F490809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1147 | 458 | 2294 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100092825|Ga0068853_1000928251 |
| Length | 345 |
| Sequence | MQALRLIEDGRLQLEDNLPEPPAPAPGEVVVRMKAVALNHIDLWGFRGMAFAKRKLPIIVGVEGAGEIAAVGAGVTNRRPGDAVAIYAGLFCGHCGPCRRGIENLCENIADGGIMGFHRDGVAAQYVPVPVRQTVPVPAGVGWAQAATAPVTFGTVQHMLFDNAKLLPGETILVHAGASGIGTTAILMAKAIGARVLTTVGSDEKMEAVKALGADHVLNYRKDRFETWARRLTGKKGVEVVFEHVGPDTWAGSLLSLKRGGRLVTCGSTSGISAETNLFHLFQQQIRIIASFGATVRNLAESMHKMAIGEALPVIDSEIPLAEFDKGLKRMADRAVIGKIIVHIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 26 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 27 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 113 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 114 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 166 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 245 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 248 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 250 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 251 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 254 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 256 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 257 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 258 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 259 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 263 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 265 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 266 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 292 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 296 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 300 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 302 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 303 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 304 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 370 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 371 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 372 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 373 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 374 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 375 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 378 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 379 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 380 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 381 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 382 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 383 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 384 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 385 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 386 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 415 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 416 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 417 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 418 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 437 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 438 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 439 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 440 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 443 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 446 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 447 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 448 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 449 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 450 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 451 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 452 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 453 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 454 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 455 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 456 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 457 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 458 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.87 |
| Metatranscriptomes | 0 |
| Isolates | 1.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.06 |
| Nodule | 0.61 |
| Rhizoplane | 7.85 |
| Rhizosphere | 85.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068853_100092825 | 3300005539 | Bacteria | 2656 |
| 2 | 2214828543 | 2209111006 | Bacteria | 9216 |
| 3 | ARcpr5oldR_c000091 | 3300000041 | Bacteria | 16524 |
| 4 | ARSoilYngRDRAFT_c00530 | 3300000042 | Bacteria | 4360 |
| 5 | ARcpr5yngRDRAFT_c000035 | 3300000043 | Bacteria | 21396 |
| 6 | ARSoilOldRDRAFT_c000038 | 3300000044 | Bacteria | 30035 |
| 7 | ARCol0oldRDRAFT_c00271 | 3300000045 | Bacteria | 4970 |
| 8 | ARCol0yngRDRAFT_1000226 | 3300000652 | Bacteria | 9392 |
| 9 | ARCol0yngRDRAFT_1000544 | 3300000652 | Bacteria | 4271 |
| 10 | JGI24741J21665_1013859 | 3300001915 | Bacteria | 1358 |
| 11 | JGI24752J21851_1001007 | 3300001976 | Bacteria | 3849 |
| 12 | JGI24746J21847_1000328 | 3300001977 | Bacteria | 6818 |
| 13 | JGI24739J22299_10000158 | 3300001989 | Bacteria | 22012 |
| 14 | JGI24737J22298_10000549 | 3300001990 | Bacteria | 13141 |
| 15 | JGI24737J22298_10004390 | 3300001990 | Bacteria | 4922 |
| 16 | JGI24743J22301_10007575 | 3300001991 | Bacteria | 1888 |
| 17 | JGI24743J22301_10013699 | 3300001991 | Bacteria | 1487 |
| 18 | JGI24750J21931_1000073 | 3300002070 | Bacteria | 14740 |
| 19 | JGI24745J21846_1001047 | 3300002073 | Bacteria | 2600 |
| 20 | JGI24748J21848_1001221 | 3300002074 | Bacteria | 2810 |
| 21 | JGI24738J21930_10000776 | 3300002075 | Bacteria | 9124 |
| 22 | JGI24749J21850_1003382 | 3300002076 | Bacteria | 2232 |
| 23 | JGI24744J21845_10013510 | 3300002077 | Bacteria | 1645 |
| 24 | JGI24035J26624_1000662 | 3300002126 | Bacteria | 3186 |
| 25 | JGI24034J26672_10000658 | 3300002239 | Bacteria | 4431 |
| 26 | JGI24742J22300_10001071 | 3300002244 | Bacteria | 4224 |
| 27 | JGI24751J29686_10012928 | 3300002459 | Bacteria | 1723 |
| 28 | JGI25159J45721_1010413 | 3300002987 | Bacteria | 2368 |
| 29 | JGI25151J46595_10000264 | 3300003187 | Bacteria | 60338 |
| 30 | JGI25404J52841_10000088 | 3300003659 | Bacteria | 8697 |
| 31 | Ga0055526_1000443 | 3300003771 | Bacteria | 32967 |
| 32 | Ga0055526_1000897 | 3300003771 | Bacteria | 22154 |
| 33 | Ga0055524_1000328 | 3300003775 | Bacteria | 44226 |
| 34 | JGI25405J52794_10001764 | 3300003911 | Bacteria | 3613 |
| 35 | Ga0065165_1000497 | 3300005262 | Bacteria | 60783 |
| 36 | Ga0065717_1002158 | 3300005276 | Bacteria | 2683 |
| 37 | Ga0065712_10000346 | 3300005290 | Bacteria | 13762 |
| 38 | Ga0065712_10069119 | 3300005290 | Bacteria | 7981 |
| 39 | Ga0065715_10089004 | 3300005293 | Bacteria | 17365 |
| 40 | Ga0065707_10158335 | 3300005295 | Bacteria | 1587 |
| 41 | Ga0070658_10019548 | 3300005327 | Bacteria | 5423 |
| 42 | Ga0070676_10002105 | 3300005328 | Bacteria | 10132 |
| 43 | Ga0070683_100000152 | 3300005329 | Bacteria | 44662 |
| 44 | Ga0070690_100001131 | 3300005330 | Bacteria | 13708 |
| 45 | Ga0070690_100001419 | 3300005330 | Bacteria | 12493 |
| 46 | Ga0070690_100047729 | 3300005330 | Bacteria | 2725 |
| 47 | Ga0070690_100100122 | 3300005330 | Bacteria | 1921 |
| 48 | Ga0070670_100015820 | 3300005331 | Bacteria | 6475 |
| 49 | Ga0070677_10000385 | 3300005333 | Bacteria | 15484 |
| 50 | Ga0068869_100000020 | 3300005334 | Bacteria | 66561 |
| 51 | Ga0068869_100040477 | 3300005334 | Bacteria | 3332 |
| 52 | Ga0070666_10002859 | 3300005335 | Bacteria | 10423 |
| 53 | Ga0070666_10022181 | 3300005335 | Bacteria | 4121 |
| 54 | Ga0070666_10025545 | 3300005335 | Bacteria | 3852 |
| 55 | Ga0070680_100007933 | 3300005336 | Bacteria | 8100 |
| 56 | Ga0070680_100016097 | 3300005336 | Bacteria | 5876 |
| 57 | Ga0070680_100018394 | 3300005336 | Bacteria | 5520 |
| 58 | Ga0070680_100114312 | 3300005336 | Bacteria | 2249 |
| 59 | Ga0070680_100192072 | 3300005336 | Bacteria | 1721 |
| 60 | Ga0070682_100000264 | 3300005337 | Bacteria | 37644 |
| 61 | Ga0070682_100034397 | 3300005337 | Bacteria | 3086 |
| 62 | Ga0068868_100000944 | 3300005338 | Bacteria | 19746 |
| 63 | Ga0068868_100020698 | 3300005338 | Bacteria | 4948 |
| 64 | Ga0070660_100001464 | 3300005339 | Bacteria | 16152 |
| 65 | Ga0070660_100026578 | 3300005339 | Bacteria | 4311 |
| 66 | Ga0070660_100078209 | 3300005339 | Bacteria | 2594 |
| 67 | Ga0070660_100134509 | 3300005339 | Bacteria | 1980 |
| 68 | Ga0070689_100000646 | 3300005340 | Bacteria | 21086 |
| 69 | Ga0070689_100006301 | 3300005340 | Bacteria | 8195 |
| 70 | Ga0070691_10000125 | 3300005341 | Bacteria | 23286 |
| 71 | Ga0070691_10009716 | 3300005341 | Bacteria | 4389 |
| 72 | Ga0070687_100000772 | 3300005343 | Bacteria | 10645 |
| 73 | Ga0070661_100001434 | 3300005344 | Bacteria | 16565 |
| 74 | Ga0070661_100066257 | 3300005344 | Bacteria | 2653 |
| 75 | Ga0070661_100182066 | 3300005344 | Bacteria | 1599 |
| 76 | Ga0070692_10000497 | 3300005345 | Bacteria | 12069 |
| 77 | Ga0070692_10017928 | 3300005345 | Bacteria | 3395 |
| 78 | Ga0070668_100001692 | 3300005347 | Bacteria | 15990 |
| 79 | Ga0070668_100050455 | 3300005347 | Bacteria | 3204 |
| 80 | Ga0070669_100001308 | 3300005353 | Bacteria | 17982 |
| 81 | Ga0070675_100002535 | 3300005354 | Bacteria | 13657 |
| 82 | Ga0070675_100044035 | 3300005354 | Bacteria | 3650 |
| 83 | Ga0070675_100167635 | 3300005354 | Bacteria | 1892 |
| 84 | Ga0070671_100003193 | 3300005355 | Bacteria | 12776 |
| 85 | Ga0070671_100020677 | 3300005355 | Bacteria | 5370 |
| 86 | Ga0070671_100026051 | 3300005355 | Bacteria | 4803 |
| 87 | Ga0070674_100000152 | 3300005356 | Bacteria | 32268 |
| 88 | Ga0070674_100038619 | 3300005356 | Bacteria | 3219 |
| 89 | Ga0070673_100000042 | 3300005364 | Bacteria | 52952 |
| 90 | Ga0070673_100005416 | 3300005364 | Bacteria | 8166 |
| 91 | Ga0070688_100011743 | 3300005365 | Bacteria | 4882 |
| 92 | Ga0070688_100019218 | 3300005365 | Bacteria | 3956 |
| 93 | Ga0070688_100094394 | 3300005365 | Bacteria | 1961 |
| 94 | Ga0070659_100000621 | 3300005366 | Bacteria | 25919 |
| 95 | Ga0070659_100257830 | 3300005366 | Bacteria | 1446 |
| 96 | Ga0070667_100000775 | 3300005367 | Bacteria | 30249 |
| 97 | Ga0070667_100040683 | 3300005367 | Bacteria | 3898 |
| 98 | Ga0070709_10008346 | 3300005434 | Bacteria | 5687 |
| 99 | Ga0070709_10045817 | 3300005434 | Bacteria | 2717 |
| 100 | Ga0070709_10196960 | 3300005434 | Bacteria | 1424 |
