F490809

General Info

Members Datasets Scaffolds Average Seq Length
1147 458 2294 324

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100092825|Ga0068853_1000928251
Length 345
Sequence MQALRLIEDGRLQLEDNLPEPPAPAPGEVVVRMKAVALNHIDLWGFRGMAFAKRKLPIIVGVEGAGEIAAVGAGVTNRRPGDAVAIYAGLFCGHCGPCRRGIENLCENIADGGIMGFHRDGVAAQYVPVPVRQTVPVPAGVGWAQAATAPVTFGTVQHMLFDNAKLLPGETILVHAGASGIGTTAILMAKAIGARVLTTVGSDEKMEAVKALGADHVLNYRKDRFETWARRLTGKKGVEVVFEHVGPDTWAGSLLSLKRGGRLVTCGSTSGISAETNLFHLFQQQIRIIASFGATVRNLAESMHKMAIGEALPVIDSEIPLAEFDKGLKRMADRAVIGKIIVHIP

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
248 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
256 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
257 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
258 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
259 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
260 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
261 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
262 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
263 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
264 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
265 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
266 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
267 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
272 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
273 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
289 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
290 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
291 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
296 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
297 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
302 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
303 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
304 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
308 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
311 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
314 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
319 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
320 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
321 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
322 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
329 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
343 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
347 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
348 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
349 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
350 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
354 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
355 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
365 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
366 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
367 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
368 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
369 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
370 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
371 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
372 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
373 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
374 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
375 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
376 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
377 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
378 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
379 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
380 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
381 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
382 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
383 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
384 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
385 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
386 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
400 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
401 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
402 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
403 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
404 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
407 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
408 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
409 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
410 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
411 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
413 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
414 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
415 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
416 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
417 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
418 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
419 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
420 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
421 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
422 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
423 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
424 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
425 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
426 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
427 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
428 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
429 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
430 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
431 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
432 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
433 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
434 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
435 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
436 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
437 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
438 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
439 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
442 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
443 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
444 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
445 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
446 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
447 2643221734 Bosea sp. Root670 Isolate Unclassified
448 2643221736 Bosea sp. Root483D1 Isolate Unclassified
449 2818991467 Bosea vestrisii 3192 Isolate Unclassified
450 2841760612 Bosea sp. Tri-49 Isolate Nodule
451 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
452 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
453 2844104063 Bosea sp. Tri-39 Isolate Nodule
454 2851182111 Bosea sp. Tri-44 Isolate Nodule
455 2851246043 Bosea sp. Tri-54 Isolate Nodule
456 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
457 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
458 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.06
Nodule 0.61
Rhizoplane 7.85
Rhizosphere 85.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100092825 3300005539 Bacteria 2656
2 2214828543 2209111006 Bacteria 9216
3 ARcpr5oldR_c000091 3300000041 Bacteria 16524
4 ARSoilYngRDRAFT_c00530 3300000042 Bacteria 4360
5 ARcpr5yngRDRAFT_c000035 3300000043 Bacteria 21396
6 ARSoilOldRDRAFT_c000038 3300000044 Bacteria 30035
7 ARCol0oldRDRAFT_c00271 3300000045 Bacteria 4970
8 ARCol0yngRDRAFT_1000226 3300000652 Bacteria 9392
9 ARCol0yngRDRAFT_1000544 3300000652 Bacteria 4271
10 JGI24741J21665_1013859 3300001915 Bacteria 1358
11 JGI24752J21851_1001007 3300001976 Bacteria 3849
12 JGI24746J21847_1000328 3300001977 Bacteria 6818
13 JGI24739J22299_10000158 3300001989 Bacteria 22012
14 JGI24737J22298_10000549 3300001990 Bacteria 13141
15 JGI24737J22298_10004390 3300001990 Bacteria 4922
16 JGI24743J22301_10007575 3300001991 Bacteria 1888
17 JGI24743J22301_10013699 3300001991 Bacteria 1487
18 JGI24750J21931_1000073 3300002070 Bacteria 14740
19 JGI24745J21846_1001047 3300002073 Bacteria 2600
20 JGI24748J21848_1001221 3300002074 Bacteria 2810
21 JGI24738J21930_10000776 3300002075 Bacteria 9124
22 JGI24749J21850_1003382 3300002076 Bacteria 2232
23 JGI24744J21845_10013510 3300002077 Bacteria 1645
24 JGI24035J26624_1000662 3300002126 Bacteria 3186
25 JGI24034J26672_10000658 3300002239 Bacteria 4431
26 JGI24742J22300_10001071 3300002244 Bacteria 4224
27 JGI24751J29686_10012928 3300002459 Bacteria 1723
28 JGI25159J45721_1010413 3300002987 Bacteria 2368
29 JGI25151J46595_10000264 3300003187 Bacteria 60338
30 JGI25404J52841_10000088 3300003659 Bacteria 8697
31 Ga0055526_1000443 3300003771 Bacteria 32967
32 Ga0055526_1000897 3300003771 Bacteria 22154
33 Ga0055524_1000328 3300003775 Bacteria 44226
34 JGI25405J52794_10001764 3300003911 Bacteria 3613
35 Ga0065165_1000497 3300005262 Bacteria 60783
36 Ga0065717_1002158 3300005276 Bacteria 2683
37 Ga0065712_10000346 3300005290 Bacteria 13762
38 Ga0065712_10069119 3300005290 Bacteria 7981
39 Ga0065715_10089004 3300005293 Bacteria 17365
40 Ga0065707_10158335 3300005295 Bacteria 1587
41 Ga0070658_10019548 3300005327 Bacteria 5423
42 Ga0070676_10002105 3300005328 Bacteria 10132
43 Ga0070683_100000152 3300005329 Bacteria 44662
44 Ga0070690_100001131 3300005330 Bacteria 13708
45 Ga0070690_100001419 3300005330 Bacteria 12493
46 Ga0070690_100047729 3300005330 Bacteria 2725
47 Ga0070690_100100122 3300005330 Bacteria 1921
48 Ga0070670_100015820 3300005331 Bacteria 6475
49 Ga0070677_10000385 3300005333 Bacteria 15484
50 Ga0068869_100000020 3300005334 Bacteria 66561
51 Ga0068869_100040477 3300005334 Bacteria 3332
52 Ga0070666_10002859 3300005335 Bacteria 10423
53 Ga0070666_10022181 3300005335 Bacteria 4121
54 Ga0070666_10025545 3300005335 Bacteria 3852
55 Ga0070680_100007933 3300005336 Bacteria 8100
56 Ga0070680_100016097 3300005336 Bacteria 5876
57 Ga0070680_100018394 3300005336 Bacteria 5520
58 Ga0070680_100114312 3300005336 Bacteria 2249
59 Ga0070680_100192072 3300005336 Bacteria 1721
60 Ga0070682_100000264 3300005337 Bacteria 37644
61 Ga0070682_100034397 3300005337 Bacteria 3086
62 Ga0068868_100000944 3300005338 Bacteria 19746
63 Ga0068868_100020698 3300005338 Bacteria 4948
64 Ga0070660_100001464 3300005339 Bacteria 16152
65 Ga0070660_100026578 3300005339 Bacteria 4311
66 Ga0070660_100078209 3300005339 Bacteria 2594
67 Ga0070660_100134509 3300005339 Bacteria 1980
68 Ga0070689_100000646 3300005340 Bacteria 21086
69 Ga0070689_100006301 3300005340 Bacteria 8195
70 Ga0070691_10000125 3300005341 Bacteria 23286
71 Ga0070691_10009716 3300005341 Bacteria 4389
72 Ga0070687_100000772 3300005343 Bacteria 10645
73 Ga0070661_100001434 3300005344 Bacteria 16565
74 Ga0070661_100066257 3300005344 Bacteria 2653
75 Ga0070661_100182066 3300005344 Bacteria 1599
76 Ga0070692_10000497 3300005345 Bacteria 12069
77 Ga0070692_10017928 3300005345 Bacteria 3395
78 Ga0070668_100001692 3300005347 Bacteria 15990
79 Ga0070668_100050455 3300005347 Bacteria 3204
80 Ga0070669_100001308 3300005353 Bacteria 17982
81 Ga0070675_100002535 3300005354 Bacteria 13657
82 Ga0070675_100044035 3300005354 Bacteria 3650
83 Ga0070675_100167635 3300005354 Bacteria 1892
84 Ga0070671_100003193 3300005355 Bacteria 12776
85 Ga0070671_100020677 3300005355 Bacteria 5370
86 Ga0070671_100026051 3300005355 Bacteria 4803
87 Ga0070674_100000152 3300005356 Bacteria 32268
88 Ga0070674_100038619 3300005356 Bacteria 3219
89 Ga0070673_100000042 3300005364 Bacteria 52952
90 Ga0070673_100005416 3300005364 Bacteria 8166
91 Ga0070688_100011743 3300005365 Bacteria 4882
92 Ga0070688_100019218 3300005365 Bacteria 3956
93 Ga0070688_100094394 3300005365 Bacteria 1961
94 Ga0070659_100000621 3300005366 Bacteria 25919
95 Ga0070659_100257830 3300005366 Bacteria 1446
96 Ga0070667_100000775 3300005367 Bacteria 30249
97 Ga0070667_100040683 3300005367 Bacteria 3898
98 Ga0070709_10008346 3300005434 Bacteria 5687
99 Ga0070709_10045817 3300005434 Bacteria 2717
100 Ga0070709_10196960 3300005434 Bacteria 1424
101 Ga0070714_100004348 3300005435 Bacteria 10679
102 Ga0070714_100010885 3300005435 Bacteria 7202
103 Ga0070714_100240517 3300005435 Bacteria 1670
104 Ga0070713_100002823 3300005436 Bacteria 11370
105 Ga0070713_100007614 3300005436 Bacteria 7619
106 Ga0070713_100014010 3300005436 Bacteria 5937
107 Ga0070713_100042866 3300005436 Bacteria 3696
108 Ga0070713_100070461 3300005436 Bacteria 2951
109 Ga0070710_10008204 3300005437 Bacteria 5080
110 Ga0070710_10009182 3300005437 Bacteria 4833
111 Ga0070710_10070188 3300005437 Bacteria 2017
112 Ga0070701_10000042 3300005438 Bacteria 32304
113 Ga0070711_100019807 3300005439 Bacteria 4324
114 Ga0070711_100055857 3300005439 Bacteria 2729
