F490804

General Info

Members Datasets Scaffolds Average Seq Length
1146 456 2292 472

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0030744|Ga0501034_0030744_1378_2946
Length 522
Sequence MAVIVDPLRLNGHYGRHDWGEDIVHQGTLSAALAGCKPALDGPWLQRQFPHELETAMNLAAKPSRDRKAAIDALTAAFGNRVVTSQAVREQHGNTVTWLPNEPPDAVVFPQSTQDVQQIVGMCAEHNMPIVPFGTGSSLEGHVNAPFGGVSIDFRDMNKVLAVHAEDLDCVIEPGLTRKALNEYLRASGVFFPIDPGADASLGGMTATRASGTNAVRYGTMKDNVLALKVVMPNGELMTTARRAKKTSAGYDLTRLMVGSEGTLGVITELTLKLHGIPEAISGGTCPFPSVEACCNTAIQTIQTGIPIARIELLDALQVRAVNLHSKLGLPETPMLFLEFHGTEASVAEQSQRFGEIAAEFGGGPFQWTTKQEERTKLWDARHHAAFSNFALRPGSHMIATDVCVPISRLAECVTQTQADIAESKLVAPIVGHIGDGNFHLTLLIDMNDADEIARAKALNERLVQRALSMDGTCTGEHGVGQGKMKYLKAEHGAPALAAMAAIKRALDPQNIMNPGKMIPLD

