 | |||
| 2092 | Ga0501039_0068437 | |||
| 2093 | Ga0501040_0005271 | |||
| 2094 | Ga0501040_0050270 | |||
| 2095 | Ga0501041_0033375 | |||
| 2096 | Ga0501041_0039968 | |||
| 2097 | Ga0501042_0009123 | |||
| 2098 | Ga0501042_0035498 | |||
| 2099 | Ga0501043_0006297 | |||
| 2100 | Ga0501043_0015583 | |||
| 2101 | Ga0501043_0015624 | |||
| 2102 | Ga0501043_0032179 | |||
| 2103 | Ga0501043_0135173 | |||
| 2104 | Ga0501046_0025250 | |||
| 2105 | Ga0501046_0032639 | |||
| 2106 | Ga0501046_0162587 | |||
| 2107 | Ga0501047_0001499 | |||
| 2108 | Ga0501047_0022488 | |||
| 2109 | Ga0501047_0046860 | |||
| 2110 | Ga0501047_0126099 | |||
| 2111 | Ga0501047_0144977 | |||
| 2112 | Ga0501048_0000856 | |||
| 2113 | Ga0501048_0005853 | |||
| 2114 | Ga0501067_0015236 | |||
| 2115 | Ga0501067_0015989 | |||
| 2116 | Ga0501068_0003005 | |||
| 2117 | Ga0501068_0010125 | |||
| 2118 | Ga0501068_0040713 | |||
| 2119 | Ga0501069_0001041 | |||
| 2120 | Ga0501070_0005480 | |||
| 2121 | Ga0501070_0009844 | |||
| 2122 | Ga0501070_0018733 | |||
| 2123 | Ga0501070_0023917 | |||
| 2124 | Ga0501070_0031183 | |||
| 2125 | Ga0501070_0034636 | |||
| 2126 | Ga0501070_0090512 | |||
| 2127 | Ga0501070_0111438 | |||
| 2128 | Ga0501071_0021040 | |||
| 2129 | Ga0501071_0076439 | |||
| 2130 | Ga0501072_0011866 | |||
| 2131 | Ga0501072_0031660 | |||
| 2132 | Ga0501072_0032646 | |||
| 2133 | Ga0501072_0032742 | |||
| 2134 | Ga0501072_0041202 | |||
| 2135 | Ga0501072_0112278 | |||
| 2136 | Ga0501073_0021662 | |||
| 2137 | Ga0501073_0055594 | |||
| 2138 | Ga0501074_0022407 | |||
| 2139 | Ga0501074_0059241 | |||
| 2140 | Ga0501075_0015464 | |||
| 2141 | Ga0501075_0074712 | |||
| 2142 | Ga0501076_0006991 | |||
| 2143 | Ga0501076_0032446 | |||
| 2144 | Ga0501076_0042538 | |||
| 2145 | Ga0501076_0124488 | |||
| 2146 | Ga0501077_0022260 | |||
| 2147 | Ga0501077_0070230 | |||
| 2148 | Ga0501077_0070722 | |||
| 2149 | Ga0501079_0013648 | |||
| 2150 | Ga0501079_0034801 | |||
| 2151 | Ga0501079_0038466 | |||
| 2152 | Ga0501079_0063709 | |||
| 2153 | Ga0501079_0067352 | |||
| 2154 | Ga0501079_0126523 | |||
| 2155 | Ga0501080_0053915 | |||
| 2156 | Ga0501080_0059890 | |||
| 2157 | Ga0501080_0082526 | |||
| 2158 | Ga0501080_0084847 | |||
| 2159 | Ga0501080_0205923 | |||
| 2160 | Ga0501080_0216580 | |||
| 2161 | Ga0501081_0006174 | |||
| 2162 | Ga0501081_0008015 | |||
| 2163 | Ga0501081_0027992 | |||
| 2164 | Ga0501081_0038505 | |||
| 2165 | Ga0501083_0017096 | |||
| 2166 | Ga0501083_0022117 | |||
| 2167 | Ga0501083_0064214 | |||
| 2168 | Ga0501083_0095636 | |||
| 2169 | Ga0501083_0103568 | |||
| 2170 | Ga0501035_0003255 | |||
| 2171 | Ga0501035_0042607 | |||
| 2172 | Ga0501035_0058650 | |||
| 2173 | Ga0501035_0081216 | |||
| 2174 | Ga0501044_0000708 | |||
| 2175 | Ga0501044_0003448 | |||
| 2176 | Ga0501044_0023822 | |||
| 2177 | Ga0501044_0138283 | |||
| 2178 | Ga0501044_0211490 | |||