115 Ga0070711_100141484 3300005439 Bacteria 1804
116 Ga0070711_100229006 3300005439 Bacteria 1448
117 Ga0070711_100333040 3300005439 Bacteria 1216
118 Ga0070705_100001795 3300005440 Bacteria 11096
119 Ga0070705_100117671 3300005440 Bacteria 1710
120 Ga0070700_100002917 3300005441 Bacteria 8773
121 Ga0070700_100138618 3300005441 Bacteria 1650
122 Ga0070700_100205424 3300005441 Bacteria 1386
123 Ga0070694_100001840 3300005444 Bacteria 12559
124 Ga0070708_100026481 3300005445 Bacteria 4965
125 Ga0070708_100409509 3300005445 Bacteria 1279
126 Ga0070663_100001813 3300005455 Bacteria 11882
127 Ga0070663_100240403 3300005455 Bacteria 1429
128 Ga0070678_100138776 3300005456 Bacteria 1942
129 Ga0070662_100009703 3300005457 Bacteria 6299
130 Ga0070662_100022381 3300005457 Bacteria 4327
131 Ga0070681_10007379 3300005458 Bacteria 10746
132 Ga0070681_10028900 3300005458 Bacteria 5570
133 Ga0070681_10082515 3300005458 Bacteria 3170
134 Ga0070681_10087773 3300005458 Bacteria 3062
135 Ga0068867_100029544 3300005459 Bacteria 3950
136 Ga0068867_100042878 3300005459 Bacteria 3311
137 Ga0068867_100051447 3300005459 Bacteria 3038
138 Ga0070685_10006591 3300005466 Bacteria 5923
139 Ga0070685_10100277 3300005466 Bacteria 1767
140 Ga0070685_10100747 3300005466 Bacteria 1764
141 Ga0070707_100089097 3300005468 Bacteria 2985
142 Ga0070679_100010500 3300005530 Bacteria 8786
143 Ga0070679_100059875 3300005530 Bacteria 3795
144 Ga0070679_100073029 3300005530 Bacteria 3423
145 Ga0070679_100090289 3300005530 Bacteria 3052
146 Ga0070679_100217427 3300005530 Bacteria 1873
147 Ga0070679_100224148 3300005530 Bacteria 1840
148 Ga0070684_100002220 3300005535 Bacteria 14325
149 Ga0070684_100020410 3300005535 Bacteria 5498
150 Ga0070684_100111323 3300005535 Bacteria 2455
151 Ga0068853_100002983 3300005539 Bacteria 12902
152 Ga0068853_100047591 3300005539 Bacteria 3680
153 Ga0068853_100087529 3300005539 Bacteria 2734
154 Ga0068853_100379633 3300005539 Bacteria 1319
155 Ga0070672_100000557 3300005543 Bacteria 21802
156 Ga0070672_100019246 3300005543 Bacteria 4952
157 Ga0070686_100000889 3300005544 Bacteria 17366
158 Ga0070686_100045503 3300005544 Bacteria 2765
159 Ga0070686_100135243 3300005544 Bacteria 1709
160 Ga0070695_100002375 3300005545 Bacteria 10814
161 Ga0070695_100011291 3300005545 Bacteria 5341
162 Ga0070696_100007145 3300005546 Bacteria 7456
163 Ga0070696_100022886 3300005546 Bacteria 4249
164 Ga0070696_100100305 3300005546 Bacteria 2074
165 Ga0070696_100235161 3300005546 Bacteria 1380
166 Ga0070693_100000816 3300005547 Bacteria 13812
167 Ga0070693_100070602 3300005547 Bacteria 2055
168 Ga0070665_100042419 3300005548 Bacteria 4573
169 Ga0070665_100187472 3300005548 Bacteria 2069
170 Ga0070665_100264445 3300005548 Bacteria 1721
171 Ga0070704_100009648 3300005549 Bacteria 5847
172 Ga0068855_100003933 3300005563 Bacteria 18135
173 Ga0068855_100015053 3300005563 Bacteria 9314
174 Ga0068855_100268801 3300005563 Bacteria 1896
175 Ga0068855_100395937 3300005563 Bacteria 1514
176 Ga0070664_100000263 3300005564 Bacteria 37910
177 Ga0070664_100279361 3300005564 Bacteria 1506
178 Ga0068857_100002138 3300005577 Bacteria 16066
179 Ga0068857_100258402 3300005577 Bacteria 1598
180 Ga0068857_100312943 3300005577 Bacteria 1449
181 Ga0068854_100003820 3300005578 Bacteria 9426
182 Ga0068856_100000803 3300005614 Bacteria 33893
183 Ga0068856_100059903 3300005614 Bacteria 3761
184 Ga0070702_100002410 3300005615 Bacteria 8050
185 Ga0070702_100029823 3300005615 Bacteria 2970
186 Ga0068852_100000579 3300005616 Bacteria 24117
187 Ga0068859_100007549 3300005617 Bacteria 11043
188 Ga0068859_100016354 3300005617 Bacteria 7453
189 Ga0068864_100000112 3300005618 Bacteria 79688
190 Ga0068864_100019256 3300005618 Bacteria 5706
191 Ga0068864_100122118 3300005618 Bacteria 2330
192 Ga0068866_10000300 3300005718 Bacteria 23587
193 Ga0068866_10026972 3300005718 Bacteria 2719
194 Ga0068861_100010541 3300005719 Bacteria 6417
195 Ga0068861_100075102 3300005719 Bacteria 2630
196 Ga0068870_10000108 3300005840 Bacteria 28313
197 Ga0068870_10032303 3300005840 Bacteria 2660
198 Ga0068863_100000491 3300005841 Bacteria 40157
199 Ga0068863_100003267 3300005841 Bacteria 16008
200 Ga0068858_100000419 3300005842 Bacteria 44155
201 Ga0068858_100021340 3300005842 Bacteria 6050
202 Ga0068858_100123945 3300005842 Bacteria 2418
203 Ga0068860_100001036 3300005843 Bacteria 30573
204 Ga0068860_100084253 3300005843 Bacteria 3024
205 Ga0068862_100003792 3300005844 Bacteria 12881
206 Ga0068862_100030972 3300005844 Bacteria 4511
207 Ga0068862_100046460 3300005844 Bacteria 3705
208 Ga0081455_10000009 3300005937 Bacteria 249885
209 Ga0081455_10000807 3300005937 Bacteria 40308
210 Ga0081455_10008889 3300005937 Bacteria 10385
211 Ga0081455_10014935 3300005937 Bacteria 7567
212 Ga0081455_10049456 3300005937 Bacteria 3624
213 Ga0081455_10064218 3300005937 Bacteria 3076
214 Ga0081538_10017231 3300005981 Bacteria 5495
215 Ga0081540_1000011 3300005983 Bacteria 191880
216 Ga0081540_1001420 3300005983 Bacteria 20722
217 Ga0081540_1053834 3300005983 Bacteria 1970
218 Ga0081539_10083226 3300005985 Bacteria 1675
219 Ga0070717_10003833 3300006028 Bacteria 10822
220 Ga0070717_10069761 3300006028 Bacteria 2928
221 Ga0070717_10176313 3300006028 Bacteria 1861
222 Ga0075365_10005156 3300006038 Bacteria 7022
223 Ga0075365_10171951 3300006038 Bacteria 1512
224 Ga0075368_10000443 3300006042 Bacteria 12217
225 Ga0075368_10010049 3300006042 Bacteria 3415
226 Ga0075363_100009180 3300006048 Bacteria 4644
227 Ga0075364_10161533 3300006051 Bacteria 1512
228 Ga0075432_10001253 3300006058 Bacteria 8180
229 Ga0075432_10026658 3300006058 Bacteria 1986
230 Ga0070715_10000530 3300006163 Bacteria 10002
231 Ga0070716_100001432 3300006173 Bacteria 10611
232 Ga0070716_100003368 3300006173 Bacteria 7518
233 Ga0070712_100015060 3300006175 Bacteria 4972
234 Ga0070712_100113287 3300006175 Bacteria 2028
235 Ga0075362_10009446 3300006177 Bacteria 3773
236 Ga0075362_10067906 3300006177 Bacteria 1623
237 Ga0075367_10001869 3300006178 Bacteria 9308
238 Ga0075367_10005992 3300006178 Bacteria 6107
239 Ga0075367_10049267 3300006178 Bacteria 2483
240 Ga0075369_10002023 3300006186 Bacteria 7141
241 Ga0097621_100000115 3300006237 Bacteria 45694
242 Ga0097621_100057842 3300006237 Bacteria 3172
243 Ga0075370_10009560 3300006353 Bacteria 5039
244 Ga0068871_100000417 3300006358 Bacteria 29416
245 Ga0068871_100004915 3300006358 Bacteria 9336
246 Ga0068871_100103493 3300006358 Bacteria 2387
247 Ga0075428_100000363 3300006844 Bacteria 45033
248 Ga0075428_100151120 3300006844 Bacteria 2522
249 Ga0075428_100304573 3300006844 Bacteria 1713
250 Ga0075430_100003344 3300006846 Bacteria 13430
251 Ga0075430_100220435 3300006846 Bacteria 1574
252 Ga0075431_100012459 3300006847 Bacteria 8583
253 Ga0075431_100015943 3300006847 Bacteria 7624
254 Ga0075433_10000187 3300006852 Bacteria 34883
255 Ga0075433_10005073 3300006852 Bacteria 10324
256 Ga0075433_10053921 3300006852 Bacteria 3507
257 Ga0075434_100002790 3300006871 Bacteria 15468
258 Ga0075434_100063307 3300006871 Bacteria 3681
259 Ga0075434_100135205 3300006871 Bacteria 2485
260 Ga0075434_100178720 3300006871 Bacteria 2142
261 Ga0075434_100225071 3300006871 Bacteria 1895
262 Ga0075429_100000846 3300006880 Bacteria 24030
263 Ga0075429_100307916 3300006880 Bacteria 1387
264 Ga0068865_100000450 3300006881 Bacteria 22865
265 Ga0068865_100078568 3300006881 Bacteria 2361
266 Ga0097620_100007549 3300006931 Bacteria 11043
267 Ga0097620_100016351 3300006931 Bacteria 7453
268 Ga0075435_100001311 3300007076 Bacteria 15971
269 Ga0075435_100033548 3300007076 Bacteria 4060
270 Ga0075435_100034161 3300007076 Bacteria 4027
271 Ga0075435_100051236 3300007076 Bacteria 3325
272 Ga0075435_100206572 3300007076 Bacteria 1665
273 Ga0099795_10042884 3300007788 Bacteria 1617
274 Ga0105244_10104891 3300009036 Bacteria 1380
275 Ga0105240_10017084 3300009093 Bacteria 9797
276 Ga0105240_10025233 3300009093 Bacteria 7816
277 Ga0105240_10303052 3300009093 Bacteria 1827
278 Ga0105240_10423907 3300009093 Bacteria 1494
279 Ga0111539_10000196 3300009094 Bacteria 70998
280 Ga0111539_10000376 3300009094 Bacteria 55320
281 Ga0111539_10010434 3300009094 Bacteria 11690
282 Ga0111539_10068463 3300009094 Bacteria 4191
283 Ga0111539_10125812 3300009094 Bacteria 3003
284 Ga0105245_10001838 3300009098 Bacteria 19304
285 Ga0105245_10040100 3300009098 Bacteria 4170
286 Ga0105247_10000844 3300009101 Bacteria 23209
287 Ga0105247_10098942 3300009101 Bacteria 1862
288 Ga0114129_10010654 3300009147 Bacteria 13110
289 Ga0114129_10011780 3300009147 Bacteria 12443
290 Ga0114129_10016386 3300009147 Bacteria 10548
291 Ga0114129_10089838 3300009147 Bacteria 4258
292 Ga0114129_10134685 3300009147 Bacteria 3390
293 Ga0105243_10002666 3300009148 Bacteria 14829
294 Ga0105243_10033223 3300009148 Bacteria 3989
295 Ga0105243_10043352 3300009148 Bacteria 3526
296 Ga0105243_10267486 3300009148 Bacteria 1533
297 Ga0105241_10004421 3300009174 Bacteria 10395
298 Ga0105241_10173764 3300009174 Bacteria 1781
299 Ga0105241_10225526 3300009174 Bacteria 1577
300 Ga0105242_10006586 3300009176 Bacteria 8948
301 Ga0105242_10029473 3300009176 Bacteria 4378
302 Ga0105242_10485285 3300009176 Bacteria 1172
303 Ga0105248_10000500 3300009177 Bacteria 44664
304 Ga0105248_10049476 3300009177 Bacteria 4714
305 Ga0105248_10110811 3300009177 Bacteria 3095
306 Ga0105237_10010999 3300009545 Bacteria 9605
307 Ga0105237_10223516 3300009545 Bacteria 1883
308 Ga0105237_10288125 3300009545 Bacteria 1645
309 Ga0105238_10084920 3300009551 Bacteria 3155
310 Ga0105238_10109250 3300009551 Bacteria 2747
311 Ga0105238_10178648 3300009551 Bacteria 2099
312 Ga0105249_10014148 3300009553 Bacteria 7053
313 Ga0105249_10072442 3300009553 Bacteria 3185
314 Ga0105239_10008765 3300010375 Bacteria 11449
315 Ga0105239_10052422 3300010375 Bacteria 4474
316 Ga0105239_10057594 3300010375 Bacteria 4263
317 Ga0105239_10170571 3300010375 Bacteria 2433
318 Ga0105239_10275788 3300010375 Bacteria 1892
319 Ga0105246_10000033 3300011119 Bacteria 50575
320 Ga0105246_10015886 3300011119 Bacteria 4761
321 Ga0105246_10137277 3300011119 Bacteria 1834
322 Ga0157342_1000140 3300012507 Bacteria 3618
323 Ga0157342_1000149 3300012507 Bacteria 3528
324 Ga0157373_10007875 3300013100 Bacteria 7925
325 Ga0157373_10031343 3300013100 Bacteria 3827
326 Ga0157371_10006432 3300013102 Bacteria 9696
327 Ga0157371_10080644 3300013102 Bacteria 2305
328 Ga0157370_10030840 3300013104 Bacteria 5251
329 Ga0157370_10196034 3300013104 Bacteria 1874
330 Ga0157369_10233946 3300013105 Bacteria 1920
331 Ga0157369_10541240 3300013105 Bacteria 1204
332 Ga0171462_1039 3300013250 Bacteria 76960
333 Ga0157374_10003002 3300013296 Bacteria 14125
334 Ga0157374_10029483 3300013296 Bacteria 4970
335 Ga0157374_10216440 3300013296 Bacteria 1879
336 Ga0157378_10002195 3300013297 Bacteria 17317
337 Ga0157378_10122484 3300013297 Bacteria 2399
338 Ga0163162_10001526 3300013306 Bacteria 21576
339 Ga0163162_10079449 3300013306 Bacteria 3347
340 Ga0157372_10049188 3300013307 Bacteria 4688
341 Ga0157372_10198111 3300013307 Bacteria 2326
342 Ga0157372_10212591 3300013307 Bacteria 2241
343 Ga0157375_10000124 3300013308 Bacteria 76003
344 Ga0157375_10204393 3300013308 Bacteria 2131
345 Ga0163163_10000745 3300014325 Bacteria 27709
346 Ga0163163_10013111 3300014325 Bacteria 7573
347 Ga0157380_10000140 3300014326 Bacteria 40628
348 Ga0157380_10488530 3300014326 Bacteria 1193
349 Ga0157377_10000117 3300014745 Bacteria 53219
350 Ga0157379_10000785 3300014968 Bacteria 25777
351 Ga0157379_10021545 3300014968 Bacteria 5706
352 Ga0157379_10090285 3300014968 Bacteria 2748
353 Ga0157379_10131578 3300014968 Bacteria 2252
354 Ga0157379_10131771 3300014968 Bacteria 2250
355 Ga0157376_10000034 3300014969 Bacteria 161526
356 Ga0157376_10078444 3300014969 Bacteria 2828
357 Ga0157376_10516039 3300014969 Bacteria 1177
358 Ga0163161_10000448 3300017792 Bacteria 34334
359 Ga0213874_10037206 3300021377 Bacteria 1439
360 Ga0209233_1005206 3300025261 Bacteria 4341
361 Ga0207666_1000017 3300025271 Bacteria 40049
362 Ga0209130_1000930 3300025284 Bacteria 23436
363 Ga0209675_1003692 3300025291 Bacteria 7139
364 Ga0209025_1000357 3300025294 Bacteria 98040
365 Ga0209025_1006354 3300025294 Bacteria 9206
366 Ga0209025_1027376 3300025294 Bacteria 2828
367 Ga0209564_1000580 3300025295 Bacteria 58002
368 Ga0209564_1000790 3300025295 Bacteria 43638
369 Ga0209256_1000504 3300025299 Bacteria 57416
370 Ga0209256_1000695 3300025299 Bacteria 44756
371 Ga0207697_10000009 3300025315 Bacteria 67526
372 Ga0207653_10005862 3300025885 Bacteria 3833
373 Ga0207653_10006516 3300025885 Bacteria 3645
374 Ga0207682_10000016 3300025893 Bacteria 78971
375 Ga0207692_10006732 3300025898 Bacteria 4672
376 Ga0207692_10049334 3300025898 Bacteria 2124
377 Ga0207692_10081307 3300025898 Bacteria 1733
378 Ga0207642_10001066 3300025899 Bacteria 8498