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
236 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
237 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
238 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
243 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
248 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
249 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
250 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
251 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
252 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
255 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
256 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
257 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
258 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
259 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
262 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
264 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
265 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
266 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
281 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
287 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
288 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
292 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
293 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
294 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
295 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
296 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
323 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
328 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
329 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
330 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
331 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
332 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
370 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
371 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
372 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
373 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
377 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
378 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
396 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
397 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
402 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
405 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
411 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
412 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
413 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
414 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
415 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
416 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
417 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
426 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
427 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
428 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
429 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
430 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
431 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
432 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
436 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
437 2508501050 Microvirga lupini Lut6 Isolate Nodule
438 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
439 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
440 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
441 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
442 2643221734 Bosea sp. Root670 Isolate Unclassified
443 2773857925 Microvirga vignae BR3299 Isolate Unclassified
444 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
445 2818991467 Bosea vestrisii 3192 Isolate Unclassified
446 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
447 2841760612 Bosea sp. Tri-49 Isolate Nodule
448 2844104063 Bosea sp. Tri-39 Isolate Nodule
449 2851182111 Bosea sp. Tri-44 Isolate Nodule
450 2851246043 Bosea sp. Tri-54 Isolate Nodule
451 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
452 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
453 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
454 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
455 641522639 Methylobacterium sp. 4-46 Isolate Nodule
456 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.4
Nodule 1.05
Rhizoplane 8.46
Rhizosphere 85.51
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0030744 3300049571 Bacteria 5457
2 2214884074 2209111006 Bacteria 7920
3 ARcpr5oldR_c000047 3300000041 Bacteria 22345
4 ARSoilYngRDRAFT_c00157 3300000042 Bacteria 11648
5 ARcpr5yngRDRAFT_c000017 3300000043 Bacteria 27988
6 ARSoilOldRDRAFT_c000006 3300000044 Bacteria 57169
7 ARCol0oldRDRAFT_c00394 3300000045 Unclassified 4195
8 ARCol0yngRDRAFT_1000410 3300000652 Bacteria 5697
9 JGI24032J14994_100449 3300001430 Unclassified 2142
10 JGI24746J21847_1001205 3300001977 Unclassified 4101
11 JGI24739J22299_10012522 3300001989 Unclassified 3112
12 JGI24743J22301_10001864 3300001991 Bacteria 3053
13 JGI24743J22301_10001874 3300001991 Unclassified 3045
14 JGI24750J21931_1000171 3300002070 Bacteria 10831
15 JGI24745J21846_1000238 3300002073 Unclassified 4527
16 JGI24738J21930_10001962 3300002075 Bacteria 5541
17 JGI24749J21850_1000164 3300002076 Bacteria 10551
18 JGI24744J21845_10007217 3300002077 Unclassified 2296
19 JGI24742J22300_10001863 3300002244 Unclassified 3354
20 JGI25153J46596_10003929 3300003215 Bacteria 8151
21 Ga0055526_1003135 3300003771 Bacteria 10710
22 Ga0055524_1000020 3300003775 Bacteria 227971
23 Ga0065165_1000141 3300005262 Bacteria 125536
24 Ga0065716_1001609 3300005277 Bacteria 5289
25 Ga0065712_10008755 3300005290 Bacteria 2185
26 Ga0065712_10073346 3300005290 Bacteria 4422
27 Ga0065712_10095088 3300005290 Bacteria 2231
28 Ga0065707_10111240 3300005295 Bacteria 2401
29 Ga0070658_10001206 3300005327 Bacteria 22151
30 Ga0070658_10131161 3300005327 Bacteria 2089
31 Ga0070676_10008970 3300005328 Bacteria 5409
32 Ga0070676_10056584 3300005328 Bacteria 2318
33 Ga0070683_100007236 3300005329 Bacteria 9366
34 Ga0070683_100054816 3300005329 Bacteria 3697
35 Ga0070683_100139939 3300005329 Bacteria 2293
36 Ga0070690_100002695 3300005330 Bacteria 9575
37 Ga0070690_100007439 3300005330 Bacteria 6275
38 Ga0070670_100023880 3300005331 Bacteria 5260
39 Ga0070677_10000354 3300005333 Bacteria 16037
40 Ga0070677_10006029 3300005333 Bacteria 4017
41 Ga0068869_100000203 3300005334 Bacteria 31014
42 Ga0068869_100016314 3300005334 Bacteria 5004
43 Ga0070666_10003118 3300005335 Bacteria 10068
44 Ga0070666_10045931 3300005335 Bacteria 2928
45 Ga0070680_100002314 3300005336 Bacteria 14060
46 Ga0070680_100008076 3300005336 Bacteria 8038
47 Ga0070680_100018551 3300005336 Bacteria 5499
48 Ga0070680_100089192 3300005336 Bacteria 2552
49 Ga0070682_100000935 3300005337 Bacteria 17035
50 Ga0070682_100048701 3300005337 Bacteria 2639
51 Ga0068868_100002681 3300005338 Bacteria 12350
52 Ga0068868_100085147 3300005338 Bacteria 2539
53 Ga0068868_100086567 3300005338 Bacteria 2519
54 Ga0070660_100002042 3300005339 Bacteria 13931
55 Ga0070660_100039578 3300005339 Bacteria 3584
56 Ga0070689_100010750 3300005340 Bacteria 6536
57 Ga0070689_100012497 3300005340 Bacteria 6118
58 Ga0070689_100104060 3300005340 Bacteria 2250
59 Ga0070691_10000067 3300005341 Bacteria 28711
60 Ga0070691_10020556 3300005341 Bacteria 3050
61 Ga0070687_100077210 3300005343 Bacteria 1806
62 Ga0070661_100001273 3300005344 Bacteria 17718
63 Ga0070661_100066329 3300005344 Bacteria 2652
64 Ga0070692_10000279 3300005345 Bacteria 14346
65 Ga0070692_10011554 3300005345 Bacteria 4057
66 Ga0070668_100001472 3300005347 Bacteria 17006
67 Ga0070668_100043745 3300005347 Bacteria 3434
68 Ga0070668_100076963 3300005347 Bacteria 2607
69 Ga0070668_100094048 3300005347 Bacteria 2366
70 Ga0070669_100001453 3300005353 Bacteria 17173
71 Ga0070669_100177205 3300005353 Bacteria 1666
72 Ga0070675_100000701 3300005354 Bacteria 23221
73 Ga0070671_100001883 3300005355 Bacteria 16034
74 Ga0070671_100047421 3300005355 Bacteria 3573
75 Ga0070674_100008500 3300005356 Bacteria 6115
76 Ga0070674_100010760 3300005356 Bacteria 5547
77 Ga0070673_100000855 3300005364 Bacteria 17061
78 Ga0070673_100040814 3300005364 Bacteria 3563
79 Ga0070688_100002458 3300005365 Bacteria 9366
80 Ga0070688_100005328 3300005365 Bacteria 6760
81 Ga0070688_100009226 3300005365 Bacteria 5384
82 Ga0070688_100017152 3300005365 Bacteria 4154
83 Ga0070659_100002844 3300005366 Bacteria 12316
84 Ga0070659_100042026 3300005366 Bacteria 3574
85 Ga0070667_100002230 3300005367 Bacteria 17055
86 Ga0070667_100045305 3300005367 Bacteria 3697
87 Ga0070667_100193441 3300005367 Bacteria 1803
88 Ga0070709_10000219 3300005434 Bacteria 37061
89 Ga0070709_10010596 3300005434 Bacteria 5110
90 Ga0070709_10041879 3300005434 Bacteria 2824
91 Ga0070714_100011112 3300005435 Bacteria 7135
92 Ga0070714_100024143 3300005435 Bacteria 5001
93 Ga0070714_100111314 3300005435 Bacteria 2424
94 Ga0070713_100000224 3300005436 Bacteria 37679
95 Ga0070713_100054191 3300005436 Bacteria 3326
96 Ga0070713_100074935 3300005436 Bacteria 2869
97 Ga0070710_10000956 3300005437 Bacteria 13707
98 Ga0070701_10000732 3300005438 Bacteria 11634
99 Ga0070711_100075313 3300005439 Bacteria 2389
100 Ga0070711_100193408 3300005439 Bacteria 1565
101 Ga0070705_100002431 3300005440 Bacteria 9366
102 Ga0070705_100065255 3300005440 Bacteria 2179
103 Ga0070700_100011866 3300005441 Bacteria 4840
104 Ga0070700_100026381 3300005441 Bacteria 3430
105 Ga0070708_100006477 3300005445 Bacteria 9315
106 Ga0070663_100003237 3300005455 Bacteria 9366
107 Ga0070663_100079771 3300005455 Bacteria 2403
108 Ga0070663_100125422 3300005455 Bacteria 1944
109 Ga0070678_100001091 3300005456 Bacteria 14198
110 Ga0070678_100020981 3300005456 Bacteria 4297
111 Ga0070678_100081860 3300005456 Bacteria 2449
112 Ga0070662_100037125 3300005457 Bacteria 3452
113 Ga0070681_10006073 3300005458 Bacteria 11714
114 Ga0070681_10013953 3300005458 Bacteria 7993
115 Ga0070681_10059673 3300005458 Bacteria 3794
116 Ga0070681_10085943 3300005458 Bacteria 3098
117 Ga0070681_10089352 3300005458 Bacteria 3032
118 Ga0070681_10128583 3300005458 Bacteria 2466
119 Ga0068867_100000679 3300005459 Bacteria 22540
120 Ga0068867_100010686 3300005459 Bacteria 6475
121 Ga0068867_100131739 3300005459 Bacteria 1944
122 Ga0070685_10001017 3300005466 Bacteria 15078
123 Ga0070706_100034715 3300005467 Bacteria 4658
124 Ga0070698_100001178 3300005471 Bacteria 29022
125 Ga0070699_100014629 3300005518 Bacteria 6749
126 Ga0070679_100002677 3300005530 Bacteria 16220
127 Ga0070679_100072165 3300005530 Bacteria 3444
128 Ga0070679_100179538 3300005530 Bacteria 2089
129 Ga0070684_100000693 3300005535 Bacteria 23221
130 Ga0070684_100078587 3300005535 Bacteria 2915
131 Ga0070684_100141498 3300005535 Bacteria 2175
132 Ga0070684_100160910 3300005535 Bacteria 2037
133 Ga0070697_100104754 3300005536 Bacteria 2352
134 Ga0070672_100004245 3300005543 Bacteria 9369
135 Ga0070672_100021286 3300005543 Bacteria 4743
136 Ga0070672_100050976 3300005543 Bacteria 3226
137 Ga0070672_100096548 3300005543 Bacteria 2391
138 Ga0070686_100001302 3300005544 Bacteria 14092
139 Ga0070686_100002564 3300005544 Bacteria 10020
140 Ga0070686_100007632 3300005544 Bacteria 6043
141 Ga0070686_100028997 3300005544 Bacteria 3361
142 Ga0070695_100002461 3300005545 Bacteria 10663
143 Ga0070695_100009173 3300005545 Bacteria 5882
144 Ga0070696_100001783 3300005546 Bacteria 14106
145 Ga0070696_100007358 3300005546 Bacteria 7353
146 Ga0070696_100057982 3300005546 Bacteria 2704
147 Ga0070693_100001926 3300005547 Bacteria 9497
148 Ga0070693_100047279 3300005547 Bacteria 2448
149 Ga0070665_100042474 3300005548 Bacteria 4570
150 Ga0070704_100031373 3300005549 Bacteria 3574
151 Ga0068855_100010931 3300005563 Bacteria 10955
152 Ga0068855_100077988 3300005563 Bacteria 3843
153 Ga0068855_100163518 3300005563 Bacteria 2525
154 Ga0070664_100006539 3300005564 Bacteria 9399
155 Ga0070664_100117084 3300005564 Bacteria 2330
156 Ga0068857_100000534 3300005577 Bacteria 27500
157 Ga0068857_100025817 3300005577 Bacteria 5173
158 Ga0068857_100054713 3300005577 Bacteria 3542
159 Ga0068854_100003403 3300005578 Bacteria 9917
160 Ga0068854_100073166 3300005578 Bacteria 2511
161 Ga0068854_100148241 3300005578 Bacteria 1806
162 Ga0068856_100008075 3300005614 Bacteria 10274
163 Ga0068856_100157777 3300005614 Bacteria 2279
164 Ga0070702_100001579 3300005615 Bacteria 9391
165 Ga0070702_100020797 3300005615 Bacteria 3443
166 Ga0070702_100037145 3300005615 Bacteria 2704
167 Ga0068852_100003393 3300005616 Bacteria 11127
168 Ga0068852_100014120 3300005616 Bacteria 6133
169 Ga0068852_100041022 3300005616 Bacteria 3909
170 Ga0068852_100072068 3300005616 Bacteria 3035
171 Ga0068859_100003965 3300005617 Bacteria 15100
172 Ga0068859_100031525 3300005617 Bacteria 5323
173 Ga0068859_100037505 3300005617 Bacteria 4864
174 Ga0068859_100067082 3300005617 Bacteria 3622
175 Ga0068864_100004544 3300005618 Bacteria 11395
176 Ga0068864_100013878 3300005618 Bacteria 6678
177 Ga0068864_100083229 3300005618 Bacteria 2810
178 Ga0068866_10000252 3300005718 Bacteria 25051
179 Ga0068861_100001032 3300005719 Bacteria 17052
180 Ga0068861_100071527 3300005719 Bacteria 2689
181 Ga0068870_10013347 3300005840 Bacteria 3859
182 Ga0068863_100000150 3300005841 Bacteria 72968
183 Ga0068863_100084827 3300005841 Bacteria 3002
184 Ga0068863_100093117 3300005841 Bacteria 2860
185 Ga0068863_100177821 3300005841 Bacteria 2042
186 Ga0068858_100003904 3300005842 Bacteria 14725
187 Ga0068858_100013222 3300005842 Bacteria 7777
188 Ga0068858_100019307 3300005842 Bacteria 6373
189 Ga0068858_100212920 3300005842 Bacteria 1829
190 Ga0068860_100003148 3300005843 Bacteria 17055
191 Ga0068860_100049421 3300005843 Unclassified 4005
192 Ga0068862_100006993 3300005844 Bacteria 9366
193 Ga0068862_100009738 3300005844 Bacteria 7944
194 Ga0081455_10000185 3300005937 Bacteria 78750
195 Ga0081455_10002539 3300005937 Bacteria 21666
196 Ga0081455_10003484 3300005937 Bacteria 18077
197 Ga0081455_10005197 3300005937 Bacteria 14318
198 Ga0081455_10011999 3300005937 Bacteria 8671
199 Ga0081455_10017717 3300005937 Bacteria 6815
200 Ga0081538_10000638 3300005981 Bacteria 38813
201 Ga0081538_10017029 3300005981 Bacteria 5539
202 Ga0081538_10065488 3300005981 Bacteria 2045
203 Ga0081538_10071988 3300005981 Bacteria 1898