| 101 | Ga0070714_100004348 | 3300005435 | Bacteria | 10679 |
| 102 | Ga0070714_100010885 | 3300005435 | Bacteria | 7202 |
| 103 | Ga0070714_100240517 | 3300005435 | Bacteria | 1670 |
| 104 | Ga0070713_100002823 | 3300005436 | Bacteria | 11370 |
| 105 | Ga0070713_100007614 | 3300005436 | Bacteria | 7619 |
| 106 | Ga0070713_100014010 | 3300005436 | Bacteria | 5937 |
| 107 | Ga0070713_100042866 | 3300005436 | Bacteria | 3696 |
| 108 | Ga0070713_100070461 | 3300005436 | Bacteria | 2951 |
| 109 | Ga0070710_10008204 | 3300005437 | Bacteria | 5080 |
| 110 | Ga0070710_10009182 | 3300005437 | Bacteria | 4833 |
| 111 | Ga0070710_10070188 | 3300005437 | Bacteria | 2017 |
| 112 | Ga0070701_10000042 | 3300005438 | Bacteria | 32304 |
| 113 | Ga0070711_100019807 | 3300005439 | Bacteria | 4324 |
| 114 | Ga0070711_100055857 | 3300005439 | Bacteria | 2729 |
| 115 | Ga0070711_100141484 | 3300005439 | Bacteria | 1804 |
| 116 | Ga0070711_100229006 | 3300005439 | Bacteria | 1448 |
| 117 | Ga0070711_100333040 | 3300005439 | Bacteria | 1216 |
| 118 | Ga0070705_100001795 | 3300005440 | Bacteria | 11096 |
| 119 | Ga0070705_100117671 | 3300005440 | Bacteria | 1710 |
| 120 | Ga0070700_100002917 | 3300005441 | Bacteria | 8773 |
| 121 | Ga0070700_100138618 | 3300005441 | Bacteria | 1650 |
| 122 | Ga0070700_100205424 | 3300005441 | Bacteria | 1386 |
| 123 | Ga0070694_100001840 | 3300005444 | Bacteria | 12559 |
| 124 | Ga0070708_100026481 | 3300005445 | Bacteria | 4965 |
| 125 | Ga0070708_100409509 | 3300005445 | Bacteria | 1279 |
| 126 | Ga0070663_100001813 | 3300005455 | Bacteria | 11882 |
| 127 | Ga0070663_100240403 | 3300005455 | Bacteria | 1429 |
| 128 | Ga0070678_100138776 | 3300005456 | Bacteria | 1942 |
| 129 | Ga0070662_100009703 | 3300005457 | Bacteria | 6299 |
| 130 | Ga0070662_100022381 | 3300005457 | Bacteria | 4327 |
| 131 | Ga0070681_10007379 | 3300005458 | Bacteria | 10746 |
| 132 | Ga0070681_10028900 | 3300005458 | Bacteria | 5570 |
| 133 | Ga0070681_10082515 | 3300005458 | Bacteria | 3170 |
| 134 | Ga0070681_10087773 | 3300005458 | Bacteria | 3062 |
| 135 | Ga0068867_100029544 | 3300005459 | Bacteria | 3950 |
| 136 | Ga0068867_100042878 | 3300005459 | Bacteria | 3311 |
| 137 | Ga0068867_100051447 | 3300005459 | Bacteria | 3038 |
| 138 | Ga0070685_10006591 | 3300005466 | Bacteria | 5923 |
| 139 | Ga0070685_10100277 | 3300005466 | Bacteria | 1767 |
| 140 | Ga0070685_10100747 | 3300005466 | Bacteria | 1764 |
| 141 | Ga0070707_100089097 | 3300005468 | Bacteria | 2985 |
| 142 | Ga0070679_100010500 | 3300005530 | Bacteria | 8786 |
| 143 | Ga0070679_100059875 | 3300005530 | Bacteria | 3795 |
| 144 | Ga0070679_100073029 | 3300005530 | Bacteria | 3423 |
| 145 | Ga0070679_100090289 | 3300005530 | Bacteria | 3052 |
| 146 | Ga0070679_100217427 | 3300005530 | Bacteria | 1873 |
| 147 | Ga0070679_100224148 | 3300005530 | Bacteria | 1840 |
| 148 | Ga0070684_100002220 | 3300005535 | Bacteria | 14325 |
| 149 | Ga0070684_100020410 | 3300005535 | Bacteria | 5498 |
| 150 | Ga0070684_100111323 | 3300005535 | Bacteria | 2455 |
| 151 | Ga0068853_100002983 | 3300005539 | Bacteria | 12902 |
| 152 | Ga0068853_100047591 | 3300005539 | Bacteria | 3680 |
| 153 | Ga0068853_100087529 | 3300005539 | Bacteria | 2734 |
| 154 | Ga0068853_100379633 | 3300005539 | Bacteria | 1319 |
| 155 | Ga0070672_100000557 | 3300005543 | Bacteria | 21802 |
| 156 | Ga0070672_100019246 | 3300005543 | Bacteria | 4952 |
| 157 | Ga0070686_100000889 | 3300005544 | Bacteria | 17366 |
| 158 | Ga0070686_100045503 | 3300005544 | Bacteria | 2765 |
| 159 | Ga0070686_100135243 | 3300005544 | Bacteria | 1709 |
| 160 | Ga0070695_100002375 | 3300005545 | Bacteria | 10814 |
| 161 | Ga0070695_100011291 | 3300005545 | Bacteria | 5341 |
| 162 | Ga0070696_100007145 | 3300005546 | Bacteria | 7456 |
| 163 | Ga0070696_100022886 | 3300005546 | Bacteria | 4249 |
| 164 | Ga0070696_100100305 | 3300005546 | Bacteria | 2074 |
| 165 | Ga0070696_100235161 | 3300005546 | Bacteria | 1380 |
| 166 | Ga0070693_100000816 | 3300005547 | Bacteria | 13812 |
| 167 | Ga0070693_100070602 | 3300005547 | Bacteria | 2055 |
| 168 | Ga0070665_100042419 | 3300005548 | Bacteria | 4573 |
| 169 | Ga0070665_100187472 | 3300005548 | Bacteria | 2069 |
| 170 | Ga0070665_100264445 | 3300005548 | Bacteria | 1721 |
| 171 | Ga0070704_100009648 | 3300005549 | Bacteria | 5847 |
| 172 | Ga0068855_100003933 | 3300005563 | Bacteria | 18135 |
| 173 | Ga0068855_100015053 | 3300005563 | Bacteria | 9314 |
| 174 | Ga0068855_100268801 | 3300005563 | Bacteria | 1896 |
| 175 | Ga0068855_100395937 | 3300005563 | Bacteria | 1514 |
| 176 | Ga0070664_100000263 | 3300005564 | Bacteria | 37910 |
| 177 | Ga0070664_100279361 | 3300005564 | Bacteria | 1506 |
| 178 | Ga0068857_100002138 | 3300005577 | Bacteria | 16066 |
| 179 | Ga0068857_100258402 | 3300005577 | Bacteria | 1598 |
| 180 | Ga0068857_100312943 | 3300005577 | Bacteria | 1449 |
| 181 | Ga0068854_100003820 | 3300005578 | Bacteria | 9426 |
| 182 | Ga0068856_100000803 | 3300005614 | Bacteria | 33893 |
| 183 | Ga0068856_100059903 | 3300005614 | Bacteria | 3761 |
| 184 | Ga0070702_100002410 | 3300005615 | Bacteria | 8050 |
| 185 | Ga0070702_100029823 | 3300005615 | Bacteria | 2970 |
| 186 | Ga0068852_100000579 | 3300005616 | Bacteria | 24117 |
| 187 | Ga0068859_100007549 | 3300005617 | Bacteria | 11043 |
| 188 | Ga0068859_100016354 | 3300005617 | Bacteria | 7453 |
| 189 | Ga0068864_100000112 | 3300005618 | Bacteria | 79688 |
| 190 | Ga0068864_100019256 | 3300005618 | Bacteria | 5706 |
| 191 | Ga0068864_100122118 | 3300005618 | Bacteria | 2330 |
| 192 | Ga0068866_10000300 | 3300005718 | Bacteria | 23587 |
| 193 | Ga0068866_10026972 | 3300005718 | Bacteria | 2719 |
| 194 | Ga0068861_100010541 | 3300005719 | Bacteria | 6417 |
| 195 | Ga0068861_100075102 | 3300005719 | Bacteria | 2630 |
| 196 | Ga0068870_10000108 | 3300005840 | Bacteria | 28313 |
| 197 | Ga0068870_10032303 | 3300005840 | Bacteria | 2660 |
| 198 | Ga0068863_100000491 | 3300005841 | Bacteria | 40157 |
| 199 | Ga0068863_100003267 | 3300005841 | Bacteria | 16008 |
| 200 | Ga0068858_100000419 | 3300005842 | Bacteria | 44155 |
| 201 | Ga0068858_100021340 | 3300005842 | Bacteria | 6050 |
| 202 | Ga0068858_100123945 | 3300005842 | Bacteria | 2418 |
| 203 | Ga0068860_100001036 | 3300005843 | Bacteria | 30573 |
| 204 | Ga0068860_100084253 | 3300005843 | Bacteria | 3024 |
| 205 | Ga0068862_100003792 | 3300005844 | Bacteria | 12881 |
| 206 | Ga0068862_100030972 | 3300005844 | Bacteria | 4511 |
| 207 | Ga0068862_100046460 | 3300005844 | Bacteria | 3705 |
| 208 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 209 | Ga0081455_10000807 | 3300005937 | Bacteria | 40308 |
| 210 | Ga0081455_10008889 | 3300005937 | Bacteria | 10385 |
| 211 | Ga0081455_10014935 | 3300005937 | Bacteria | 7567 |
| 212 | Ga0081455_10049456 | 3300005937 | Bacteria | 3624 |
| 213 | Ga0081455_10064218 | 3300005937 | Bacteria | 3076 |
| 214 | Ga0081538_10017231 | 3300005981 | Bacteria | 5495 |
| 215 | Ga0081540_1000011 | 3300005983 | Bacteria | 191880 |
| 216 | Ga0081540_1001420 | 3300005983 | Bacteria | 20722 |
| 217 | Ga0081540_1053834 | 3300005983 | Bacteria | 1970 |
| 218 | Ga0081539_10083226 | 3300005985 | Bacteria | 1675 |
| 219 | Ga0070717_10003833 | 3300006028 | Bacteria | 10822 |
| 220 | Ga0070717_10069761 | 3300006028 | Bacteria | 2928 |
| 221 | Ga0070717_10176313 | 3300006028 | Bacteria | 1861 |
| 222 | Ga0075365_10005156 | 3300006038 | Bacteria | 7022 |
| 223 | Ga0075365_10171951 | 3300006038 | Bacteria | 1512 |
| 224 | Ga0075368_10000443 | 3300006042 | Bacteria | 12217 |
| 225 | Ga0075368_10010049 | 3300006042 | Bacteria | 3415 |
| 226 | Ga0075363_100009180 | 3300006048 | Bacteria | 4644 |
| 227 | Ga0075364_10161533 | 3300006051 | Bacteria | 1512 |
| 228 | Ga0075432_10001253 | 3300006058 | Bacteria | 8180 |
| 229 | Ga0075432_10026658 | 3300006058 | Bacteria | 1986 |
| 230 | Ga0070715_10000530 | 3300006163 | Bacteria | 10002 |
| 231 | Ga0070716_100001432 | 3300006173 | Bacteria | 10611 |
| 232 | Ga0070716_100003368 | 3300006173 | Bacteria | 7518 |
| 233 | Ga0070712_100015060 | 3300006175 | Bacteria | 4972 |
| 234 | Ga0070712_100113287 | 3300006175 | Bacteria | 2028 |
| 235 | Ga0075362_10009446 | 3300006177 | Bacteria | 3773 |
| 236 | Ga0075362_10067906 | 3300006177 | Bacteria | 1623 |
| 237 | Ga0075367_10001869 | 3300006178 | Bacteria | 9308 |
| 238 | Ga0075367_10005992 | 3300006178 | Bacteria | 6107 |
| 239 | Ga0075367_10049267 | 3300006178 | Bacteria | 2483 |
| 240 | Ga0075369_10002023 | 3300006186 | Bacteria | 7141 |
| 241 | Ga0097621_100000115 | 3300006237 | Bacteria | 45694 |
| 242 | Ga0097621_100057842 | 3300006237 | Bacteria | 3172 |
| 243 | Ga0075370_10009560 | 3300006353 | Bacteria | 5039 |
| 244 | Ga0068871_100000417 | 3300006358 | Bacteria | 29416 |
| 245 | Ga0068871_100004915 | 3300006358 | Bacteria | 9336 |
| 246 | Ga0068871_100103493 | 3300006358 | Bacteria | 2387 |
| 247 | Ga0075428_100000363 | 3300006844 | Bacteria | 45033 |
| 248 | Ga0075428_100151120 | 3300006844 | Bacteria | 2522 |
| 249 | Ga0075428_100304573 | 3300006844 | Bacteria | 1713 |
| 250 | Ga0075430_100003344 | 3300006846 | Bacteria | 13430 |
| 251 | Ga0075430_100220435 | 3300006846 | Bacteria | 1574 |
| 252 | Ga0075431_100012459 | 3300006847 | Bacteria | 8583 |
| 253 | Ga0075431_100015943 | 3300006847 | Bacteria | 7624 |
| 254 | Ga0075433_10000187 | 3300006852 | Bacteria | 34883 |
| 255 | Ga0075433_10005073 | 3300006852 | Bacteria | 10324 |
| 256 | Ga0075433_10053921 | 3300006852 | Bacteria | 3507 |
| 257 | Ga0075434_100002790 | 3300006871 | Bacteria | 15468 |
| 258 | Ga0075434_100063307 | 3300006871 | Bacteria | 3681 |
| 259 | Ga0075434_100135205 | 3300006871 | Bacteria | 2485 |
| 260 | Ga0075434_100178720 | 3300006871 | Bacteria | 2142 |
| 261 | Ga0075434_100225071 | 3300006871 | Bacteria | 1895 |
| 262 | Ga0075429_100000846 | 3300006880 | Bacteria | 24030 |
| 263 | Ga0075429_100307916 | 3300006880 | Bacteria | 1387 |
| 264 | Ga0068865_100000450 | 3300006881 | Bacteria | 22865 |
| 265 | Ga0068865_100078568 | 3300006881 | Bacteria | 2361 |
| 266 | Ga0097620_100007549 | 3300006931 | Bacteria | 11043 |
| 267 | Ga0097620_100016351 | 3300006931 | Bacteria | 7453 |
| 268 | Ga0075435_100001311 | 3300007076 | Bacteria | 15971 |
| 269 | Ga0075435_100033548 | 3300007076 | Bacteria | 4060 |
| 270 | Ga0075435_100034161 | 3300007076 | Bacteria | 4027 |