379 Ga0207710_10000872 3300025900 Bacteria 16150
380 Ga0207710_10042878 3300025900 Bacteria 2011
381 Ga0207688_10000012 3300025901 Bacteria 60353
382 Ga0207688_10000724 3300025901 Bacteria 16358
383 Ga0207688_10012750 3300025901 Bacteria 4570
384 Ga0207680_10004638 3300025903 Bacteria 6527
385 Ga0207680_10007328 3300025903 Bacteria 5369
386 Ga0207647_10000675 3300025904 Bacteria 26752
387 Ga0207685_10002531 3300025905 Bacteria 4212
388 Ga0207685_10003645 3300025905 Bacteria 3778
389 Ga0207699_10000471 3300025906 Bacteria 20543
390 Ga0207699_10058348 3300025906 Bacteria 2308
391 Ga0207645_10000124 3300025907 Bacteria 58746
392 Ga0207645_10014691 3300025907 Bacteria 5227
393 Ga0207643_10000075 3300025908 Bacteria 64981
394 Ga0207643_10002257 3300025908 Bacteria 10508
395 Ga0207684_10028032 3300025910 Bacteria 4797
396 Ga0207654_10001577 3300025911 Bacteria 11968
397 Ga0207654_10102791 3300025911 Bacteria 1763
398 Ga0207654_10160888 3300025911 Bacteria 1450
399 Ga0207707_10006050 3300025912 Bacteria 10585
400 Ga0207707_10017365 3300025912 Bacteria 6273
401 Ga0207707_10153684 3300025912 Bacteria 2012
402 Ga0207707_10200959 3300025912 Bacteria 1738
403 Ga0207707_10288018 3300025912 Bacteria 1421
404 Ga0207671_10004598 3300025914 Bacteria 13105
405 Ga0207693_10007591 3300025915 Bacteria 8911
406 Ga0207693_10007801 3300025915 Bacteria 8784
407 Ga0207693_10009539 3300025915 Bacteria 7905
408 Ga0207693_10010807 3300025915 Bacteria 7411
409 Ga0207693_10080348 3300025915 Bacteria 2553
410 Ga0207693_10087329 3300025915 Bacteria 2444
411 Ga0207693_10098075 3300025915 Bacteria 2298
412 Ga0207663_10033218 3300025916 Bacteria 3071
413 Ga0207663_10054700 3300025916 Bacteria 2501
414 Ga0207663_10066103 3300025916 Bacteria 2314
415 Ga0207663_10119156 3300025916 Bacteria 1804
416 Ga0207660_10000489 3300025917 Bacteria 26431
417 Ga0207660_10066164 3300025917 Bacteria 2614
418 Ga0207660_10082119 3300025917 Bacteria 2370
419 Ga0207662_10000466 3300025918 Bacteria 18040
420 Ga0207662_10003107 3300025918 Bacteria 8472
421 Ga0207662_10029187 3300025918 Bacteria 3194
422 Ga0207657_10000162 3300025919 Bacteria 68121
423 Ga0207657_10020188 3300025919 Bacteria 6303
424 Ga0207657_10025969 3300025919 Bacteria 5391
425 Ga0207649_10000411 3300025920 Bacteria 31667
426 Ga0207649_10265672 3300025920 Bacteria 1242
427 Ga0207652_10007710 3300025921 Bacteria 8650
428 Ga0207652_10141802 3300025921 Bacteria 2149
429 Ga0207652_10181365 3300025921 Bacteria 1892
430 Ga0207646_10169050 3300025922 Bacteria 1974
431 Ga0207681_10001617 3300025923 Bacteria 14530
432 Ga0207694_10079957 3300025924 Bacteria 2565
433 Ga0207650_10005173 3300025925 Bacteria 8903
434 Ga0207650_10017729 3300025925 Bacteria 4989
435 Ga0207659_10000017 3300025926 Bacteria 159908
436 Ga0207687_10000417 3300025927 Bacteria 28902
437 Ga0207687_10033527 3300025927 Bacteria 3484
438 Ga0207687_10065475 3300025927 Bacteria 2581
439 Ga0207700_10001122 3300025928 Bacteria 15358
440 Ga0207700_10005932 3300025928 Bacteria 7350
441 Ga0207700_10019154 3300025928 Bacteria 4618
442 Ga0207700_10058890 3300025928 Bacteria 2903
443 Ga0207700_10174603 3300025928 Bacteria 1795
444 Ga0207664_10017837 3300025929 Bacteria 5215
445 Ga0207644_10002417 3300025931 Bacteria 12031
446 Ga0207644_10007214 3300025931 Bacteria 7233
447 Ga0207644_10030185 3300025931 Bacteria 3767
448 Ga0207690_10000151 3300025932 Bacteria 54897
449 Ga0207690_10022512 3300025932 Bacteria 3922
450 Ga0207690_10105350 3300025932 Bacteria 2022
451 Ga0207706_10000368 3300025933 Bacteria 48834
452 Ga0207706_10002835 3300025933 Bacteria 16817
453 Ga0207706_10017875 3300025933 Bacteria 6385
454 Ga0207706_10035451 3300025933 Bacteria 4436
455 Ga0207686_10002957 3300025934 Bacteria 9162
456 Ga0207686_10134991 3300025934 Bacteria 1698
457 Ga0207709_10000256 3300025935 Bacteria 63853
458 Ga0207709_10048397 3300025935 Bacteria 2590
459 Ga0207670_10000086 3300025936 Bacteria 63570
460 Ga0207669_10000398 3300025937 Bacteria 19196
461 Ga0207669_10306386 3300025937 Bacteria 1209
462 Ga0207704_10000139 3300025938 Bacteria 38829
463 Ga0207704_10020379 3300025938 Bacteria 3507
464 Ga0207704_10185629 3300025938 Bacteria 1507
465 Ga0207665_10000204 3300025939 Bacteria 39853
466 Ga0207665_10006321 3300025939 Bacteria 7856
467 Ga0207665_10014646 3300025939 Bacteria 5160
468 Ga0207665_10221950 3300025939 Bacteria 1385
469 Ga0207691_10000303 3300025940 Bacteria 48873
470 Ga0207691_10016212 3300025940 Bacteria 7075
471 Ga0207711_10049816 3300025941 Bacteria 3586
472 Ga0207689_10000109 3300025942 Bacteria 67941
473 Ga0207689_10003705 3300025942 Bacteria 13938
474 Ga0207689_10359761 3300025942 Bacteria 1210
475 Ga0207661_10000074 3300025944 Bacteria 68047
476 Ga0207661_10102176 3300025944 Bacteria 2410
477 Ga0207679_10000031 3300025945 Bacteria 165962
478 Ga0207667_10031004 3300025949 Bacteria 5777
479 Ga0207667_10131935 3300025949 Bacteria 2573
480 Ga0207667_10516451 3300025949 Bacteria 1210
481 Ga0207651_10000044 3300025960 Bacteria 58072
482 Ga0207651_10261780 3300025960 Bacteria 1420
483 Ga0207712_10007106 3300025961 Bacteria 7060
484 Ga0207712_10098775 3300025961 Bacteria 2166
485 Ga0207668_10000345 3300025972 Bacteria 30182
486 Ga0207668_10068502 3300025972 Bacteria 2523
487 Ga0207640_10001716 3300025981 Bacteria 11750
488 Ga0207640_10131110 3300025981 Bacteria 1812
489 Ga0207658_10005012 3300025986 Bacteria 9123
490 Ga0207658_10051910 3300025986 Bacteria 3024
491 Ga0207658_10060072 3300025986 Bacteria 2835
492 Ga0207658_10141485 3300025986 Bacteria 1947
493 Ga0207677_10002560 3300026023 Bacteria 9553
494 Ga0207677_10012300 3300026023 Bacteria 4913
495 Ga0207703_10002483 3300026035 Bacteria 15991
496 Ga0207703_10011289 3300026035 Bacteria 6947
497 Ga0207639_10004898 3300026041 Bacteria 9020
498 Ga0207678_10000158 3300026067 Bacteria 56255
499 Ga0207678_10003070 3300026067 Bacteria 15096
500 Ga0207708_10000098 3300026075 Bacteria 67005
501 Ga0207708_10000416 3300026075 Bacteria 33357
502 Ga0207702_10014157 3300026078 Bacteria 6624
503 Ga0207702_10269951 3300026078 Bacteria 1604
504 Ga0207702_10306472 3300026078 Bacteria 1508
505 Ga0207641_10000408 3300026088 Bacteria 50477
506 Ga0207641_10143181 3300026088 Bacteria 2159
507 Ga0207641_10270308 3300026088 Bacteria 1595
508 Ga0207648_10000696 3300026089 Bacteria 37592
509 Ga0207648_10005386 3300026089 Bacteria 12904
510 Ga0207648_10010270 3300026089 Bacteria 8890
511 Ga0207648_10022337 3300026089 Bacteria 5684
512 Ga0207676_10006295 3300026095 Bacteria 8383
513 Ga0207676_10074682 3300026095 Bacteria 2732
514 Ga0207674_10000420 3300026116 Bacteria 55287
515 Ga0207674_10087738 3300026116 Bacteria 3104
516 Ga0207674_10277455 3300026116 Bacteria 1624
517 Ga0207675_100001146 3300026118 Bacteria 26264
518 Ga0207675_100001268 3300026118 Bacteria 25252
519 Ga0207675_100061395 3300026118 Bacteria 3509
520 Ga0207675_100220445 3300026118 Bacteria 1827
521 Ga0207683_10000004 3300026121 Bacteria 188086
522 Ga0207683_10001766 3300026121 Bacteria 19131
523 Ga0207683_10006982 3300026121 Bacteria 9681
524 Ga0207698_10001253 3300026142 Bacteria 14832
525 Ga0207698_10098636 3300026142 Bacteria 2415
526 Ga0209967_1012008 3300027364 Bacteria 1220
527 Ga0210002_1000731 3300027617 Bacteria 4456
528 Ga0209983_1018941 3300027665 Bacteria 1430
529 Ga0209966_1003032 3300027695 Bacteria 2817
530 Ga0209998_10000945 3300027717 Bacteria 7381
531 Ga0209974_10000117 3300027876 Bacteria 23200
532 Ga0209974_10077748 3300027876 Bacteria 1138
533 Ga0207428_10000250 3300027907 Bacteria 73217
534 Ga0207428_10001707 3300027907 Bacteria 22539
535 Ga0207428_10002343 3300027907 Bacteria 18933
536 Ga0268265_10000752 3300028380 Bacteria 31485
537 Ga0268265_10131359 3300028380 Bacteria 2081
538 Ga0268265_10258375 3300028380 Bacteria 1547
539 Ga0268264_10002529 3300028381 Bacteria 16070
540 Ga0268264_10038211 3300028381 Bacteria 3961
541 Ga0265337_1002301 3300028556 Bacteria 8867
542 Ga0265324_10032758 3300029957 Bacteria 1815
543 Ga0265325_10000039 3300031241 Bacteria 93014
544 Ga0265325_10002499 3300031241 Bacteria 12381
545 Ga0265325_10003454 3300031241 Bacteria 10310
546 Ga0265325_10036910 3300031241 Bacteria 2586
547 Ga0265325_10052094 3300031241 Bacteria 2102
548 Ga0265340_10052354 3300031247 Bacteria 1975
549 Ga0265339_10006717 3300031249 Bacteria 7512
550 Ga0265339_10016529 3300031249 Bacteria 4396
551 Ga0265339_10024016 3300031249 Bacteria 3518
552 Ga0265331_10001218 3300031250 Bacteria 19353
553 Ga0265331_10029044 3300031250 Bacteria 2762
554 Ga0265316_10148171 3300031344 Bacteria 1759
555 Ga0265313_10000021 3300031595 Bacteria 144949
556 Ga0265313_10000057 3300031595 Bacteria 108544
557 Ga0265313_10002016 3300031595 Bacteria 18226
558 Ga0265313_10017419 3300031595 Bacteria 4083
559 Ga0265313_10029421 3300031595 Bacteria 2842
560 Ga0265313_10039737 3300031595 Bacteria 2332
561 Ga0265313_10052558 3300031595 Bacteria 1943
562 Ga0265314_10004299 3300031711 Bacteria 13304
563 Ga0265314_10005478 3300031711 Bacteria 11446
564 Ga0265314_10009434 3300031711 Bacteria 8231
565 Ga0265342_10003392 3300031712 Bacteria 13127
566 Ga0265342_10025747 3300031712 Bacteria 3693
567 Ga0265342_10039196 3300031712 Bacteria 2880
568 Ga0316576_10323306 3300031727 Bacteria 1150
569 Ga0316583_10008041 3300032133 Bacteria 3799
570 Ga0373930_0003658 3300034816 Bacteria 2455
571 Ga0373948_0000331 3300034817 Bacteria 5765
572 Ga0373950_0000525 3300034818 Bacteria 4685
573 Ga0373950_0002206 3300034818 Bacteria 2655
574 Ga0373950_0009375 3300034818 Bacteria 1562
575 Ga0373958_0001188 3300034819 Bacteria 3465
576 Ga0373959_0003250 3300034820 Bacteria 2585
577 Ga0373938_0003628 3300034957 Bacteria 2542
578 Ga0373926_0004729 3300035083 Bacteria 4476
579 Ga0373926_0013859 3300035083 Bacteria 2737
580 Ga0373928_0002766 3300035084 Bacteria 3385
581 Ga0373929_0000934 3300035085 Bacteria 5683
582 Ga0373929_0005827 3300035085 Bacteria 2226
583 Ga0373934_0038218 3300035086 Bacteria 1890
584 Ga0373934_0114124 3300035086 Bacteria 1097
585 Ga0373940_0000070 3300035088 Bacteria 11704
586 Ga0373944_0000293 3300035089 Bacteria 11123
587 Ga0373949_0000878 3300035090 Bacteria 9503
588 Ga0373949_0002003 3300035090 Bacteria 5447
589 Ga0373951_0001550 3300035091 Bacteria 6022
590 Ga0373951_0006833 3300035091 Bacteria 2606
591 Ga0373952_0002820 3300035092 Bacteria 3141
592 Ga0373952_0008501 3300035092 Bacteria 1948
593 Ga0373923_0021776 3300035111 Bacteria 2506
594 Ga0373923_0057726 3300035111 Bacteria 1642
595 Ga0373932_0000094 3300035112 Bacteria 23612
596 Ga0373936_0004221 3300035113 Bacteria 5421
597 Ga0373939_0000436 3300035114 Bacteria 10505
598 Ga0373939_0004620 3300035114 Bacteria 3261
599 Ga0373941_0000404 3300035115 Bacteria 8578
600 Ga0373941_0000909 3300035115 Bacteria 6090
601 Ga0373945_0051977 3300035116 Bacteria 1508
602 Ga0373953_0001892 3300035117 Bacteria 6206
603 Ga0373953_0002543 3300035117 Bacteria 5511
604 Ga0373953_0028516 3300035117 Bacteria 2153
605 Ga0373954_0002451 3300035118 Bacteria 7774
606 Ga0373954_0017633 3300035118 Bacteria 3208
607 Ga0373956_0005141 3300035119 Bacteria 5235
608 Ga0373957_0008056 3300035120 Bacteria 3398
609 Ga0373960_0003391 3300035121 Bacteria 3607
610 Ga0373960_0006721 3300035121 Bacteria 2706
611 Ga0373960_0019556 3300035121 Bacteria 1781
612 Ga0373943_0000574 3300035170 Bacteria 15943
613 Ga0373943_0038255 3300035170 Bacteria 2306
614 Ga0373943_0055379 3300035170 Bacteria 1964
615 Ga0373943_0092472 3300035170 Bacteria 1568
616 Ga0373946_0001887 3300035171 Bacteria 7317
617 Ga0373946_0030093 3300035171 Bacteria 2165
618 Ga0373955_0000179 3300035172 Bacteria 26002
619 Ga0373955_0000573 3300035172 Bacteria 15620
620 Ga0373955_0009737 3300035172 Bacteria 4514
621 Ga0373955_0052874 3300035172 Bacteria 2216
622 Ga0373942_0003796 3300035207 Bacteria 3530
623 Ga0373942_0004402 3300035207 Bacteria 3273
624 Ga0373961_0003554 3300035241 Bacteria 3840
625 Ga0373962_0000137 3300035242 Bacteria 15079
626 Ga0373962_0001436 3300035242 Bacteria 5627
627 Ga0373962_0010790 3300035242 Bacteria 2284
628 Ga0316574_0003710 3300035398 Bacteria 7907
629 Ga0373924_0000231 3300035410 Bacteria 16976
630 Ga0373924_0003315 3300035410 Bacteria 5522
631 Ga0373924_0039594 3300035410 Bacteria 1926
632 Ga0373924_0050973 3300035410 Bacteria 1715
633 Ga0373924_0080610 3300035410 Bacteria 1384
634 Ga0373931_0000034 3300035691 Bacteria 86665
635 Ga0373931_0004201 3300035691 Bacteria 6559
636 Ga0373931_0168071 3300035691 Bacteria 1290
637 Ga0373935_0000041 3300035692 Bacteria 50248
638 Ga0373935_0027233 3300035692 Bacteria 3533
639 Ga0373927_0013903 3300035695 Bacteria 5339
640 Ga0373927_0067208 3300035695 Bacteria 2319
641 Ga0373927_0103055 3300035695 Bacteria 1856
642 Ga0373927_0106884 3300035695 Bacteria 1822
643 Ga0373927_0133573 3300035695 Bacteria 1621
644 Ga0373933_0000827 3300035724 Bacteria 18917
645 Ga0373933_0000876 3300035724 Bacteria 18373
646 Ga0373933_0004375 3300035724 Bacteria 7754