204 Ga0081540_1000925 3300005983 Bacteria 26377
205 Ga0081540_1004357 3300005983 Bacteria 10826
206 Ga0081540_1081091 3300005983 Bacteria 1460
207 Ga0081539_10002542 3300005985 Bacteria 25354
208 Ga0081539_10002695 3300005985 Bacteria 24099
209 Ga0070717_10000285 3300006028 Bacteria 34330
210 Ga0070717_10026319 3300006028 Bacteria 4640
211 Ga0075365_10039163 3300006038 Bacteria 3085
212 Ga0075364_10029445 3300006051 Bacteria 3521
213 Ga0075432_10000240 3300006058 Bacteria 14777
214 Ga0070715_10001307 3300006163 Bacteria 7164
215 Ga0070716_100011132 3300006173 Bacteria 4527
216 Ga0070716_100023971 3300006173 Bacteria 3244
217 Ga0070712_100020468 3300006175 Bacteria 4329
218 Ga0070712_100054255 3300006175 Bacteria 2802
219 Ga0075362_10014565 3300006177 Bacteria 3176
220 Ga0075362_10019606 3300006177 Bacteria 2815
221 Ga0075367_10012684 3300006178 Bacteria 4506
222 Ga0075367_10088361 3300006178 Bacteria 1883
223 Ga0097621_100000544 3300006237 Bacteria 26555
224 Ga0097621_100004712 3300006237 Bacteria 9530
225 Ga0097621_100025145 3300006237 Bacteria 4657
226 Ga0075370_10009286 3300006353 Bacteria 5103
227 Ga0075370_10064015 3300006353 Bacteria 2097
228 Ga0068871_100001366 3300006358 Bacteria 16355
229 Ga0068871_100003497 3300006358 Bacteria 10802
230 Ga0068871_100174820 3300006358 Bacteria 1843
231 Ga0075428_100000205 3300006844 Bacteria 56652
232 Ga0075428_100019769 3300006844 Bacteria 7453
233 Ga0075428_100082405 3300006844 Bacteria 3510
234 Ga0075428_100102778 3300006844 Bacteria 3117
235 Ga0075428_100201860 3300006844 Bacteria 2149
236 Ga0075430_100000012 3300006846 Bacteria 94359
237 Ga0075430_100004858 3300006846 Bacteria 11310
238 Ga0075430_100068023 3300006846 Bacteria 2989
239 Ga0075431_100000266 3300006847 Bacteria 40349
240 Ga0075431_100005460 3300006847 Bacteria 12559
241 Ga0075431_100014481 3300006847 Bacteria 7978
242 Ga0075431_100022527 3300006847 Bacteria 6441
243 Ga0075431_100072901 3300006847 Bacteria 3543
244 Ga0075431_100098627 3300006847 Bacteria 3016
245 Ga0075431_100248972 3300006847 Bacteria 1806
246 Ga0075433_10000338 3300006852 Bacteria 29055
247 Ga0075433_10004462 3300006852 Bacteria 10906
248 Ga0075433_10012596 3300006852 Bacteria 6840
249 Ga0075433_10080536 3300006852 Bacteria 2871
250 Ga0075434_100000373 3300006871 Bacteria 32610
251 Ga0075434_100009082 3300006871 Bacteria 9258
252 Ga0075434_100009842 3300006871 Bacteria 8940
253 Ga0075434_100012045 3300006871 Bacteria 8184
254 Ga0075434_100027939 3300006871 Bacteria 5538
255 Ga0075434_100133652 3300006871 Bacteria 2500
256 Ga0075429_100002160 3300006880 Bacteria 16411
257 Ga0075429_100022260 3300006880 Bacteria 5498
258 Ga0075429_100160193 3300006880 Bacteria 1971
259 Ga0068865_100000190 3300006881 Bacteria 34392
260 Ga0068865_100044980 3300006881 Bacteria 3024
261 Ga0068865_100168964 3300006881 Bacteria 1675
262 Ga0075436_100000443 3300006914 Bacteria 26527
263 Ga0097620_100003965 3300006931 Bacteria 15100
264 Ga0097620_100031525 3300006931 Bacteria 5323
265 Ga0097620_100037508 3300006931 Bacteria 4864
266 Ga0097620_100067084 3300006931 Bacteria 3622
267 Ga0075435_100013108 3300007076 Bacteria 6158
268 Ga0075435_100134915 3300007076 Bacteria 2067
269 Ga0075435_100173393 3300007076 Bacteria 1820
270 Ga0099794_10007253 3300007265 Bacteria 4543
271 Ga0105250_10010395 3300009092 Bacteria 3880
272 Ga0105250_10023450 3300009092 Bacteria 2486
273 Ga0105240_10003481 3300009093 Bacteria 24428
274 Ga0105240_10070736 3300009093 Bacteria 4316
275 Ga0105240_10160426 3300009093 Bacteria 2671
276 Ga0111539_10000299 3300009094 Bacteria 60010
277 Ga0111539_10005091 3300009094 Bacteria 17061
278 Ga0111539_10005821 3300009094 Bacteria 15939
279 Ga0111539_10025137 3300009094 Bacteria 7300
280 Ga0111539_10080025 3300009094 Bacteria 3844
281 Ga0111539_10179589 3300009094 Bacteria 2472
282 Ga0105245_10000543 3300009098 Bacteria 34420
283 Ga0105245_10017080 3300009098 Bacteria 6332
284 Ga0105245_10178269 3300009098 Bacteria 2028
285 Ga0105247_10026146 3300009101 Bacteria 3523
286 Ga0105247_10034263 3300009101 Bacteria 3093
287 Ga0105247_10104703 3300009101 Bacteria 1813
288 Ga0114129_10000640 3300009147 Bacteria 43706
289 Ga0114129_10016895 3300009147 Bacteria 10390
290 Ga0114129_10019077 3300009147 Bacteria 9768
291 Ga0114129_10106391 3300009147 Bacteria 3875
292 Ga0105243_10014840 3300009148 Bacteria 5895
293 Ga0105243_10020519 3300009148 Bacteria 5009
294 Ga0105243_10216149 3300009148 Bacteria 1691
295 Ga0105241_10002875 3300009174 Bacteria 12867
296 Ga0105241_10016416 3300009174 Bacteria 5431
297 Ga0105241_10045570 3300009174 Bacteria 3328
298 Ga0105242_10001766 3300009176 Bacteria 17062
299 Ga0105242_10004776 3300009176 Bacteria 10490
300 Ga0105242_10020801 3300009176 Bacteria 5147
301 Ga0105248_10000501 3300009177 Bacteria 44646
302 Ga0105248_10010945 3300009177 Bacteria 10011
303 Ga0105248_10017190 3300009177 Bacteria 7969
304 Ga0105248_10040194 3300009177 Bacteria 5244
305 Ga0105248_10095011 3300009177 Bacteria 3356
306 Ga0105238_10024549 3300009551 Bacteria 6144
307 Ga0105238_10116235 3300009551 Bacteria 2654
308 Ga0105249_10006521 3300009553 Bacteria 10153
309 Ga0105239_10005329 3300010375 Bacteria 15087
310 Ga0105239_10019260 3300010375 Bacteria 7538
311 Ga0105239_10035309 3300010375 Bacteria 5491
312 Ga0105239_10110589 3300010375 Bacteria 3046
313 Ga0105239_10127527 3300010375 Bacteria 2829
314 Ga0105246_10009901 3300011119 Bacteria 5878
315 Ga0105246_10064351 3300011119 Bacteria 2561
316 Ga0105246_10082067 3300011119 Bacteria 2300
317 Ga0157373_10060401 3300013100 Bacteria 2686
318 Ga0157371_10042393 3300013102 Bacteria 3243
319 Ga0157370_10026677 3300013104 Bacteria 5701
320 Ga0157370_10030889 3300013104 Bacteria 5246
321 Ga0157369_10048634 3300013105 Bacteria 4601
322 Ga0157369_10232379 3300013105 Bacteria 1928
323 Ga0171462_1032 3300013250 Bacteria 98473
324 Ga0157374_10013556 3300013296 Bacteria 7118
325 Ga0157374_10067536 3300013296 Bacteria 3361
326 Ga0157378_10003057 3300013297 Bacteria 14869
327 Ga0163162_10004207 3300013306 Bacteria 13834
328 Ga0163162_10083860 3300013306 Bacteria 3261
329 Ga0163162_10236195 3300013306 Bacteria 1958
330 Ga0157372_10028637 3300013307 Bacteria 6082
331 Ga0157375_10002141 3300013308 Bacteria 17061
332 Ga0157375_10009534 3300013308 Bacteria 8523
333 Ga0157375_10011822 3300013308 Bacteria 7718
334 Ga0157375_10289737 3300013308 Bacteria 1800
335 Ga0163163_10003931 3300014325 Bacteria 12675
336 Ga0163163_10010114 3300014325 Bacteria 8461
337 Ga0163163_10187720 3300014325 Bacteria 2115
338 Ga0157380_10000049 3300014326 Bacteria 71296
339 Ga0157380_10117233 3300014326 Bacteria 2249
340 Ga0182008_10048537 3300014497 Bacteria 2108
341 Ga0157377_10002000 3300014745 Bacteria 8928
342 Ga0157377_10013212 3300014745 Bacteria 4175
343 Ga0157379_10035738 3300014968 Bacteria 4430
344 Ga0157379_10080671 3300014968 Bacteria 2914
345 Ga0157376_10000099 3300014969 Bacteria 62912
346 Ga0157376_10148915 3300014969 Bacteria 2109
347 Ga0163161_10000081 3300017792 Bacteria 97213
348 Ga0163161_10075725 3300017792 Bacteria 2470
349 Ga0163161_10140989 3300017792 Bacteria 1825
350 Ga0213876_10001399 3300021384 Bacteria 15040
351 Ga0213876_10070589 3300021384 Bacteria 1845
352 Ga0213875_10004329 3300021388 Bacteria 7821
353 Ga0209233_1012396 3300025261 Bacteria 2475
354 Ga0207666_1000167 3300025271 Bacteria 10172
355 Ga0209130_1000178 3300025284 Bacteria 90293
356 Ga0207673_1000367 3300025290 Bacteria 4557
357 Ga0209675_1000692 3300025291 Bacteria 23450
358 Ga0209025_1000008 3300025294 Bacteria 1130876
359 Ga0209025_1002015 3300025294 Bacteria 23178
360 Ga0209564_1000049 3300025295 Bacteria 362075
361 Ga0209758_1007060 3300025297 Bacteria 7790
362 Ga0209256_1000014 3300025299 Bacteria 687409
363 Ga0209256_1000200 3300025299 Bacteria 112931
364 Ga0207426_1023081 3300025302 Bacteria 2126
365 Ga0207653_10000843 3300025885 Bacteria 10205
366 Ga0207682_10000046 3300025893 Bacteria 51587
367 Ga0207682_10000637 3300025893 Bacteria 16334
368 Ga0207692_10000988 3300025898 Bacteria 10376
369 Ga0207642_10001252 3300025899 Bacteria 7870
370 Ga0207710_10000850 3300025900 Bacteria 16454
371 Ga0207710_10009377 3300025900 Bacteria 4121
372 Ga0207710_10010799 3300025900 Bacteria 3846
373 Ga0207688_10001056 3300025901 Bacteria 14080
374 Ga0207688_10001343 3300025901 Bacteria 12782
375 Ga0207680_10002036 3300025903 Bacteria 9466
376 Ga0207680_10007258 3300025903 Bacteria 5390
377 Ga0207680_10048876 3300025903 Bacteria 2515
378 Ga0207647_10007296 3300025904 Bacteria 8002
379 Ga0207647_10079370 3300025904 Bacteria 1970
380 Ga0207685_10002344 3300025905 Bacteria 4314
381 Ga0207685_10014730 3300025905 Bacteria 2455
382 Ga0207699_10000312 3300025906 Bacteria 25999
383 Ga0207699_10037876 3300025906 Bacteria 2759
384 Ga0207645_10000162 3300025907 Bacteria 52720
385 Ga0207645_10037726 3300025907 Bacteria 3101
386 Ga0207643_10000025 3300025908 Bacteria 101583
387 Ga0207643_10001138 3300025908 Bacteria 15810
388 Ga0207654_10001641 3300025911 Bacteria 11696
389 Ga0207654_10033211 3300025911 Bacteria 2859
390 Ga0207707_10002255 3300025912 Bacteria 17449
391 Ga0207707_10010884 3300025912 Bacteria 7907
392 Ga0207707_10012619 3300025912 Bacteria 7342
393 Ga0207707_10073899 3300025912 Bacteria 2973
394 Ga0207707_10149927 3300025912 Bacteria 2039
395 Ga0207671_10010591 3300025914 Bacteria 7591
396 Ga0207693_10006436 3300025915 Bacteria 9731
397 Ga0207693_10036605 3300025915 Bacteria 3868
398 Ga0207693_10039616 3300025915 Bacteria 3711
399 Ga0207693_10040965 3300025915 Bacteria 3648
400 Ga0207663_10050345 3300025916 Bacteria 2588
401 Ga0207663_10076825 3300025916 Bacteria 2171
402 Ga0207660_10001243 3300025917 Bacteria 17069
403 Ga0207662_10016220 3300025918 Bacteria 4201
404 Ga0207662_10016564 3300025918 Bacteria 4161
405 Ga0207662_10107287 3300025918 Bacteria 1738
406 Ga0207657_10039151 3300025919 Bacteria 4215
407 Ga0207649_10000048 3300025920 Bacteria 110714
408 Ga0207652_10003743 3300025921 Bacteria 12479
409 Ga0207652_10019346 3300025921 Bacteria 5599
410 Ga0207652_10023862 3300025921 Bacteria 5072
411 Ga0207652_10042464 3300025921 Bacteria 3870
412 Ga0207652_10081384 3300025921 Bacteria 2832
413 Ga0207681_10000131 3300025923 Bacteria 61025
414 Ga0207694_10057921 3300025924 Bacteria 3013
415 Ga0207650_10002321 3300025925 Bacteria 13259
416 Ga0207650_10053527 3300025925 Bacteria 2992
417 Ga0207650_10140014 3300025925 Bacteria 1901
418 Ga0207659_10000040 3300025926 Bacteria 91375
419 Ga0207659_10048887 3300025926 Bacteria 2998
420 Ga0207659_10117466 3300025926 Bacteria 2033
421 Ga0207687_10000090 3300025927 Bacteria 66310
422 Ga0207687_10007813 3300025927 Bacteria 7014
423 Ga0207700_10000231 3300025928 Bacteria 33501
424 Ga0207700_10040992 3300025928 Bacteria 3384
425 Ga0207700_10080333 3300025928 Bacteria 2543
426 Ga0207700_10139355 3300025928 Bacteria 1991
427 Ga0207664_10026272 3300025929 Bacteria 4399
428 Ga0207664_10182187 3300025929 Bacteria 1804
429 Ga0207644_10000473 3300025931 Bacteria 25907
430 Ga0207644_10007385 3300025931 Bacteria 7160
431 Ga0207690_10000173 3300025932 Bacteria 50054
432 Ga0207706_10005557 3300025933 Bacteria 11754
433 Ga0207706_10048639 3300025933 Bacteria 3750
434 Ga0207706_10060198 3300025933 Bacteria 3344
435 Ga0207686_10002985 3300025934 Bacteria 9120
436 Ga0207686_10003177 3300025934 Bacteria 8843
437 Ga0207686_10025401 3300025934 Bacteria 3445
438 Ga0207709_10000585 3300025935 Bacteria 30473
439 Ga0207709_10064941 3300025935 Bacteria 2293
440 Ga0207670_10002222 3300025936 Bacteria 10152
441 Ga0207670_10002465 3300025936 Bacteria 9706
442 Ga0207670_10076952 3300025936 Bacteria 2323
443 Ga0207669_10000102 3300025937 Bacteria 42874
444 Ga0207669_10004690 3300025937 Bacteria 6046
445 Ga0207704_10000097 3300025938 Bacteria 49151
446 Ga0207704_10006584 3300025938 Bacteria 5432
447 Ga0207704_10012115 3300025938 Bacteria 4271
448 Ga0207665_10000487 3300025939 Bacteria 26772
449 Ga0207665_10000745 3300025939 Bacteria 21939
450 Ga0207665_10049274 3300025939 Bacteria 2829
451 Ga0207691_10001237 3300025940 Bacteria 25472
452 Ga0207691_10007973 3300025940 Bacteria 10188
453 Ga0207691_10012219 3300025940 Bacteria 8230
454 Ga0207711_10000847 3300025941 Bacteria 29585
455 Ga0207711_10001975 3300025941 Bacteria 18574
456 Ga0207711_10057697 3300025941 Bacteria 3338
457 Ga0207711_10189442 3300025941 Bacteria 1874
458 Ga0207689_10000677 3300025942 Bacteria 32501
459 Ga0207689_10003052 3300025942 Bacteria 15417
460 Ga0207689_10004233 3300025942 Bacteria 13052
461 Ga0207689_10052095 3300025942 Bacteria 3373
462 Ga0207661_10000204 3300025944 Bacteria 38344
463 Ga0207661_10111725 3300025944 Bacteria 2312
464 Ga0207679_10000090 3300025945 Bacteria 79412
465 Ga0207667_10018822 3300025949 Bacteria 7733
466 Ga0207667_10098381 3300025949 Bacteria 3019
467 Ga0207667_10122143 3300025949 Bacteria 2684
468 Ga0207667_10267315 3300025949 Bacteria 1748
469 Ga0207651_10000017 3300025960 Bacteria 100256
470 Ga0207651_10017251 3300025960 Bacteria 4260
471 Ga0207712_10000114 3300025961 Bacteria 87261
472 Ga0207712_10009218 3300025961 Bacteria 6250
473 Ga0207712_10067021 3300025961 Bacteria 2568
474 Ga0207668_10000139 3300025972 Bacteria 49764
475 Ga0207668_10011937 3300025972 Bacteria 5301
476 Ga0207668_10016242 3300025972 Bacteria 4642
477 Ga0207668_10084432 3300025972 Bacteria 2314
478 Ga0207640_10000221 3300025981 Bacteria 40097
479 Ga0207640_10109641 3300025981 Bacteria 1953
480 Ga0207640_10115559 3300025981 Bacteria 1911
481 Ga0207658_10001766 3300025986 Bacteria 16236
482 Ga0207658_10024367 3300025986 Bacteria 4234
483 Ga0207658_10062170 3300025986 Bacteria 2794
484 Ga0207658_10080747 3300025986 Bacteria 2492
485 Ga0207658_10138949 3300025986 Bacteria 1963
486 Ga0207658_10174420 3300025986 Unclassified 1774
487 Ga0207677_10023458 3300026023 Bacteria 3813
488 Ga0207677_10044776 3300026023 Bacteria 2950
489 Ga0207703_10001230 3300026035 Bacteria 23955
490 Ga0207703_10006478 3300026035 Bacteria 9348
491 Ga0207703_10011650 3300026035 Bacteria 6839
492 Ga0207703_10165148 3300026035 Bacteria 1942
493 Ga0207703_10180100 3300026035 Bacteria 1865
494 Ga0207639_10001275 3300026041 Bacteria 17013
495 Ga0207678_10010483 3300026067 Bacteria 8140
496 Ga0207708_10001855 3300026075 Bacteria 15567
497 Ga0207708_10040517 3300026075 Bacteria 3551
498 Ga0207708_10133814 3300026075 Bacteria 1940
499 Ga0207702_10000198 3300026078 Bacteria 71277
500 Ga0207641_10000417 3300026088 Bacteria 49719
501 Ga0207641_10044363 3300026088 Bacteria 3739
502 Ga0207641_10240009 3300026088 Bacteria 1688
503 Ga0207648_10000483 3300026089 Bacteria 44295