| 271 | Ga0075435_100051236 | 3300007076 | Bacteria | 3325 |
| 272 | Ga0075435_100206572 | 3300007076 | Bacteria | 1665 |
| 273 | Ga0099795_10042884 | 3300007788 | Bacteria | 1617 |
| 274 | Ga0105244_10104891 | 3300009036 | Bacteria | 1380 |
| 275 | Ga0105240_10017084 | 3300009093 | Bacteria | 9797 |
| 276 | Ga0105240_10025233 | 3300009093 | Bacteria | 7816 |
| 277 | Ga0105240_10303052 | 3300009093 | Bacteria | 1827 |
| 278 | Ga0105240_10423907 | 3300009093 | Bacteria | 1494 |
| 279 | Ga0111539_10000196 | 3300009094 | Bacteria | 70998 |
| 280 | Ga0111539_10000376 | 3300009094 | Bacteria | 55320 |
| 281 | Ga0111539_10010434 | 3300009094 | Bacteria | 11690 |
| 282 | Ga0111539_10068463 | 3300009094 | Bacteria | 4191 |
| 283 | Ga0111539_10125812 | 3300009094 | Bacteria | 3003 |
| 284 | Ga0105245_10001838 | 3300009098 | Bacteria | 19304 |
| 285 | Ga0105245_10040100 | 3300009098 | Bacteria | 4170 |
| 286 | Ga0105247_10000844 | 3300009101 | Bacteria | 23209 |
| 287 | Ga0105247_10098942 | 3300009101 | Bacteria | 1862 |
| 288 | Ga0114129_10010654 | 3300009147 | Bacteria | 13110 |
| 289 | Ga0114129_10011780 | 3300009147 | Bacteria | 12443 |
| 290 | Ga0114129_10016386 | 3300009147 | Bacteria | 10548 |
| 291 | Ga0114129_10089838 | 3300009147 | Bacteria | 4258 |
| 292 | Ga0114129_10134685 | 3300009147 | Bacteria | 3390 |
| 293 | Ga0105243_10002666 | 3300009148 | Bacteria | 14829 |
| 294 | Ga0105243_10033223 | 3300009148 | Bacteria | 3989 |
| 295 | Ga0105243_10043352 | 3300009148 | Bacteria | 3526 |
| 296 | Ga0105243_10267486 | 3300009148 | Bacteria | 1533 |
| 297 | Ga0105241_10004421 | 3300009174 | Bacteria | 10395 |
| 298 | Ga0105241_10173764 | 3300009174 | Bacteria | 1781 |
| 299 | Ga0105241_10225526 | 3300009174 | Bacteria | 1577 |
| 300 | Ga0105242_10006586 | 3300009176 | Bacteria | 8948 |
| 301 | Ga0105242_10029473 | 3300009176 | Bacteria | 4378 |
| 302 | Ga0105242_10485285 | 3300009176 | Bacteria | 1172 |
| 303 | Ga0105248_10000500 | 3300009177 | Bacteria | 44664 |
| 304 | Ga0105248_10049476 | 3300009177 | Bacteria | 4714 |
| 305 | Ga0105248_10110811 | 3300009177 | Bacteria | 3095 |
| 306 | Ga0105237_10010999 | 3300009545 | Bacteria | 9605 |
| 307 | Ga0105237_10223516 | 3300009545 | Bacteria | 1883 |
| 308 | Ga0105237_10288125 | 3300009545 | Bacteria | 1645 |
| 309 | Ga0105238_10084920 | 3300009551 | Bacteria | 3155 |
| 310 | Ga0105238_10109250 | 3300009551 | Bacteria | 2747 |
| 311 | Ga0105238_10178648 | 3300009551 | Bacteria | 2099 |
| 312 | Ga0105249_10014148 | 3300009553 | Bacteria | 7053 |
| 313 | Ga0105249_10072442 | 3300009553 | Bacteria | 3185 |
| 314 | Ga0105239_10008765 | 3300010375 | Bacteria | 11449 |
| 315 | Ga0105239_10052422 | 3300010375 | Bacteria | 4474 |
| 316 | Ga0105239_10057594 | 3300010375 | Bacteria | 4263 |
| 317 | Ga0105239_10170571 | 3300010375 | Bacteria | 2433 |
| 318 | Ga0105239_10275788 | 3300010375 | Bacteria | 1892 |
| 319 | Ga0105246_10000033 | 3300011119 | Bacteria | 50575 |
| 320 | Ga0105246_10015886 | 3300011119 | Bacteria | 4761 |
| 321 | Ga0105246_10137277 | 3300011119 | Bacteria | 1834 |
| 322 | Ga0157342_1000140 | 3300012507 | Bacteria | 3618 |
| 323 | Ga0157342_1000149 | 3300012507 | Bacteria | 3528 |
| 324 | Ga0157373_10007875 | 3300013100 | Bacteria | 7925 |
| 325 | Ga0157373_10031343 | 3300013100 | Bacteria | 3827 |
| 326 | Ga0157371_10006432 | 3300013102 | Bacteria | 9696 |
| 327 | Ga0157371_10080644 | 3300013102 | Bacteria | 2305 |
| 328 | Ga0157370_10030840 | 3300013104 | Bacteria | 5251 |
| 329 | Ga0157370_10196034 | 3300013104 | Bacteria | 1874 |
| 330 | Ga0157369_10233946 | 3300013105 | Bacteria | 1920 |
| 331 | Ga0157369_10541240 | 3300013105 | Bacteria | 1204 |
| 332 | Ga0171462_1039 | 3300013250 | Bacteria | 76960 |
| 333 | Ga0157374_10003002 | 3300013296 | Bacteria | 14125 |
| 334 | Ga0157374_10029483 | 3300013296 | Bacteria | 4970 |
| 335 | Ga0157374_10216440 | 3300013296 | Bacteria | 1879 |
| 336 | Ga0157378_10002195 | 3300013297 | Bacteria | 17317 |
| 337 | Ga0157378_10122484 | 3300013297 | Bacteria | 2399 |
| 338 | Ga0163162_10001526 | 3300013306 | Bacteria | 21576 |
| 339 | Ga0163162_10079449 | 3300013306 | Bacteria | 3347 |
| 340 | Ga0157372_10049188 | 3300013307 | Bacteria | 4688 |
| 341 | Ga0157372_10198111 | 3300013307 | Bacteria | 2326 |
| 342 | Ga0157372_10212591 | 3300013307 | Bacteria | 2241 |
| 343 | Ga0157375_10000124 | 3300013308 | Bacteria | 76003 |
| 344 | Ga0157375_10204393 | 3300013308 | Bacteria | 2131 |
| 345 | Ga0163163_10000745 | 3300014325 | Bacteria | 27709 |
| 346 | Ga0163163_10013111 | 3300014325 | Bacteria | 7573 |
| 347 | Ga0157380_10000140 | 3300014326 | Bacteria | 40628 |
| 348 | Ga0157380_10488530 | 3300014326 | Bacteria | 1193 |
| 349 | Ga0157377_10000117 | 3300014745 | Bacteria | 53219 |
| 350 | Ga0157379_10000785 | 3300014968 | Bacteria | 25777 |
| 351 | Ga0157379_10021545 | 3300014968 | Bacteria | 5706 |
| 352 | Ga0157379_10090285 | 3300014968 | Bacteria | 2748 |
| 353 | Ga0157379_10131578 | 3300014968 | Bacteria | 2252 |
| 354 | Ga0157379_10131771 | 3300014968 | Bacteria | 2250 |
| 355 | Ga0157376_10000034 | 3300014969 | Bacteria | 161526 |
| 356 | Ga0157376_10078444 | 3300014969 | Bacteria | 2828 |
| 357 | Ga0157376_10516039 | 3300014969 | Bacteria | 1177 |
| 358 | Ga0163161_10000448 | 3300017792 | Bacteria | 34334 |
| 359 | Ga0213874_10037206 | 3300021377 | Bacteria | 1439 |
| 360 | Ga0209233_1005206 | 3300025261 | Bacteria | 4341 |
| 361 | Ga0207666_1000017 | 3300025271 | Bacteria | 40049 |
| 362 | Ga0209130_1000930 | 3300025284 | Bacteria | 23436 |
| 363 | Ga0209675_1003692 | 3300025291 | Bacteria | 7139 |
| 364 | Ga0209025_1000357 | 3300025294 | Bacteria | 98040 |
| 365 | Ga0209025_1006354 | 3300025294 | Bacteria | 9206 |
| 366 | Ga0209025_1027376 | 3300025294 | Bacteria | 2828 |
| 367 | Ga0209564_1000580 | 3300025295 | Bacteria | 58002 |
| 368 | Ga0209564_1000790 | 3300025295 | Bacteria | 43638 |
| 369 | Ga0209256_1000504 | 3300025299 | Bacteria | 57416 |
| 370 | Ga0209256_1000695 | 3300025299 | Bacteria | 44756 |
| 371 | Ga0207697_10000009 | 3300025315 | Bacteria | 67526 |
| 372 | Ga0207653_10005862 | 3300025885 | Bacteria | 3833 |
| 373 | Ga0207653_10006516 | 3300025885 | Bacteria | 3645 |
| 374 | Ga0207682_10000016 | 3300025893 | Bacteria | 78971 |
| 375 | Ga0207692_10006732 | 3300025898 | Bacteria | 4672 |
| 376 | Ga0207692_10049334 | 3300025898 | Bacteria | 2124 |
| 377 | Ga0207692_10081307 | 3300025898 | Bacteria | 1733 |
| 378 | Ga0207642_10001066 | 3300025899 | Bacteria | 8498 |
| 379 | Ga0207710_10000872 | 3300025900 | Bacteria | 16150 |
| 380 | Ga0207710_10042878 | 3300025900 | Bacteria | 2011 |
| 381 | Ga0207688_10000012 | 3300025901 | Bacteria | 60353 |
| 382 | Ga0207688_10000724 | 3300025901 | Bacteria | 16358 |
| 383 | Ga0207688_10012750 | 3300025901 | Bacteria | 4570 |
| 384 | Ga0207680_10004638 | 3300025903 | Bacteria | 6527 |
| 385 | Ga0207680_10007328 | 3300025903 | Bacteria | 5369 |
| 386 | Ga0207647_10000675 | 3300025904 | Bacteria | 26752 |
| 387 | Ga0207685_10002531 | 3300025905 | Bacteria | 4212 |
| 388 | Ga0207685_10003645 | 3300025905 | Bacteria | 3778 |
| 389 | Ga0207699_10000471 | 3300025906 | Bacteria | 20543 |
| 390 | Ga0207699_10058348 | 3300025906 | Bacteria | 2308 |
| 391 | Ga0207645_10000124 | 3300025907 | Bacteria | 58746 |
| 392 | Ga0207645_10014691 | 3300025907 | Bacteria | 5227 |
| 393 | Ga0207643_10000075 | 3300025908 | Bacteria | 64981 |
| 394 | Ga0207643_10002257 | 3300025908 | Bacteria | 10508 |
| 395 | Ga0207684_10028032 | 3300025910 | Bacteria | 4797 |
| 396 | Ga0207654_10001577 | 3300025911 | Bacteria | 11968 |
| 397 | Ga0207654_10102791 | 3300025911 | Bacteria | 1763 |
| 398 | Ga0207654_10160888 | 3300025911 | Bacteria | 1450 |
| 399 | Ga0207707_10006050 | 3300025912 | Bacteria | 10585 |
| 400 | Ga0207707_10017365 | 3300025912 | Bacteria | 6273 |
| 401 | Ga0207707_10153684 | 3300025912 | Bacteria | 2012 |
| 402 | Ga0207707_10200959 | 3300025912 | Bacteria | 1738 |
| 403 | Ga0207707_10288018 | 3300025912 | Bacteria | 1421 |
| 404 | Ga0207671_10004598 | 3300025914 | Bacteria | 13105 |
| 405 | Ga0207693_10007591 | 3300025915 | Bacteria | 8911 |
| 406 | Ga0207693_10007801 | 3300025915 | Bacteria | 8784 |
| 407 | Ga0207693_10009539 | 3300025915 | Bacteria | 7905 |
| 408 | Ga0207693_10010807 | 3300025915 | Bacteria | 7411 |
| 409 | Ga0207693_10080348 | 3300025915 | Bacteria | 2553 |
| 410 | Ga0207693_10087329 | 3300025915 | Bacteria | 2444 |
| 411 | Ga0207693_10098075 | 3300025915 | Bacteria | 2298 |
| 412 | Ga0207663_10033218 | 3300025916 | Bacteria | 3071 |
| 413 | Ga0207663_10054700 | 3300025916 | Bacteria | 2501 |
| 414 | Ga0207663_10066103 | 3300025916 | Bacteria | 2314 |
| 415 | Ga0207663_10119156 | 3300025916 | Bacteria | 1804 |
| 416 | Ga0207660_10000489 | 3300025917 | Bacteria | 26431 |
| 417 | Ga0207660_10066164 | 3300025917 | Bacteria | 2614 |
| 418 | Ga0207660_10082119 | 3300025917 | Bacteria | 2370 |
| 419 | Ga0207662_10000466 | 3300025918 | Bacteria | 18040 |
| 420 | Ga0207662_10003107 | 3300025918 | Bacteria | 8472 |
| 421 | Ga0207662_10029187 | 3300025918 | Bacteria | 3194 |
| 422 | Ga0207657_10000162 | 3300025919 | Bacteria | 68121 |
| 423 | Ga0207657_10020188 | 3300025919 | Bacteria | 6303 |
| 424 | Ga0207657_10025969 | 3300025919 | Bacteria | 5391 |
| 425 | Ga0207649_10000411 | 3300025920 | Bacteria | 31667 |
| 426 | Ga0207649_10265672 | 3300025920 | Bacteria | 1242 |
| 427 | Ga0207652_10007710 | 3300025921 | Bacteria | 8650 |
| 428 | Ga0207652_10141802 | 3300025921 | Bacteria | 2149 |
| 429 | Ga0207652_10181365 | 3300025921 | Bacteria | 1892 |
| 430 | Ga0207646_10169050 | 3300025922 | Bacteria | 1974 |
| 431 | Ga0207681_10001617 | 3300025923 | Bacteria | 14530 |
| 432 | Ga0207694_10079957 | 3300025924 | Bacteria | 2565 |
| 433 | Ga0207650_10005173 | 3300025925 | Bacteria | 8903 |
| 434 | Ga0207650_10017729 | 3300025925 | Bacteria | 4989 |
| 435 | Ga0207659_10000017 | 3300025926 | Bacteria | 159908 |
| 436 | Ga0207687_10000417 | 3300025927 | Bacteria | 28902 |
| 437 | Ga0207687_10033527 | 3300025927 | Bacteria | 3484 |
| 438 | Ga0207687_10065475 | 3300025927 | Bacteria | 2581 |
| 439 | Ga0207700_10001122 | 3300025928 | Bacteria | 15358 |
| 440 | Ga0207700_10005932 | 3300025928 | Bacteria | 7350 |
| 441 | Ga0207700_10019154 | 3300025928 | Bacteria | 4618 |
| 442 | Ga0207700_10058890 | 3300025928 | Bacteria | 2903 |