647 Ga0373933_0038252 3300035724 Bacteria 2819
648 Ga0373933_0044678 3300035724 Bacteria 2625
649 Ga0373933_0190104 3300035724 Bacteria 1311
650 Ga0373947_0000606 3300035725 Bacteria 21112
651 Ga0373947_0039421 3300035725 Bacteria 2810
652 Ga0373947_0066320 3300035725 Bacteria 2203
653 Ga0373937_0000458 3300036401 Bacteria 37656
654 Ga0373937_0004869 3300036401 Bacteria 11411
655 Ga0373937_0011492 3300036401 Bacteria 7771
656 Ga0373937_0011831 3300036401 Bacteria 7662
657 Ga0373937_0015291 3300036401 Bacteria 6786
658 Ga0373937_0016247 3300036401 Bacteria 6605
659 Ga0373937_0049613 3300036401 Bacteria 3843
660 Ga0373937_0141643 3300036401 Bacteria 2250
661 Ga0316582_0223725 3300036647 Bacteria 1287
662 Ga0373925_0000084 3300037068 Bacteria 100945
663 Ga0373925_0023174 3300037068 Bacteria 4530
664 Ga0373925_0048639 3300037068 Bacteria 3160
665 Ga0373925_0144652 3300037068 Bacteria 1863
666 Ga0373925_0258493 3300037068 Bacteria 1398
667 Ga0373925_0279066 3300037068 Bacteria 1345
668 Ga0373925_0293022 3300037068 Bacteria 1312
669 Ga0436364_0815578 3300037853 Bacteria 1227
670 Ga0436364_1454102 3300037853 Bacteria 2119
671 Ga0436360_0478773 3300039438 Bacteria 6606
672 Ga0436360_0682085 3300039438 Bacteria 2464
673 Ga0436360_0961521 3300039438 Bacteria 992
674 Ga0436361_0003682 3300039447 Bacteria 24999
675 Ga0436363_1560263 3300039450 Bacteria 3625
676 Ga0466967_0078916 3300045976 Bacteria 2967
677 Ga0495617_026205 3300046452 Bacteria 1963
678 Ga0495627_041952 3300046453 Bacteria 1404
679 Ga0495592_0000026 3300046454 Bacteria 136204
680 Ga0495592_0007769 3300046454 Bacteria 8038
681 Ga0495592_0013078 3300046454 Bacteria 6315
682 Ga0495592_0027747 3300046454 Bacteria 4289
683 Ga0495592_0082742 3300046454 Bacteria 2319
684 Ga0495629_0002921 3300046459 Bacteria 13039
685 Ga0495629_0010593 3300046459 Bacteria 6706
686 Ga0495638_0063532 3300046460 Bacteria 2276
687 Ga0495641_0050150 3300046461 Bacteria 1908
688 Ga0495641_0067144 3300046461 Bacteria 1613
689 Ga0495651_0001559 3300046462 Bacteria 17718
690 Ga0495651_0009033 3300046462 Bacteria 7653
691 Ga0495651_0014408 3300046462 Bacteria 6113
692 Ga0495651_0030845 3300046462 Bacteria 4180
693 Ga0495653_0000003 3300046463 Bacteria 377892
694 Ga0495653_0007399 3300046463 Bacteria 8995
695 Ga0495582_0066961 3300046473 Bacteria 1984
696 Ga0495582_0149324 3300046473 Bacteria 1326
697 Ga0495582_0164943 3300046473 Bacteria 1260
698 Ga0495639_0022520 3300046475 Bacteria 2764
699 Ga0495639_0024518 3300046475 Bacteria 2655
700 Ga0495662_0024038 3300046476 Bacteria 2940
701 Ga0495664_0000001 3300046477 Bacteria 757730
702 Ga0495664_0005683 3300046477 Bacteria 6859
703 Ga0495584_0028231 3300046491 Bacteria 2843
704 Ga0495584_0043390 3300046491 Bacteria 2270
705 Ga0495584_0128304 3300046491 Bacteria 1286
706 Ga0495585_0002362 3300046492 Bacteria 13540
707 Ga0495594_0062544 3300046499 Bacteria 2061
708 Ga0495607_0007810 3300046501 Bacteria 7365
709 Ga0495583_0036681 3300046506 Bacteria 2330
710 Ga0495608_0000012 3300046511 Bacteria 242758
711 Ga0495608_0006328 3300046511 Bacteria 8397
712 Ga0495608_0051798 3300046511 Bacteria 2719
713 Ga0495618_0008669 3300046514 Bacteria 6146
714 Ga0495618_0029856 3300046514 Bacteria 3402
715 Ga0495628_0000095 3300046516 Bacteria 70388
716 Ga0495628_0006043 3300046516 Bacteria 10583
717 Ga0495628_0018089 3300046516 Bacteria 5844
718 Ga0495628_0064924 3300046516 Bacteria 2857
719 Ga0495630_0002688 3300046517 Bacteria 12341
720 Ga0495630_0015138 3300046517 Bacteria 5629
721 Ga0495630_0026641 3300046517 Bacteria 4282
722 Ga0495630_0160924 3300046517 Bacteria 1709
723 Ga0495631_0058073 3300046518 Bacteria 1683
724 Ga0495644_0003320 3300046523 Bacteria 6361
725 Ga0495644_0010527 3300046523 Bacteria 3563
726 Ga0495663_0008764 3300046525 Bacteria 2805
727 Ga0495666_0006722 3300046526 Bacteria 5783
728 Ga0495652_0000001 3300046529 Bacteria 1045081
729 Ga0495652_0023334 3300046529 Bacteria 5484
730 Ga0495652_0024406 3300046529 Bacteria 5351
731 Ga0495665_0027624 3300046531 Bacteria 3045
732 Ga0495665_0028821 3300046531 Bacteria 2975
733 Ga0495640_0000010 3300046533 Bacteria 214167
734 Ga0495640_0011907 3300046533 Bacteria 6670
735 Ga0495640_0032087 3300046533 Bacteria 3743
736 Ga0495586_0028866 3300046535 Bacteria 2969
737 Ga0495586_0123593 3300046535 Bacteria 1446
738 Ga0495587_0000003 3300046536 Bacteria 424188
739 Ga0495587_0000784 3300046536 Bacteria 21237
740 Ga0495587_0014912 3300046536 Bacteria 4861
741 Ga0495587_0038540 3300046536 Bacteria 2864
742 Ga0495609_0023490 3300046538 Bacteria 2834
743 Ga0495645_0000026 3300046543 Bacteria 118737
744 Ga0495645_0001504 3300046543 Bacteria 15761
745 Ga0495645_0010117 3300046543 Bacteria 6608
746 Ga0495622_0015371 3300046557 Bacteria 3557
747 Ga0495667_0000001 3300046559 Bacteria 834831
748 Ga0495667_0005788 3300046559 Bacteria 8372
749 Ga0495667_0011936 3300046559 Bacteria 5888
750 Ga0495667_0036076 3300046559 Bacteria 3302
751 Ga0495667_0048298 3300046559 Bacteria 2810
752 Ga0495656_0004129 3300046615 Bacteria 4946
753 Ga0495656_0004992 3300046615 Bacteria 4570
754 Ga0495634_0000037 3300046642 Bacteria 105318
755 Ga0495634_0016507 3300046642 Bacteria 5280
756 Ga0495634_0170556 3300046642 Bacteria 1367
757 Ga0495635_0000011 3300046663 Bacteria 240094
758 Ga0495635_0004840 3300046663 Bacteria 9368
759 Ga0495635_0033836 3300046663 Bacteria 3545
760 Ga0495635_0136158 3300046663 Bacteria 1674
761 Ga0495635_0176270 3300046663 Bacteria 1453
762 Ga0495659_0007435 3300046664 Bacteria 3475
763 Ga0495661_0097359 3300046665 Bacteria 1662
764 Ga0495588_0003043 3300046674 Bacteria 7254
765 Ga0495657_0000050 3300046675 Bacteria 102791
766 Ga0495657_0000582 3300046675 Bacteria 33505
767 Ga0495599_0000004 3300046678 Bacteria 316231
768 Ga0495599_0006216 3300046678 Bacteria 7197
769 Ga0495599_0031357 3300046678 Bacteria 3336
770 Ga0495599_0046099 3300046678 Bacteria 2733
771 Ga0495623_0000081 3300046679 Bacteria 56783
772 Ga0495623_0006875 3300046679 Bacteria 7400
773 Ga0495623_0013754 3300046679 Bacteria 5246
774 Ga0495623_0035106 3300046679 Bacteria 3214
775 Ga0495646_0000010 3300046680 Bacteria 195319
776 Ga0495646_0000200 3300046680 Bacteria 29769
777 Ga0495646_0022383 3300046680 Bacteria 3987
778 Ga0495647_0001076 3300046681 Bacteria 8324
779 Ga0495647_0014060 3300046681 Bacteria 2783
780 Ga0495658_0001728 3300046683 Bacteria 11316
781 Ga0495658_0003067 3300046683 Bacteria 8355
782 Ga0495658_0134353 3300046683 Bacteria 1508
783 Ga0495658_0207945 3300046683 Bacteria 1222
784 Ga0495613_0008422 3300046689 Bacteria 7656
785 Ga0495613_0035259 3300046689 Bacteria 3713
786 Ga0495624_0011303 3300046690 Bacteria 6137
787 Ga0495624_0014992 3300046690 Bacteria 5248
788 Ga0495624_0042983 3300046690 Bacteria 2884
789 Ga0495671_0027293 3300046692 Bacteria 2950
790 Ga0495600_0000007 3300046809 Bacteria 150995
791 Ga0495600_0001285 3300046809 Bacteria 13878
792 Ga0495600_0007437 3300046809 Bacteria 6703
793 Ga0495600_0011093 3300046809 Bacteria 5608
794 Ga0495581_0002943 3300047315 Bacteria 9746
795 Ga0495581_0011203 3300047315 Bacteria 5184
796 Ga0495581_0062533 3300047315 Bacteria 2151
797 Ga0495581_0097487 3300047315 Bacteria 1708
798 Ga0495604_0000010 3300047317 Bacteria 312236
799 Ga0495604_0005339 3300047317 Bacteria 10186
800 Ga0495604_0012612 3300047317 Bacteria 6723
801 Ga0495604_0012983 3300047317 Bacteria 6639
802 Ga0495604_0024305 3300047317 Bacteria 4834
803 Ga0495604_0035103 3300047317 Bacteria 3962
804 Ga0495604_0123084 3300047317 Bacteria 1875
805 Ga0495674_0000013 3300047319 Bacteria 248475
806 Ga0495674_0146698 3300047319 Bacteria 1980
807 Ga0495674_0258991 3300047319 Bacteria 1430
808 Ga0495674_0334528 3300047319 Bacteria 1231
809 Ga0495676_0017489 3300047321 Bacteria 6338
810 Ga0495676_0052021 3300047321 Bacteria 3272
811 Ga0495676_0069527 3300047321 Bacteria 2716
812 Ga0495676_0091904 3300047321 Bacteria 2266
813 Ga0495676_0126249 3300047321 Bacteria 1854
814 Ga0495680_0000078 3300047322 Bacteria 86663
815 Ga0495680_0001872 3300047322 Bacteria 22140
816 Ga0495680_0004686 3300047322 Bacteria 13028
817 Ga0495680_0004980 3300047322 Bacteria 12557
818 Ga0495680_0012957 3300047322 Bacteria 7302
819 Ga0495680_0039186 3300047322 Bacteria 3781
820 Ga0495680_0205747 3300047322 Bacteria 1411
821 Ga0495675_0000305 3300047444 Bacteria 35233
822 Ga0495675_0006007 3300047444 Bacteria 7424
823 Ga0495675_0013982 3300047444 Bacteria 5075
824 Ga0495681_0101166 3300047470 Bacteria 1260
825 Ga0495684_0000008 3300047471 Bacteria 201370
826 Ga0495684_0059040 3300047471 Bacteria 2921
827 Ga0495684_0062269 3300047471 Bacteria 2838
828 Ga0495593_0000145 3300047673 Bacteria 34809
829 Ga0495593_0002171 3300047673 Bacteria 11734
830 Ga0495593_0006743 3300047673 Bacteria 6722
831 Ga0495602_0000002 3300048088 Bacteria 422216
832 Ga0495602_0009411 3300048088 Bacteria 10165
833 Ga0495602_0015651 3300048088 Bacteria 7647
834 Ga0495602_0015918 3300048088 Bacteria 7574
835 Ga0495602_0160995 3300048088 Bacteria 1752
836 Ga0495614_0012218 3300048089 Bacteria 3771
837 Ga0496100_0000679 3300048903 Bacteria 16224
838 Ga0496100_0005609 3300048903 Bacteria 6778
839 Ga0496100_0010839 3300048903 Bacteria 5172
840 Ga0496100_0020414 3300048903 Bacteria 3972
841 Ga0496100_0049389 3300048903 Bacteria 2720
842 Ga0496100_0080139 3300048903 Bacteria 2202
843 Ga0496101_0000121 3300048904 Bacteria 76264
844 Ga0496101_0002379 3300048904 Bacteria 11545
845 Ga0496101_0072114 3300048904 Bacteria 2534
846 Ga0496102_0001800 3300048905 Bacteria 18544
847 Ga0496102_0003585 3300048905 Bacteria 13145
848 Ga0496102_0142914 3300048905 Bacteria 2244
849 Ga0496102_0146266 3300048905 Bacteria 2218
850 Ga0496103_0002140 3300048906 Bacteria 12580
851 Ga0496103_0002528 3300048906 Bacteria 11461
852 Ga0496103_0019764 3300048906 Bacteria 4043
853 Ga0496104_0000575 3300048907 Bacteria 31363
854 Ga0496104_0009294 3300048907 Bacteria 8742
855 Ga0496104_0033246 3300048907 Bacteria 4803
856 Ga0496104_0060319 3300048907 Bacteria 3594
857 Ga0496104_0061472 3300048907 Bacteria 3561
858 Ga0496105_0005756 3300048908 Bacteria 9445
859 Ga0496105_0014700 3300048908 Bacteria 6231
860 Ga0496105_0026365 3300048908 Bacteria 4740
861 Ga0496105_0037340 3300048908 Bacteria 4001
862 Ga0496105_0038085 3300048908 Bacteria 3961
863 Ga0496105_0274656 3300048908 Bacteria 1360
864 Ga0496106_0000133 3300048909 Bacteria 55926
865 Ga0496106_0004497 3300048909 Bacteria 10339
866 Ga0496106_0029780 3300048909 Bacteria 4070
867 Ga0496106_0036322 3300048909 Bacteria 3686
868 Ga0496106_0055385 3300048909 Bacteria 2997
869 Ga0496106_0195346 3300048909 Bacteria 1609
870 Ga0496107_0001229 3300048910 Bacteria 15645
871 Ga0496107_0011864 3300048910 Bacteria 6087
872 Ga0496107_0026643 3300048910 Bacteria 4099
873 Ga0496107_0054233 3300048910 Bacteria 2893
874 Ga0496107_0070643 3300048910 Bacteria 2535
875 Ga0496107_0150469 3300048910 Bacteria 1721
876 Ga0496107_0259886 3300048910 Bacteria 1292
877 Ga0496108_0005937 3300048911 Bacteria 9890
878 Ga0496108_0006248 3300048911 Bacteria 9647
879 Ga0496108_0010047 3300048911 Bacteria 7677
880 Ga0496108_0013329 3300048911 Bacteria 6702
881 Ga0496108_0016034 3300048911 Bacteria 6109
882 Ga0496108_0149094 3300048911 Bacteria 2018
883 Ga0496108_0389807 3300048911 Bacteria 1216
884 Ga0496109_0006607 3300048912 Bacteria 9766
885 Ga0496109_0006735 3300048912 Bacteria 9676
886 Ga0496109_0006919 3300048912 Bacteria 9568
887 Ga0496109_0016552 3300048912 Bacteria 6448
888 Ga0496109_0163386 3300048912 Bacteria 2086
889 Ga0496110_0006375 3300048913 Bacteria 9329
890 Ga0496110_0025620 3300048913 Bacteria 5042
891 Ga0496110_0040058 3300048913 Bacteria 4082
892 Ga0496110_0082707 3300048913 Bacteria 2863
893 Ga0496110_0101737 3300048913 Bacteria 2576
894 Ga0496110_0161381 3300048913 Bacteria 2032
895 Ga0496110_0237387 3300048913 Bacteria 1659
896 Ga0496111_0008013 3300048914 Bacteria 6967
897 Ga0496111_0012311 3300048914 Bacteria 5787
898 Ga0496111_0023099 3300048914 Bacteria 4362
899 Ga0496111_0023383 3300048914 Bacteria 4338
900 Ga0496111_0023811 3300048914 Bacteria 4301
901 Ga0496111_0028981 3300048914 Bacteria 3927
902 Ga0496111_0045320 3300048914 Bacteria 3164
903 Ga0496111_0235273 3300048914 Bacteria 1360
904 Ga0496111_0293535 3300048914 Bacteria 1205
905 Ga0496112_0001095 3300048915 Bacteria 20053
906 Ga0496112_0028750 3300048915 Bacteria 5369
907 Ga0496112_0103617 3300048915 Bacteria 2815
908 Ga0496112_0137026 3300048915 Bacteria 2418
909 Ga0496112_0184414 3300048915 Bacteria 2050
910 Ga0496112_0286534 3300048915 Bacteria 1593
911 Ga0496113_0006833 3300048916 Bacteria 7276
912 Ga0496113_0010461 3300048916 Bacteria 6134
913 Ga0496113_0030136 3300048916 Bacteria 3925
914 Ga0496113_0034994 3300048916 Bacteria 3669
915 Ga0496113_0102121 3300048916 Bacteria 2223
916 Ga0496113_0244011 3300048916 Bacteria 1433
917 Ga0496113_0251316 3300048916 Bacteria 1411