504 Ga0207648_10015227 3300026089 Bacteria 7075
505 Ga0207648_10027045 3300026089 Bacteria 5094
506 Ga0207648_10098232 3300026089 Unclassified 2563
507 Ga0207676_10000372 3300026095 Bacteria 38295
508 Ga0207676_10001984 3300026095 Bacteria 14895
509 Ga0207676_10015557 3300026095 Bacteria 5490
510 Ga0207674_10009004 3300026116 Bacteria 11470
511 Ga0207674_10035884 3300026116 Bacteria 5172
512 Ga0207674_10116617 3300026116 Bacteria 2641
513 Ga0207675_100005906 3300026118 Bacteria 11682
514 Ga0207675_100053176 3300026118 Bacteria 3779
515 Ga0207683_10000141 3300026121 Bacteria 59587
516 Ga0207683_10003008 3300026121 Bacteria 14733
517 Ga0207683_10007416 3300026121 Bacteria 9407
518 Ga0207683_10024647 3300026121 Bacteria 5182
519 Ga0207683_10026401 3300026121 Bacteria 5012
520 Ga0207683_10045434 3300026121 Bacteria 3841
521 Ga0207698_10005863 3300026142 Bacteria 7634
522 Ga0207698_10270873 3300026142 Bacteria 1565
523 Ga0207698_10277801 3300026142 Bacteria 1547
524 Ga0209971_1002132 3300027682 Bacteria 4814
525 Ga0209998_10007120 3300027717 Bacteria 2320
526 Ga0209998_10008001 3300027717 Bacteria 2194
527 Ga0209974_10042219 3300027876 Bacteria 1518
528 Ga0207428_10000058 3300027907 Bacteria 158579
529 Ga0207428_10001115 3300027907 Bacteria 29201
530 Ga0207428_10002874 3300027907 Bacteria 17069
531 Ga0268266_10002234 3300028379 Bacteria 21139
532 Ga0268266_10024665 3300028379 Bacteria 5117
533 Ga0268266_10028466 3300028379 Bacteria 4749
534 Ga0268265_10003432 3300028380 Bacteria 11404
535 Ga0268265_10043620 3300028380 Bacteria 3335
536 Ga0268265_10226512 3300028380 Bacteria 1640
537 Ga0268264_10000412 3300028381 Bacteria 60566
538 Ga0265337_1010903 3300028556 Bacteria 3159
539 Ga0265330_10036549 3300031235 Bacteria 2189
540 Ga0265332_10000849 3300031238 Bacteria 18521
541 Ga0265325_10000036 3300031241 Bacteria 96858
542 Ga0265325_10000464 3300031241 Bacteria 29365
543 Ga0265325_10007651 3300031241 Bacteria 6456
544 Ga0265325_10047190 3300031241 Bacteria 2230
545 Ga0265340_10004313 3300031247 Bacteria 7968
546 Ga0265340_10038095 3300031247 Bacteria 2379
547 Ga0265339_10001612 3300031249 Bacteria 16687
548 Ga0265339_10004115 3300031249 Bacteria 10026
549 Ga0265339_10007937 3300031249 Bacteria 6807
550 Ga0265331_10014085 3300031250 Bacteria 4272
551 Ga0265331_10018026 3300031250 Bacteria 3670
552 Ga0265316_10028221 3300031344 Bacteria 4632
553 Ga0265316_10118153 3300031344 Bacteria 2004
554 Ga0265313_10000513 3300031595 Bacteria 40580
555 Ga0265313_10001147 3300031595 Bacteria 25315
556 Ga0265313_10001570 3300031595 Bacteria 21191
557 Ga0265313_10003857 3300031595 Bacteria 11830
558 Ga0265313_10013620 3300031595 Bacteria 4865
559 Ga0265313_10026302 3300031595 Bacteria 3067
560 Ga0265313_10066220 3300031595 Bacteria 1675
561 Ga0265314_10007314 3300031711 Bacteria 9589
562 Ga0265314_10024700 3300031711 Bacteria 4550
563 Ga0265314_10034461 3300031711 Bacteria 3701
564 Ga0265314_10120567 3300031711 Bacteria 1652
565 Ga0265342_10000360 3300031712 Bacteria 50461
566 Ga0265342_10002687 3300031712 Bacteria 15127
567 Ga0265342_10010083 3300031712 Bacteria 6587
568 Ga0265342_10017720 3300031712 Bacteria 4625
569 Ga0265342_10030918 3300031712 Bacteria 3314
570 Ga0265342_10049630 3300031712 Bacteria 2510
571 Ga0307411_10103866 3300032005 Bacteria 2017
572 Ga0373930_0000011 3300034816 Bacteria 18016
573 Ga0373948_0000241 3300034817 Bacteria 6519
574 Ga0373950_0002353 3300034818 Bacteria 2594
575 Ga0373958_0000313 3300034819 Bacteria 5848
576 Ga0373959_0005453 3300034820 Bacteria 2086
577 Ga0373938_0000404 3300034957 Bacteria 6956
578 Ga0373926_0013686 3300035083 Bacteria 2754
579 Ga0373926_0017166 3300035083 Bacteria 2482
580 Ga0373928_0000880 3300035084 Bacteria 5888
581 Ga0373929_0000816 3300035085 Bacteria 6065
582 Ga0373940_0000619 3300035088 Bacteria 5660
583 Ga0373944_0010711 3300035089 Bacteria 2503
584 Ga0373951_0000312 3300035091 Bacteria 15385
585 Ga0373951_0006275 3300035091 Unclassified 2722
586 Ga0373952_0000253 3300035092 Bacteria 8714
587 Ga0373952_0003999 3300035092 Bacteria 2664
588 Ga0373923_0015576 3300035111 Bacteria 2873
589 Ga0373923_0054353 3300035111 Bacteria 1685
590 Ga0373932_0001887 3300035112 Bacteria 5600
591 Ga0373932_0008193 3300035112 Bacteria 2497
592 Ga0373932_0008544 3300035112 Bacteria 2449
593 Ga0373936_0048268 3300035113 Bacteria 1718
594 Ga0373939_0000502 3300035114 Bacteria 9837
595 Ga0373939_0000832 3300035114 Bacteria 7638
596 Ga0373939_0002168 3300035114 Bacteria 4660
597 Ga0373941_0000330 3300035115 Bacteria 9276
598 Ga0373945_0004542 3300035116 Bacteria 4411
599 Ga0373945_0007082 3300035116 Bacteria 3628
600 Ga0373945_0010369 3300035116 Bacteria 3068
601 Ga0373953_0017789 3300035117 Bacteria 2619
602 Ga0373953_0025159 3300035117 Bacteria 2271
603 Ga0373954_0000753 3300035118 Bacteria 12522
604 Ga0373956_0001330 3300035119 Bacteria 10205
605 Ga0373956_0015305 3300035119 Bacteria 3210
606 Ga0373957_0006863 3300035120 Bacteria 3611
607 Ga0373957_0008264 3300035120 Bacteria 3365
608 Ga0373960_0000137 3300035121 Bacteria 12098
609 Ga0373943_0003107 3300035170 Bacteria 7543
610 Ga0373946_0001852 3300035171 Bacteria 7383
611 Ga0373946_0002090 3300035171 Bacteria 7018
612 Ga0373946_0013540 3300035171 Bacteria 3068
613 Ga0373946_0023809 3300035171 Bacteria 2394
614 Ga0373955_0000158 3300035172 Bacteria 27228
615 Ga0373955_0002098 3300035172 Bacteria 8610
616 Ga0373961_0000492 3300035241 Bacteria 15342
617 Ga0373961_0003857 3300035241 Bacteria 3659
618 Ga0373962_0000279 3300035242 Bacteria 10997
619 Ga0316574_0023419 3300035398 Bacteria 3686
620 Ga0373924_0007302 3300035410 Bacteria 3985
621 Ga0373931_0000131 3300035691 Bacteria 34406
622 Ga0373931_0005561 3300035691 Bacteria 5841
623 Ga0373931_0011848 3300035691 Bacteria 4216
624 Ga0373931_0063546 3300035691 Unclassified 1995
625 Ga0373935_0000026 3300035692 Bacteria 58851
626 Ga0373927_0006909 3300035695 Bacteria 7711
627 Ga0373927_0023307 3300035695 Bacteria 4054
628 Ga0373927_0042130 3300035695 Bacteria 2959
629 Ga0373927_0069958 3300035695 Bacteria 2271
630 Ga0373933_0001665 3300035724 Bacteria 12922
631 Ga0373933_0011017 3300035724 Bacteria 4967
632 Ga0373947_0004512 3300035725 Bacteria 8165
633 Ga0373947_0016533 3300035725 Bacteria 4239
634 Ga0373947_0054904 3300035725 Bacteria 2405
635 Ga0373937_0002145 3300036401 Bacteria 16512
636 Ga0373937_0003289 3300036401 Bacteria 13564
637 Ga0373937_0005585 3300036401 Bacteria 10787
638 Ga0373937_0011521 3300036401 Bacteria 7761
639 Ga0373937_0030958 3300036401 Bacteria 4845
640 Ga0373937_0075764 3300036401 Bacteria 3107
641 Ga0373937_0213011 3300036401 Bacteria 1818
642 Ga0316584_0011236 3300036712 Bacteria 6285
643 Ga0373925_0000034 3300037068 Bacteria 144257
644 Ga0373925_0001381 3300037068 Bacteria 21133
645 Ga0373925_0006934 3300037068 Bacteria 8288
646 Ga0373925_0007514 3300037068 Bacteria 7944
647 Ga0373925_0027906 3300037068 Bacteria 4133
648 Ga0373925_0036449 3300037068 Bacteria 3630
649 Ga0373925_0080847 3300037068 Bacteria 2471
650 Ga0395899_0078953 3300037312 Bacteria 2398
651 Ga0395899_0141107 3300037312 Bacteria 1714
652 Ga0395900_0007587 3300037418 Bacteria 11203
653 Ga0395900_0023602 3300037418 Bacteria 6292
654 Ga0395900_0093408 3300037418 Bacteria 3090
655 Ga0395898_0006512 3300037466 Bacteria 12478
656 Ga0395898_0028469 3300037466 Bacteria 5597
657 Ga0395898_0061182 3300037466 Bacteria 3658
658 Ga0395898_0108979 3300037466 Bacteria 2655
659 Ga0395898_0175469 3300037466 Bacteria 2048
660 Ga0436364_0308859 3300037853 Bacteria 7431
661 Ga0436364_0631135 3300037853 Bacteria 32086
662 Ga0395901_0005082 3300038443 Bacteria 13285
663 Ga0395901_0010709 3300038443 Bacteria 9296
664 Ga0395901_0018368 3300038443 Bacteria 7139
665 Ga0395901_0173895 3300038443 Bacteria 2259
666 Ga0436365_0174563 3300039437 Bacteria 17649
667 Ga0436365_0231168 3300039437 Bacteria 6346
668 Ga0436365_1231055 3300039437 Bacteria 2961
669 Ga0436361_0164715 3300039447 Bacteria 1770
670 Ga0436361_0377742 3300039447 Bacteria 7150
671 Ga0436363_0874280 3300039450 Bacteria 11837
672 Ga0436362_0837885 3300039453 Bacteria 10424
673 Ga0439441_005457 3300042001 Bacteria 1978
674 Ga0466969_0073136 3300044656 Bacteria 1645
675 Ga0466966_0053978 3300044684 Bacteria 2548
676 Ga0466963_0072116 3300044694 Bacteria 2326
677 Ga0466963_0148797 3300044694 Bacteria 1625
678 Ga0466957_0051372 3300044842 Bacteria 2509
679 Ga0451576_0017698 3300045051 Bacteria 7831
680 Ga0495592_0000031 3300046454 Bacteria 128596
681 Ga0495592_0001425 3300046454 Bacteria 16601
682 Ga0495603_0002046 3300046455 Bacteria 11869
683 Ga0495603_0013789 3300046455 Bacteria 4890
684 Ga0495603_0018444 3300046455 Bacteria 4221
685 Ga0495629_0001317 3300046459 Bacteria 19520
686 Ga0495629_0011658 3300046459 Bacteria 6378
687 Ga0495638_0005408 3300046460 Bacteria 9506
688 Ga0495651_0000200 3300046462 Bacteria 45618
689 Ga0495651_0001028 3300046462 Bacteria 21603
690 Ga0495651_0006877 3300046462 Bacteria 8692
691 Ga0495651_0034700 3300046462 Bacteria 3932
692 Ga0495653_0000012 3300046463 Bacteria 266880
693 Ga0495580_0012176 3300046472 Bacteria 6610
694 Ga0495580_0027217 3300046472 Bacteria 4161
695 Ga0495580_0081889 3300046472 Bacteria 2249
696 Ga0495582_0002161 3300046473 Bacteria 10999
697 Ga0495582_0008114 3300046473 Bacteria 5799
698 Ga0495582_0038565 3300046473 Bacteria 2629
699 Ga0495639_0007711 3300046475 Bacteria 4628
700 Ga0495662_0005794 3300046476 Bacteria 6180
701 Ga0495662_0009602 3300046476 Bacteria 4743
702 Ga0495664_0000004 3300046477 Bacteria 489411
703 Ga0495664_0009525 3300046477 Bacteria 5437
704 Ga0495584_0013764 3300046491 Bacteria 4126
705 Ga0495584_0034654 3300046491 Bacteria 2552
706 Ga0495585_0002983 3300046492 Bacteria 11691
707 Ga0495594_0004109 3300046499 Bacteria 7487
708 Ga0495594_0023399 3300046499 Bacteria 3310
709 Ga0495594_0120822 3300046499 Bacteria 1481
710 Ga0495607_0033049 3300046501 Bacteria 3150
711 Ga0495606_0005478 3300046507 Bacteria 12151
712 Ga0495608_0000005 3300046511 Bacteria 350726
713 Ga0495608_0011395 3300046511 Bacteria 6187
714 Ga0495608_0011757 3300046511 Bacteria 6088
715 Ga0495608_0046951 3300046511 Bacteria 2872
716 Ga0495616_0029782 3300046513 Bacteria 2878
717 Ga0495618_0000024 3300046514 Bacteria 122536
718 Ga0495618_0015603 3300046514 Bacteria 4636
719 Ga0495628_0000001 3300046516 Bacteria 917742
720 Ga0495628_0032380 3300046516 Bacteria 4220
721 Ga0495628_0048931 3300046516 Bacteria 3348
722 Ga0495628_0103738 3300046516 Bacteria 2192
723 Ga0495630_0000433 3300046517 Bacteria 31976
724 Ga0495630_0072327 3300046517 Bacteria 2595
725 Ga0495644_0026755 3300046523 Bacteria 2187
726 Ga0495666_0021525 3300046526 Bacteria 3192
727 Ga0495652_0000002 3300046529 Bacteria 946606
728 Ga0495652_0006243 3300046529 Bacteria 11114
729 Ga0495665_0008064 3300046531 Bacteria 5711
730 Ga0495665_0047533 3300046531 Bacteria 2276
731 Ga0495665_0075077 3300046531 Bacteria 1780
732 Ga0495640_0000001 3300046533 Bacteria 853827
733 Ga0495640_0022609 3300046533 Bacteria 4592
734 Ga0495640_0066862 3300046533 Bacteria 2423
735 Ga0495587_0000016 3300046536 Bacteria 185585
736 Ga0495587_0012035 3300046536 Bacteria 5464
737 Ga0495598_0001760 3300046537 Bacteria 4349
738 Ga0495598_0006198 3300046537 Bacteria 2691
739 Ga0495645_0000002 3300046543 Bacteria 651644
740 Ga0495645_0008421 3300046543 Bacteria 7204
741 Ga0495622_0006154 3300046557 Bacteria 5577
742 Ga0495633_0047131 3300046558 Bacteria 2037
743 Ga0495667_0000007 3300046559 Bacteria 234736
744 Ga0495667_0004749 3300046559 Bacteria 9187
745 Ga0495667_0017859 3300046559 Bacteria 4793
746 Ga0495667_0123335 3300046559 Bacteria 1672
747 Ga0495656_0002224 3300046615 Bacteria 6412
748 Ga0495634_0000637 3300046642 Bacteria 34135
749 Ga0495634_0059015 3300046642 Bacteria 2556
750 Ga0495635_0000002 3300046663 Bacteria 490490
751 Ga0495635_0003581 3300046663 Bacteria 10750
752 Ga0495635_0084095 3300046663 Bacteria 2178
753 Ga0495635_0086692 3300046663 Bacteria 2142
754 Ga0495659_0002344 3300046664 Bacteria 6116
755 Ga0495588_0001979 3300046674 Bacteria 8763
756 Ga0495588_0010900 3300046674 Bacteria 4249
757 Ga0495657_0000628 3300046675 Bacteria 31950
758 Ga0495657_0015907 3300046675 Bacteria 5492
759 Ga0495657_0018234 3300046675 Bacteria 5085
760 Ga0495599_0000005 3300046678 Bacteria 300169
761 Ga0495599_0005324 3300046678 Bacteria 7680
762 Ga0495599_0068953 3300046678 Bacteria 2208
763 Ga0495623_0000016 3300046679 Bacteria 113454
764 Ga0495623_0000554 3300046679 Bacteria 24925
765 Ga0495646_0000002 3300046680 Bacteria 310568
766 Ga0495647_0002658 3300046681 Bacteria 5670
767 Ga0495658_0004985 3300046683 Bacteria 6518
768 Ga0495658_0006650 3300046683 Bacteria 5684
769 Ga0495658_0007896 3300046683 Bacteria 5267
770 Ga0495658_0015425 3300046683 Bacteria 3919
771 Ga0495669_0064220 3300046684 Bacteria 1666
772 Ga0495613_0003637 3300046689 Bacteria 11546
773 Ga0495613_0054770 3300046689 Bacteria 2931
774 Ga0495624_0013261 3300046690 Bacteria 5619
775 Ga0495624_0044384 3300046690 Bacteria 2833
776 Ga0495670_0010273 3300046691 Bacteria 4600
777 Ga0495670_0038246 3300046691 Bacteria 2392
778 Ga0495600_0000018 3300046809 Bacteria 102683
779 Ga0495600_0000989 3300046809 Bacteria 15327
780 Ga0495660_0083899 3300046810 Bacteria 1667
781 Ga0495581_0006932 3300047315 Bacteria 6564
782 Ga0495581_0011122 3300047315 Bacteria 5200
783 Ga0495581_0035026 3300047315 Bacteria 2905
784 Ga0495604_0000020 3300047317 Bacteria 171989
785 Ga0495604_0007911 3300047317 Bacteria 8420
786 Ga0495604_0008426 3300047317 Bacteria 8143
787 Ga0495604_0162420 3300047317 Bacteria 1577
788 Ga0495674_0000002 3300047319 Bacteria 642785
789 Ga0495674_0042306 3300047319 Bacteria 4065
790 Ga0495676_0017061 3300047321 Bacteria 6423
791 Ga0495676_0060276 3300047321 Bacteria 2975
792 Ga0495680_0001158 3300047322 Bacteria 29075
793 Ga0495680_0001832 3300047322 Bacteria 22412
794 Ga0495680_0007696 3300047322 Bacteria 9835
795 Ga0495680_0022544 3300047322 Bacteria 5245
796 Ga0495680_0047732 3300047322 Bacteria 3366
797 Ga0495680_0083674 3300047322 Bacteria 2405
798 Ga0495675_0000284 3300047444 Bacteria 36681
799 Ga0495675_0000625 3300047444 Bacteria 22516
800 Ga0495684_0000017 3300047471 Bacteria 160663
801 Ga0495684_0000517 3300047471 Bacteria 31334
802 Ga0495684_0019009 3300047471 Bacteria 5290
803 Ga0495684_0053566 3300047471 Bacteria 3078
804 Ga0495593_0000759 3300047673 Bacteria 18716
805 Ga0495593_0011494 3300047673 Bacteria 5083
806 Ga0495593_0019161 3300047673 Bacteria 3840
807 Ga0495593_0041222 3300047673 Bacteria 2483