| 443 | Ga0207700_10174603 | 3300025928 | Bacteria | 1795 |
| 444 | Ga0207664_10017837 | 3300025929 | Bacteria | 5215 |
| 445 | Ga0207644_10002417 | 3300025931 | Bacteria | 12031 |
| 446 | Ga0207644_10007214 | 3300025931 | Bacteria | 7233 |
| 447 | Ga0207644_10030185 | 3300025931 | Bacteria | 3767 |
| 448 | Ga0207690_10000151 | 3300025932 | Bacteria | 54897 |
| 449 | Ga0207690_10022512 | 3300025932 | Bacteria | 3922 |
| 450 | Ga0207690_10105350 | 3300025932 | Bacteria | 2022 |
| 451 | Ga0207706_10000368 | 3300025933 | Bacteria | 48834 |
| 452 | Ga0207706_10002835 | 3300025933 | Bacteria | 16817 |
| 453 | Ga0207706_10017875 | 3300025933 | Bacteria | 6385 |
| 454 | Ga0207706_10035451 | 3300025933 | Bacteria | 4436 |
| 455 | Ga0207686_10002957 | 3300025934 | Bacteria | 9162 |
| 456 | Ga0207686_10134991 | 3300025934 | Bacteria | 1698 |
| 457 | Ga0207709_10000256 | 3300025935 | Bacteria | 63853 |
| 458 | Ga0207709_10048397 | 3300025935 | Bacteria | 2590 |
| 459 | Ga0207670_10000086 | 3300025936 | Bacteria | 63570 |
| 460 | Ga0207669_10000398 | 3300025937 | Bacteria | 19196 |
| 461 | Ga0207669_10306386 | 3300025937 | Bacteria | 1209 |
| 462 | Ga0207704_10000139 | 3300025938 | Bacteria | 38829 |
| 463 | Ga0207704_10020379 | 3300025938 | Bacteria | 3507 |
| 464 | Ga0207704_10185629 | 3300025938 | Bacteria | 1507 |
| 465 | Ga0207665_10000204 | 3300025939 | Bacteria | 39853 |
| 466 | Ga0207665_10006321 | 3300025939 | Bacteria | 7856 |
| 467 | Ga0207665_10014646 | 3300025939 | Bacteria | 5160 |
| 468 | Ga0207665_10221950 | 3300025939 | Bacteria | 1385 |
| 469 | Ga0207691_10000303 | 3300025940 | Bacteria | 48873 |
| 470 | Ga0207691_10016212 | 3300025940 | Bacteria | 7075 |
| 471 | Ga0207711_10049816 | 3300025941 | Bacteria | 3586 |
| 472 | Ga0207689_10000109 | 3300025942 | Bacteria | 67941 |
| 473 | Ga0207689_10003705 | 3300025942 | Bacteria | 13938 |
| 474 | Ga0207689_10359761 | 3300025942 | Bacteria | 1210 |
| 475 | Ga0207661_10000074 | 3300025944 | Bacteria | 68047 |
| 476 | Ga0207661_10102176 | 3300025944 | Bacteria | 2410 |
| 477 | Ga0207679_10000031 | 3300025945 | Bacteria | 165962 |
| 478 | Ga0207667_10031004 | 3300025949 | Bacteria | 5777 |
| 479 | Ga0207667_10131935 | 3300025949 | Bacteria | 2573 |
| 480 | Ga0207667_10516451 | 3300025949 | Bacteria | 1210 |
| 481 | Ga0207651_10000044 | 3300025960 | Bacteria | 58072 |
| 482 | Ga0207651_10261780 | 3300025960 | Bacteria | 1420 |
| 483 | Ga0207712_10007106 | 3300025961 | Bacteria | 7060 |
| 484 | Ga0207712_10098775 | 3300025961 | Bacteria | 2166 |
| 485 | Ga0207668_10000345 | 3300025972 | Bacteria | 30182 |
| 486 | Ga0207668_10068502 | 3300025972 | Bacteria | 2523 |
| 487 | Ga0207640_10001716 | 3300025981 | Bacteria | 11750 |
| 488 | Ga0207640_10131110 | 3300025981 | Bacteria | 1812 |
| 489 | Ga0207658_10005012 | 3300025986 | Bacteria | 9123 |
| 490 | Ga0207658_10051910 | 3300025986 | Bacteria | 3024 |
| 491 | Ga0207658_10060072 | 3300025986 | Bacteria | 2835 |
| 492 | Ga0207658_10141485 | 3300025986 | Bacteria | 1947 |
| 493 | Ga0207677_10002560 | 3300026023 | Bacteria | 9553 |
| 494 | Ga0207677_10012300 | 3300026023 | Bacteria | 4913 |
| 495 | Ga0207703_10002483 | 3300026035 | Bacteria | 15991 |
| 496 | Ga0207703_10011289 | 3300026035 | Bacteria | 6947 |
| 497 | Ga0207639_10004898 | 3300026041 | Bacteria | 9020 |
| 498 | Ga0207678_10000158 | 3300026067 | Bacteria | 56255 |
| 499 | Ga0207678_10003070 | 3300026067 | Bacteria | 15096 |
| 500 | Ga0207708_10000098 | 3300026075 | Bacteria | 67005 |
| 501 | Ga0207708_10000416 | 3300026075 | Bacteria | 33357 |
| 502 | Ga0207702_10014157 | 3300026078 | Bacteria | 6624 |
| 503 | Ga0207702_10269951 | 3300026078 | Bacteria | 1604 |
| 504 | Ga0207702_10306472 | 3300026078 | Bacteria | 1508 |
| 505 | Ga0207641_10000408 | 3300026088 | Bacteria | 50477 |
| 506 | Ga0207641_10143181 | 3300026088 | Bacteria | 2159 |
| 507 | Ga0207641_10270308 | 3300026088 | Bacteria | 1595 |
| 508 | Ga0207648_10000696 | 3300026089 | Bacteria | 37592 |
| 509 | Ga0207648_10005386 | 3300026089 | Bacteria | 12904 |
| 510 | Ga0207648_10010270 | 3300026089 | Bacteria | 8890 |
| 511 | Ga0207648_10022337 | 3300026089 | Bacteria | 5684 |
| 512 | Ga0207676_10006295 | 3300026095 | Bacteria | 8383 |
| 513 | Ga0207676_10074682 | 3300026095 | Bacteria | 2732 |
| 514 | Ga0207674_10000420 | 3300026116 | Bacteria | 55287 |
| 515 | Ga0207674_10087738 | 3300026116 | Bacteria | 3104 |
| 516 | Ga0207674_10277455 | 3300026116 | Bacteria | 1624 |
| 517 | Ga0207675_100001146 | 3300026118 | Bacteria | 26264 |
| 518 | Ga0207675_100001268 | 3300026118 | Bacteria | 25252 |
| 519 | Ga0207675_100061395 | 3300026118 | Bacteria | 3509 |
| 520 | Ga0207675_100220445 | 3300026118 | Bacteria | 1827 |
| 521 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 522 | Ga0207683_10001766 | 3300026121 | Bacteria | 19131 |
| 523 | Ga0207683_10006982 | 3300026121 | Bacteria | 9681 |
| 524 | Ga0207698_10001253 | 3300026142 | Bacteria | 14832 |
| 525 | Ga0207698_10098636 | 3300026142 | Bacteria | 2415 |
| 526 | Ga0209967_1012008 | 3300027364 | Bacteria | 1220 |
| 527 | Ga0210002_1000731 | 3300027617 | Bacteria | 4456 |
| 528 | Ga0209983_1018941 | 3300027665 | Bacteria | 1430 |
| 529 | Ga0209966_1003032 | 3300027695 | Bacteria | 2817 |
| 530 | Ga0209998_10000945 | 3300027717 | Bacteria | 7381 |
| 531 | Ga0209974_10000117 | 3300027876 | Bacteria | 23200 |
| 532 | Ga0209974_10077748 | 3300027876 | Bacteria | 1138 |
| 533 | Ga0207428_10000250 | 3300027907 | Bacteria | 73217 |
| 534 | Ga0207428_10001707 | 3300027907 | Bacteria | 22539 |
| 535 | Ga0207428_10002343 | 3300027907 | Bacteria | 18933 |
| 536 | Ga0268265_10000752 | 3300028380 | Bacteria | 31485 |
| 537 | Ga0268265_10131359 | 3300028380 | Bacteria | 2081 |
| 538 | Ga0268265_10258375 | 3300028380 | Bacteria | 1547 |
| 539 | Ga0268264_10002529 | 3300028381 | Bacteria | 16070 |
| 540 | Ga0268264_10038211 | 3300028381 | Bacteria | 3961 |
| 541 | Ga0265337_1002301 | 3300028556 | Bacteria | 8867 |
| 542 | Ga0265324_10032758 | 3300029957 | Bacteria | 1815 |
| 543 | Ga0265325_10000039 | 3300031241 | Bacteria | 93014 |
| 544 | Ga0265325_10002499 | 3300031241 | Bacteria | 12381 |
| 545 | Ga0265325_10003454 | 3300031241 | Bacteria | 10310 |
| 546 | Ga0265325_10036910 | 3300031241 | Bacteria | 2586 |
| 547 | Ga0265325_10052094 | 3300031241 | Bacteria | 2102 |
| 548 | Ga0265340_10052354 | 3300031247 | Bacteria | 1975 |
| 549 | Ga0265339_10006717 | 3300031249 | Bacteria | 7512 |
| 550 | Ga0265339_10016529 | 3300031249 | Bacteria | 4396 |
| 551 | Ga0265339_10024016 | 3300031249 | Bacteria | 3518 |
| 552 | Ga0265331_10001218 | 3300031250 | Bacteria | 19353 |
| 553 | Ga0265331_10029044 | 3300031250 | Bacteria | 2762 |
| 554 | Ga0265316_10148171 | 3300031344 | Bacteria | 1759 |
| 555 | Ga0265313_10000021 | 3300031595 | Bacteria | 144949 |
| 556 | Ga0265313_10000057 | 3300031595 | Bacteria | 108544 |
| 557 | Ga0265313_10002016 | 3300031595 | Bacteria | 18226 |
| 558 | Ga0265313_10017419 | 3300031595 | Bacteria | 4083 |
| 559 | Ga0265313_10029421 | 3300031595 | Bacteria | 2842 |
| 560 | Ga0265313_10039737 | 3300031595 | Bacteria | 2332 |
| 561 | Ga0265313_10052558 | 3300031595 | Bacteria | 1943 |
| 562 | Ga0265314_10004299 | 3300031711 | Bacteria | 13304 |
| 563 | Ga0265314_10005478 | 3300031711 | Bacteria | 11446 |
| 564 | Ga0265314_10009434 | 3300031711 | Bacteria | 8231 |
| 565 | Ga0265342_10003392 | 3300031712 | Bacteria | 13127 |
| 566 | Ga0265342_10025747 | 3300031712 | Bacteria | 3693 |
| 567 | Ga0265342_10039196 | 3300031712 | Bacteria | 2880 |
| 568 | Ga0316576_10323306 | 3300031727 | Bacteria | 1150 |
| 569 | Ga0316583_10008041 | 3300032133 | Bacteria | 3799 |
| 570 | Ga0373930_0003658 | 3300034816 | Bacteria | 2455 |
| 571 | Ga0373948_0000331 | 3300034817 | Bacteria | 5765 |
| 572 | Ga0373950_0000525 | 3300034818 | Bacteria | 4685 |
| 573 | Ga0373950_0002206 | 3300034818 | Bacteria | 2655 |
| 574 | Ga0373950_0009375 | 3300034818 | Bacteria | 1562 |
| 575 | Ga0373958_0001188 | 3300034819 | Bacteria | 3465 |
| 576 | Ga0373959_0003250 | 3300034820 | Bacteria | 2585 |
| 577 | Ga0373938_0003628 | 3300034957 | Bacteria | 2542 |
| 578 | Ga0373926_0004729 | 3300035083 | Bacteria | 4476 |
| 579 | Ga0373926_0013859 | 3300035083 | Bacteria | 2737 |
| 580 | Ga0373928_0002766 | 3300035084 | Bacteria | 3385 |
| 581 | Ga0373929_0000934 | 3300035085 | Bacteria | 5683 |
| 582 | Ga0373929_0005827 | 3300035085 | Bacteria | 2226 |
| 583 | Ga0373934_0038218 | 3300035086 | Bacteria | 1890 |
| 584 | Ga0373934_0114124 | 3300035086 | Bacteria | 1097 |
| 585 | Ga0373940_0000070 | 3300035088 | Bacteria | 11704 |
| 586 | Ga0373944_0000293 | 3300035089 | Bacteria | 11123 |
| 587 | Ga0373949_0000878 | 3300035090 | Bacteria | 9503 |
| 588 | Ga0373949_0002003 | 3300035090 | Bacteria | 5447 |
| 589 | Ga0373951_0001550 | 3300035091 | Bacteria | 6022 |
| 590 | Ga0373951_0006833 | 3300035091 | Bacteria | 2606 |
| 591 | Ga0373952_0002820 | 3300035092 | Bacteria | 3141 |
| 592 | Ga0373952_0008501 | 3300035092 | Bacteria | 1948 |
| 593 | Ga0373923_0021776 | 3300035111 | Bacteria | 2506 |
| 594 | Ga0373923_0057726 | 3300035111 | Bacteria | 1642 |
| 595 | Ga0373932_0000094 | 3300035112 | Bacteria | 23612 |
| 596 | Ga0373936_0004221 | 3300035113 | Bacteria | 5421 |
| 597 | Ga0373939_0000436 | 3300035114 | Bacteria | 10505 |
| 598 | Ga0373939_0004620 | 3300035114 | Bacteria | 3261 |
| 599 | Ga0373941_0000404 | 3300035115 | Bacteria | 8578 |
| 600 | Ga0373941_0000909 | 3300035115 | Bacteria | 6090 |
| 601 | Ga0373945_0051977 | 3300035116 | Bacteria | 1508 |
| 602 | Ga0373953_0001892 | 3300035117 | Bacteria | 6206 |
| 603 | Ga0373953_0002543 | 3300035117 | Bacteria | 5511 |
| 604 | Ga0373953_0028516 | 3300035117 | Bacteria | 2153 |
| 605 | Ga0373954_0002451 | 3300035118 | Bacteria | 7774 |
| 606 | Ga0373954_0017633 | 3300035118 | Bacteria | 3208 |
| 607 | Ga0373956_0005141 | 3300035119 | Bacteria | 5235 |
| 608 | Ga0373957_0008056 | 3300035120 | Bacteria | 3398 |
| 609 | Ga0373960_0003391 | 3300035121 | Bacteria | 3607 |
| 610 | Ga0373960_0006721 | 3300035121 | Bacteria | 2706 |
| 611 | Ga0373960_0019556 | 3300035121 | Bacteria | 1781 |
| 612 | Ga0373943_0000574 | 3300035170 | Bacteria | 15943 |
| 613 | Ga0373943_0038255 | 3300035170 | Bacteria | 2306 |
| 614 | Ga0373943_0055379 | 3300035170 | Bacteria | 1964 |