918 Ga0496114_0024196 3300048917 Bacteria 4956
919 Ga0496114_0061556 3300048917 Bacteria 3140
920 Ga0496114_0142440 3300048917 Bacteria 2076
921 Ga0496115_0004251 3300048918 Bacteria 10355
922 Ga0496115_0044425 3300048918 Bacteria 3544
923 Ga0496115_0052630 3300048918 Bacteria 3267
924 Ga0496115_0053974 3300048918 Bacteria 3226
925 Ga0496115_0056919 3300048918 Bacteria 3143
926 Ga0496115_0089844 3300048918 Bacteria 2509
927 Ga0496117_0074455 3300048920 Bacteria 2260
928 Ga0496122_0018456 3300048925 Bacteria 6442
929 Ga0496122_0132407 3300048925 Bacteria 1581
930 Ga0496123_0011563 3300048926 Bacteria 7636
931 Ga0496123_0030058 3300048926 Bacteria 3983
932 Ga0496123_0093631 3300048926 Bacteria 1773
933 Ga0501031_0001650 3300049568 Bacteria 14002
934 Ga0501032_0016718 3300049569 Bacteria 5154
935 Ga0501032_0045230 3300049569 Bacteria 2978
936 Ga0501032_0084246 3300049569 Bacteria 2113
937 Ga0501032_0132560 3300049569 Bacteria 1643
938 Ga0501033_0049551 3300049570 Bacteria 3117
939 Ga0501033_0055120 3300049570 Bacteria 2939
940 Ga0501033_0074193 3300049570 Bacteria 2497
941 Ga0501034_0000032 3300049571 Bacteria 243763
942 Ga0501034_0000623 3300049571 Bacteria 55353
943 Ga0501034_0011296 3300049571 Bacteria 9264
944 Ga0501034_0015888 3300049571 Bacteria 7730
945 Ga0501034_0036635 3300049571 Bacteria 4967
946 Ga0501034_0044949 3300049571 Bacteria 4464
947 Ga0501034_0078963 3300049571 Bacteria 3294
948 Ga0501034_0081950 3300049571 Bacteria 3228
949 Ga0501034_0146865 3300049571 Bacteria 2335
950 Ga0501034_0380316 3300049571 Bacteria 1337
951 Ga0501034_0424268 3300049571 Bacteria 1251
952 Ga0501036_0007360 3300049572 Bacteria 8970
953 Ga0501036_0010284 3300049572 Bacteria 7718
954 Ga0501036_0048396 3300049572 Bacteria 3599
955 Ga0501036_0054322 3300049572 Bacteria 3392
956 Ga0501036_0070649 3300049572 Bacteria 2952
957 Ga0501037_0004970 3300049573 Bacteria 9668
958 Ga0501037_0005615 3300049573 Bacteria 9143
959 Ga0501037_0009466 3300049573 Bacteria 7152
960 Ga0501037_0013851 3300049573 Bacteria 5943
961 Ga0501037_0075101 3300049573 Bacteria 2455
962 Ga0501037_0099786 3300049573 Bacteria 2097
963 Ga0501038_0008677 3300049574 Bacteria 9330
964 Ga0501038_0011705 3300049574 Bacteria 8003
965 Ga0501038_0043948 3300049574 Bacteria 3883
966 Ga0501038_0048763 3300049574 Bacteria 3663
967 Ga0501038_0098638 3300049574 Bacteria 2436
968 Ga0501039_0009153 3300049575 Bacteria 7543
969 Ga0501039_0014974 3300049575 Bacteria 5931
970 Ga0501039_0296060 3300049575 Bacteria 1272
971 Ga0501042_0272524 3300049578 Bacteria 1222
972 Ga0501043_0001573 3300049579 Bacteria 19879
973 Ga0501043_0014132 3300049579 Bacteria 6247
974 Ga0501043_0017896 3300049579 Bacteria 5557
975 Ga0501043_0043984 3300049579 Bacteria 3510
976 Ga0501043_0081974 3300049579 Bacteria 2535
977 Ga0501046_0009868 3300049580 Bacteria 8229
978 Ga0501046_0042134 3300049580 Bacteria 3640
979 Ga0501047_0000010 3300049581 Bacteria 429357
980 Ga0501047_0015576 3300049581 Bacteria 7244
981 Ga0501047_0021992 3300049581 Bacteria 6125
982 Ga0501047_0036706 3300049581 Bacteria 4737
983 Ga0501047_0053829 3300049581 Bacteria 3893
984 Ga0501047_0084142 3300049581 Bacteria 3057
985 Ga0501047_0129064 3300049581 Bacteria 2408
986 Ga0501047_0157287 3300049581 Bacteria 2146
987 Ga0501047_0203524 3300049581 Bacteria 1840
988 Ga0501048_0000168 3300049582 Bacteria 41187
989 Ga0501048_0014318 3300049582 Bacteria 5873
990 Ga0501067_0092874 3300049583 Bacteria 1675
991 Ga0501067_0119614 3300049583 Bacteria 1465
992 Ga0501068_0015863 3300049584 Bacteria 4338
993 Ga0501068_0030640 3300049584 Bacteria 3192
994 Ga0501068_0039312 3300049584 Bacteria 2836
995 Ga0501069_0011306 3300049585 Bacteria 4733
996 Ga0501069_0014514 3300049585 Bacteria 4212
997 Ga0501069_0046904 3300049585 Bacteria 2398
998 Ga0501069_0048103 3300049585 Bacteria 2368
999 Ga0501070_0004804 3300049586 Bacteria 11552
1000 Ga0501070_0008692 3300049586 Bacteria 8585
1001 Ga0501070_0018877 3300049586 Bacteria 5784
1002 Ga0501070_0024148 3300049586 Bacteria 5097
1003 Ga0501070_0042126 3300049586 Bacteria 3802
1004 Ga0501070_0072099 3300049586 Bacteria 2859
1005 Ga0501070_0073990 3300049586 Bacteria 2819
1006 Ga0501071_0085944 3300049587 Bacteria 2307
1007 Ga0501071_0332179 3300049587 Bacteria 1155
1008 Ga0501072_0060633 3300049588 Bacteria 2983
1009 Ga0501072_0105701 3300049588 Bacteria 2238
1010 Ga0501072_0115525 3300049588 Bacteria 2137
1011 Ga0501072_0285537 3300049588 Bacteria 1312
1012 Ga0501073_0008770 3300049589 Bacteria 7484
1013 Ga0501073_0009775 3300049589 Bacteria 7060
1014 Ga0501073_0034787 3300049589 Bacteria 3583
1015 Ga0501073_0112314 3300049589 Bacteria 1890
1016 Ga0501073_0262691 3300049589 Bacteria 1191
1017 Ga0501074_0011571 3300049590 Bacteria 6416
1018 Ga0501074_0015553 3300049590 Bacteria 5530
1019 Ga0501074_0092443 3300049590 Bacteria 2166
1020 Ga0501075_0157073 3300049591 Bacteria 1734
1021 Ga0501076_0224885 3300049592 Bacteria 1534
1022 Ga0501080_0000198 3300049742 Bacteria 44139
1023 Ga0501080_0014363 3300049742 Bacteria 7292
1024 Ga0501080_0017519 3300049742 Bacteria 6624
1025 Ga0501080_0038138 3300049742 Bacteria 4488
1026 Ga0501080_0096651 3300049742 Bacteria 2742
1027 Ga0501080_0113375 3300049742 Bacteria 2513
1028 Ga0501080_0201842 3300049742 Bacteria 1825
1029 Ga0501083_0001536 3300049744 Bacteria 15781
1030 Ga0501083_0011302 3300049744 Bacteria 6262
1031 Ga0501083_0038503 3300049744 Bacteria 3250
1032 Ga0501035_0000994 3300049822 Bacteria 29965
1033 Ga0501035_0027935 3300049822 Bacteria 5154
1034 Ga0501035_0233210 3300049822 Bacteria 1568
1035 Ga0501044_0002086 3300049823 Bacteria 23014
1036 Ga0501044_0005135 3300049823 Bacteria 14600
1037 Ga0501044_0014287 3300049823 Bacteria 8572
1038 Ga0501044_0136706 3300049823 Bacteria 2442
1039 Ga0501044_0160100 3300049823 Bacteria 2228
1040 Ga0501044_0209404 3300049823 Bacteria 1904
1041 Ga0501044_0339605 3300049823 Bacteria 1423
1042 nmdc:mga03683_47548_c1 3300050489 Bacteria 1780
1043 nmdc:mga03683_49545_c1 3300050489 Bacteria 1749
1044 nmdc:mga03683_67690_c1 3300050489 Bacteria 1520
1045 nmdc:mga03n38_3239_c1 3300050490 Bacteria 5192
1046 nmdc:mga00v17_19178_c1 3300050491 Bacteria 3900
1047 nmdc:mga00v17_87978_c1 3300050491 Bacteria 1947
1048 nmdc:mga00v17_9160_c1 3300050491 Bacteria 5343
1049 nmdc:mga0yw44_1900_c1 3300050492 Bacteria 8614
1050 nmdc:mga0yw44_7593_c1 3300050492 Bacteria 5347
1051 nmdc:mga0yw44_8643_c1 3300050492 Bacteria 5088
1052 nmdc:mga0k408_75005_c1 3300050493 Bacteria 1976
1053 nmdc:mga06z11_204072_c1 3300050494 Bacteria 1149
1054 nmdc:mga06z11_82159_c1 3300050494 Bacteria 1731
1055 nmdc:mga06z11_9433_c1 3300050494 Bacteria 4112
1056 nmdc:mga04h51_4310_c1 3300050495 Bacteria 3528
1057 nmdc:mga04h51_6053_c1 3300050495 Bacteria 3116
1058 nmdc:mga05p37_2711_c2 3300050507 Bacteria 18727
1059 nmdc:mga05p37_354_c1 3300050507 Bacteria 49188
1060 nmdc:mga05p37_53293_c1 3300050507 Bacteria 4975
1061 nmdc:mga05p37_7402_c1 3300050507 Bacteria 12952
1062 nmdc:mga09592_1147_c1 3300050508 Bacteria 21127
1063 nmdc:mga0qj67_20294_c1 3300050509 Bacteria 5086
1064 nmdc:mga0qj67_219409_c1 3300050509 Bacteria 1544
1065 nmdc:mga0qj67_316678_c1 3300050509 Bacteria 1263
1066 nmdc:mga06r32_115465_c1 3300050510 Bacteria 2644
1067 nmdc:mga06r32_147_c1 3300050510 Bacteria 53171
1068 nmdc:mga06r32_32730_c1 3300050510 Bacteria 4894
1069 nmdc:mga06r32_91117_c1 3300050510 Bacteria 2979
1070 nmdc:mga08y16_289_c1 3300050511 Bacteria 45654
1071 nmdc:mga08y16_344933_c1 3300050511 Bacteria 1530
1072 nmdc:mga08y16_4156_c1 3300050511 Bacteria 15112
1073 nmdc:mga08y16_49079_c1 3300050511 Bacteria 4417
1074 nmdc:mga08y16_6983_c1 3300050511 Bacteria 11838
1075 nmdc:mga0n895_109704_c1 3300050512 Bacteria 2775
1076 nmdc:mga0n895_148630_c1 3300050512 Bacteria 2372
1077 nmdc:mga0n895_191567_c1 3300050512 Bacteria 2076
1078 nmdc:mga0n895_2287_c1 3300050512 Bacteria 14868
1079 nmdc:mga0n895_2438_c1 3300050512 Bacteria 14525
1080 nmdc:mga0n895_50171_c1 3300050512 Bacteria 4090
1081 nmdc:mga0n895_64716_c1 3300050512 Bacteria 3617
1082 nmdc:mga0n895_70268_c1 3300050512 Bacteria 3470
1083 nmdc:mga0rr50_52939_c1 3300050513 Bacteria 3018
1084 nmdc:mga0rr50_60619_c1 3300050513 Bacteria 2847
1085 nmdc:mga0rr50_866_c1 3300050513 Bacteria 16346
1086 nmdc:mga08x19_133724_c1 3300050514 Bacteria 1670
1087 nmdc:mga08x19_57652_c1 3300050514 Bacteria 2510
1088 nmdc:mga0a205_47327_c1 3300050515 Bacteria 4149
1089 nmdc:mga0a205_60_c1 3300050515 Bacteria 60202
1090 nmdc:mga0a205_733_c1 3300050515 Bacteria 15506
1091 nmdc:mga0sz30_32048_c1 3300050516 Bacteria 2177
1092 Ga0495601_0000003 3300053077 Bacteria 493642
1093 Ga0495601_0000633 3300053077 Bacteria 18799
1094 Ga0495601_0009435 3300053077 Bacteria 5771
1095 Ga0495601_0014499 3300053077 Bacteria 4749
1096 Ga0495601_0039919 3300053077 Bacteria 2939
1097 Ga0495601_0128092 3300053077 Bacteria 1652
1098 Ga0495612_0000009 3300053078 Bacteria 229858
1099 Ga0495612_0001588 3300053078 Bacteria 9375
1100 Ga0495612_0008883 3300053078 Bacteria 4071
1101 Ga0495612_0010222 3300053078 Bacteria 3796
1102 Ga0495612_0012233 3300053078 Bacteria 3460
1103 Ga0495655_0003034 3300053083 Bacteria 2725
1104 Ga0495595_0000011 3300053084 Bacteria 174945
1105 Ga0495595_0002035 3300053084 Bacteria 7853
1106 Ga0495595_0002334 3300053084 Bacteria 7395
1107 Ga0495595_0003065 3300053084 Bacteria 6611
1108 Ga0495595_0003222 3300053084 Bacteria 6477
1109 Ga0495595_0014156 3300053084 Bacteria 3379
1110 Ga0495619_0000039 3300053085 Bacteria 118681
1111 Ga0495619_0000859 3300053085 Bacteria 19908
1112 Ga0495619_0000996 3300053085 Bacteria 18589
1113 Ga0495619_0003147 3300053085 Bacteria 10703
1114 Ga0495619_0003231 3300053085 Bacteria 10556
1115 Ga0495619_0003678 3300053085 Bacteria 9887
1116 Ga0495619_0035546 3300053085 Bacteria 3240
1117 Ga0495619_0095560 3300053085 Bacteria 2016
1118 Ga0495619_0182146 3300053085 Bacteria 1453
1119 Ga0500644_0000321 3300053088 Bacteria 24950
1120 Ga0500651_0012299 3300053093 Bacteria 5188
1121 Ga0500641_0005670 3300053096 Bacteria 4424
1122 Ga0500595_000002 3300053119 Bacteria 1074388
1123 Ga0500595_011319 3300053119 Bacteria 3499
1124 Ga0500595_015084 3300053119 Bacteria 2908
1125 Ga0500652_000080 3300053131 Bacteria 42009
1126 Ga0500652_017107 3300053131 Bacteria 2653
1127 Ga0500616_0000002 3300053153 Bacteria 1611257
1128 Ga0500616_0024210 3300053153 Bacteria 3377
1129 Ga0500636_0034305 3300053177 Bacteria 3003
1130 Ga0500645_000086 3300053730 Bacteria 74512
1131 Ga0501084_0051321 3300054114 Bacteria 3452
1132 Ga0501082_0117241 3300060353 Bacteria 2306
1133 Ga0501082_0149258 3300060353 Bacteria 2030
1134 Ga0530510_0241753 3300061734 Bacteria 1344
1135 2643756745 2643221547 Bacteria 4740017
1136 2644734686 2643221734 Bacteria 5365412
1137 2644746428 2643221736 Bacteria 6608466
1138 2819722198 2818991467 Bacteria 5893227
1139 2841765059 2841760612 Bacteria 6454112
1140 2841912545 2841911363 Bacteria 6173697
1141 2841918300 2841917233 Bacteria 6173500
1142 2844105584 2844104063 Bacteria 6440972
1143 2851183855 2851182111 Bacteria 6047226
1144 2851249599 2851246043 Bacteria 6439203
1145 2883578826 2883577096 Bacteria 4709178
1146 2917703097 2917699015 Bacteria 7043791
1147 8057532912 8057529695 Bacteria 6306553
1148 Ga0068853_100092825
1149 2214828543
1150 ARcpr5oldR_c000091
1151 ARSoilYngRDRAFT_c00530
1152 ARcpr5yngRDRAFT_c000035
1153 ARSoilOldRDRAFT_c000038
1154 ARCol0oldRDRAFT_c00271
1155 ARCol0yngRDRAFT_1000226
1156 ARCol0yngRDRAFT_1000544
1157 JGI24741J21665_1013859
1158 JGI24752J21851_1001007
1159 JGI24746J21847_1000328
1160 JGI24739J22299_10000158
1161 JGI24737J22298_10000549
1162 JGI24737J22298_10004390
1163 JGI24743J22301_10007575
1164 JGI24743J22301_10013699
1165 JGI24750J21931_1000073
1166 JGI24745J21846_1001047
1167 JGI24748J21848_1001221
1168 JGI24738J21930_10000776
1169 JGI24749J21850_1003382
1170 JGI24744J21845_10013510
1171 JGI24035J26624_1000662
1172 JGI24034J26672_10000658
1173 JGI24742J22300_10001071
1174 JGI24751J29686_10012928
1175 JGI25159J45721_1010413
1176 JGI25151J46595_10000264
1177 JGI25404J52841_10000088
1178 Ga0055526_1000443
1179 Ga0055526_1000897
1180 Ga0055524_1000328
1181 JGI25405J52794_10001764
1182 Ga0065165_1000497
1183 Ga0065717_1002158
1184 Ga0065712_10000346
1185 Ga0065712_10069119
1186 Ga0065715_10089004
1187 Ga0065707_10158335
1188 Ga0070658_10019548
1189 Ga0070676_10002105
1190 Ga0070683_100000152
1191 Ga0070690_100001131
1192 Ga0070690_100001419
1193 Ga0070690_100047729
1194 Ga0070690_100100122
1195 Ga0070670_100015820
1196 Ga0070677_10000385
1197 Ga0068869_100000020
1198 Ga0068869_100040477
1199 Ga0070666_10002859
1200 Ga0070666_10022181
1201 Ga0070666_10025545
1202 Ga0070680_100007933
1203 Ga0070680_100016097
1204 Ga0070680_100018394
1205 Ga0070680_100114312
1206 Ga0070680_100192072
1207 Ga0070682_100000264
1208 Ga0070682_100034397
1209 Ga0068868_100000944
1210 Ga0068868_100020698
1211 Ga0070660_100001464