808 Ga0495602_0000040 3300048088 Bacteria 127280
809 Ga0495602_0017182 3300048088 Bacteria 7254
810 Ga0495602_0035207 3300048088 Bacteria 4671
811 Ga0495602_0052529 3300048088 Bacteria 3619
812 Ga0495614_0002673 3300048089 Bacteria 7926
813 Ga0495614_0018347 3300048089 Bacteria 3031
814 Ga0495614_0024776 3300048089 Bacteria 2590
815 Ga0496100_0001217 3300048903 Bacteria 12503
816 Ga0496100_0001822 3300048903 Bacteria 10654
817 Ga0496100_0007937 3300048903 Bacteria 5896
818 Ga0496100_0017190 3300048903 Bacteria 4265
819 Ga0496100_0036333 3300048903 Bacteria 3106
820 Ga0496101_0000800 3300048904 Bacteria 18616
821 Ga0496101_0001253 3300048904 Bacteria 15192
822 Ga0496101_0001810 3300048904 Bacteria 12876
823 Ga0496101_0035739 3300048904 Bacteria 3515
824 Ga0496102_0002101 3300048905 Bacteria 17126
825 Ga0496102_0023824 3300048905 Bacteria 5439
826 Ga0496102_0167895 3300048905 Bacteria 2065
827 Ga0496102_0196536 3300048905 Bacteria 1901
828 Ga0496103_0003368 3300048906 Bacteria 9769
829 Ga0496103_0004504 3300048906 Bacteria 8442
830 Ga0496103_0005932 3300048906 Bacteria 7302
831 Ga0496103_0017251 3300048906 Bacteria 4318
832 Ga0496103_0019471 3300048906 Bacteria 4077
833 Ga0496103_0063198 3300048906 Bacteria 2305
834 Ga0496104_0000055 3300048907 Bacteria 124267
835 Ga0496104_0001184 3300048907 Bacteria 22438
836 Ga0496104_0003351 3300048907 Bacteria 13834
837 Ga0496104_0017343 3300048907 Bacteria 6554
838 Ga0496104_0023547 3300048907 Bacteria 5662
839 Ga0496104_0033443 3300048907 Bacteria 4789
840 Ga0496104_0043386 3300048907 Bacteria 4224
841 Ga0496104_0056436 3300048907 Bacteria 3714
842 Ga0496104_0081672 3300048907 Bacteria 3082
843 Ga0496104_0099014 3300048907 Bacteria 2791
844 Ga0496104_0158430 3300048907 Bacteria 2172
845 Ga0496105_0000918 3300048908 Bacteria 20094
846 Ga0496105_0004894 3300048908 Bacteria 10124
847 Ga0496105_0010872 3300048908 Bacteria 7166
848 Ga0496105_0015814 3300048908 Bacteria 6019
849 Ga0496105_0027859 3300048908 Bacteria 4619
850 Ga0496105_0168117 3300048908 Bacteria 1798
851 Ga0496106_0000317 3300048909 Bacteria 33879
852 Ga0496106_0013398 3300048909 Bacteria 6054
853 Ga0496106_0023257 3300048909 Bacteria 4604
854 Ga0496106_0031823 3300048909 Bacteria 3931
855 Ga0496106_0039870 3300048909 Bacteria 3517
856 Ga0496107_0000272 3300048910 Bacteria 27458
857 Ga0496107_0011403 3300048910 Bacteria 6190
858 Ga0496107_0015091 3300048910 Bacteria 5412
859 Ga0496107_0024456 3300048910 Bacteria 4272
860 Ga0496107_0038665 3300048910 Bacteria 3421
861 Ga0496107_0069882 3300048910 Bacteria 2549
862 Ga0496107_0150840 3300048910 Bacteria 1719
863 Ga0496108_0000333 3300048911 Bacteria 39976
864 Ga0496108_0002477 3300048911 Bacteria 14777
865 Ga0496108_0015151 3300048911 Bacteria 6290
866 Ga0496108_0041814 3300048911 Bacteria 3827
867 Ga0496108_0043056 3300048911 Bacteria 3770
868 Ga0496108_0086804 3300048911 Bacteria 2656
869 Ga0496108_0092288 3300048911 Bacteria 2574
870 Ga0496109_0000812 3300048912 Bacteria 26052
871 Ga0496109_0005773 3300048912 Bacteria 10358
872 Ga0496109_0018601 3300048912 Bacteria 6104
873 Ga0496109_0022601 3300048912 Bacteria 5571
874 Ga0496109_0027809 3300048912 Bacteria 5053
875 Ga0496109_0036508 3300048912 Bacteria 4436
876 Ga0496109_0051967 3300048912 Bacteria 3733
877 Ga0496109_0091894 3300048912 Bacteria 2807
878 Ga0496110_0004023 3300048913 Bacteria 11334
879 Ga0496110_0028476 3300048913 Bacteria 4798
880 Ga0496110_0029025 3300048913 Bacteria 4755
881 Ga0496110_0057529 3300048913 Bacteria 3423
882 Ga0496110_0076083 3300048913 Bacteria 2984
883 Ga0496110_0086278 3300048913 Bacteria 2802
884 Ga0496110_0232298 3300048913 Bacteria 1677
885 Ga0496111_0001052 3300048914 Bacteria 15204
886 Ga0496111_0005383 3300048914 Bacteria 8190
887 Ga0496111_0006334 3300048914 Bacteria 7673
888 Ga0496111_0011787 3300048914 Bacteria 5903
889 Ga0496111_0020826 3300048914 Bacteria 4571
890 Ga0496112_0000838 3300048915 Bacteria 21919
891 Ga0496112_0002948 3300048915 Bacteria 13879
892 Ga0496112_0084814 3300048915 Bacteria 3134
893 Ga0496112_0134520 3300048915 Bacteria 2443
894 Ga0496113_0000693 3300048916 Bacteria 17195
895 Ga0496113_0002078 3300048916 Bacteria 11521
896 Ga0496113_0016912 3300048916 Bacteria 5049
897 Ga0496113_0020421 3300048916 Bacteria 4656
898 Ga0496113_0023896 3300048916 Bacteria 4339
899 Ga0496113_0034483 3300048916 Bacteria 3692
900 Ga0496113_0159288 3300048916 Bacteria 1784
901 Ga0496114_0003697 3300048917 Bacteria 11773
902 Ga0496114_0009608 3300048917 Bacteria 7682
903 Ga0496114_0011582 3300048917 Bacteria 7048
904 Ga0496114_0011924 3300048917 Bacteria 6955
905 Ga0496114_0026852 3300048917 Bacteria 4717
906 Ga0496115_0008581 3300048918 Bacteria 7564
907 Ga0496115_0026529 3300048918 Bacteria 4522
908 Ga0496115_0029394 3300048918 Bacteria 4316
909 Ga0496115_0045335 3300048918 Bacteria 3509
910 Ga0496115_0084107 3300048918 Bacteria 2594
911 Ga0496115_0149071 3300048918 Bacteria 1931
912 Ga0496117_0069747 3300048920 Bacteria 2365
913 Ga0496123_0077248 3300048926 Bacteria 2045
914 Ga0501032_0009993 3300049569 Bacteria 6853
915 Ga0501032_0062656 3300049569 Bacteria 2491
916 Ga0501033_0023629 3300049570 Bacteria 4636
917 Ga0501033_0098467 3300049570 Bacteria 2135
918 Ga0501034_0000197 3300049571 Bacteria 114088
919 Ga0501034_0001247 3300049571 Bacteria 34598
920 Ga0501034_0001484 3300049571 Bacteria 30939
921 Ga0501034_0009010 3300049571 Bacteria 10481
922 Ga0501034_0022549 3300049571 Bacteria 6416
923 Ga0501034_0048161 3300049571 Bacteria 4302
924 Ga0501034_0071341 3300049571 Bacteria 3483
925 Ga0501034_0072575 3300049571 Bacteria 3450
926 Ga0501034_0149834 3300049571 Bacteria 2309
927 Ga0501034_0174344 3300049571 Bacteria 2117
928 Ga0501034_0185427 3300049571 Bacteria 2044
929 Ga0501034_0210554 3300049571 Bacteria 1899
930 Ga0501036_0005919 3300049572 Bacteria 9907
931 Ga0501036_0014217 3300049572 Bacteria 6622
932 Ga0501036_0023090 3300049572 Bacteria 5235
933 Ga0501036_0024606 3300049572 Bacteria 5077
934 Ga0501036_0055574 3300049572 Bacteria 3354
935 Ga0501037_0007042 3300049573 Bacteria 8212
936 Ga0501037_0012566 3300049573 Bacteria 6238
937 Ga0501037_0026037 3300049573 Bacteria 4322
938 Ga0501037_0053216 3300049573 Bacteria 2961
939 Ga0501037_0105255 3300049573 Bacteria 2033
940 Ga0501038_0007088 3300049574 Bacteria 10352
941 Ga0501038_0008817 3300049574 Bacteria 9250
942 Ga0501038_0022499 3300049574 Bacteria 5647
943 Ga0501038_0037071 3300049574 Bacteria 4277
944 Ga0501038_0084138 3300049574 Bacteria 2677
945 Ga0501039_0013196 3300049575 Bacteria 6314
946 Ga0501039_0068437 3300049575 Bacteria 2757
947 Ga0501040_0005271 3300049576 Bacteria 8359
948 Ga0501040_0050270 3300049576 Bacteria 2851
949 Ga0501041_0033375 3300049577 Bacteria 3114
950 Ga0501041_0039968 3300049577 Bacteria 2847
951 Ga0501042_0009123 3300049578 Bacteria 6594
952 Ga0501042_0035498 3300049578 Bacteria 3537
953 Ga0501043_0006297 3300049579 Bacteria 9530
954 Ga0501043_0015583 3300049579 Bacteria 5957
955 Ga0501043_0015624 3300049579 Bacteria 5952
956 Ga0501043_0032179 3300049579 Bacteria 4122
957 Ga0501043_0135173 3300049579 Bacteria 1932
958 Ga0501046_0025250 3300049580 Bacteria 4864
959 Ga0501046_0032639 3300049580 Bacteria 4215
960 Ga0501046_0162587 3300049580 Bacteria 1678
961 Ga0501047_0001499 3300049581 Bacteria 22761
962 Ga0501047_0022488 3300049581 Bacteria 6055
963 Ga0501047_0046860 3300049581 Bacteria 4176
964 Ga0501047_0126099 3300049581 Bacteria 2440
965 Ga0501047_0144977 3300049581 Bacteria 2252
966 Ga0501048_0000856 3300049582 Bacteria 22438
967 Ga0501048_0005853 3300049582 Bacteria 9350
968 Ga0501067_0015236 3300049583 Bacteria 4257
969 Ga0501067_0015989 3300049583 Bacteria 4151
970 Ga0501068_0003005 3300049584 Bacteria 8989
971 Ga0501068_0010125 3300049584 Bacteria 5290
972 Ga0501068_0040713 3300049584 Bacteria 2790
973 Ga0501069_0001041 3300049585 Bacteria 13260
974 Ga0501070_0005480 3300049586 Bacteria 10830
975 Ga0501070_0009844 3300049586 Bacteria 8083
976 Ga0501070_0018733 3300049586 Bacteria 5808
977 Ga0501070_0023917 3300049586 Bacteria 5119
978 Ga0501070_0031183 3300049586 Bacteria 4466
979 Ga0501070_0034636 3300049586 Bacteria 4220
980 Ga0501070_0090512 3300049586 Bacteria 2532
981 Ga0501070_0111438 3300049586 Bacteria 2262
982 Ga0501071_0021040 3300049587 Bacteria 4541
983 Ga0501071_0076439 3300049587 Bacteria 2446
984 Ga0501072_0011866 3300049588 Bacteria 6656
985 Ga0501072_0031660 3300049588 Bacteria 4143
986 Ga0501072_0032646 3300049588 Bacteria 4078
987 Ga0501072_0032742 3300049588 Bacteria 4071
988 Ga0501072_0041202 3300049588 Bacteria 3627
989 Ga0501072_0112278 3300049588 Bacteria 2170
990 Ga0501073_0021662 3300049589 Bacteria 4630
991 Ga0501073_0055594 3300049589 Bacteria 2769
992 Ga0501074_0022407 3300049590 Bacteria 4588
993 Ga0501074_0059241 3300049590 Bacteria 2759
994 Ga0501075_0015464 3300049591 Bacteria 5477
995 Ga0501075_0074712 3300049591 Bacteria 2564
996 Ga0501076_0006991 3300049592 Bacteria 8199
997 Ga0501076_0032446 3300049592 Bacteria 4076
998 Ga0501076_0042538 3300049592 Bacteria 3577
999 Ga0501076_0124488 3300049592 Bacteria 2088
1000 Ga0501077_0022260 3300049593 Bacteria 4015
1001 Ga0501077_0070230 3300049593 Bacteria 2220
1002 Ga0501077_0070722 3300049593 Bacteria 2211
1003 Ga0501079_0013648 3300049741 Bacteria 6195
1004 Ga0501079_0034801 3300049741 Bacteria 3876
1005 Ga0501079_0038466 3300049741 Bacteria 3689
1006 Ga0501079_0063709 3300049741 Bacteria 2844
1007 Ga0501079_0067352 3300049741 Bacteria 2763
1008 Ga0501079_0126523 3300049741 Bacteria 1988
1009 Ga0501080_0053915 3300049742 Bacteria 3745
1010 Ga0501080_0059890 3300049742 Bacteria 3543
1011 Ga0501080_0082526 3300049742 Bacteria 2985
1012 Ga0501080_0084847 3300049742 Bacteria 2943
1013 Ga0501080_0205923 3300049742 Bacteria 1804
1014 Ga0501080_0216580 3300049742 Bacteria 1753
1015 Ga0501081_0006174 3300049743 Bacteria 7760
1016 Ga0501081_0008015 3300049743 Bacteria 6855
1017 Ga0501081_0027992 3300049743 Bacteria 3801
1018 Ga0501081_0038505 3300049743 Bacteria 3267
1019 Ga0501083_0017096 3300049744 Bacteria 5061
1020 Ga0501083_0022117 3300049744 Bacteria 4413
1021 Ga0501083_0064214 3300049744 Bacteria 2447
1022 Ga0501083_0095636 3300049744 Bacteria 1960
1023 Ga0501083_0103568 3300049744 Bacteria 1875
1024 Ga0501035_0003255 3300049822 Bacteria 15561
1025 Ga0501035_0042607 3300049822 Bacteria 4094
1026 Ga0501035_0058650 3300049822 Bacteria 3429
1027 Ga0501035_0081216 3300049822 Bacteria 2861
1028 Ga0501044_0000708 3300049823 Bacteria 40261
1029 Ga0501044_0003448 3300049823 Bacteria 17811
1030 Ga0501044_0023822 3300049823 Bacteria 6506
1031 Ga0501044_0138283 3300049823 Bacteria 2425
1032 Ga0501044_0211490 3300049823 Bacteria 1893
1033 Ga0501044_0229647 3300049823 Bacteria 1804
1034 Ga0501045_0031096 3300049824 Bacteria 3866
1035 Ga0501045_0116135 3300049824 Bacteria 1986
1036 Ga0501045_0164173 3300049824 Bacteria 1653
1037 nmdc:mga03683_8170_c2 3300050489 Bacteria 3085
1038 nmdc:mga00v17_17587_c1 3300050491 Bacteria 4050
1039 nmdc:mga0yw44_24491_c1 3300050492 Bacteria 3416
1040 nmdc:mga0yw44_36543_c1 3300050492 Bacteria 2895
1041 nmdc:mga0yw44_6036_c1 3300050492 Bacteria 5803
1042 nmdc:mga06z11_27068_c1 3300050494 Bacteria 2738
1043 nmdc:mga06z11_56833_c1 3300050494 Bacteria 2025
1044 nmdc:mga07m45_15749_c1 3300050496 Bacteria 4040
1045 nmdc:mga07m45_79108_c1 3300050496 Bacteria 1876
1046 nmdc:mga05p37_178457_c1 3300050507 Bacteria 2586
1047 nmdc:mga05p37_187410_c1 3300050507 Bacteria 2515
1048 nmdc:mga05p37_335814_c1 3300050507 Bacteria 1783
1049 nmdc:mga05p37_39331_c1 3300050507 Bacteria 5806
1050 nmdc:mga05p37_6218_c1 3300050507 Bacteria 14054
1051 nmdc:mga05p37_675_c1 3300050507 Bacteria 37726
1052 nmdc:mga05p37_9875_c1 3300050507 Bacteria 11327
1053 nmdc:mga09592_11427_c1 3300050508 Bacteria 7221
1054 nmdc:mga09592_12884_c1 3300050508 Bacteria 6819
1055 nmdc:mga0qj67_229_c1 3300050509 Bacteria 38215
1056 nmdc:mga0qj67_267_c1 3300050509 Bacteria 35925
1057 nmdc:mga0qj67_41899_c1 3300050509 Bacteria 3603
1058 nmdc:mga0qj67_82604_c1 3300050509 Bacteria 2576
1059 nmdc:mga06r32_122772_c1 3300050510 Bacteria 2563
1060 nmdc:mga06r32_147605_c1 3300050510 Bacteria 2329
1061 nmdc:mga06r32_21208_c1 3300050510 Bacteria 5996
1062 nmdc:mga06r32_36012_c1 3300050510 Bacteria 4673
1063 nmdc:mga06r32_4977_c1 3300050510 Bacteria 11971
1064 nmdc:mga06r32_64_c1 3300050510 Bacteria 67984
1065 nmdc:mga08y16_1152_c1 3300050511 Bacteria 26044
1066 nmdc:mga08y16_148802_c1 3300050511 Bacteria 2434
1067 nmdc:mga08y16_6860_c1 3300050511 Bacteria 11941
1068 nmdc:mga08y16_8101_c1 3300050511 Bacteria 10988
1069 nmdc:mga08y16_906_c1 3300050511 Bacteria 28665
1070 nmdc:mga0n895_14204_c1 3300050512 Bacteria 7222
1071 nmdc:mga0n895_24792_c1 3300050512 Bacteria 5658
1072 nmdc:mga0n895_2947_c1 3300050512 Bacteria 13508
1073 nmdc:mga0n895_3362_c1 3300050512 Bacteria 12865
1074 nmdc:mga0n895_55579_c1 3300050512 Bacteria 3896
1075 nmdc:mga0n895_73_c1 3300050512 Bacteria 57709
1076 nmdc:mga0n895_9100_c1 3300050512 Bacteria 8666
1077 nmdc:mga0rr50_138021_c1 3300050513 Bacteria 1959
1078 nmdc:mga0rr50_747_c1 3300050513 Bacteria 14216
1079 nmdc:mga08x19_66_c1 3300050514 Bacteria 105609
1080 nmdc:mga0a205_16585_c1 3300050515 Bacteria 6900
1081 nmdc:mga0a205_214946_c1 3300050515 Bacteria 1810
1082 nmdc:mga0a205_29219_c1 3300050515 Bacteria 5275
1083 nmdc:mga0a205_30916_c1 3300050515 Bacteria 5129
1084 nmdc:mga0a205_4115_c1 3300050515 Bacteria 13018
1085 nmdc:mga0a205_59_c1 3300050515 Bacteria 60447
1086 nmdc:mga0sz30_3395_c1 3300050516 Bacteria 5732
1087 Ga0495601_0000018 3300053077 Bacteria 171665
1088 Ga0495601_0000357 3300053077 Bacteria 23996
1089 Ga0495601_0000555 3300053077 Bacteria 19790
1090 Ga0495601_0022810 3300053077 Bacteria 3845
1091 Ga0495612_0000011 3300053078 Bacteria 224729
1092 Ga0495612_0000539 3300053078 Bacteria 15250
1093 Ga0495612_0014087 3300053078 Bacteria 3219
1094 Ga0495612_0016752 3300053078 Bacteria 2935
1095 Ga0495612_0027133 3300053078 Bacteria 2302
1096 Ga0495655_0000451 3300053083 Bacteria 6920
1097 Ga0495595_0000016 3300053084 Bacteria 134329
1098 Ga0495595_0000939 3300053084 Bacteria 11212
1099 Ga0495595_0001313 3300053084 Bacteria 9655
1100 Ga0495595_0002410 3300053084 Bacteria 7299
1101 Ga0495595_0019761 3300053084 Bacteria 2926
1102 Ga0495595_0069748 3300053084 Bacteria 1660
1103 Ga0495619_0000014 3300053085 Bacteria 261449
1104 Ga0495619_0000085 3300053085 Bacteria 70073
1105 Ga0495619_0000380 3300053085 Bacteria 30640
1106 Ga0495619_0000636 3300053085 Bacteria 23148
1107 Ga0495619_0002427 3300053085 Bacteria 12237