| 615 | Ga0373943_0092472 | 3300035170 | Bacteria | 1568 |
| 616 | Ga0373946_0001887 | 3300035171 | Bacteria | 7317 |
| 617 | Ga0373946_0030093 | 3300035171 | Bacteria | 2165 |
| 618 | Ga0373955_0000179 | 3300035172 | Bacteria | 26002 |
| 619 | Ga0373955_0000573 | 3300035172 | Bacteria | 15620 |
| 620 | Ga0373955_0009737 | 3300035172 | Bacteria | 4514 |
| 621 | Ga0373955_0052874 | 3300035172 | Bacteria | 2216 |
| 622 | Ga0373942_0003796 | 3300035207 | Bacteria | 3530 |
| 623 | Ga0373942_0004402 | 3300035207 | Bacteria | 3273 |
| 624 | Ga0373961_0003554 | 3300035241 | Bacteria | 3840 |
| 625 | Ga0373962_0000137 | 3300035242 | Bacteria | 15079 |
| 626 | Ga0373962_0001436 | 3300035242 | Bacteria | 5627 |
| 627 | Ga0373962_0010790 | 3300035242 | Bacteria | 2284 |
| 628 | Ga0316574_0003710 | 3300035398 | Bacteria | 7907 |
| 629 | Ga0373924_0000231 | 3300035410 | Bacteria | 16976 |
| 630 | Ga0373924_0003315 | 3300035410 | Bacteria | 5522 |
| 631 | Ga0373924_0039594 | 3300035410 | Bacteria | 1926 |
| 632 | Ga0373924_0050973 | 3300035410 | Bacteria | 1715 |
| 633 | Ga0373924_0080610 | 3300035410 | Bacteria | 1384 |
| 634 | Ga0373931_0000034 | 3300035691 | Bacteria | 86665 |
| 635 | Ga0373931_0004201 | 3300035691 | Bacteria | 6559 |
| 636 | Ga0373931_0168071 | 3300035691 | Bacteria | 1290 |
| 637 | Ga0373935_0000041 | 3300035692 | Bacteria | 50248 |
| 638 | Ga0373935_0027233 | 3300035692 | Bacteria | 3533 |
| 639 | Ga0373927_0013903 | 3300035695 | Bacteria | 5339 |
| 640 | Ga0373927_0067208 | 3300035695 | Bacteria | 2319 |
| 641 | Ga0373927_0103055 | 3300035695 | Bacteria | 1856 |
| 642 | Ga0373927_0106884 | 3300035695 | Bacteria | 1822 |
| 643 | Ga0373927_0133573 | 3300035695 | Bacteria | 1621 |
| 644 | Ga0373933_0000827 | 3300035724 | Bacteria | 18917 |
| 645 | Ga0373933_0000876 | 3300035724 | Bacteria | 18373 |
| 646 | Ga0373933_0004375 | 3300035724 | Bacteria | 7754 |
| 647 | Ga0373933_0038252 | 3300035724 | Bacteria | 2819 |
| 648 | Ga0373933_0044678 | 3300035724 | Bacteria | 2625 |
| 649 | Ga0373933_0190104 | 3300035724 | Bacteria | 1311 |
| 650 | Ga0373947_0000606 | 3300035725 | Bacteria | 21112 |
| 651 | Ga0373947_0039421 | 3300035725 | Bacteria | 2810 |
| 652 | Ga0373947_0066320 | 3300035725 | Bacteria | 2203 |
| 653 | Ga0373937_0000458 | 3300036401 | Bacteria | 37656 |
| 654 | Ga0373937_0004869 | 3300036401 | Bacteria | 11411 |
| 655 | Ga0373937_0011492 | 3300036401 | Bacteria | 7771 |
| 656 | Ga0373937_0011831 | 3300036401 | Bacteria | 7662 |
| 657 | Ga0373937_0015291 | 3300036401 | Bacteria | 6786 |
| 658 | Ga0373937_0016247 | 3300036401 | Bacteria | 6605 |
| 659 | Ga0373937_0049613 | 3300036401 | Bacteria | 3843 |
| 660 | Ga0373937_0141643 | 3300036401 | Bacteria | 2250 |
| 661 | Ga0316582_0223725 | 3300036647 | Bacteria | 1287 |
| 662 | Ga0373925_0000084 | 3300037068 | Bacteria | 100945 |
| 663 | Ga0373925_0023174 | 3300037068 | Bacteria | 4530 |
| 664 | Ga0373925_0048639 | 3300037068 | Bacteria | 3160 |
| 665 | Ga0373925_0144652 | 3300037068 | Bacteria | 1863 |
| 666 | Ga0373925_0258493 | 3300037068 | Bacteria | 1398 |
| 667 | Ga0373925_0279066 | 3300037068 | Bacteria | 1345 |
| 668 | Ga0373925_0293022 | 3300037068 | Bacteria | 1312 |
| 669 | Ga0436364_0815578 | 3300037853 | Bacteria | 1227 |
| 670 | Ga0436364_1454102 | 3300037853 | Bacteria | 2119 |
| 671 | Ga0436360_0478773 | 3300039438 | Bacteria | 6606 |
| 672 | Ga0436360_0682085 | 3300039438 | Bacteria | 2464 |
| 673 | Ga0436360_0961521 | 3300039438 | Bacteria | 992 |
| 674 | Ga0436361_0003682 | 3300039447 | Bacteria | 24999 |
| 675 | Ga0436363_1560263 | 3300039450 | Bacteria | 3625 |
| 676 | Ga0466967_0078916 | 3300045976 | Bacteria | 2967 |
| 677 | Ga0495617_026205 | 3300046452 | Bacteria | 1963 |
| 678 | Ga0495627_041952 | 3300046453 | Bacteria | 1404 |
| 679 | Ga0495592_0000026 | 3300046454 | Bacteria | 136204 |
| 680 | Ga0495592_0007769 | 3300046454 | Bacteria | 8038 |
| 681 | Ga0495592_0013078 | 3300046454 | Bacteria | 6315 |
| 682 | Ga0495592_0027747 | 3300046454 | Bacteria | 4289 |
| 683 | Ga0495592_0082742 | 3300046454 | Bacteria | 2319 |
| 684 | Ga0495629_0002921 | 3300046459 | Bacteria | 13039 |
| 685 | Ga0495629_0010593 | 3300046459 | Bacteria | 6706 |
| 686 | Ga0495638_0063532 | 3300046460 | Bacteria | 2276 |
| 687 | Ga0495641_0050150 | 3300046461 | Bacteria | 1908 |
| 688 | Ga0495641_0067144 | 3300046461 | Bacteria | 1613 |
| 689 | Ga0495651_0001559 | 3300046462 | Bacteria | 17718 |
| 690 | Ga0495651_0009033 | 3300046462 | Bacteria | 7653 |
| 691 | Ga0495651_0014408 | 3300046462 | Bacteria | 6113 |
| 692 | Ga0495651_0030845 | 3300046462 | Bacteria | 4180 |
| 693 | Ga0495653_0000003 | 3300046463 | Bacteria | 377892 |
| 694 | Ga0495653_0007399 | 3300046463 | Bacteria | 8995 |
| 695 | Ga0495582_0066961 | 3300046473 | Bacteria | 1984 |
| 696 | Ga0495582_0149324 | 3300046473 | Bacteria | 1326 |
| 697 | Ga0495582_0164943 | 3300046473 | Bacteria | 1260 |
| 698 | Ga0495639_0022520 | 3300046475 | Bacteria | 2764 |
| 699 | Ga0495639_0024518 | 3300046475 | Bacteria | 2655 |
| 700 | Ga0495662_0024038 | 3300046476 | Bacteria | 2940 |
| 701 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 702 | Ga0495664_0005683 | 3300046477 | Bacteria | 6859 |
| 703 | Ga0495584_0028231 | 3300046491 | Bacteria | 2843 |
| 704 | Ga0495584_0043390 | 3300046491 | Bacteria | 2270 |
| 705 | Ga0495584_0128304 | 3300046491 | Bacteria | 1286 |
| 706 | Ga0495585_0002362 | 3300046492 | Bacteria | 13540 |
| 707 | Ga0495594_0062544 | 3300046499 | Bacteria | 2061 |
| 708 | Ga0495607_0007810 | 3300046501 | Bacteria | 7365 |
| 709 | Ga0495583_0036681 | 3300046506 | Bacteria | 2330 |
| 710 | Ga0495608_0000012 | 3300046511 | Bacteria | 242758 |
| 711 | Ga0495608_0006328 | 3300046511 | Bacteria | 8397 |
| 712 | Ga0495608_0051798 | 3300046511 | Bacteria | 2719 |
| 713 | Ga0495618_0008669 | 3300046514 | Bacteria | 6146 |
| 714 | Ga0495618_0029856 | 3300046514 | Bacteria | 3402 |
| 715 | Ga0495628_0000095 | 3300046516 | Bacteria | 70388 |
| 716 | Ga0495628_0006043 | 3300046516 | Bacteria | 10583 |
| 717 | Ga0495628_0018089 | 3300046516 | Bacteria | 5844 |
| 718 | Ga0495628_0064924 | 3300046516 | Bacteria | 2857 |
| 719 | Ga0495630_0002688 | 3300046517 | Bacteria | 12341 |
| 720 | Ga0495630_0015138 | 3300046517 | Bacteria | 5629 |
| 721 | Ga0495630_0026641 | 3300046517 | Bacteria | 4282 |
| 722 | Ga0495630_0160924 | 3300046517 | Bacteria | 1709 |
| 723 | Ga0495631_0058073 | 3300046518 | Bacteria | 1683 |
| 724 | Ga0495644_0003320 | 3300046523 | Bacteria | 6361 |
| 725 | Ga0495644_0010527 | 3300046523 | Bacteria | 3563 |
| 726 | Ga0495663_0008764 | 3300046525 | Bacteria | 2805 |
| 727 | Ga0495666_0006722 | 3300046526 | Bacteria | 5783 |
| 728 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 729 | Ga0495652_0023334 | 3300046529 | Bacteria | 5484 |
| 730 | Ga0495652_0024406 | 3300046529 | Bacteria | 5351 |
| 731 | Ga0495665_0027624 | 3300046531 | Bacteria | 3045 |
| 732 | Ga0495665_0028821 | 3300046531 | Bacteria | 2975 |
| 733 | Ga0495640_0000010 | 3300046533 | Bacteria | 214167 |
| 734 | Ga0495640_0011907 | 3300046533 | Bacteria | 6670 |
| 735 | Ga0495640_0032087 | 3300046533 | Bacteria | 3743 |
| 736 | Ga0495586_0028866 | 3300046535 | Bacteria | 2969 |
| 737 | Ga0495586_0123593 | 3300046535 | Bacteria | 1446 |
| 738 | Ga0495587_0000003 | 3300046536 | Bacteria | 424188 |
| 739 | Ga0495587_0000784 | 3300046536 | Bacteria | 21237 |
| 740 | Ga0495587_0014912 | 3300046536 | Bacteria | 4861 |
| 741 | Ga0495587_0038540 | 3300046536 | Bacteria | 2864 |
| 742 | Ga0495609_0023490 | 3300046538 | Bacteria | 2834 |
| 743 | Ga0495645_0000026 | 3300046543 | Bacteria | 118737 |
| 744 | Ga0495645_0001504 | 3300046543 | Bacteria | 15761 |
| 745 | Ga0495645_0010117 | 3300046543 | Bacteria | 6608 |
| 746 | Ga0495622_0015371 | 3300046557 | Bacteria | 3557 |
| 747 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 748 | Ga0495667_0005788 | 3300046559 | Bacteria | 8372 |
| 749 | Ga0495667_0011936 | 3300046559 | Bacteria | 5888 |
| 750 | Ga0495667_0036076 | 3300046559 | Bacteria | 3302 |
| 751 | Ga0495667_0048298 | 3300046559 | Bacteria | 2810 |
| 752 | Ga0495656_0004129 | 3300046615 | Bacteria | 4946 |
| 753 | Ga0495656_0004992 | 3300046615 | Bacteria | 4570 |
| 754 | Ga0495634_0000037 | 3300046642 | Bacteria | 105318 |
| 755 | Ga0495634_0016507 | 3300046642 | Bacteria | 5280 |
| 756 | Ga0495634_0170556 | 3300046642 | Bacteria | 1367 |
| 757 | Ga0495635_0000011 | 3300046663 | Bacteria | 240094 |
| 758 | Ga0495635_0004840 | 3300046663 | Bacteria | 9368 |
| 759 | Ga0495635_0033836 | 3300046663 | Bacteria | 3545 |
| 760 | Ga0495635_0136158 | 3300046663 | Bacteria | 1674 |
| 761 | Ga0495635_0176270 | 3300046663 | Bacteria | 1453 |
| 762 | Ga0495659_0007435 | 3300046664 | Bacteria | 3475 |
| 763 | Ga0495661_0097359 | 3300046665 | Bacteria | 1662 |
| 764 | Ga0495588_0003043 | 3300046674 | Bacteria | 7254 |
| 765 | Ga0495657_0000050 | 3300046675 | Bacteria | 102791 |
| 766 | Ga0495657_0000582 | 3300046675 | Bacteria | 33505 |
| 767 | Ga0495599_0000004 | 3300046678 | Bacteria | 316231 |
| 768 | Ga0495599_0006216 | 3300046678 | Bacteria | 7197 |
| 769 | Ga0495599_0031357 | 3300046678 | Bacteria | 3336 |
| 770 | Ga0495599_0046099 | 3300046678 | Bacteria | 2733 |
| 771 | Ga0495623_0000081 | 3300046679 | Bacteria | 56783 |
| 772 | Ga0495623_0006875 | 3300046679 | Bacteria | 7400 |
| 773 | Ga0495623_0013754 | 3300046679 | Bacteria | 5246 |
| 774 | Ga0495623_0035106 | 3300046679 | Bacteria | 3214 |
| 775 | Ga0495646_0000010 | 3300046680 | Bacteria | 195319 |
| 776 | Ga0495646_0000200 | 3300046680 | Bacteria | 29769 |
| 777 | Ga0495646_0022383 | 3300046680 | Bacteria | 3987 |
| 778 | Ga0495647_0001076 | 3300046681 | Bacteria | 8324 |
| 779 | Ga0495647_0014060 | 3300046681 | Bacteria | 2783 |
| 780 | Ga0495658_0001728 | 3300046683 | Bacteria | 11316 |
| 781 | Ga0495658_0003067 | 3300046683 | Bacteria | 8355 |
| 782 | Ga0495658_0134353 | 3300046683 | Bacteria | 1508 |
| 783 | Ga0495658_0207945 | 3300046683 | Bacteria | 1222 |
| 784 | Ga0495613_0008422 | 3300046689 | Bacteria | 7656 |
| 785 | Ga0495613_0035259 | 3300046689 | Bacteria | 3713 |
| 786 | Ga0495624_0011303 | 3300046690 | Bacteria | 6137 |
| 787 | Ga0495624_0014992 | 3300046690 | Bacteria | 5248 |
| 788 | Ga0495624_0042983 | 3300046690 | Bacteria | 2884 |
| 789 | Ga0495671_0027293 | 3300046692 | Bacteria | 2950 |