1212 Ga0070660_100026578
1213 Ga0070660_100078209
1214 Ga0070660_100134509
1215 Ga0070689_100000646
1216 Ga0070689_100006301
1217 Ga0070691_10000125
1218 Ga0070691_10009716
1219 Ga0070687_100000772
1220 Ga0070661_100001434
1221 Ga0070661_100066257
1222 Ga0070661_100182066
1223 Ga0070692_10000497
1224 Ga0070692_10017928
1225 Ga0070668_100001692
1226 Ga0070668_100050455
1227 Ga0070669_100001308
1228 Ga0070675_100002535
1229 Ga0070675_100044035
1230 Ga0070675_100167635
1231 Ga0070671_100003193
1232 Ga0070671_100020677
1233 Ga0070671_100026051
1234 Ga0070674_100000152
1235 Ga0070674_100038619
1236 Ga0070673_100000042
1237 Ga0070673_100005416
1238 Ga0070688_100011743
1239 Ga0070688_100019218
1240 Ga0070688_100094394
1241 Ga0070659_100000621
1242 Ga0070659_100257830
1243 Ga0070667_100000775
1244 Ga0070667_100040683
1245 Ga0070709_10008346
1246 Ga0070709_10045817
1247 Ga0070709_10196960
1248 Ga0070714_100004348
1249 Ga0070714_100010885
1250 Ga0070714_100240517
1251 Ga0070713_100002823
1252 Ga0070713_100007614
1253 Ga0070713_100014010
1254 Ga0070713_100042866
1255 Ga0070713_100070461
1256 Ga0070710_10008204
1257 Ga0070710_10009182
1258 Ga0070710_10070188
1259 Ga0070701_10000042
1260 Ga0070711_100019807
1261 Ga0070711_100055857
1262 Ga0070711_100141484
1263 Ga0070711_100229006
1264 Ga0070711_100333040
1265 Ga0070705_100001795
1266 Ga0070705_100117671
1267 Ga0070700_100002917
1268 Ga0070700_100138618
1269 Ga0070700_100205424
1270 Ga0070694_100001840
1271 Ga0070708_100026481
1272 Ga0070708_100409509
1273 Ga0070663_100001813
1274 Ga0070663_100240403
1275 Ga0070678_100138776
1276 Ga0070662_100009703
1277 Ga0070662_100022381
1278 Ga0070681_10007379
1279 Ga0070681_10028900
1280 Ga0070681_10082515
1281 Ga0070681_10087773
1282 Ga0068867_100029544
1283 Ga0068867_100042878
1284 Ga0068867_100051447
1285 Ga0070685_10006591
1286 Ga0070685_10100277
1287 Ga0070685_10100747
1288 Ga0070707_100089097
1289 Ga0070679_100010500
1290 Ga0070679_100059875
1291 Ga0070679_100073029
1292 Ga0070679_100090289
1293 Ga0070679_100217427
1294 Ga0070679_100224148
1295 Ga0070684_100002220
1296 Ga0070684_100020410
1297 Ga0070684_100111323
1298 Ga0068853_100002983
1299 Ga0068853_100047591
1300 Ga0068853_100087529
1301 Ga0068853_100379633
1302 Ga0070672_100000557
1303 Ga0070672_100019246
1304 Ga0070686_100000889
1305 Ga0070686_100045503
1306 Ga0070686_100135243
1307 Ga0070695_100002375
1308 Ga0070695_100011291
1309 Ga0070696_100007145
1310 Ga0070696_100022886
1311 Ga0070696_100100305
1312 Ga0070696_100235161
1313 Ga0070693_100000816
1314 Ga0070693_100070602
1315 Ga0070665_100042419
1316 Ga0070665_100187472
1317 Ga0070665_100264445
1318 Ga0070704_100009648
1319 Ga0068855_100003933
1320 Ga0068855_100015053
1321 Ga0068855_100268801
1322 Ga0068855_100395937
1323 Ga0070664_100000263
1324 Ga0070664_100279361
1325 Ga0068857_100002138
1326 Ga0068857_100258402
1327 Ga0068857_100312943
1328 Ga0068854_100003820
1329 Ga0068856_100000803
1330 Ga0068856_100059903
1331 Ga0070702_100002410
1332 Ga0070702_100029823
1333 Ga0068852_100000579
1334 Ga0068859_100007549
1335 Ga0068859_100016354
1336 Ga0068864_100000112
1337 Ga0068864_100019256
1338 Ga0068864_100122118
1339 Ga0068866_10000300
1340 Ga0068866_10026972
1341 Ga0068861_100010541
1342 Ga0068861_100075102
1343 Ga0068870_10000108
1344 Ga0068870_10032303
1345 Ga0068863_100000491
1346 Ga0068863_100003267
1347 Ga0068858_100000419
1348 Ga0068858_100021340
1349 Ga0068858_100123945
1350 Ga0068860_100001036
1351 Ga0068860_100084253
1352 Ga0068862_100003792
1353 Ga0068862_100030972
1354 Ga0068862_100046460
1355 Ga0081455_10000009
1356 Ga0081455_10000807
1357 Ga0081455_10008889
1358 Ga0081455_10014935
1359 Ga0081455_10049456
1360 Ga0081455_10064218
1361 Ga0081538_10017231
1362 Ga0081540_1000011
1363 Ga0081540_1001420
1364 Ga0081540_1053834
1365 Ga0081539_10083226
1366 Ga0070717_10003833
1367 Ga0070717_10069761
1368 Ga0070717_10176313
1369 Ga0075365_10005156
1370 Ga0075365_10171951
1371 Ga0075368_10000443
1372 Ga0075368_10010049
1373 Ga0075363_100009180
1374 Ga0075364_10161533
1375 Ga0075432_10001253
1376 Ga0075432_10026658
1377 Ga0070715_10000530
1378 Ga0070716_100001432
1379 Ga0070716_100003368
1380 Ga0070712_100015060
1381 Ga0070712_100113287
1382 Ga0075362_10009446
1383 Ga0075362_10067906
1384 Ga0075367_10001869
1385 Ga0075367_10005992
1386 Ga0075367_10049267
1387 Ga0075369_10002023
1388 Ga0097621_100000115
1389 Ga0097621_100057842
1390 Ga0075370_10009560
1391 Ga0068871_100000417
1392 Ga0068871_100004915
1393 Ga0068871_100103493
1394 Ga0075428_100000363
1395 Ga0075428_100151120
1396 Ga0075428_100304573
1397 Ga0075430_100003344
1398 Ga0075430_100220435
1399 Ga0075431_100012459
1400 Ga0075431_100015943
1401 Ga0075433_10000187
1402 Ga0075433_10005073
1403 Ga0075433_10053921
1404 Ga0075434_100002790
1405 Ga0075434_100063307
1406 Ga0075434_100135205
1407 Ga0075434_100178720
1408 Ga0075434_100225071
1409 Ga0075429_100000846
1410 Ga0075429_100307916
1411 Ga0068865_100000450
1412 Ga0068865_100078568
1413 Ga0097620_100007549
1414 Ga0097620_100016351
1415 Ga0075435_100001311
1416 Ga0075435_100033548
1417 Ga0075435_100034161
1418 Ga0075435_100051236
1419 Ga0075435_100206572
1420 Ga0099795_10042884
1421 Ga0105244_10104891
1422 Ga0105240_10017084
1423 Ga0105240_10025233
1424 Ga0105240_10303052
1425 Ga0105240_10423907
1426 Ga0111539_10000196
1427 Ga0111539_10000376
1428 Ga0111539_10010434
1429 Ga0111539_10068463
1430 Ga0111539_10125812
1431 Ga0105245_10001838
1432 Ga0105245_10040100
1433 Ga0105247_10000844
1434 Ga0105247_10098942
1435 Ga0114129_10010654
1436 Ga0114129_10011780
1437 Ga0114129_10016386
1438 Ga0114129_10089838
1439 Ga0114129_10134685
1440 Ga0105243_10002666
1441 Ga0105243_10033223
1442 Ga0105243_10043352
1443 Ga0105243_10267486
1444 Ga0105241_10004421
1445 Ga0105241_10173764
1446 Ga0105241_10225526
1447 Ga0105242_10006586
1448 Ga0105242_10029473
1449 Ga0105242_10485285
1450 Ga0105248_10000500
1451 Ga0105248_10049476
1452 Ga0105248_10110811
1453 Ga0105237_10010999
1454 Ga0105237_10223516
1455 Ga0105237_10288125
1456 Ga0105238_10084920
1457 Ga0105238_10109250
1458 Ga0105238_10178648
1459 Ga0105249_10014148
1460 Ga0105249_10072442
1461 Ga0105239_10008765
1462 Ga0105239_10052422
1463 Ga0105239_10057594
1464 Ga0105239_10170571
1465 Ga0105239_10275788
1466 Ga0105246_10000033
1467 Ga0105246_10015886
1468 Ga0105246_10137277
1469 Ga0157342_1000140
1470 Ga0157342_1000149
1471 Ga0157373_10007875
1472 Ga0157373_10031343
1473 Ga0157371_10006432
1474 Ga0157371_10080644
1475 Ga0157370_10030840
1476 Ga0157370_10196034
1477 Ga0157369_10233946
1478 Ga0157369_10541240
1479 Ga0171462_1039
1480 Ga0157374_10003002
1481 Ga0157374_10029483
1482 Ga0157374_10216440
1483 Ga0157378_10002195
1484 Ga0157378_10122484
1485 Ga0163162_10001526
1486 Ga0163162_10079449
1487 Ga0157372_10049188
1488 Ga0157372_10198111
1489 Ga0157372_10212591
1490 Ga0157375_10000124
1491 Ga0157375_10204393
1492 Ga0163163_10000745
1493 Ga0163163_10013111
1494 Ga0157380_10000140
1495 Ga0157380_10488530
1496 Ga0157377_10000117
1497 Ga0157379_10000785
1498 Ga0157379_10021545
1499 Ga0157379_10090285
1500 Ga0157379_10131578
1501 Ga0157379_10131771
1502 Ga0157376_10000034
1503 Ga0157376_10078444
1504 Ga0157376_10516039
1505 Ga0163161_10000448
1506 Ga0213874_10037206
1507 Ga0209233_1005206
1508 Ga0207666_1000017
1509 Ga0209130_1000930
1510 Ga0209675_1003692
1511 Ga0209025_1000357
1512 Ga0209025_1006354
1513 Ga0209025_1027376
1514 Ga0209564_1000580
1515 Ga0209564_1000790
1516 Ga0209256_1000504
1517 Ga0209256_1000695
1518 Ga0207697_10000009
1519 Ga0207653_10005862
1520 Ga0207653_10006516
1521 Ga0207682_10000016
1522 Ga0207692_10006732
1523 Ga0207692_10049334
1524 Ga0207692_10081307
1525 Ga0207642_10001066
1526 Ga0207710_10000872
1527 Ga0207710_10042878
1528 Ga0207688_10000012
1529 Ga0207688_10000724
1530 Ga0207688_10012750
1531 Ga0207680_10004638
1532 Ga0207680_10007328
1533 Ga0207647_10000675
1534 Ga0207685_10002531
1535 Ga0207685_10003645
1536 Ga0207699_10000471
1537 Ga0207699_10058348
1538 Ga0207645_10000124
1539 Ga0207645_10014691
1540 Ga0207643_10000075
1541 Ga0207643_10002257
1542 Ga0207684_10028032
1543 Ga0207654_10001577
1544 Ga0207654_10102791
1545 Ga0207654_10160888
1546 Ga0207707_10006050
1547 Ga0207707_10017365
1548 Ga0207707_10153684
1549 Ga0207707_10200959
1550 Ga0207707_10288018
1551 Ga0207671_10004598
1552 Ga0207693_10007591
1553 Ga0207693_10007801
1554 Ga0207693_10009539
1555 Ga0207693_10010807
1556 Ga0207693_10080348
1557 Ga0207693_10087329
1558 Ga0207693_10098075
1559 Ga0207663_10033218
1560 Ga0207663_10054700
1561 Ga0207663_10066103
1562 Ga0207663_10119156
1563 Ga0207660_10000489
1564 Ga0207660_10066164
1565 Ga0207660_10082119
1566 Ga0207662_10000466
1567 Ga0207662_10003107
1568 Ga0207662_10029187
1569 Ga0207657_10000162
1570 Ga0207657_10020188
1571 Ga0207657_10025969
1572 Ga0207649_10000411
1573 Ga0207649_10265672
1574 Ga0207652_10007710
1575 Ga0207652_10141802
1576 Ga0207652_10181365
1577 Ga0207646_10169050
1578 Ga0207681_10001617
1579 Ga0207694_10079957
1580 Ga0207650_10005173
1581 Ga0207650_10017729
1582 Ga0207659_10000017
1583 Ga0207687_10000417
1584 Ga0207687_10033527
1585 Ga0207687_10065475
1586 Ga0207700_10001122
1587 Ga0207700_10005932
1588 Ga0207700_10019154
1589 Ga0207700_10058890
1590 Ga0207700_10174603
1591 Ga0207664_10017837
1592 Ga0207644_10002417
1593 Ga0207644_10007214
1594 Ga0207644_10030185
1595 Ga0207690_10000151
1596 Ga0207690_10022512
1597 Ga0207690_10105350
1598 Ga0207706_10000368
1599 Ga0207706_10002835
1600 Ga0207706_10017875
1601 Ga0207706_10035451
1602 Ga0207686_10002957
1603 Ga0207686_10134991
1604 Ga0207709_10000256
1605 Ga0207709_10048397
1606 Ga0207670_10000086
1607 Ga0207669_10000398
1608 Ga0207669_10306386
1609 Ga0207704_10000139
1610 Ga0207704_10020379
1611 Ga0207704_10185629
1612 Ga0207665_10000204
1613 Ga0207665_10006321
1614 Ga0207665_10014646
1615 Ga0207665_10221950
1616 Ga0207691_10000303
1617 Ga0207691_10016212
1618 Ga0207711_10049816
1619 Ga0207689_10000109
1620 Ga0207689_10003705
1621 Ga0207689_10359761
1622 Ga0207661_10000074
1623 Ga0207661_10102176
1624 Ga0207679_10000031
1625 Ga0207667_10031004
1626 Ga0207667_10131935
1627 Ga0207667_10516451
1628 Ga0207651_10000044
1629 Ga0207651_10261780
1630 Ga0207712_10007106
1631 Ga0207712_10098775
1632 Ga0207668_10000345
1633 Ga0207668_10068502
1634 Ga0207640_10001716
1635 Ga0207640_10131110
1636 Ga0207658_10005012
1637 Ga0207658_10051910
1638 Ga0207658_10060072
1639 Ga0207658_10141485
1640 Ga0207677_10002560
1641 Ga0207677_10012300
1642 Ga0207703_10002483
1643 Ga0207703_10011289
1644 Ga0207639_10004898
1645 Ga0207678_10000158
1646 Ga0207678_10003070
1647 Ga0207708_10000098
1648 Ga0207708_10000416
1649 Ga0207702_10014157
1650 Ga0207702_10269951
1651 Ga0207702_10306472
1652 Ga0207641_10000408
1653 Ga0207641_10143181
1654 Ga0207641_10270308
1655 Ga0207648_10000696
1656 Ga0207648_10005386
1657 Ga0207648_10010270
1658 Ga0207648_10022337
1659 Ga0207676_10006295
1660 Ga0207676_10074682
1661 Ga0207674_10000420
1662 Ga0207674_10087738
1663 Ga0207674_10277455
1664 Ga0207675_100001146
1665 Ga0207675_100001268
1666 Ga0207675_100061395
1667 Ga0207675_100220445
1668 Ga0207683_10000004
1669 Ga0207683_10001766
1670 Ga0207683_10006982
1671 Ga0207698_10001253
1672 Ga0207698_10098636
1673 Ga0209967_1012008
1674 Ga0210002_1000731
1675 Ga0209983_1018941
1676 Ga0209966_1003032
1677 Ga0209998_10000945
1678 Ga0209974_10000117
1679 Ga0209974_10077748
1680 Ga0207428_10000250
1681 Ga0207428_10001707
1682 Ga0207428_10002343
1683 Ga0268265_10000752
1684 Ga0268265_10131359
1685 Ga0268265_10258375
1686 Ga0268264_10002529
1687 Ga0268264_10038211
1688 Ga0265337_1002301
1689 Ga0265324_10032758
1690 Ga0265325_10000039
1691 Ga0265325_10002499
1692 Ga0265325_10003454
1693 Ga0265325_10036910
1694 Ga0265325_10052094
1695 Ga0265340_10052354
1696 Ga0265339_10006717
1697 Ga0265339_10016529
1698 Ga0265339_10024016
1699 Ga0265331_10001218
1700 Ga0265331_10029044
1701 Ga0265316_10148171
1702 Ga0265313_10000021
1703 Ga0265313_10000057
1704 Ga0265313_10002016
1705 Ga0265313_10017419
1706 Ga0265313_10029421
1707 Ga0265313_10039737
1708 Ga0265313_10052558
1709 Ga0265314_10004299
1710 Ga0265314_10005478
1711 Ga0265314_10009434
1712 Ga0265342_10003392
1713 Ga0265342_10025747
1714 Ga0265342_10039196
1715 Ga0316576_10323306
1716 Ga0316583_10008041
1717 Ga0373930_0003658
1718 Ga0373948_0000331
1719 Ga0373950_0000525
1720 Ga0373950_0002206
1721 Ga0373950_0009375
1722 Ga0373958_0001188
1723 Ga0373959_0003250
1724 Ga0373938_0003628
1725 Ga0373926_0004729
1726 Ga0373926_0013859
1727 Ga0373928_0002766
1728 Ga0373929_0000934
1729 Ga0373929_0005827
1730 Ga0373934_0038218
1731 Ga0373934_0114124
1732 Ga0373940_0000070
1733 Ga0373944_0000293
1734 Ga0373949_0000878
1735 Ga0373949_0002003
1736 Ga0373951_0001550
1737 Ga0373951_0006833
1738 Ga0373952_0002820
1739 Ga0373952_0008501
1740 Ga0373923_0021776
1741 Ga0373923_0057726
1742 Ga0373932_0000094