1108 Ga0495619_0003404 3300053085 Bacteria 10276
1109 Ga0495619_0009386 3300053085 Bacteria 6172
1110 Ga0495619_0064422 3300053085 Bacteria 2443
1111 Ga0500651_0053147 3300053093 Bacteria 2540
1112 Ga0500641_0000932 3300053096 Bacteria 10439
1113 Ga0500641_0002842 3300053096 Bacteria 6135
1114 Ga0500641_0008319 3300053096 Bacteria 3699
1115 Ga0500595_000024 3300053119 Bacteria 144160
1116 Ga0500616_0000458 3300053153 Bacteria 53402
1117 Ga0500645_000874 3300053730 Bacteria 17538
1118 Ga0501084_0038702 3300054114 Bacteria 3987
1119 Ga0501084_0232500 3300054114 Bacteria 1556
1120 Ga0501082_0004773 3300060353 Bacteria 11829
1121 Ga0501082_0011414 3300060353 Bacteria 7644
1122 Ga0501082_0044248 3300060353 Bacteria 3840
1123 Ga0530510_0029715 3300061734 Bacteria 3923
1124 Ga0530510_0036852 3300061734 Bacteria 3524
1125 Ga0530510_0064081 3300061734 Bacteria 2662
1126 Ga0530510_0080846 3300061734 Bacteria 2365
1127 2508729266 2508501050 Bacteria 9633614
1128 2509077924 2508501114 Bacteria 7082538
1129 2513590344 2513237087 Bacteria 5817514
1130 2545673131 2545555834 Bacteria 8130841
1131 2643755202 2643221547 Bacteria 4740017
1132 2644735000 2643221734 Bacteria 5365412
1133 2774870261 2773857925 Bacteria 6472445
1134 2776258787 2775506901 Bacteria 9631051
1135 2819719552 2818991467 Bacteria 5893227
1136 2835312888 2835312727 Bacteria 7413381
1137 2841760930 2841760612 Bacteria 6454112
1138 2844106587 2844104063 Bacteria 6440972
1139 2851183739 2851182111 Bacteria 6047226
1140 2851246943 2851246043 Bacteria 6439203
1141 2882457992 2882456835 Bacteria 6863978
1142 2894242386 2894232714 Bacteria 8834183
1143 2917704791 2917699015 Bacteria 7043791
1144 3003670267 3003665799 Bacteria 7279786
1145 641642265 641522639 Bacteria 7737025
1146 8057530848 8057529695 Bacteria 6306553
1147 Ga0501034_0030744
1148 2214884074
1149 ARcpr5oldR_c000047
1150 ARSoilYngRDRAFT_c00157
1151 ARcpr5yngRDRAFT_c000017
1152 ARSoilOldRDRAFT_c000006
1153 ARCol0oldRDRAFT_c00394
1154 ARCol0yngRDRAFT_1000410
1155 JGI24032J14994_100449
1156 JGI24746J21847_1001205
1157 JGI24739J22299_10012522
1158 JGI24743J22301_10001864
1159 JGI24743J22301_10001874
1160 JGI24750J21931_1000171
1161 JGI24745J21846_1000238
1162 JGI24738J21930_10001962
1163 JGI24749J21850_1000164
1164 JGI24744J21845_10007217
1165 JGI24742J22300_10001863
1166 JGI25153J46596_10003929
1167 Ga0055526_1003135
1168 Ga0055524_1000020
1169 Ga0065165_1000141
1170 Ga0065716_1001609
1171 Ga0065712_10008755
1172 Ga0065712_10073346
1173 Ga0065712_10095088
1174 Ga0065707_10111240
1175 Ga0070658_10001206
1176 Ga0070658_10131161
1177 Ga0070676_10008970
1178 Ga0070676_10056584
1179 Ga0070683_100007236
1180 Ga0070683_100054816
1181 Ga0070683_100139939
1182 Ga0070690_100002695
1183 Ga0070690_100007439
1184 Ga0070670_100023880
1185 Ga0070677_10000354
1186 Ga0070677_10006029
1187 Ga0068869_100000203
1188 Ga0068869_100016314
1189 Ga0070666_10003118
1190 Ga0070666_10045931
1191 Ga0070680_100002314
1192 Ga0070680_100008076
1193 Ga0070680_100018551
1194 Ga0070680_100089192
1195 Ga0070682_100000935
1196 Ga0070682_100048701
1197 Ga0068868_100002681
1198 Ga0068868_100085147
1199 Ga0068868_100086567
1200 Ga0070660_100002042
1201 Ga0070660_100039578
1202 Ga0070689_100010750
1203 Ga0070689_100012497
1204 Ga0070689_100104060
1205 Ga0070691_10000067
1206 Ga0070691_10020556
1207 Ga0070687_100077210
1208 Ga0070661_100001273
1209 Ga0070661_100066329
1210 Ga0070692_10000279
1211 Ga0070692_10011554
1212 Ga0070668_100001472
1213 Ga0070668_100043745
1214 Ga0070668_100076963
1215 Ga0070668_100094048
1216 Ga0070669_100001453
1217 Ga0070669_100177205
1218 Ga0070675_100000701
1219 Ga0070671_100001883
1220 Ga0070671_100047421
1221 Ga0070674_100008500
1222 Ga0070674_100010760
1223 Ga0070673_100000855
1224 Ga0070673_100040814
1225 Ga0070688_100002458
1226 Ga0070688_100005328
1227 Ga0070688_100009226
1228 Ga0070688_100017152
1229 Ga0070659_100002844
1230 Ga0070659_100042026
1231 Ga0070667_100002230
1232 Ga0070667_100045305
1233 Ga0070667_100193441
1234 Ga0070709_10000219
1235 Ga0070709_10010596
1236 Ga0070709_10041879
1237 Ga0070714_100011112
1238 Ga0070714_100024143
1239 Ga0070714_100111314
1240 Ga0070713_100000224
1241 Ga0070713_100054191
1242 Ga0070713_100074935
1243 Ga0070710_10000956
1244 Ga0070701_10000732
1245 Ga0070711_100075313
1246 Ga0070711_100193408
1247 Ga0070705_100002431
1248 Ga0070705_100065255
1249 Ga0070700_100011866
1250 Ga0070700_100026381
1251 Ga0070708_100006477
1252 Ga0070663_100003237
1253 Ga0070663_100079771
1254 Ga0070663_100125422
1255 Ga0070678_100001091
1256 Ga0070678_100020981
1257 Ga0070678_100081860
1258 Ga0070662_100037125
1259 Ga0070681_10006073
1260 Ga0070681_10013953
1261 Ga0070681_10059673
1262 Ga0070681_10085943
1263 Ga0070681_10089352
1264 Ga0070681_10128583
1265 Ga0068867_100000679
1266 Ga0068867_100010686
1267 Ga0068867_100131739
1268 Ga0070685_10001017
1269 Ga0070706_100034715
1270 Ga0070698_100001178
1271 Ga0070699_100014629
1272 Ga0070679_100002677
1273 Ga0070679_100072165
1274 Ga0070679_100179538
1275 Ga0070684_100000693
1276 Ga0070684_100078587
1277 Ga0070684_100141498
1278 Ga0070684_100160910
1279 Ga0070697_100104754
1280 Ga0070672_100004245
1281 Ga0070672_100021286
1282 Ga0070672_100050976
1283 Ga0070672_100096548
1284 Ga0070686_100001302
1285 Ga0070686_100002564
1286 Ga0070686_100007632
1287 Ga0070686_100028997
1288 Ga0070695_100002461
1289 Ga0070695_100009173
1290 Ga0070696_100001783
1291 Ga0070696_100007358
1292 Ga0070696_100057982
1293 Ga0070693_100001926
1294 Ga0070693_100047279
1295 Ga0070665_100042474
1296 Ga0070704_100031373
1297 Ga0068855_100010931
1298 Ga0068855_100077988
1299 Ga0068855_100163518
1300 Ga0070664_100006539
1301 Ga0070664_100117084
1302 Ga0068857_100000534
1303 Ga0068857_100025817
1304 Ga0068857_100054713
1305 Ga0068854_100003403
1306 Ga0068854_100073166
1307 Ga0068854_100148241
1308 Ga0068856_100008075
1309 Ga0068856_100157777
1310 Ga0070702_100001579
1311 Ga0070702_100020797
1312 Ga0070702_100037145
1313 Ga0068852_100003393
1314 Ga0068852_100014120
1315 Ga0068852_100041022
1316 Ga0068852_100072068
1317 Ga0068859_100003965
1318 Ga0068859_100031525
1319 Ga0068859_100037505
1320 Ga0068859_100067082
1321 Ga0068864_100004544
1322 Ga0068864_100013878
1323 Ga0068864_100083229
1324 Ga0068866_10000252
1325 Ga0068861_100001032
1326 Ga0068861_100071527
1327 Ga0068870_10013347
1328 Ga0068863_100000150
1329 Ga0068863_100084827
1330 Ga0068863_100093117
1331 Ga0068863_100177821
1332 Ga0068858_100003904
1333 Ga0068858_100013222
1334 Ga0068858_100019307
1335 Ga0068858_100212920
1336 Ga0068860_100003148
1337 Ga0068860_100049421
1338 Ga0068862_100006993
1339 Ga0068862_100009738
1340 Ga0081455_10000185
1341 Ga0081455_10002539
1342 Ga0081455_10003484
1343 Ga0081455_10005197
1344 Ga0081455_10011999
1345 Ga0081455_10017717
1346 Ga0081538_10000638
1347 Ga0081538_10017029
1348 Ga0081538_10065488
1349 Ga0081538_10071988
1350 Ga0081540_1000925
1351 Ga0081540_1004357
1352 Ga0081540_1081091
1353 Ga0081539_10002542
1354 Ga0081539_10002695
1355 Ga0070717_10000285
1356 Ga0070717_10026319
1357 Ga0075365_10039163
1358 Ga0075364_10029445
1359 Ga0075432_10000240
1360 Ga0070715_10001307
1361 Ga0070716_100011132
1362 Ga0070716_100023971
1363 Ga0070712_100020468
1364 Ga0070712_100054255
1365 Ga0075362_10014565
1366 Ga0075362_10019606
1367 Ga0075367_10012684
1368 Ga0075367_10088361
1369 Ga0097621_100000544
1370 Ga0097621_100004712
1371 Ga0097621_100025145
1372 Ga0075370_10009286
1373 Ga0075370_10064015
1374 Ga0068871_100001366
1375 Ga0068871_100003497
1376 Ga0068871_100174820
1377 Ga0075428_100000205
1378 Ga0075428_100019769
1379 Ga0075428_100082405
1380 Ga0075428_100102778
1381 Ga0075428_100201860
1382 Ga0075430_100000012
1383 Ga0075430_100004858
1384 Ga0075430_100068023
1385 Ga0075431_100000266
1386 Ga0075431_100005460
1387 Ga0075431_100014481
1388 Ga0075431_100022527
1389 Ga0075431_100072901
1390 Ga0075431_100098627
1391 Ga0075431_100248972
1392 Ga0075433_10000338
1393 Ga0075433_10004462
1394 Ga0075433_10012596
1395 Ga0075433_10080536
1396 Ga0075434_100000373
1397 Ga0075434_100009082
1398 Ga0075434_100009842
1399 Ga0075434_100012045
1400 Ga0075434_100027939
1401 Ga0075434_100133652
1402 Ga0075429_100002160
1403 Ga0075429_100022260
1404 Ga0075429_100160193
1405 Ga0068865_100000190
1406 Ga0068865_100044980
1407 Ga0068865_100168964
1408 Ga0075436_100000443
1409 Ga0097620_100003965
1410 Ga0097620_100031525
1411 Ga0097620_100037508
1412 Ga0097620_100067084
1413 Ga0075435_100013108
1414 Ga0075435_100134915
1415 Ga0075435_100173393
1416 Ga0099794_10007253
1417 Ga0105250_10010395
1418 Ga0105250_10023450
1419 Ga0105240_10003481
1420 Ga0105240_10070736
1421 Ga0105240_10160426
1422 Ga0111539_10000299
1423 Ga0111539_10005091
1424 Ga0111539_10005821
1425 Ga0111539_10025137
1426 Ga0111539_10080025
1427 Ga0111539_10179589
1428 Ga0105245_10000543
1429 Ga0105245_10017080
1430 Ga0105245_10178269
1431 Ga0105247_10026146
1432 Ga0105247_10034263
1433 Ga0105247_10104703
1434 Ga0114129_10000640
1435 Ga0114129_10016895
1436 Ga0114129_10019077
1437 Ga0114129_10106391
1438 Ga0105243_10014840
1439 Ga0105243_10020519
1440 Ga0105243_10216149
1441 Ga0105241_10002875
1442 Ga0105241_10016416
1443 Ga0105241_10045570
1444 Ga0105242_10001766
1445 Ga0105242_10004776
1446 Ga0105242_10020801
1447 Ga0105248_10000501
1448 Ga0105248_10010945
1449 Ga0105248_10017190
1450 Ga0105248_10040194
1451 Ga0105248_10095011
1452 Ga0105238_10024549
1453 Ga0105238_10116235
1454 Ga0105249_10006521
1455 Ga0105239_10005329
1456 Ga0105239_10019260
1457 Ga0105239_10035309
1458 Ga0105239_10110589
1459 Ga0105239_10127527
1460 Ga0105246_10009901
1461 Ga0105246_10064351
1462 Ga0105246_10082067
1463 Ga0157373_10060401
1464 Ga0157371_10042393
1465 Ga0157370_10026677
1466 Ga0157370_10030889
1467 Ga0157369_10048634
1468 Ga0157369_10232379
1469 Ga0171462_1032
1470 Ga0157374_10013556
1471 Ga0157374_10067536
1472 Ga0157378_10003057
1473 Ga0163162_10004207
1474 Ga0163162_10083860
1475 Ga0163162_10236195
1476 Ga0157372_10028637
1477 Ga0157375_10002141
1478 Ga0157375_10009534
1479 Ga0157375_10011822
1480 Ga0157375_10289737
1481 Ga0163163_10003931
1482 Ga0163163_10010114
1483 Ga0163163_10187720
1484 Ga0157380_10000049
1485 Ga0157380_10117233
1486 Ga0182008_10048537
1487 Ga0157377_10002000
1488 Ga0157377_10013212
1489 Ga0157379_10035738
1490 Ga0157379_10080671
1491 Ga0157376_10000099
1492 Ga0157376_10148915
1493 Ga0163161_10000081
1494 Ga0163161_10075725
1495 Ga0163161_10140989
1496 Ga0213876_10001399
1497 Ga0213876_10070589
1498 Ga0213875_10004329
1499 Ga0209233_1012396
1500 Ga0207666_1000167
1501 Ga0209130_1000178
1502 Ga0207673_1000367
1503 Ga0209675_1000692
1504 Ga0209025_1000008
1505 Ga0209025_1002015
1506 Ga0209564_1000049
1507 Ga0209758_1007060
1508 Ga0209256_1000014
1509 Ga0209256_1000200
1510 Ga0207426_1023081
1511 Ga0207653_10000843
1512 Ga0207682_10000046
1513 Ga0207682_10000637
1514 Ga0207692_10000988
1515 Ga0207642_10001252
1516 Ga0207710_10000850
1517 Ga0207710_10009377
1518 Ga0207710_10010799
1519 Ga0207688_10001056
1520 Ga0207688_10001343
1521 Ga0207680_10002036
1522 Ga0207680_10007258
1523 Ga0207680_10048876
1524 Ga0207647_10007296
1525 Ga0207647_10079370
1526 Ga0207685_10002344
1527 Ga0207685_10014730
1528 Ga0207699_10000312
1529 Ga0207699_10037876
1530 Ga0207645_10000162
1531 Ga0207645_10037726
1532 Ga0207643_10000025
1533 Ga0207643_10001138
1534 Ga0207654_10001641
1535 Ga0207654_10033211
1536 Ga0207707_10002255
1537 Ga0207707_10010884
1538 Ga0207707_10012619
1539 Ga0207707_10073899
1540 Ga0207707_10149927
1541 Ga0207671_10010591
1542 Ga0207693_10006436
1543 Ga0207693_10036605
1544 Ga0207693_10039616
1545 Ga0207693_10040965
1546 Ga0207663_10050345
1547 Ga0207663_10076825
1548 Ga0207660_10001243
1549 Ga0207662_10016220
1550 Ga0207662_10016564
1551 Ga0207662_10107287
1552 Ga0207657_10039151
1553 Ga0207649_10000048
1554 Ga0207652_10003743
1555 Ga0207652_10019346
1556 Ga0207652_10023862
1557 Ga0207652_10042464
1558 Ga0207652_10081384
1559 Ga0207681_10000131
1560 Ga0207694_10057921
1561 Ga0207650_10002321
1562 Ga0207650_10053527
1563 Ga0207650_10140014
1564 Ga0207659_10000040
1565 Ga0207659_10048887
1566 Ga0207659_10117466
1567 Ga0207687_10000090
1568 Ga0207687_10007813
1569 Ga0207700_10000231
1570 Ga0207700_10040992
1571 Ga0207700_10080333
1572 Ga0207700_10139355
1573 Ga0207664_10026272
1574 Ga0207664_10182187
1575 Ga0207644_10000473
1576 Ga0207644_10007385
1577 Ga0207690_10000173
1578 Ga0207706_10005557
1579 Ga0207706_10048639
1580 Ga0207706_10060198
1581 Ga0207686_10002985
1582 Ga0207686_10003177
1583 Ga0207686_10025401
1584 Ga0207709_10000585
1585 Ga0207709_10064941
1586 Ga0207670_10002222
1587 Ga0207670_10002465
1588 Ga0207670_10076952
1589 Ga0207669_10000102
1590 Ga0207669_10004690
1591 Ga0207704_10000097
1592 Ga0207704_10006584
1593 Ga0207704_10012115
1594 Ga0207665_10000487
1595 Ga0207665_10000745
1596 Ga0207665_10049274
1597 Ga0207691_10001237
1598 Ga0207691_10007973
1599 Ga0207691_10012219
1600 Ga0207711_10000847
1601 Ga0207711_10001975
1602 Ga0207711_10057697
1603 Ga0207711_10189442
1604 Ga0207689_10000677
1605 Ga0207689_10003052
1606 Ga0207689_10004233
1607 Ga0207689_10052095
1608 Ga0207661_10000204
1609 Ga0207661_10111725
1610 Ga0207679_10000090
1611 Ga0207667_10018822
1612 Ga0207667_10098381
1613 Ga0207667_10122143
1614 Ga0207667_10267315
1615 Ga0207651_10000017
1616 Ga0207651_10017251
1617 Ga0207712_10000114
1618 Ga0207712_10009218
1619 Ga0207712_10067021
1620 Ga0207668_10000139
1621 Ga0207668_10011937
1622 Ga0207668_10016242
1623 Ga0207668_10084432
1624 Ga0207640_10000221
1625 Ga0207640_10109641
1626 Ga0207640_10115559
1627 Ga0207658_10001766
1628 Ga0207658_10024367
1629 Ga0207658_10062170
1630 Ga0207658_10080747
1631 Ga0207658_10138949
1632 Ga0207658_10174420
1633 Ga0207677_10023458
1634 Ga0207677_10044776
1635 Ga0207703_10001230
1636 Ga0207703_10006478
1637 Ga0207703_10011650
1638 Ga0207703_10165148
1639 Ga0207703_10180100
1640 Ga0207639_10001275
1641 Ga0207678_10010483
1642 Ga0207708_10001855
1643 Ga0207708_10040517
1644 Ga0207708_10133814
1645 Ga0207702_10000198
1646 Ga0207641_10000417
1647 Ga0207641_10044363
1648 Ga0207641_10240009
1649 Ga0207648_10000483
1650 Ga0207648_10015227
1651 Ga0207648_10027045
1652 Ga0207648_10098232
1653 Ga0207676_10000372
1654 Ga0207676_10001984
1655 Ga0207676_10015557
1656 Ga0207674_10009004
1657 Ga0207674_10035884
1658 Ga0207674_10116617
1659 Ga0207675_100005906
1660 Ga0207675_100053176
1661 Ga0207683_10000141
1662 Ga0207683_10003008
1663 Ga0207683_10007416
1664 Ga0207683_10024647
1665 Ga0207683_10026401
1666 Ga0207683_10045434
1667 Ga0207698_10005863