| 790 | Ga0495600_0000007 | 3300046809 | Bacteria | 150995 |
| 791 | Ga0495600_0001285 | 3300046809 | Bacteria | 13878 |
| 792 | Ga0495600_0007437 | 3300046809 | Bacteria | 6703 |
| 793 | Ga0495600_0011093 | 3300046809 | Bacteria | 5608 |
| 794 | Ga0495581_0002943 | 3300047315 | Bacteria | 9746 |
| 795 | Ga0495581_0011203 | 3300047315 | Bacteria | 5184 |
| 796 | Ga0495581_0062533 | 3300047315 | Bacteria | 2151 |
| 797 | Ga0495581_0097487 | 3300047315 | Bacteria | 1708 |
| 798 | Ga0495604_0000010 | 3300047317 | Bacteria | 312236 |
| 799 | Ga0495604_0005339 | 3300047317 | Bacteria | 10186 |
| 800 | Ga0495604_0012612 | 3300047317 | Bacteria | 6723 |
| 801 | Ga0495604_0012983 | 3300047317 | Bacteria | 6639 |
| 802 | Ga0495604_0024305 | 3300047317 | Bacteria | 4834 |
| 803 | Ga0495604_0035103 | 3300047317 | Bacteria | 3962 |
| 804 | Ga0495604_0123084 | 3300047317 | Bacteria | 1875 |
| 805 | Ga0495674_0000013 | 3300047319 | Bacteria | 248475 |
| 806 | Ga0495674_0146698 | 3300047319 | Bacteria | 1980 |
| 807 | Ga0495674_0258991 | 3300047319 | Bacteria | 1430 |
| 808 | Ga0495674_0334528 | 3300047319 | Bacteria | 1231 |
| 809 | Ga0495676_0017489 | 3300047321 | Bacteria | 6338 |
| 810 | Ga0495676_0052021 | 3300047321 | Bacteria | 3272 |
| 811 | Ga0495676_0069527 | 3300047321 | Bacteria | 2716 |
| 812 | Ga0495676_0091904 | 3300047321 | Bacteria | 2266 |
| 813 | Ga0495676_0126249 | 3300047321 | Bacteria | 1854 |
| 814 | Ga0495680_0000078 | 3300047322 | Bacteria | 86663 |
| 815 | Ga0495680_0001872 | 3300047322 | Bacteria | 22140 |
| 816 | Ga0495680_0004686 | 3300047322 | Bacteria | 13028 |
| 817 | Ga0495680_0004980 | 3300047322 | Bacteria | 12557 |
| 818 | Ga0495680_0012957 | 3300047322 | Bacteria | 7302 |
| 819 | Ga0495680_0039186 | 3300047322 | Bacteria | 3781 |
| 820 | Ga0495680_0205747 | 3300047322 | Bacteria | 1411 |
| 821 | Ga0495675_0000305 | 3300047444 | Bacteria | 35233 |
| 822 | Ga0495675_0006007 | 3300047444 | Bacteria | 7424 |
| 823 | Ga0495675_0013982 | 3300047444 | Bacteria | 5075 |
| 824 | Ga0495681_0101166 | 3300047470 | Bacteria | 1260 |
| 825 | Ga0495684_0000008 | 3300047471 | Bacteria | 201370 |
| 826 | Ga0495684_0059040 | 3300047471 | Bacteria | 2921 |
| 827 | Ga0495684_0062269 | 3300047471 | Bacteria | 2838 |
| 828 | Ga0495593_0000145 | 3300047673 | Bacteria | 34809 |
| 829 | Ga0495593_0002171 | 3300047673 | Bacteria | 11734 |
| 830 | Ga0495593_0006743 | 3300047673 | Bacteria | 6722 |
| 831 | Ga0495602_0000002 | 3300048088 | Bacteria | 422216 |
| 832 | Ga0495602_0009411 | 3300048088 | Bacteria | 10165 |
| 833 | Ga0495602_0015651 | 3300048088 | Bacteria | 7647 |
| 834 | Ga0495602_0015918 | 3300048088 | Bacteria | 7574 |
| 835 | Ga0495602_0160995 | 3300048088 | Bacteria | 1752 |
| 836 | Ga0495614_0012218 | 3300048089 | Bacteria | 3771 |
| 837 | Ga0496100_0000679 | 3300048903 | Bacteria | 16224 |
| 838 | Ga0496100_0005609 | 3300048903 | Bacteria | 6778 |
| 839 | Ga0496100_0010839 | 3300048903 | Bacteria | 5172 |
| 840 | Ga0496100_0020414 | 3300048903 | Bacteria | 3972 |
| 841 | Ga0496100_0049389 | 3300048903 | Bacteria | 2720 |
| 842 | Ga0496100_0080139 | 3300048903 | Bacteria | 2202 |
| 843 | Ga0496101_0000121 | 3300048904 | Bacteria | 76264 |
| 844 | Ga0496101_0002379 | 3300048904 | Bacteria | 11545 |
| 845 | Ga0496101_0072114 | 3300048904 | Bacteria | 2534 |
| 846 | Ga0496102_0001800 | 3300048905 | Bacteria | 18544 |
| 847 | Ga0496102_0003585 | 3300048905 | Bacteria | 13145 |
| 848 | Ga0496102_0142914 | 3300048905 | Bacteria | 2244 |
| 849 | Ga0496102_0146266 | 3300048905 | Bacteria | 2218 |
| 850 | Ga0496103_0002140 | 3300048906 | Bacteria | 12580 |
| 851 | Ga0496103_0002528 | 3300048906 | Bacteria | 11461 |
| 852 | Ga0496103_0019764 | 3300048906 | Bacteria | 4043 |
| 853 | Ga0496104_0000575 | 3300048907 | Bacteria | 31363 |
| 854 | Ga0496104_0009294 | 3300048907 | Bacteria | 8742 |
| 855 | Ga0496104_0033246 | 3300048907 | Bacteria | 4803 |
| 856 | Ga0496104_0060319 | 3300048907 | Bacteria | 3594 |
| 857 | Ga0496104_0061472 | 3300048907 | Bacteria | 3561 |
| 858 | Ga0496105_0005756 | 3300048908 | Bacteria | 9445 |
| 859 | Ga0496105_0014700 | 3300048908 | Bacteria | 6231 |
| 860 | Ga0496105_0026365 | 3300048908 | Bacteria | 4740 |
| 861 | Ga0496105_0037340 | 3300048908 | Bacteria | 4001 |
| 862 | Ga0496105_0038085 | 3300048908 | Bacteria | 3961 |
| 863 | Ga0496105_0274656 | 3300048908 | Bacteria | 1360 |
| 864 | Ga0496106_0000133 | 3300048909 | Bacteria | 55926 |
| 865 | Ga0496106_0004497 | 3300048909 | Bacteria | 10339 |
| 866 | Ga0496106_0029780 | 3300048909 | Bacteria | 4070 |
| 867 | Ga0496106_0036322 | 3300048909 | Bacteria | 3686 |
| 868 | Ga0496106_0055385 | 3300048909 | Bacteria | 2997 |
| 869 | Ga0496106_0195346 | 3300048909 | Bacteria | 1609 |
| 870 | Ga0496107_0001229 | 3300048910 | Bacteria | 15645 |
| 871 | Ga0496107_0011864 | 3300048910 | Bacteria | 6087 |
| 872 | Ga0496107_0026643 | 3300048910 | Bacteria | 4099 |
| 873 | Ga0496107_0054233 | 3300048910 | Bacteria | 2893 |
| 874 | Ga0496107_0070643 | 3300048910 | Bacteria | 2535 |
| 875 | Ga0496107_0150469 | 3300048910 | Bacteria | 1721 |
| 876 | Ga0496107_0259886 | 3300048910 | Bacteria | 1292 |
| 877 | Ga0496108_0005937 | 3300048911 | Bacteria | 9890 |
| 878 | Ga0496108_0006248 | 3300048911 | Bacteria | 9647 |
| 879 | Ga0496108_0010047 | 3300048911 | Bacteria | 7677 |
| 880 | Ga0496108_0013329 | 3300048911 | Bacteria | 6702 |
| 881 | Ga0496108_0016034 | 3300048911 | Bacteria | 6109 |
| 882 | Ga0496108_0149094 | 3300048911 | Bacteria | 2018 |
| 883 | Ga0496108_0389807 | 3300048911 | Bacteria | 1216 |
| 884 | Ga0496109_0006607 | 3300048912 | Bacteria | 9766 |
| 885 | Ga0496109_0006735 | 3300048912 | Bacteria | 9676 |
| 886 | Ga0496109_0006919 | 3300048912 | Bacteria | 9568 |
| 887 | Ga0496109_0016552 | 3300048912 | Bacteria | 6448 |
| 888 | Ga0496109_0163386 | 3300048912 | Bacteria | 2086 |
| 889 | Ga0496110_0006375 | 3300048913 | Bacteria | 9329 |
| 890 | Ga0496110_0025620 | 3300048913 | Bacteria | 5042 |
| 891 | Ga0496110_0040058 | 3300048913 | Bacteria | 4082 |
| 892 | Ga0496110_0082707 | 3300048913 | Bacteria | 2863 |
| 893 | Ga0496110_0101737 | 3300048913 | Bacteria | 2576 |
| 894 | Ga0496110_0161381 | 3300048913 | Bacteria | 2032 |
| 895 | Ga0496110_0237387 | 3300048913 | Bacteria | 1659 |
| 896 | Ga0496111_0008013 | 3300048914 | Bacteria | 6967 |
| 897 | Ga0496111_0012311 | 3300048914 | Bacteria | 5787 |
| 898 | Ga0496111_0023099 | 3300048914 | Bacteria | 4362 |
| 899 | Ga0496111_0023383 | 3300048914 | Bacteria | 4338 |
| 900 | Ga0496111_0023811 | 3300048914 | Bacteria | 4301 |
| 901 | Ga0496111_0028981 | 3300048914 | Bacteria | 3927 |
| 902 | Ga0496111_0045320 | 3300048914 | Bacteria | 3164 |
| 903 | Ga0496111_0235273 | 3300048914 | Bacteria | 1360 |
| 904 | Ga0496111_0293535 | 3300048914 | Bacteria | 1205 |
| 905 | Ga0496112_0001095 | 3300048915 | Bacteria | 20053 |
| 906 | Ga0496112_0028750 | 3300048915 | Bacteria | 5369 |
| 907 | Ga0496112_0103617 | 3300048915 | Bacteria | 2815 |
| 908 | Ga0496112_0137026 | 3300048915 | Bacteria | 2418 |
| 909 | Ga0496112_0184414 | 3300048915 | Bacteria | 2050 |
| 910 | Ga0496112_0286534 | 3300048915 | Bacteria | 1593 |
| 911 | Ga0496113_0006833 | 3300048916 | Bacteria | 7276 |
| 912 | Ga0496113_0010461 | 3300048916 | Bacteria | 6134 |
| 913 | Ga0496113_0030136 | 3300048916 | Bacteria | 3925 |
| 914 | Ga0496113_0034994 | 3300048916 | Bacteria | 3669 |
| 915 | Ga0496113_0102121 | 3300048916 | Bacteria | 2223 |
| 916 | Ga0496113_0244011 | 3300048916 | Bacteria | 1433 |
| 917 | Ga0496113_0251316 | 3300048916 | Bacteria | 1411 |
| 918 | Ga0496114_0024196 | 3300048917 | Bacteria | 4956 |
| 919 | Ga0496114_0061556 | 3300048917 | Bacteria | 3140 |
| 920 | Ga0496114_0142440 | 3300048917 | Bacteria | 2076 |
| 921 | Ga0496115_0004251 | 3300048918 | Bacteria | 10355 |
| 922 | Ga0496115_0044425 | 3300048918 | Bacteria | 3544 |
| 923 | Ga0496115_0052630 | 3300048918 | Bacteria | 3267 |
| 924 | Ga0496115_0053974 | 3300048918 | Bacteria | 3226 |
| 925 | Ga0496115_0056919 | 3300048918 | Bacteria | 3143 |
| 926 | Ga0496115_0089844 | 3300048918 | Bacteria | 2509 |
| 927 | Ga0496117_0074455 | 3300048920 | Bacteria | 2260 |
| 928 | Ga0496122_0018456 | 3300048925 | Bacteria | 6442 |
| 929 | Ga0496122_0132407 | 3300048925 | Bacteria | 1581 |
| 930 | Ga0496123_0011563 | 3300048926 | Bacteria | 7636 |
| 931 | Ga0496123_0030058 | 3300048926 | Bacteria | 3983 |
| 932 | Ga0496123_0093631 | 3300048926 | Bacteria | 1773 |
| 933 | Ga0501031_0001650 | 3300049568 | Bacteria | 14002 |
| 934 | Ga0501032_0016718 | 3300049569 | Bacteria | 5154 |
| 935 | Ga0501032_0045230 | 3300049569 | Bacteria | 2978 |
| 936 | Ga0501032_0084246 | 3300049569 | Bacteria | 2113 |
| 937 | Ga0501032_0132560 | 3300049569 | Bacteria | 1643 |
| 938 | Ga0501033_0049551 | 3300049570 | Bacteria | 3117 |
| 939 | Ga0501033_0055120 | 3300049570 | Bacteria | 2939 |
| 940 | Ga0501033_0074193 | 3300049570 | Bacteria | 2497 |
| 941 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 942 | Ga0501034_0000623 | 3300049571 | Bacteria | 55353 |
| 943 | Ga0501034_0011296 | 3300049571 | Bacteria | 9264 |
| 944 | Ga0501034_0015888 | 3300049571 | Bacteria | 7730 |
| 945 | Ga0501034_0036635 | 3300049571 | Bacteria | 4967 |
| 946 | Ga0501034_0044949 | 3300049571 | Bacteria | 4464 |
| 947 | Ga0501034_0078963 | 3300049571 | Bacteria | 3294 |
| 948 | Ga0501034_0081950 | 3300049571 | Bacteria | 3228 |
| 949 | Ga0501034_0146865 | 3300049571 | Bacteria | 2335 |
| 950 | Ga0501034_0380316 | 3300049571 | Bacteria | 1337 |
| 951 | Ga0501034_0424268 | 3300049571 | Bacteria | 1251 |
| 952 | Ga0501036_0007360 | 3300049572 | Bacteria | 8970 |
| 953 | Ga0501036_0010284 | 3300049572 | Bacteria | 7718 |
| 954 | Ga0501036_0048396 | 3300049572 | Bacteria | 3599 |
| 955 | Ga0501036_0054322 | 3300049572 | Bacteria | 3392 |
| 956 | Ga0501036_0070649 | 3300049572 | Bacteria | 2952 |
| 957 | Ga0501037_0004970 | 3300049573 | Bacteria | 9668 |
| 958 | Ga0501037_0005615 | 3300049573 | Bacteria | 9143 |
| 959 | Ga0501037_0009466 | 3300049573 | Bacteria | 7152 |
| 960 | Ga0501037_0013851 | 3300049573 | Bacteria | 5943 |
| 961 | Ga0501037_0075101 | 3300049573 | Bacteria | 2455 |
| 962 | Ga0501037_0099786 | 3300049573 | Bacteria | 2097 |
| 963 | Ga0501038_0008677 | 3300049574 | Bacteria | 9330 |
| 964 | Ga0501038_0011705 | 3300049574 | Bacteria | 8003 |