| 2179 | Ga0501044_0229647 | |||
| 2180 | Ga0501045_0031096 | |||
| 2181 | Ga0501045_0116135 | |||
| 2182 | Ga0501045_0164173 | |||
| 2183 | nmdc:mga03683_8170_c2 | |||
| 2184 | nmdc:mga00v17_17587_c1 | |||
| 2185 | nmdc:mga0yw44_24491_c1 | |||
| 2186 | nmdc:mga0yw44_36543_c1 | |||
| 2187 | nmdc:mga0yw44_6036_c1 | |||
| 2188 | nmdc:mga06z11_27068_c1 | |||
| 2189 | nmdc:mga06z11_56833_c1 | |||
| 2190 | nmdc:mga07m45_15749_c1 | |||
| 2191 | nmdc:mga07m45_79108_c1 | |||
| 2192 | nmdc:mga05p37_178457_c1 | |||
| 2193 | nmdc:mga05p37_187410_c1 | |||
| 2194 | nmdc:mga05p37_335814_c1 | |||
| 2195 | nmdc:mga05p37_39331_c1 | |||
| 2196 | nmdc:mga05p37_6218_c1 | |||
| 2197 | nmdc:mga05p37_675_c1 | |||
| 2198 | nmdc:mga05p37_9875_c1 | |||
| 2199 | nmdc:mga09592_11427_c1 | |||
| 2200 | nmdc:mga09592_12884_c1 | |||
| 2201 | nmdc:mga0qj67_229_c1 | |||
| 2202 | nmdc:mga0qj67_267_c1 | |||
| 2203 | nmdc:mga0qj67_41899_c1 | |||
| 2204 | nmdc:mga0qj67_82604_c1 | |||
| 2205 | nmdc:mga06r32_122772_c1 | |||
| 2206 | nmdc:mga06r32_147605_c1 | |||
| 2207 | nmdc:mga06r32_21208_c1 | |||
| 2208 | nmdc:mga06r32_36012_c1 | |||
| 2209 | nmdc:mga06r32_4977_c1 | |||
| 2210 | nmdc:mga06r32_64_c1 | |||
| 2211 | nmdc:mga08y16_1152_c1 | |||
| 2212 | nmdc:mga08y16_148802_c1 | |||
| 2213 | nmdc:mga08y16_6860_c1 | |||
| 2214 | nmdc:mga08y16_8101_c1 | |||
| 2215 | nmdc:mga08y16_906_c1 | |||
| 2216 | nmdc:mga0n895_14204_c1 | |||
| 2217 | nmdc:mga0n895_24792_c1 | |||
| 2218 | nmdc:mga0n895_2947_c1 | |||
| 2219 | nmdc:mga0n895_3362_c1 | |||
| 2220 | nmdc:mga0n895_55579_c1 | |||
| 2221 | nmdc:mga0n895_73_c1 | |||
| 2222 | nmdc:mga0n895_9100_c1 | |||
| 2223 | nmdc:mga0rr50_138021_c1 | |||
| 2224 | nmdc:mga0rr50_747_c1 | |||
| 2225 | nmdc:mga08x19_66_c1 | |||
| 2226 | nmdc:mga0a205_16585_c1 | |||
| 2227 | nmdc:mga0a205_214946_c1 | |||
| 2228 | nmdc:mga0a205_29219_c1 | |||
| 2229 | nmdc:mga0a205_30916_c1 | |||
| 2230 | nmdc:mga0a205_4115_c1 | |||
| 2231 | nmdc:mga0a205_59_c1 | |||
| 2232 | nmdc:mga0sz30_3395_c1 | |||
| 2233 | Ga0495601_0000018 | |||
| 2234 | Ga0495601_0000357 | |||
| 2235 | Ga0495601_0000555 | |||
| 2236 | Ga0495601_0022810 | |||
| 2237 | Ga0495612_0000011 | |||
| 2238 | Ga0495612_0000539 | |||
| 2239 | Ga0495612_0014087 | |||
| 2240 | Ga0495612_0016752 | |||
| 2241 | Ga0495612_0027133 | |||
| 2242 | Ga0495655_0000451 | |||
| 2243 | Ga0495595_0000016 | |||
| 2244 | Ga0495595_0000939 | |||
| 2245 | Ga0495595_0001313 | |||
| 2246 | Ga0495595_0002410 | |||
| 2247 | Ga0495595_0019761 | |||
| 2248 | Ga0495595_0069748 | |||
| 2249 | Ga0495619_0000014 | |||
| 2250 | Ga0495619_0000085 | |||
| 2251 | Ga0495619_0000380 | |||
| 2252 | Ga0495619_0000636 | |||
| 2253 | Ga0495619_0002427 | |||
| 2254 | Ga0495619_0003404 | |||
| 2255 | Ga0495619_0009386 | |||
| 2256 | Ga0495619_0064422 | |||
| 2257 | Ga0500651_0053147 | |||
| 2258 | Ga0500641_0000932 | |||
| 2259 | Ga0500641_0002842 | |||