1668 Ga0207698_10270873
1669 Ga0207698_10277801
1670 Ga0209971_1002132
1671 Ga0209998_10007120
1672 Ga0209998_10008001
1673 Ga0209974_10042219
1674 Ga0207428_10000058
1675 Ga0207428_10001115
1676 Ga0207428_10002874
1677 Ga0268266_10002234
1678 Ga0268266_10024665
1679 Ga0268266_10028466
1680 Ga0268265_10003432
1681 Ga0268265_10043620
1682 Ga0268265_10226512
1683 Ga0268264_10000412
1684 Ga0265337_1010903
1685 Ga0265330_10036549
1686 Ga0265332_10000849
1687 Ga0265325_10000036
1688 Ga0265325_10000464
1689 Ga0265325_10007651
1690 Ga0265325_10047190
1691 Ga0265340_10004313
1692 Ga0265340_10038095
1693 Ga0265339_10001612
1694 Ga0265339_10004115
1695 Ga0265339_10007937
1696 Ga0265331_10014085
1697 Ga0265331_10018026
1698 Ga0265316_10028221
1699 Ga0265316_10118153
1700 Ga0265313_10000513
1701 Ga0265313_10001147
1702 Ga0265313_10001570
1703 Ga0265313_10003857
1704 Ga0265313_10013620
1705 Ga0265313_10026302
1706 Ga0265313_10066220
1707 Ga0265314_10007314
1708 Ga0265314_10024700
1709 Ga0265314_10034461
1710 Ga0265314_10120567
1711 Ga0265342_10000360
1712 Ga0265342_10002687
1713 Ga0265342_10010083
1714 Ga0265342_10017720
1715 Ga0265342_10030918
1716 Ga0265342_10049630
1717 Ga0307411_10103866
1718 Ga0373930_0000011
1719 Ga0373948_0000241
1720 Ga0373950_0002353
1721 Ga0373958_0000313
1722 Ga0373959_0005453
1723 Ga0373938_0000404
1724 Ga0373926_0013686
1725 Ga0373926_0017166
1726 Ga0373928_0000880
1727 Ga0373929_0000816
1728 Ga0373940_0000619
1729 Ga0373944_0010711
1730 Ga0373951_0000312
1731 Ga0373951_0006275
1732 Ga0373952_0000253
1733 Ga0373952_0003999
1734 Ga0373923_0015576
1735 Ga0373923_0054353
1736 Ga0373932_0001887
1737 Ga0373932_0008193
1738 Ga0373932_0008544
1739 Ga0373936_0048268
1740 Ga0373939_0000502
1741 Ga0373939_0000832
1742 Ga0373939_0002168
1743 Ga0373941_0000330
1744 Ga0373945_0004542
1745 Ga0373945_0007082
1746 Ga0373945_0010369
1747 Ga0373953_0017789
1748 Ga0373953_0025159
1749 Ga0373954_0000753
1750 Ga0373956_0001330
1751 Ga0373956_0015305
1752 Ga0373957_0006863
1753 Ga0373957_0008264
1754 Ga0373960_0000137
1755 Ga0373943_0003107
1756 Ga0373946_0001852
1757 Ga0373946_0002090
1758 Ga0373946_0013540
1759 Ga0373946_0023809
1760 Ga0373955_0000158
1761 Ga0373955_0002098
1762 Ga0373961_0000492
1763 Ga0373961_0003857
1764 Ga0373962_0000279
1765 Ga0316574_0023419
1766 Ga0373924_0007302
1767 Ga0373931_0000131
1768 Ga0373931_0005561
1769 Ga0373931_0011848
1770 Ga0373931_0063546
1771 Ga0373935_0000026
1772 Ga0373927_0006909
1773 Ga0373927_0023307
1774 Ga0373927_0042130
1775 Ga0373927_0069958
1776 Ga0373933_0001665
1777 Ga0373933_0011017
1778 Ga0373947_0004512
1779 Ga0373947_0016533
1780 Ga0373947_0054904
1781 Ga0373937_0002145
1782 Ga0373937_0003289
1783 Ga0373937_0005585
1784 Ga0373937_0011521
1785 Ga0373937_0030958
1786 Ga0373937_0075764
1787 Ga0373937_0213011
1788 Ga0316584_0011236
1789 Ga0373925_0000034
1790 Ga0373925_0001381
1791 Ga0373925_0006934
1792 Ga0373925_0007514
1793 Ga0373925_0027906
1794 Ga0373925_0036449
1795 Ga0373925_0080847
1796 Ga0395899_0078953
1797 Ga0395899_0141107
1798 Ga0395900_0007587
1799 Ga0395900_0023602
1800 Ga0395900_0093408
1801 Ga0395898_0006512
1802 Ga0395898_0028469
1803 Ga0395898_0061182
1804 Ga0395898_0108979
1805 Ga0395898_0175469
1806 Ga0436364_0308859
1807 Ga0436364_0631135
1808 Ga0395901_0005082
1809 Ga0395901_0010709
1810 Ga0395901_0018368
1811 Ga0395901_0173895
1812 Ga0436365_0174563
1813 Ga0436365_0231168
1814 Ga0436365_1231055
1815 Ga0436361_0164715
1816 Ga0436361_0377742
1817 Ga0436363_0874280
1818 Ga0436362_0837885
1819 Ga0439441_005457
1820 Ga0466969_0073136
1821 Ga0466966_0053978
1822 Ga0466963_0072116
1823 Ga0466963_0148797
1824 Ga0466957_0051372
1825 Ga0451576_0017698
1826 Ga0495592_0000031
1827 Ga0495592_0001425
1828 Ga0495603_0002046
1829 Ga0495603_0013789
1830 Ga0495603_0018444
1831 Ga0495629_0001317
1832 Ga0495629_0011658
1833 Ga0495638_0005408
1834 Ga0495651_0000200
1835 Ga0495651_0001028
1836 Ga0495651_0006877
1837 Ga0495651_0034700
1838 Ga0495653_0000012
1839 Ga0495580_0012176
1840 Ga0495580_0027217
1841 Ga0495580_0081889
1842 Ga0495582_0002161
1843 Ga0495582_0008114
1844 Ga0495582_0038565
1845 Ga0495639_0007711
1846 Ga0495662_0005794
1847 Ga0495662_0009602
1848 Ga0495664_0000004
1849 Ga0495664_0009525
1850 Ga0495584_0013764
1851 Ga0495584_0034654
1852 Ga0495585_0002983
1853 Ga0495594_0004109
1854 Ga0495594_0023399
1855 Ga0495594_0120822
1856 Ga0495607_0033049
1857 Ga0495606_0005478
1858 Ga0495608_0000005
1859 Ga0495608_0011395
1860 Ga0495608_0011757
1861 Ga0495608_0046951
1862 Ga0495616_0029782
1863 Ga0495618_0000024
1864 Ga0495618_0015603
1865 Ga0495628_0000001
1866 Ga0495628_0032380
1867 Ga0495628_0048931
1868 Ga0495628_0103738
1869 Ga0495630_0000433
1870 Ga0495630_0072327
1871 Ga0495644_0026755
1872 Ga0495666_0021525
1873 Ga0495652_0000002
1874 Ga0495652_0006243
1875 Ga0495665_0008064
1876 Ga0495665_0047533
1877 Ga0495665_0075077
1878 Ga0495640_0000001
1879 Ga0495640_0022609
1880 Ga0495640_0066862
1881 Ga0495587_0000016
1882 Ga0495587_0012035
1883 Ga0495598_0001760
1884 Ga0495598_0006198
1885 Ga0495645_0000002
1886 Ga0495645_0008421
1887 Ga0495622_0006154
1888 Ga0495633_0047131
1889 Ga0495667_0000007
1890 Ga0495667_0004749
1891 Ga0495667_0017859
1892 Ga0495667_0123335
1893 Ga0495656_0002224
1894 Ga0495634_0000637
1895 Ga0495634_0059015
1896 Ga0495635_0000002
1897 Ga0495635_0003581
1898 Ga0495635_0084095
1899 Ga0495635_0086692
1900 Ga0495659_0002344
1901 Ga0495588_0001979
1902 Ga0495588_0010900
1903 Ga0495657_0000628
1904 Ga0495657_0015907
1905 Ga0495657_0018234
1906 Ga0495599_0000005
1907 Ga0495599_0005324
1908 Ga0495599_0068953
1909 Ga0495623_0000016
1910 Ga0495623_0000554
1911 Ga0495646_0000002
1912 Ga0495647_0002658
1913 Ga0495658_0004985
1914 Ga0495658_0006650
1915 Ga0495658_0007896
1916 Ga0495658_0015425
1917 Ga0495669_0064220
1918 Ga0495613_0003637
1919 Ga0495613_0054770
1920 Ga0495624_0013261
1921 Ga0495624_0044384
1922 Ga0495670_0010273
1923 Ga0495670_0038246
1924 Ga0495600_0000018
1925 Ga0495600_0000989
1926 Ga0495660_0083899
1927 Ga0495581_0006932
1928 Ga0495581_0011122
1929 Ga0495581_0035026
1930 Ga0495604_0000020
1931 Ga0495604_0007911
1932 Ga0495604_0008426
1933 Ga0495604_0162420
1934 Ga0495674_0000002
1935 Ga0495674_0042306
1936 Ga0495676_0017061
1937 Ga0495676_0060276
1938 Ga0495680_0001158
1939 Ga0495680_0001832
1940 Ga0495680_0007696
1941 Ga0495680_0022544
1942 Ga0495680_0047732
1943 Ga0495680_0083674
1944 Ga0495675_0000284
1945 Ga0495675_0000625
1946 Ga0495684_0000017
1947 Ga0495684_0000517
1948 Ga0495684_0019009
1949 Ga0495684_0053566
1950 Ga0495593_0000759
1951 Ga0495593_0011494
1952 Ga0495593_0019161
1953 Ga0495593_0041222
1954 Ga0495602_0000040
1955 Ga0495602_0017182
1956 Ga0495602_0035207
1957 Ga0495602_0052529
1958 Ga0495614_0002673
1959 Ga0495614_0018347
1960 Ga0495614_0024776
1961 Ga0496100_0001217
1962 Ga0496100_0001822
1963 Ga0496100_0007937
1964 Ga0496100_0017190
1965 Ga0496100_0036333
1966 Ga0496101_0000800
1967 Ga0496101_0001253
1968 Ga0496101_0001810
1969 Ga0496101_0035739
1970 Ga0496102_0002101
1971 Ga0496102_0023824
1972 Ga0496102_0167895
1973 Ga0496102_0196536
1974 Ga0496103_0003368
1975 Ga0496103_0004504
1976 Ga0496103_0005932
1977 Ga0496103_0017251
1978 Ga0496103_0019471
1979 Ga0496103_0063198
1980 Ga0496104_0000055
1981 Ga0496104_0001184
1982 Ga0496104_0003351
1983 Ga0496104_0017343
1984 Ga0496104_0023547
1985 Ga0496104_0033443
1986 Ga0496104_0043386
1987 Ga0496104_0056436
1988 Ga0496104_0081672
1989 Ga0496104_0099014
1990 Ga0496104_0158430
1991 Ga0496105_0000918
1992 Ga0496105_0004894
1993 Ga0496105_0010872
1994 Ga0496105_0015814
1995 Ga0496105_0027859
1996 Ga0496105_0168117
1997 Ga0496106_0000317
1998 Ga0496106_0013398
1999 Ga0496106_0023257
2000 Ga0496106_0031823
2001 Ga0496106_0039870
2002 Ga0496107_0000272
2003 Ga0496107_0011403
2004 Ga0496107_0015091
2005 Ga0496107_0024456
2006 Ga0496107_0038665
2007 Ga0496107_0069882
2008 Ga0496107_0150840
2009 Ga0496108_0000333
2010 Ga0496108_0002477
2011 Ga0496108_0015151
2012 Ga0496108_0041814
2013 Ga0496108_0043056
2014 Ga0496108_0086804
2015 Ga0496108_0092288
2016 Ga0496109_0000812
2017 Ga0496109_0005773
2018 Ga0496109_0018601
2019 Ga0496109_0022601
2020 Ga0496109_0027809
2021 Ga0496109_0036508
2022 Ga0496109_0051967
2023 Ga0496109_0091894
2024 Ga0496110_0004023
2025 Ga0496110_0028476
2026 Ga0496110_0029025
2027 Ga0496110_0057529
2028 Ga0496110_0076083
2029 Ga0496110_0086278
2030 Ga0496110_0232298
2031 Ga0496111_0001052
2032 Ga0496111_0005383
2033 Ga0496111_0006334
2034 Ga0496111_0011787
2035 Ga0496111_0020826
2036 Ga0496112_0000838
2037 Ga0496112_0002948
2038 Ga0496112_0084814
2039 Ga0496112_0134520
2040 Ga0496113_0000693
2041 Ga0496113_0002078
2042 Ga0496113_0016912
2043 Ga0496113_0020421
2044 Ga0496113_0023896
2045 Ga0496113_0034483
2046 Ga0496113_0159288
2047 Ga0496114_0003697
2048 Ga0496114_0009608
2049 Ga0496114_0011582
2050 Ga0496114_0011924
2051 Ga0496114_0026852
2052 Ga0496115_0008581
2053 Ga0496115_0026529
2054 Ga0496115_0029394
2055 Ga0496115_0045335
2056 Ga0496115_0084107
2057 Ga0496115_0149071
2058 Ga0496117_0069747
2059 Ga0496123_0077248
2060 Ga0501032_0009993
2061 Ga0501032_0062656
2062 Ga0501033_0023629
2063 Ga0501033_0098467
2064 Ga0501034_0000197
2065 Ga0501034_0001247
2066 Ga0501034_0001484
2067 Ga0501034_0009010
2068 Ga0501034_0022549
2069 Ga0501034_0048161
2070 Ga0501034_0071341
2071 Ga0501034_0072575
2072 Ga0501034_0149834
2073 Ga0501034_0174344
2074 Ga0501034_0185427
2075 Ga0501034_0210554
2076 Ga0501036_0005919
2077 Ga0501036_0014217
2078 Ga0501036_0023090
2079 Ga0501036_0024606
2080 Ga0501036_0055574
2081 Ga0501037_0007042
2082 Ga0501037_0012566
2083 Ga0501037_0026037
2084 Ga0501037_0053216
2085 Ga0501037_0105255
2086 Ga0501038_0007088
2087 Ga0501038_0008817
2088 Ga0501038_0022499
2089 Ga0501038_0037071
2090 Ga0501038_0084138
2091 Ga0501039_0013196
2092 Ga0501039_0068437
2093 Ga0501040_0005271
2094 Ga0501040_0050270
2095 Ga0501041_0033375
2096 Ga0501041_0039968
2097 Ga0501042_0009123
2098 Ga0501042_0035498
2099 Ga0501043_0006297
2100 Ga0501043_0015583
2101 Ga0501043_0015624
2102 Ga0501043_0032179
2103 Ga0501043_0135173
2104 Ga0501046_0025250
2105 Ga0501046_0032639
2106 Ga0501046_0162587
2107 Ga0501047_0001499
2108 Ga0501047_0022488
2109 Ga0501047_0046860
2110 Ga0501047_0126099
2111 Ga0501047_0144977
2112 Ga0501048_0000856
2113 Ga0501048_0005853
2114 Ga0501067_0015236
2115 Ga0501067_0015989
2116 Ga0501068_0003005
2117 Ga0501068_0010125
2118 Ga0501068_0040713
2119 Ga0501069_0001041
2120 Ga0501070_0005480
2121 Ga0501070_0009844
2122 Ga0501070_0018733
2123 Ga0501070_0023917
2124 Ga0501070_0031183
2125 Ga0501070_0034636
2126 Ga0501070_0090512
2127 Ga0501070_0111438
2128 Ga0501071_0021040
2129 Ga0501071_0076439
2130 Ga0501072_0011866
2131 Ga0501072_0031660
2132 Ga0501072_0032646
2133 Ga0501072_0032742
2134 Ga0501072_0041202
2135 Ga0501072_0112278
2136 Ga0501073_0021662
2137 Ga0501073_0055594
2138 Ga0501074_0022407
2139 Ga0501074_0059241
2140 Ga0501075_0015464
2141 Ga0501075_0074712
2142 Ga0501076_0006991
2143 Ga0501076_0032446
2144 Ga0501076_0042538
2145 Ga0501076_0124488
2146 Ga0501077_0022260
2147 Ga0501077_0070230
2148 Ga0501077_0070722
2149 Ga0501079_0013648
2150 Ga0501079_0034801
2151 Ga0501079_0038466
2152 Ga0501079_0063709
2153 Ga0501079_0067352
2154 Ga0501079_0126523
2155 Ga0501080_0053915
2156 Ga0501080_0059890
2157 Ga0501080_0082526
2158 Ga0501080_0084847
2159 Ga0501080_0205923
2160 Ga0501080_0216580
2161 Ga0501081_0006174
2162 Ga0501081_0008015
2163 Ga0501081_0027992
2164 Ga0501081_0038505
2165 Ga0501083_0017096
2166 Ga0501083_0022117
2167 Ga0501083_0064214
2168 Ga0501083_0095636
2169 Ga0501083_0103568
2170 Ga0501035_0003255
2171 Ga0501035_0042607
2172 Ga0501035_0058650
2173 Ga0501035_0081216
2174 Ga0501044_0000708
2175 Ga0501044_0003448
2176 Ga0501044_0023822
2177 Ga0501044_0138283
2178 Ga0501044_0211490
2179 Ga0501044_0229647
2180 Ga0501045_0031096
2181 Ga0501045_0116135
2182 Ga0501045_0164173
2183 nmdc:mga03683_8170_c2
2184 nmdc:mga00v17_17587_c1
2185 nmdc:mga0yw44_24491_c1
2186 nmdc:mga0yw44_36543_c1
2187 nmdc:mga0yw44_6036_c1
2188 nmdc:mga06z11_27068_c1
2189 nmdc:mga06z11_56833_c1
2190 nmdc:mga07m45_15749_c1
2191 nmdc:mga07m45_79108_c1
2192 nmdc:mga05p37_178457_c1
2193 nmdc:mga05p37_187410_c1
2194 nmdc:mga05p37_335814_c1
2195 nmdc:mga05p37_39331_c1
2196 nmdc:mga05p37_6218_c1
2197 nmdc:mga05p37_675_c1
2198 nmdc:mga05p37_9875_c1
2199 nmdc:mga09592_11427_c1
2200 nmdc:mga09592_12884_c1
2201 nmdc:mga0qj67_229_c1
2202 nmdc:mga0qj67_267_c1
2203 nmdc:mga0qj67_41899_c1
2204 nmdc:mga0qj67_82604_c1
2205 nmdc:mga06r32_122772_c1
2206 nmdc:mga06r32_147605_c1
2207 nmdc:mga06r32_21208_c1
2208 nmdc:mga06r32_36012_c1
2209 nmdc:mga06r32_4977_c1
2210 nmdc:mga06r32_64_c1
2211 nmdc:mga08y16_1152_c1
2212 nmdc:mga08y16_148802_c1
2213 nmdc:mga08y16_6860_c1
2214 nmdc:mga08y16_8101_c1
2215 nmdc:mga08y16_906_c1
2216 nmdc:mga0n895_14204_c1
2217 nmdc:mga0n895_24792_c1
2218 nmdc:mga0n895_2947_c1
2219 nmdc:mga0n895_3362_c1
2220 nmdc:mga0n895_55579_c1
2221 nmdc:mga0n895_73_c1
2222 nmdc:mga0n895_9100_c1
2223 nmdc:mga0rr50_138021_c1
2224 nmdc:mga0rr50_747_c1
2225 nmdc:mga08x19_66_c1
2226 nmdc:mga0a205_16585_c1
2227 nmdc:mga0a205_214946_c1
2228 nmdc:mga0a205_29219_c1
2229 nmdc:mga0a205_30916_c1
2230 nmdc:mga0a205_4115_c1
2231 nmdc:mga0a205_59_c1
2232 nmdc:mga0sz30_3395_c1
2233 Ga0495601_0000018
2234 Ga0495601_0000357
2235 Ga0495601_0000555
2236 Ga0495601_0022810
2237 Ga0495612_0000011
2238 Ga0495612_0000539
2239 Ga0495612_0014087
2240 Ga0495612_0016752
2241 Ga0495612_0027133
2242 Ga0495655_0000451
2243 Ga0495595_0000016
2244 Ga0495595_0000939
2245 Ga0495595_0001313
2246 Ga0495595_0002410
2247 Ga0495595_0019761
2248 Ga0495595_0069748
2249 Ga0495619_0000014
2250 Ga0495619_0000085
2251 Ga0495619_0000380
2252 Ga0495619_0000636
2253 Ga0495619_0002427
2254 Ga0495619_0003404
2255 Ga0495619_0009386
2256 Ga0495619_0064422
2257 Ga0500651_0053147
2258 Ga0500641_0000932
2259 Ga0500641_0002842
2260 Ga0500641_0008319
2261 Ga0500595_000024
2262 Ga0500616_0000458
2263 Ga0500645_000874
2264 Ga0501084_0038702
2265 Ga0501084_0232500
2266 Ga0501082_0004773
2267 Ga0501082_0011414
2268 Ga0501082_0044248
2269 Ga0530510_0029715
2270 Ga0530510_0036852
2271 Ga0530510_0064081
2272 Ga0530510_0080846
2273 2508729266
2274 2509077924
2275 2513590344
2276 2545673131
2277 2643755202
2278 2644735000
2279 2774870261
2280 2776258787
2281 2819719552
2282 2835312888
2283 2841760930
2284 2844106587
2285 2851183739
2286 2851246943
2287 2882457992
2288 2894242386
2289 2917704791
2290 3003670267
2291 641642265
2292 8057530848