| 965 | Ga0501038_0043948 | 3300049574 | Bacteria | 3883 |
| 966 | Ga0501038_0048763 | 3300049574 | Bacteria | 3663 |
| 967 | Ga0501038_0098638 | 3300049574 | Bacteria | 2436 |
| 968 | Ga0501039_0009153 | 3300049575 | Bacteria | 7543 |
| 969 | Ga0501039_0014974 | 3300049575 | Bacteria | 5931 |
| 970 | Ga0501039_0296060 | 3300049575 | Bacteria | 1272 |
| 971 | Ga0501042_0272524 | 3300049578 | Bacteria | 1222 |
| 972 | Ga0501043_0001573 | 3300049579 | Bacteria | 19879 |
| 973 | Ga0501043_0014132 | 3300049579 | Bacteria | 6247 |
| 974 | Ga0501043_0017896 | 3300049579 | Bacteria | 5557 |
| 975 | Ga0501043_0043984 | 3300049579 | Bacteria | 3510 |
| 976 | Ga0501043_0081974 | 3300049579 | Bacteria | 2535 |
| 977 | Ga0501046_0009868 | 3300049580 | Bacteria | 8229 |
| 978 | Ga0501046_0042134 | 3300049580 | Bacteria | 3640 |
| 979 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 980 | Ga0501047_0015576 | 3300049581 | Bacteria | 7244 |
| 981 | Ga0501047_0021992 | 3300049581 | Bacteria | 6125 |
| 982 | Ga0501047_0036706 | 3300049581 | Bacteria | 4737 |
| 983 | Ga0501047_0053829 | 3300049581 | Bacteria | 3893 |
| 984 | Ga0501047_0084142 | 3300049581 | Bacteria | 3057 |
| 985 | Ga0501047_0129064 | 3300049581 | Bacteria | 2408 |
| 986 | Ga0501047_0157287 | 3300049581 | Bacteria | 2146 |
| 987 | Ga0501047_0203524 | 3300049581 | Bacteria | 1840 |
| 988 | Ga0501048_0000168 | 3300049582 | Bacteria | 41187 |
| 989 | Ga0501048_0014318 | 3300049582 | Bacteria | 5873 |
| 990 | Ga0501067_0092874 | 3300049583 | Bacteria | 1675 |
| 991 | Ga0501067_0119614 | 3300049583 | Bacteria | 1465 |
| 992 | Ga0501068_0015863 | 3300049584 | Bacteria | 4338 |
| 993 | Ga0501068_0030640 | 3300049584 | Bacteria | 3192 |
| 994 | Ga0501068_0039312 | 3300049584 | Bacteria | 2836 |
| 995 | Ga0501069_0011306 | 3300049585 | Bacteria | 4733 |
| 996 | Ga0501069_0014514 | 3300049585 | Bacteria | 4212 |
| 997 | Ga0501069_0046904 | 3300049585 | Bacteria | 2398 |
| 998 | Ga0501069_0048103 | 3300049585 | Bacteria | 2368 |
| 999 | Ga0501070_0004804 | 3300049586 | Bacteria | 11552 |
| 1000 | Ga0501070_0008692 | 3300049586 | Bacteria | 8585 |
| 1001 | Ga0501070_0018877 | 3300049586 | Bacteria | 5784 |
| 1002 | Ga0501070_0024148 | 3300049586 | Bacteria | 5097 |
| 1003 | Ga0501070_0042126 | 3300049586 | Bacteria | 3802 |
| 1004 | Ga0501070_0072099 | 3300049586 | Bacteria | 2859 |
| 1005 | Ga0501070_0073990 | 3300049586 | Bacteria | 2819 |
| 1006 | Ga0501071_0085944 | 3300049587 | Bacteria | 2307 |
| 1007 | Ga0501071_0332179 | 3300049587 | Bacteria | 1155 |
| 1008 | Ga0501072_0060633 | 3300049588 | Bacteria | 2983 |
| 1009 | Ga0501072_0105701 | 3300049588 | Bacteria | 2238 |
| 1010 | Ga0501072_0115525 | 3300049588 | Bacteria | 2137 |
| 1011 | Ga0501072_0285537 | 3300049588 | Bacteria | 1312 |
| 1012 | Ga0501073_0008770 | 3300049589 | Bacteria | 7484 |
| 1013 | Ga0501073_0009775 | 3300049589 | Bacteria | 7060 |
| 1014 | Ga0501073_0034787 | 3300049589 | Bacteria | 3583 |
| 1015 | Ga0501073_0112314 | 3300049589 | Bacteria | 1890 |
| 1016 | Ga0501073_0262691 | 3300049589 | Bacteria | 1191 |
| 1017 | Ga0501074_0011571 | 3300049590 | Bacteria | 6416 |
| 1018 | Ga0501074_0015553 | 3300049590 | Bacteria | 5530 |
| 1019 | Ga0501074_0092443 | 3300049590 | Bacteria | 2166 |
| 1020 | Ga0501075_0157073 | 3300049591 | Bacteria | 1734 |
| 1021 | Ga0501076_0224885 | 3300049592 | Bacteria | 1534 |
| 1022 | Ga0501080_0000198 | 3300049742 | Bacteria | 44139 |
| 1023 | Ga0501080_0014363 | 3300049742 | Bacteria | 7292 |
| 1024 | Ga0501080_0017519 | 3300049742 | Bacteria | 6624 |
| 1025 | Ga0501080_0038138 | 3300049742 | Bacteria | 4488 |
| 1026 | Ga0501080_0096651 | 3300049742 | Bacteria | 2742 |
| 1027 | Ga0501080_0113375 | 3300049742 | Bacteria | 2513 |
| 1028 | Ga0501080_0201842 | 3300049742 | Bacteria | 1825 |
| 1029 | Ga0501083_0001536 | 3300049744 | Bacteria | 15781 |
| 1030 | Ga0501083_0011302 | 3300049744 | Bacteria | 6262 |
| 1031 | Ga0501083_0038503 | 3300049744 | Bacteria | 3250 |
| 1032 | Ga0501035_0000994 | 3300049822 | Bacteria | 29965 |
| 1033 | Ga0501035_0027935 | 3300049822 | Bacteria | 5154 |
| 1034 | Ga0501035_0233210 | 3300049822 | Bacteria | 1568 |
| 1035 | Ga0501044_0002086 | 3300049823 | Bacteria | 23014 |
| 1036 | Ga0501044_0005135 | 3300049823 | Bacteria | 14600 |
| 1037 | Ga0501044_0014287 | 3300049823 | Bacteria | 8572 |
| 1038 | Ga0501044_0136706 | 3300049823 | Bacteria | 2442 |
| 1039 | Ga0501044_0160100 | 3300049823 | Bacteria | 2228 |
| 1040 | Ga0501044_0209404 | 3300049823 | Bacteria | 1904 |
| 1041 | Ga0501044_0339605 | 3300049823 | Bacteria | 1423 |
| 1042 | nmdc:mga03683_47548_c1 | 3300050489 | Bacteria | 1780 |
| 1043 | nmdc:mga03683_49545_c1 | 3300050489 | Bacteria | 1749 |
| 1044 | nmdc:mga03683_67690_c1 | 3300050489 | Bacteria | 1520 |
| 1045 | nmdc:mga03n38_3239_c1 | 3300050490 | Bacteria | 5192 |
| 1046 | nmdc:mga00v17_19178_c1 | 3300050491 | Bacteria | 3900 |
| 1047 | nmdc:mga00v17_87978_c1 | 3300050491 | Bacteria | 1947 |
| 1048 | nmdc:mga00v17_9160_c1 | 3300050491 | Bacteria | 5343 |
| 1049 | nmdc:mga0yw44_1900_c1 | 3300050492 | Bacteria | 8614 |
| 1050 | nmdc:mga0yw44_7593_c1 | 3300050492 | Bacteria | 5347 |
| 1051 | nmdc:mga0yw44_8643_c1 | 3300050492 | Bacteria | 5088 |
| 1052 | nmdc:mga0k408_75005_c1 | 3300050493 | Bacteria | 1976 |
| 1053 | nmdc:mga06z11_204072_c1 | 3300050494 | Bacteria | 1149 |
| 1054 | nmdc:mga06z11_82159_c1 | 3300050494 | Bacteria | 1731 |
| 1055 | nmdc:mga06z11_9433_c1 | 3300050494 | Bacteria | 4112 |
| 1056 | nmdc:mga04h51_4310_c1 | 3300050495 | Bacteria | 3528 |
| 1057 | nmdc:mga04h51_6053_c1 | 3300050495 | Bacteria | 3116 |
| 1058 | nmdc:mga05p37_2711_c2 | 3300050507 | Bacteria | 18727 |
| 1059 | nmdc:mga05p37_354_c1 | 3300050507 | Bacteria | 49188 |
| 1060 | nmdc:mga05p37_53293_c1 | 3300050507 | Bacteria | 4975 |
| 1061 | nmdc:mga05p37_7402_c1 | 3300050507 | Bacteria | 12952 |
| 1062 | nmdc:mga09592_1147_c1 | 3300050508 | Bacteria | 21127 |
| 1063 | nmdc:mga0qj67_20294_c1 | 3300050509 | Bacteria | 5086 |
| 1064 | nmdc:mga0qj67_219409_c1 | 3300050509 | Bacteria | 1544 |
| 1065 | nmdc:mga0qj67_316678_c1 | 3300050509 | Bacteria | 1263 |
| 1066 | nmdc:mga06r32_115465_c1 | 3300050510 | Bacteria | 2644 |
| 1067 | nmdc:mga06r32_147_c1 | 3300050510 | Bacteria | 53171 |
| 1068 | nmdc:mga06r32_32730_c1 | 3300050510 | Bacteria | 4894 |
| 1069 | nmdc:mga06r32_91117_c1 | 3300050510 | Bacteria | 2979 |
| 1070 | nmdc:mga08y16_289_c1 | 3300050511 | Bacteria | 45654 |
| 1071 | nmdc:mga08y16_344933_c1 | 3300050511 | Bacteria | 1530 |
| 1072 | nmdc:mga08y16_4156_c1 | 3300050511 | Bacteria | 15112 |
| 1073 | nmdc:mga08y16_49079_c1 | 3300050511 | Bacteria | 4417 |
| 1074 | nmdc:mga08y16_6983_c1 | 3300050511 | Bacteria | 11838 |
| 1075 | nmdc:mga0n895_109704_c1 | 3300050512 | Bacteria | 2775 |
| 1076 | nmdc:mga0n895_148630_c1 | 3300050512 | Bacteria | 2372 |
| 1077 | nmdc:mga0n895_191567_c1 | 3300050512 | Bacteria | 2076 |
| 1078 | nmdc:mga0n895_2287_c1 | 3300050512 | Bacteria | 14868 |
| 1079 | nmdc:mga0n895_2438_c1 | 3300050512 | Bacteria | 14525 |
| 1080 | nmdc:mga0n895_50171_c1 | 3300050512 | Bacteria | 4090 |
| 1081 | nmdc:mga0n895_64716_c1 | 3300050512 | Bacteria | 3617 |
| 1082 | nmdc:mga0n895_70268_c1 | 3300050512 | Bacteria | 3470 |
| 1083 | nmdc:mga0rr50_52939_c1 | 3300050513 | Bacteria | 3018 |
| 1084 | nmdc:mga0rr50_60619_c1 | 3300050513 | Bacteria | 2847 |
| 1085 | nmdc:mga0rr50_866_c1 | 3300050513 | Bacteria | 16346 |
| 1086 | nmdc:mga08x19_133724_c1 | 3300050514 | Bacteria | 1670 |
| 1087 | nmdc:mga08x19_57652_c1 | 3300050514 | Bacteria | 2510 |
| 1088 | nmdc:mga0a205_47327_c1 | 3300050515 | Bacteria | 4149 |
| 1089 | nmdc:mga0a205_60_c1 | 3300050515 | Bacteria | 60202 |
| 1090 | nmdc:mga0a205_733_c1 | 3300050515 | Bacteria | 15506 |
| 1091 | nmdc:mga0sz30_32048_c1 | 3300050516 | Bacteria | 2177 |
| 1092 | Ga0495601_0000003 | 3300053077 | Bacteria | 493642 |
| 1093 | Ga0495601_0000633 | 3300053077 | Bacteria | 18799 |
| 1094 | Ga0495601_0009435 | 3300053077 | Bacteria | 5771 |
| 1095 | Ga0495601_0014499 | 3300053077 | Bacteria | 4749 |
| 1096 | Ga0495601_0039919 | 3300053077 | Bacteria | 2939 |
| 1097 | Ga0495601_0128092 | 3300053077 | Bacteria | 1652 |
| 1098 | Ga0495612_0000009 | 3300053078 | Bacteria | 229858 |
| 1099 | Ga0495612_0001588 | 3300053078 | Bacteria | 9375 |
| 1100 | Ga0495612_0008883 | 3300053078 | Bacteria | 4071 |
| 1101 | Ga0495612_0010222 | 3300053078 | Bacteria | 3796 |
| 1102 | Ga0495612_0012233 | 3300053078 | Bacteria | 3460 |
| 1103 | Ga0495655_0003034 | 3300053083 | Bacteria | 2725 |
| 1104 | Ga0495595_0000011 | 3300053084 | Bacteria | 174945 |
| 1105 | Ga0495595_0002035 | 3300053084 | Bacteria | 7853 |
| 1106 | Ga0495595_0002334 | 3300053084 | Bacteria | 7395 |
| 1107 | Ga0495595_0003065 | 3300053084 | Bacteria | 6611 |
| 1108 | Ga0495595_0003222 | 3300053084 | Bacteria | 6477 |
| 1109 | Ga0495595_0014156 | 3300053084 | Bacteria | 3379 |
| 1110 | Ga0495619_0000039 | 3300053085 | Bacteria | 118681 |
| 1111 | Ga0495619_0000859 | 3300053085 | Bacteria | 19908 |
| 1112 | Ga0495619_0000996 | 3300053085 | Bacteria | 18589 |
| 1113 | Ga0495619_0003147 | 3300053085 | Bacteria | 10703 |
| 1114 | Ga0495619_0003231 | 3300053085 | Bacteria | 10556 |
| 1115 | Ga0495619_0003678 | 3300053085 | Bacteria | 9887 |
| 1116 | Ga0495619_0035546 | 3300053085 | Bacteria | 3240 |
| 1117 | Ga0495619_0095560 | 3300053085 | Bacteria | 2016 |
| 1118 | Ga0495619_0182146 | 3300053085 | Bacteria | 1453 |
| 1119 | Ga0500644_0000321 | 3300053088 | Bacteria | 24950 |
| 1120 | Ga0500651_0012299 | 3300053093 | Bacteria | 5188 |
| 1121 | Ga0500641_0005670 | 3300053096 | Bacteria | 4424 |
| 1122 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1123 | Ga0500595_011319 | 3300053119 | Bacteria | 3499 |
| 1124 | Ga0500595_015084 | 3300053119 | Bacteria | 2908 |
| 1125 | Ga0500652_000080 | 3300053131 | Bacteria | 42009 |
| 1126 | Ga0500652_017107 | 3300053131 | Bacteria | 2653 |
| 1127 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1128 | Ga0500616_0024210 | 3300053153 | Bacteria | 3377 |
| 1129 | Ga0500636_0034305 | 3300053177 | Bacteria | 3003 |
| 1130 | Ga0500645_000086 | 3300053730 | Bacteria | 74512 |
| 1131 | Ga0501084_0051321 | 3300054114 | Bacteria | 3452 |
| 1132 | Ga0501082_0117241 | 3300060353 | Bacteria | 2306 |
| 1133 | Ga0501082_0149258 | 3300060353 | Bacteria | 2030 |