1743 Ga0373936_0004221
1744 Ga0373939_0000436
1745 Ga0373939_0004620
1746 Ga0373941_0000404
1747 Ga0373941_0000909
1748 Ga0373945_0051977
1749 Ga0373953_0001892
1750 Ga0373953_0002543
1751 Ga0373953_0028516
1752 Ga0373954_0002451
1753 Ga0373954_0017633
1754 Ga0373956_0005141
1755 Ga0373957_0008056
1756 Ga0373960_0003391
1757 Ga0373960_0006721
1758 Ga0373960_0019556
1759 Ga0373943_0000574
1760 Ga0373943_0038255
1761 Ga0373943_0055379
1762 Ga0373943_0092472
1763 Ga0373946_0001887
1764 Ga0373946_0030093
1765 Ga0373955_0000179
1766 Ga0373955_0000573
1767 Ga0373955_0009737
1768 Ga0373955_0052874
1769 Ga0373942_0003796
1770 Ga0373942_0004402
1771 Ga0373961_0003554
1772 Ga0373962_0000137
1773 Ga0373962_0001436
1774 Ga0373962_0010790
1775 Ga0316574_0003710
1776 Ga0373924_0000231
1777 Ga0373924_0003315
1778 Ga0373924_0039594
1779 Ga0373924_0050973
1780 Ga0373924_0080610
1781 Ga0373931_0000034
1782 Ga0373931_0004201
1783 Ga0373931_0168071
1784 Ga0373935_0000041
1785 Ga0373935_0027233
1786 Ga0373927_0013903
1787 Ga0373927_0067208
1788 Ga0373927_0103055
1789 Ga0373927_0106884
1790 Ga0373927_0133573
1791 Ga0373933_0000827
1792 Ga0373933_0000876
1793 Ga0373933_0004375
1794 Ga0373933_0038252
1795 Ga0373933_0044678
1796 Ga0373933_0190104
1797 Ga0373947_0000606
1798 Ga0373947_0039421
1799 Ga0373947_0066320
1800 Ga0373937_0000458
1801 Ga0373937_0004869
1802 Ga0373937_0011492
1803 Ga0373937_0011831
1804 Ga0373937_0015291
1805 Ga0373937_0016247
1806 Ga0373937_0049613
1807 Ga0373937_0141643
1808 Ga0316582_0223725
1809 Ga0373925_0000084
1810 Ga0373925_0023174
1811 Ga0373925_0048639
1812 Ga0373925_0144652
1813 Ga0373925_0258493
1814 Ga0373925_0279066
1815 Ga0373925_0293022
1816 Ga0436364_0815578
1817 Ga0436364_1454102
1818 Ga0436360_0478773
1819 Ga0436360_0682085
1820 Ga0436360_0961521
1821 Ga0436361_0003682
1822 Ga0436363_1560263
1823 Ga0466967_0078916
1824 Ga0495617_026205
1825 Ga0495627_041952
1826 Ga0495592_0000026
1827 Ga0495592_0007769
1828 Ga0495592_0013078
1829 Ga0495592_0027747
1830 Ga0495592_0082742
1831 Ga0495629_0002921
1832 Ga0495629_0010593
1833 Ga0495638_0063532
1834 Ga0495641_0050150
1835 Ga0495641_0067144
1836 Ga0495651_0001559
1837 Ga0495651_0009033
1838 Ga0495651_0014408
1839 Ga0495651_0030845
1840 Ga0495653_0000003
1841 Ga0495653_0007399
1842 Ga0495582_0066961
1843 Ga0495582_0149324
1844 Ga0495582_0164943
1845 Ga0495639_0022520
1846 Ga0495639_0024518
1847 Ga0495662_0024038
1848 Ga0495664_0000001
1849 Ga0495664_0005683
1850 Ga0495584_0028231
1851 Ga0495584_0043390
1852 Ga0495584_0128304
1853 Ga0495585_0002362
1854 Ga0495594_0062544
1855 Ga0495607_0007810
1856 Ga0495583_0036681
1857 Ga0495608_0000012
1858 Ga0495608_0006328
1859 Ga0495608_0051798
1860 Ga0495618_0008669
1861 Ga0495618_0029856
1862 Ga0495628_0000095
1863 Ga0495628_0006043
1864 Ga0495628_0018089
1865 Ga0495628_0064924
1866 Ga0495630_0002688
1867 Ga0495630_0015138
1868 Ga0495630_0026641
1869 Ga0495630_0160924
1870 Ga0495631_0058073
1871 Ga0495644_0003320
1872 Ga0495644_0010527
1873 Ga0495663_0008764
1874 Ga0495666_0006722
1875 Ga0495652_0000001
1876 Ga0495652_0023334
1877 Ga0495652_0024406
1878 Ga0495665_0027624
1879 Ga0495665_0028821
1880 Ga0495640_0000010
1881 Ga0495640_0011907
1882 Ga0495640_0032087
1883 Ga0495586_0028866
1884 Ga0495586_0123593
1885 Ga0495587_0000003
1886 Ga0495587_0000784
1887 Ga0495587_0014912
1888 Ga0495587_0038540
1889 Ga0495609_0023490
1890 Ga0495645_0000026
1891 Ga0495645_0001504
1892 Ga0495645_0010117
1893 Ga0495622_0015371
1894 Ga0495667_0000001
1895 Ga0495667_0005788
1896 Ga0495667_0011936
1897 Ga0495667_0036076
1898 Ga0495667_0048298
1899 Ga0495656_0004129
1900 Ga0495656_0004992
1901 Ga0495634_0000037
1902 Ga0495634_0016507
1903 Ga0495634_0170556
1904 Ga0495635_0000011
1905 Ga0495635_0004840
1906 Ga0495635_0033836
1907 Ga0495635_0136158
1908 Ga0495635_0176270
1909 Ga0495659_0007435
1910 Ga0495661_0097359
1911 Ga0495588_0003043
1912 Ga0495657_0000050
1913 Ga0495657_0000582
1914 Ga0495599_0000004
1915 Ga0495599_0006216
1916 Ga0495599_0031357
1917 Ga0495599_0046099
1918 Ga0495623_0000081
1919 Ga0495623_0006875
1920 Ga0495623_0013754
1921 Ga0495623_0035106
1922 Ga0495646_0000010
1923 Ga0495646_0000200
1924 Ga0495646_0022383
1925 Ga0495647_0001076
1926 Ga0495647_0014060
1927 Ga0495658_0001728
1928 Ga0495658_0003067
1929 Ga0495658_0134353
1930 Ga0495658_0207945
1931 Ga0495613_0008422
1932 Ga0495613_0035259
1933 Ga0495624_0011303
1934 Ga0495624_0014992
1935 Ga0495624_0042983
1936 Ga0495671_0027293
1937 Ga0495600_0000007
1938 Ga0495600_0001285
1939 Ga0495600_0007437
1940 Ga0495600_0011093
1941 Ga0495581_0002943
1942 Ga0495581_0011203
1943 Ga0495581_0062533
1944 Ga0495581_0097487
1945 Ga0495604_0000010
1946 Ga0495604_0005339
1947 Ga0495604_0012612
1948 Ga0495604_0012983
1949 Ga0495604_0024305
1950 Ga0495604_0035103
1951 Ga0495604_0123084
1952 Ga0495674_0000013
1953 Ga0495674_0146698
1954 Ga0495674_0258991
1955 Ga0495674_0334528
1956 Ga0495676_0017489
1957 Ga0495676_0052021
1958 Ga0495676_0069527
1959 Ga0495676_0091904
1960 Ga0495676_0126249
1961 Ga0495680_0000078
1962 Ga0495680_0001872
1963 Ga0495680_0004686
1964 Ga0495680_0004980
1965 Ga0495680_0012957
1966 Ga0495680_0039186
1967 Ga0495680_0205747
1968 Ga0495675_0000305
1969 Ga0495675_0006007
1970 Ga0495675_0013982
1971 Ga0495681_0101166
1972 Ga0495684_0000008
1973 Ga0495684_0059040
1974 Ga0495684_0062269
1975 Ga0495593_0000145
1976 Ga0495593_0002171
1977 Ga0495593_0006743
1978 Ga0495602_0000002
1979 Ga0495602_0009411
1980 Ga0495602_0015651
1981 Ga0495602_0015918
1982 Ga0495602_0160995
1983 Ga0495614_0012218
1984 Ga0496100_0000679
1985 Ga0496100_0005609
1986 Ga0496100_0010839
1987 Ga0496100_0020414
1988 Ga0496100_0049389
1989 Ga0496100_0080139
1990 Ga0496101_0000121
1991 Ga0496101_0002379
1992 Ga0496101_0072114
1993 Ga0496102_0001800
1994 Ga0496102_0003585
1995 Ga0496102_0142914
1996 Ga0496102_0146266
1997 Ga0496103_0002140
1998 Ga0496103_0002528
1999 Ga0496103_0019764
2000 Ga0496104_0000575
2001 Ga0496104_0009294
2002 Ga0496104_0033246
2003 Ga0496104_0060319
2004 Ga0496104_0061472
2005 Ga0496105_0005756
2006 Ga0496105_0014700
2007 Ga0496105_0026365
2008 Ga0496105_0037340
2009 Ga0496105_0038085
2010 Ga0496105_0274656
2011 Ga0496106_0000133
2012 Ga0496106_0004497
2013 Ga0496106_0029780
2014 Ga0496106_0036322
2015 Ga0496106_0055385
2016 Ga0496106_0195346
2017 Ga0496107_0001229
2018 Ga0496107_0011864
2019 Ga0496107_0026643
2020 Ga0496107_0054233
2021 Ga0496107_0070643
2022 Ga0496107_0150469
2023 Ga0496107_0259886
2024 Ga0496108_0005937
2025 Ga0496108_0006248
2026 Ga0496108_0010047
2027 Ga0496108_0013329
2028 Ga0496108_0016034
2029 Ga0496108_0149094
2030 Ga0496108_0389807
2031 Ga0496109_0006607
2032 Ga0496109_0006735
2033 Ga0496109_0006919
2034 Ga0496109_0016552
2035 Ga0496109_0163386
2036 Ga0496110_0006375
2037 Ga0496110_0025620
2038 Ga0496110_0040058
2039 Ga0496110_0082707
2040 Ga0496110_0101737
2041 Ga0496110_0161381
2042 Ga0496110_0237387
2043 Ga0496111_0008013
2044 Ga0496111_0012311
2045 Ga0496111_0023099
2046 Ga0496111_0023383
2047 Ga0496111_0023811
2048 Ga0496111_0028981
2049 Ga0496111_0045320
2050 Ga0496111_0235273
2051 Ga0496111_0293535
2052 Ga0496112_0001095
2053 Ga0496112_0028750
2054 Ga0496112_0103617
2055 Ga0496112_0137026
2056 Ga0496112_0184414
2057 Ga0496112_0286534
2058 Ga0496113_0006833
2059 Ga0496113_0010461
2060 Ga0496113_0030136
2061 Ga0496113_0034994
2062 Ga0496113_0102121
2063 Ga0496113_0244011
2064 Ga0496113_0251316
2065 Ga0496114_0024196
2066 Ga0496114_0061556
2067 Ga0496114_0142440
2068 Ga0496115_0004251
2069 Ga0496115_0044425
2070 Ga0496115_0052630
2071 Ga0496115_0053974
2072 Ga0496115_0056919
2073 Ga0496115_0089844
2074 Ga0496117_0074455
2075 Ga0496122_0018456
2076 Ga0496122_0132407
2077 Ga0496123_0011563
2078 Ga0496123_0030058
2079 Ga0496123_0093631
2080 Ga0501031_0001650
2081 Ga0501032_0016718
2082 Ga0501032_0045230
2083 Ga0501032_0084246
2084 Ga0501032_0132560
2085 Ga0501033_0049551
2086 Ga0501033_0055120
2087 Ga0501033_0074193
2088 Ga0501034_0000032
2089 Ga0501034_0000623
2090 Ga0501034_0011296
2091 Ga0501034_0015888
2092 Ga0501034_0036635
2093 Ga0501034_0044949
2094 Ga0501034_0078963
2095 Ga0501034_0081950
2096 Ga0501034_0146865
2097 Ga0501034_0380316
2098 Ga0501034_0424268
2099 Ga0501036_0007360
2100 Ga0501036_0010284
2101 Ga0501036_0048396
2102 Ga0501036_0054322
2103 Ga0501036_0070649
2104 Ga0501037_0004970
2105 Ga0501037_0005615
2106 Ga0501037_0009466
2107 Ga0501037_0013851
2108 Ga0501037_0075101
2109 Ga0501037_0099786
2110 Ga0501038_0008677
2111 Ga0501038_0011705
2112 Ga0501038_0043948
2113 Ga0501038_0048763
2114 Ga0501038_0098638
2115 Ga0501039_0009153
2116 Ga0501039_0014974
2117 Ga0501039_0296060
2118 Ga0501042_0272524
2119 Ga0501043_0001573
2120 Ga0501043_0014132
2121 Ga0501043_0017896
2122 Ga0501043_0043984
2123 Ga0501043_0081974
2124 Ga0501046_0009868
2125 Ga0501046_0042134
2126 Ga0501047_0000010
2127 Ga0501047_0015576
2128 Ga0501047_0021992
2129 Ga0501047_0036706
2130 Ga0501047_0053829
2131 Ga0501047_0084142
2132 Ga0501047_0129064
2133 Ga0501047_0157287
2134 Ga0501047_0203524
2135 Ga0501048_0000168
2136 Ga0501048_0014318
2137 Ga0501067_0092874
2138 Ga0501067_0119614
2139 Ga0501068_0015863
2140 Ga0501068_0030640
2141 Ga0501068_0039312
2142 Ga0501069_0011306
2143 Ga0501069_0014514
2144 Ga0501069_0046904
2145 Ga0501069_0048103
2146 Ga0501070_0004804
2147 Ga0501070_0008692
2148 Ga0501070_0018877
2149 Ga0501070_0024148
2150 Ga0501070_0042126
2151 Ga0501070_0072099
2152 Ga0501070_0073990
2153 Ga0501071_0085944
2154 Ga0501071_0332179
2155 Ga0501072_0060633
2156 Ga0501072_0105701
2157 Ga0501072_0115525
2158 Ga0501072_0285537
2159 Ga0501073_0008770
2160 Ga0501073_0009775
2161 Ga0501073_0034787
2162 Ga0501073_0112314
2163 Ga0501073_0262691
2164 Ga0501074_0011571
2165 Ga0501074_0015553
2166 Ga0501074_0092443
2167 Ga0501075_0157073
2168 Ga0501076_0224885
2169 Ga0501080_0000198
2170 Ga0501080_0014363
2171 Ga0501080_0017519
2172 Ga0501080_0038138
2173 Ga0501080_0096651
2174 Ga0501080_0113375
2175 Ga0501080_0201842
2176 Ga0501083_0001536
2177 Ga0501083_0011302
2178 Ga0501083_0038503
2179 Ga0501035_0000994
2180 Ga0501035_0027935
2181 Ga0501035_0233210
2182 Ga0501044_0002086
2183 Ga0501044_0005135
2184 Ga0501044_0014287
2185 Ga0501044_0136706
2186 Ga0501044_0160100
2187 Ga0501044_0209404
2188 Ga0501044_0339605
2189 nmdc:mga03683_47548_c1
2190 nmdc:mga03683_49545_c1
2191 nmdc:mga03683_67690_c1
2192 nmdc:mga03n38_3239_c1
2193 nmdc:mga00v17_19178_c1
2194 nmdc:mga00v17_87978_c1
2195 nmdc:mga00v17_9160_c1
2196 nmdc:mga0yw44_1900_c1
2197 nmdc:mga0yw44_7593_c1
2198 nmdc:mga0yw44_8643_c1
2199 nmdc:mga0k408_75005_c1
2200 nmdc:mga06z11_204072_c1
2201 nmdc:mga06z11_82159_c1
2202 nmdc:mga06z11_9433_c1
2203 nmdc:mga04h51_4310_c1
2204 nmdc:mga04h51_6053_c1
2205 nmdc:mga05p37_2711_c2
2206 nmdc:mga05p37_354_c1
2207 nmdc:mga05p37_53293_c1
2208 nmdc:mga05p37_7402_c1
2209 nmdc:mga09592_1147_c1
2210 nmdc:mga0qj67_20294_c1
2211 nmdc:mga0qj67_219409_c1
2212 nmdc:mga0qj67_316678_c1
2213 nmdc:mga06r32_115465_c1
2214 nmdc:mga06r32_147_c1
2215 nmdc:mga06r32_32730_c1
2216 nmdc:mga06r32_91117_c1
2217 nmdc:mga08y16_289_c1
2218 nmdc:mga08y16_344933_c1
2219 nmdc:mga08y16_4156_c1
2220 nmdc:mga08y16_49079_c1
2221 nmdc:mga08y16_6983_c1
2222 nmdc:mga0n895_109704_c1
2223 nmdc:mga0n895_148630_c1
2224 nmdc:mga0n895_191567_c1
2225 nmdc:mga0n895_2287_c1
2226 nmdc:mga0n895_2438_c1
2227 nmdc:mga0n895_50171_c1
2228 nmdc:mga0n895_64716_c1
2229 nmdc:mga0n895_70268_c1
2230 nmdc:mga0rr50_52939_c1
2231 nmdc:mga0rr50_60619_c1
2232 nmdc:mga0rr50_866_c1
2233 nmdc:mga08x19_133724_c1
2234 nmdc:mga08x19_57652_c1
2235 nmdc:mga0a205_47327_c1
2236 nmdc:mga0a205_60_c1
2237 nmdc:mga0a205_733_c1
2238 nmdc:mga0sz30_32048_c1
2239 Ga0495601_0000003
2240 Ga0495601_0000633
2241 Ga0495601_0009435
2242 Ga0495601_0014499
2243 Ga0495601_0039919
2244 Ga0495601_0128092
2245 Ga0495612_0000009
2246 Ga0495612_0001588
2247 Ga0495612_0008883
2248 Ga0495612_0010222
2249 Ga0495612_0012233
2250 Ga0495655_0003034
2251 Ga0495595_0000011
2252 Ga0495595_0002035
2253 Ga0495595_0002334
2254 Ga0495595_0003065
2255 Ga0495595_0003222
2256 Ga0495595_0014156
2257 Ga0495619_0000039
2258 Ga0495619_0000859
2259 Ga0495619_0000996
2260 Ga0495619_0003147
2261 Ga0495619_0003231
2262 Ga0495619_0003678
2263 Ga0495619_0035546
2264 Ga0495619_0095560
2265 Ga0495619_0182146
2266 Ga0500644_0000321
2267 Ga0500651_0012299
2268 Ga0500641_0005670
2269 Ga0500595_000002
2270 Ga0500595_011319
2271 Ga0500595_015084
2272 Ga0500652_000080
2273 Ga0500652_017107
2274 Ga0500616_0000002
2275 Ga0500616_0024210
2276 Ga0500636_0034305
2277 Ga0500645_000086
2278 Ga0501084_0051321
2279 Ga0501082_0117241
2280 Ga0501082_0149258
2281 Ga0530510_0241753
2282 2643756745
2283 2644734686
2284 2644746428
2285 2819722198
2286 2841765059
2287 2841912545
2288 2841918300
2289 2844105584
2290 2851183855
2291 2851249599
2292 2883578826
2293 2917703097
2294 8057532912