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

104

241

0.98

PF02913

FAD-oxidase_C

FAD linked oxidases, C-terminal domain

277

518

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jde-assembly1.cif.gz_A crystal structure of mldhd in complex with d-lactate 0.9535 17 468
8jdo-assembly1.cif.gz_A crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid 0.9493 12 468
8jdp-assembly1.cif.gz_A crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid 0.9484 12 468
8jdc-assembly1.cif.gz_A crystal structure of mldhd in apo form 0.9482 12 468
8jdx-assembly1.cif.gz_A crystal structure of mldhd in complex with 2-ketoisovaleric acid 0.9477 12 468
ID Description Score Start End Superfamily
af_Q7TNG8_361_443_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9913 347 427 3.30.70.2740
af_Q86WU2_267_377_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9867 228 337 3.30.70.2190
af_Q55BQ4_423_504_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9822 347 427 3.30.70.2740
af_Q7TPJ4_275_344_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9778 248 316 3.30.70.2190
af_Q94AX4_441_520_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9709 348 427 3.30.70.2740
ID Description Score Start End GO Terms
AF-A0A7T7BD72-F1-model_v4 deleted 0.9779 239 419
AF-A0A436FTH0-F1-model_v4 FAD-binding oxidoreductase 0.9748 171 471 GO:0004458
GO:0008720
GO:0071949
GO:1903457
AF-A0A803RAW2-F1-model_v4 FAD-binding oxidoreductase/transferase type 4 C-terminal domain-containing protein 0.971 264 468 GO:0004458
GO:0005739
GO:0008720
GO:0050660
GO:1903457
AF-A0A436FTH0-F1-model_v4 FAD-binding oxidoreductase 0.9684 171 471 GO:0004458
GO:0008720
GO:0071949
GO:1903457
AF-A0A821IVH0-F1-model_v4 D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4) 0.966 14 468 GO:0004458
GO:0005739
GO:0008720
GO:0071949
GO:1903457

Map