| 2260 | Ga0500641_0008319 | |||
| 2261 | Ga0500595_000024 | |||
| 2262 | Ga0500616_0000458 | |||
| 2263 | Ga0500645_000874 | |||
| 2264 | Ga0501084_0038702 | |||
| 2265 | Ga0501084_0232500 | |||
| 2266 | Ga0501082_0004773 | |||
| 2267 | Ga0501082_0011414 | |||
| 2268 | Ga0501082_0044248 | |||
| 2269 | Ga0530510_0029715 | |||
| 2270 | Ga0530510_0036852 | |||
| 2271 | Ga0530510_0064081 | |||
| 2272 | Ga0530510_0080846 | |||
| 2273 | 2508729266 | |||
| 2274 | 2509077924 | |||
| 2275 | 2513590344 | |||
| 2276 | 2545673131 | |||
| 2277 | 2643755202 | |||
| 2278 | 2644735000 | |||
| 2279 | 2774870261 | |||
| 2280 | 2776258787 | |||
| 2281 | 2819719552 | |||
| 2282 | 2835312888 | |||
| 2283 | 2841760930 | |||
| 2284 | 2844106587 | |||
| 2285 | 2851183739 | |||
| 2286 | 2851246943 | |||
| 2287 | 2882457992 | |||
| 2288 | 2894242386 | |||
| 2289 | 2917704791 | |||
| 2290 | 3003670267 | |||
| 2291 | 641642265 | |||
| 2292 | 8057530848 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8jde-assembly1.cif.gz_A | crystal structure of mldhd in complex with d-lactate | 0.9535 | 17 | 468 |
| 8jdo-assembly1.cif.gz_A | crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid | 0.9493 | 12 | 468 |
| 8jdp-assembly1.cif.gz_A | crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid | 0.9484 | 12 | 468 |
| 8jdc-assembly1.cif.gz_A | crystal structure of mldhd in apo form | 0.9482 | 12 | 468 |
| 8jdx-assembly1.cif.gz_A | crystal structure of mldhd in complex with 2-ketoisovaleric acid | 0.9477 | 12 | 468 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7TNG8_361_443_3.30.70.2740 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9913 | 347 | 427 | 3.30.70.2740 |
| af_Q86WU2_267_377_3.30.70.2190 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9867 | 228 | 337 | 3.30.70.2190 |
| af_Q55BQ4_423_504_3.30.70.2740 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9822 | 347 | 427 | 3.30.70.2740 |
| af_Q7TPJ4_275_344_3.30.70.2190 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9778 | 248 | 316 | 3.30.70.2190 |
| af_Q94AX4_441_520_3.30.70.2740 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9709 | 348 | 427 | 3.30.70.2740 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T7BD72-F1-model_v4 | deleted | 0.9779 | 239 | 419 |
|
| AF-A0A436FTH0-F1-model_v4 | FAD-binding oxidoreductase | 0.9748 | 171 | 471 |
GO:0004458
GO:0008720 GO:0071949 GO:1903457 |
| AF-A0A803RAW2-F1-model_v4 | FAD-binding oxidoreductase/transferase type 4 C-terminal domain-containing protein | 0.971 | 264 | 468 |
GO:0004458
GO:0005739 GO:0008720 GO:0050660 GO:1903457 |
| AF-A0A436FTH0-F1-model_v4 | FAD-binding oxidoreductase | 0.9684 | 171 | 471 |
GO:0004458
GO:0008720 GO:0071949 GO:1903457 |
| AF-A0A821IVH0-F1-model_v4 | D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4) | 0.966 | 14 | 468 |
GO:0004458
GO:0005739 GO:0008720 GO:0071949 GO:1903457 |