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

25

139

0.95

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

180

308

0.92

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

212

342

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k1s-assembly1.cif.gz_B crystal structure of aibc 0.9181 38 314
4jbh-assembly2.cif.gz_B 2.2a resolution structure of cobalt and zinc bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum 0.9122 36 316
3krt-assembly1.cif.gz_D crystal structure of putative crotonyl coa reductase from streptomyces coelicolor a3(2) 0.9111 34 314
5k1s-assembly2.cif.gz_D crystal structure of aibc 0.9076 35 314
4y1b-assembly1.cif.gz_A structure of crotonyl-coa carboxylase/reductase ante v350a in complex with nadp 0.9074 36 314
ID Description Score Start End Superfamily
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9637 129 264 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.954 123 264 3.40.50.720
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9501 129 264 3.40.50.720
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9408 127 263 3.40.50.720
af_Q54UL7_143_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9355 123 263 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V9S5C6-F1-model_v4 Alcohol dehydrogenase 0.9651 118 316 GO:0016491
AF-A0A2V7IB97-F1-model_v4 NADPH:quinone reductase 0.9579 156 316
AF-X0UTV7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9514 98 315 GO:0016491
AF-A0A2V9S5C6-F1-model_v4 Alcohol dehydrogenase 0.9512 118 316 GO:0016491
AF-A0A6B1FE41-F1-model_v4 Zinc-binding dehydrogenase 0.9507 101 316 GO:0016491

Map