| 1134 | Ga0530510_0241753 | 3300061734 | Bacteria | 1344 |
| 1135 | 2643756745 | 2643221547 | Bacteria | 4740017 |
| 1136 | 2644734686 | 2643221734 | Bacteria | 5365412 |
| 1137 | 2644746428 | 2643221736 | Bacteria | 6608466 |
| 1138 | 2819722198 | 2818991467 | Bacteria | 5893227 |
| 1139 | 2841765059 | 2841760612 | Bacteria | 6454112 |
| 1140 | 2841912545 | 2841911363 | Bacteria | 6173697 |
| 1141 | 2841918300 | 2841917233 | Bacteria | 6173500 |
| 1142 | 2844105584 | 2844104063 | Bacteria | 6440972 |
| 1143 | 2851183855 | 2851182111 | Bacteria | 6047226 |
| 1144 | 2851249599 | 2851246043 | Bacteria | 6439203 |
| 1145 | 2883578826 | 2883577096 | Bacteria | 4709178 |
| 1146 | 2917703097 | 2917699015 | Bacteria | 7043791 |
| 1147 | 8057532912 | 8057529695 | Bacteria | 6306553 |
| 1148 | Ga0068853_100092825 | |||
| 1149 | 2214828543 | |||
| 1150 | ARcpr5oldR_c000091 | |||
| 1151 | ARSoilYngRDRAFT_c00530 | |||
| 1152 | ARcpr5yngRDRAFT_c000035 | |||
| 1153 | ARSoilOldRDRAFT_c000038 | |||
| 1154 | ARCol0oldRDRAFT_c00271 | |||
| 1155 | ARCol0yngRDRAFT_1000226 | |||
| 1156 | ARCol0yngRDRAFT_1000544 | |||
| 1157 | JGI24741J21665_1013859 | |||
| 1158 | JGI24752J21851_1001007 | |||
| 1159 | JGI24746J21847_1000328 | |||
| 1160 | JGI24739J22299_10000158 | |||
| 1161 | JGI24737J22298_10000549 | |||
| 1162 | JGI24737J22298_10004390 | |||
| 1163 | JGI24743J22301_10007575 | |||
| 1164 | JGI24743J22301_10013699 | |||
| 1165 | JGI24750J21931_1000073 | |||
| 1166 | JGI24745J21846_1001047 | |||
| 1167 | JGI24748J21848_1001221 | |||
| 1168 | JGI24738J21930_10000776 | |||
| 1169 | JGI24749J21850_1003382 | |||
| 1170 | JGI24744J21845_10013510 | |||
| 1171 | JGI24035J26624_1000662 | |||
| 1172 | JGI24034J26672_10000658 | |||
| 1173 | JGI24742J22300_10001071 | |||
| 1174 | JGI24751J29686_10012928 | |||
| 1175 | JGI25159J45721_1010413 | |||
| 1176 | JGI25151J46595_10000264 | |||
| 1177 | JGI25404J52841_10000088 | |||
| 1178 | Ga0055526_1000443 | |||
| 1179 | Ga0055526_1000897 | |||
| 1180 | Ga0055524_1000328 | |||
| 1181 | JGI25405J52794_10001764 | |||
| 1182 | Ga0065165_1000497 | |||
| 1183 | Ga0065717_1002158 | |||
| 1184 | Ga0065712_10000346 | |||
| 1185 | Ga0065712_10069119 | |||
| 1186 | Ga0065715_10089004 | |||
| 1187 | Ga0065707_10158335 | |||
| 1188 | Ga0070658_10019548 | |||
| 1189 | Ga0070676_10002105 | |||
| 1190 | Ga0070683_100000152 | |||
| 1191 | Ga0070690_100001131 | |||
| 1192 | Ga0070690_100001419 | |||
| 1193 | Ga0070690_100047729 | |||
| 1194 | Ga0070690_100100122 | |||
| 1195 | Ga0070670_100015820 | |||
| 1196 | Ga0070677_10000385 | |||
| 1197 | Ga0068869_100000020 | |||
| 1198 | Ga0068869_100040477 | |||
| 1199 | Ga0070666_10002859 | |||
| 1200 | Ga0070666_10022181 | |||
| 1201 | Ga0070666_10025545 | |||
| 1202 | Ga0070680_100007933 | |||
| 1203 | Ga0070680_100016097 | |||
| 1204 | Ga0070680_100018394 | |||
| 1205 | Ga0070680_100114312 | |||
| 1206 | Ga0070680_100192072 | |||
| 1207 | Ga0070682_100000264 | |||
| 1208 | Ga0070682_100034397 | |||
| 1209 | Ga0068868_100000944 | |||
| 1210 | Ga0068868_100020698 | |||
| 1211 | Ga0070660_100001464 | |||
| 1212 | Ga0070660_100026578 | |||
| 1213 | Ga0070660_100078209 | |||
| 1214 | Ga0070660_100134509 | |||
| 1215 | Ga0070689_100000646 | |||
| 1216 | Ga0070689_100006301 | |||
| 1217 | Ga0070691_10000125 | |||
| 1218 | Ga0070691_10009716 | |||
| 1219 | Ga0070687_100000772 | |||
| 1220 | Ga0070661_100001434 | |||
| 1221 | Ga0070661_100066257 | |||
| 1222 | Ga0070661_100182066 | |||
| 1223 | Ga0070692_10000497 | |||
| 1224 | Ga0070692_10017928 | |||
| 1225 | Ga0070668_100001692 | |||
| 1226 | Ga0070668_100050455 | |||
| 1227 | Ga0070669_100001308 | |||
| 1228 | Ga0070675_100002535 | |||
| 1229 | Ga0070675_100044035 | |||
| 1230 | Ga0070675_100167635 | |||
| 1231 | Ga0070671_100003193 | |||
| 1232 | Ga0070671_100020677 | |||
| 1233 | Ga0070671_100026051 | |||
| 1234 | Ga0070674_100000152 | |||
| 1235 | Ga0070674_100038619 | |||
| 1236 | Ga0070673_100000042 | |||
| 1237 | Ga0070673_100005416 | |||
| 1238 | Ga0070688_100011743 | |||
| 1239 | Ga0070688_100019218 | |||
| 1240 | Ga0070688_100094394 | |||
| 1241 | Ga0070659_100000621 | |||
| 1242 | Ga0070659_100257830 | |||
| 1243 | Ga0070667_100000775 | |||
| 1244 | Ga0070667_100040683 | |||
| 1245 | Ga0070709_10008346 | |||
| 1246 | Ga0070709_10045817 | |||
| 1247 | Ga0070709_10196960 | |||
| 1248 | Ga0070714_100004348 | |||
| 1249 | Ga0070714_100010885 | |||
| 1250 | Ga0070714_100240517 | |||
| 1251 | Ga0070713_100002823 | |||
| 1252 | Ga0070713_100007614 | |||
| 1253 | Ga0070713_100014010 | |||
| 1254 | Ga0070713_100042866 | |||
| 1255 | Ga0070713_100070461 | |||
| 1256 | Ga0070710_10008204 | |||
| 1257 | Ga0070710_10009182 | |||
| 1258 | Ga0070710_10070188 | |||
| 1259 | Ga0070701_10000042 | |||
| 1260 | Ga0070711_100019807 | |||
| 1261 | Ga0070711_100055857 | |||
| 1262 | Ga0070711_100141484 | |||
| 1263 | Ga0070711_100229006 | |||
| 1264 | Ga0070711_100333040 | |||
| 1265 | Ga0070705_100001795 | |||
| 1266 | Ga0070705_100117671 | |||
| 1267 | Ga0070700_100002917 | |||
| 1268 | Ga0070700_100138618 | |||
| 1269 | Ga0070700_100205424 | |||
| 1270 | Ga0070694_100001840 | |||
| 1271 | Ga0070708_100026481 | |||
| 1272 | Ga0070708_100409509 | |||
| 1273 | Ga0070663_100001813 | |||
| 1274 | Ga0070663_100240403 | |||
| 1275 | Ga0070678_100138776 | |||
| 1276 | Ga0070662_100009703 | |||
| 1277 | Ga0070662_100022381 | |||
| 1278 | Ga0070681_10007379 | |||
| 1279 | Ga0070681_10028900 | |||
| 1280 | Ga0070681_10082515 | |||
| 1281 | Ga0070681_10087773 | |||
| 1282 | Ga0068867_100029544 | |||
| 1283 | Ga0068867_100042878 | |||
| 1284 | Ga0068867_100051447 | |||
| 1285 | Ga0070685_10006591 | |||
| 1286 | Ga0070685_10100277 | |||
| 1287 | Ga0070685_10100747 | |||
| 1288 | Ga0070707_100089097 | |||
| 1289 | Ga0070679_100010500 | |||
| 1290 | Ga0070679_100059875 | |||
| 1291 | Ga0070679_100073029 | |||
| 1292 | Ga0070679_100090289 | |||
| 1293 | Ga0070679_100217427 | |||
| 1294 | Ga0070679_100224148 | |||
| 1295 | Ga0070684_100002220 | |||
| 1296 | Ga0070684_100020410 | |||
| 1297 | Ga0070684_100111323 | |||
| 1298 | Ga0068853_100002983 | |||
| 1299 | Ga0068853_100047591 | |||
| 1300 | Ga0068853_100087529 | |||
| 1301 | Ga0068853_100379633 | |||
| 1302 | Ga0070672_100000557 | |||
| 1303 | Ga0070672_100019246 | |||
| 1304 | Ga0070686_100000889 | |||
| 1305 | Ga0070686_100045503 | |||
| 1306 | Ga0070686_100135243 | |||
| 1307 | Ga0070695_100002375 | |||
| 1308 | Ga0070695_100011291 | |||
| 1309 | Ga0070696_100007145 | |||
| 1310 | Ga0070696_100022886 | |||
| 1311 | Ga0070696_100100305 | |||
| 1312 | Ga0070696_100235161 | |||
| 1313 | Ga0070693_100000816 | |||
| 1314 | Ga0070693_100070602 | |||
| 1315 | Ga0070665_100042419 | |||
| 1316 | Ga0070665_100187472 | |||
| 1317 | Ga0070665_100264445 | |||
| 1318 | Ga0070704_100009648 | |||
| 1319 | Ga0068855_100003933 | |||
| 1320 | Ga0068855_100015053 | |||
| 1321 | Ga0068855_100268801 | |||
| 1322 | Ga0068855_100395937 | |||
| 1323 | Ga0070664_100000263 | |||
| 1324 | Ga0070664_100279361 | |||
| 1325 | Ga0068857_100002138 | |||
| 1326 | Ga0068857_100258402 | |||
| 1327 | Ga0068857_100312943 | |||
| 1328 | Ga0068854_100003820 | |||
| 1329 | Ga0068856_100000803 | |||
| 1330 | Ga0068856_100059903 | |||
| 1331 | Ga0070702_100002410 | |||
| 1332 | Ga0070702_100029823 | |||
| 1333 | Ga0068852_100000579 | |||
| 1334 | Ga0068859_100007549 | |||
| 1335 | Ga0068859_100016354 | |||
| 1336 | Ga0068864_100000112 | |||
| 1337 | Ga0068864_100019256 | |||
| 1338 | Ga0068864_100122118 | |||
| 1339 | Ga0068866_10000300 | |||
| 1340 | Ga0068866_10026972 | |||
| 1341 | Ga0068861_100010541 | |||
| 1342 | Ga0068861_100075102 | |||
| 1343 | Ga0068870_10000108 | |||
| 1344 | Ga0068870_10032303 | |||
| 1345 | Ga0068863_100000491 | |||
| 1346 | Ga0068863_100003267 | |||
| 1347 | Ga0068858_100000419 | |||
| 1348 | Ga0068858_100021340 | |||
| 1349 | Ga0068858_100123945 | |||
| 1350 | Ga0068860_100001036 | |||
| 1351 | Ga0068860_100084253 | |||
| 1352 | Ga0068862_100003792 | |||
| 1353 | Ga0068862_100030972 | |||
| 1354 | Ga0068862_100046460 | |||
| 1355 | Ga0081455_10000009 | |||
| 1356 | Ga0081455_10000807 | |||
| 1357 | Ga0081455_10008889 | |||
| 1358 | Ga0081455_10014935 | |||
| 1359 | Ga0081455_10049456 | |||
| 1360 | Ga0081455_10064218 | |||
| 1361 | Ga0081538_10017231 | |||
| 1362 | Ga0081540_1000011 | |||
| 1363 | Ga0081540_1001420 | |||
| 1364 | Ga0081540_1053834 | |||
| 1365 | Ga0081539_10083226 | |||
| 1366 | Ga0070717_10003833 | |||
| 1367 | Ga0070717_10069761 | |||
| 1368 | Ga0070717_10176313 | |||
| 1369 | Ga0075365_10005156 | |||
| 1370 | Ga0075365_10171951 | |||
| 1371 | Ga0075368_10000443 | |||
| 1372 | Ga0075368_10010049 | |||
| 1373 | Ga0075363_100009180 | |||
| 1374 | Ga0075364_10161533 | |||
| 1375 | Ga0075432_10001253 | |||
| 1376 | Ga0075432_10026658 | |||
| 1377 | Ga0070715_10000530 | |||
| 1378 | Ga0070716_100001432 | |||
| 1379 | Ga0070716_100003368 | |||
| 1380 | Ga0070712_100015060 | |||
| 1381 | Ga0070712_100113287 | |||
| 1382 | Ga0075362_10009446 | |||
| 1383 | Ga0075362_10067906 | |||
| 1384 | Ga0075367_10001869 | |||
| 1385 | Ga0075367_10005992 | |||
| 1386 | Ga0075367_10049267 | |||
| 1387 | Ga0075369_10002023 | |||
| 1388 | Ga0097621_100000115 | |||
| 1389 | Ga0097621_100057842 | |||
| 1390 | Ga0075370_10009560 | |||
| 1391 | Ga0068871_100000417 | |||
| 1392 | Ga0068871_100004915 | |||
| 1393 | Ga0068871_100103493 | |||
| 1394 | Ga0075428_100000363 | |||
| 1395 | Ga0075428_100151120 | |||
| 1396 | Ga0075428_100304573 | |||
| 1397 | Ga0075430_100003344 | |||
| 1398 | Ga0075430_100220435 | |||
| 1399 | Ga0075431_100012459 | |||
| 1400 | Ga0075431_100015943 | |||
| 1401 | Ga0075433_10000187 | |||
| 1402 | Ga0075433_10005073 | |||
| 1403 | Ga0075433_10053921 | |||
| 1404 | Ga0075434_100002790 | |||
| 1405 | Ga0075434_100063307 | |||
| 1406 | Ga0075434_100135205 | |||
| 1407 | Ga0075434_100178720 | |||
| 1408 | Ga0075434_100225071 | |||
| 1409 | Ga0075429_100000846 | |||
| 1410 | Ga0075429_100307916 | |||
| 1411 | Ga0068865_100000450 | |||
| 1412 | Ga0068865_100078568 | |||
| 1413 | Ga0097620_100007549 | |||
| 1414 | Ga0097620_100016351 | |||
| 1415 | Ga0075435_100001311 | |||
| 1416 | Ga0075435_100033548 | |||
| 1417 | Ga0075435_100034161 | |||
| 1418 | Ga0075435_100051236 | |||
| 1419 | Ga0075435_100206572 | |||
| 1420 | Ga0099795_10042884 | |||
| 1421 | Ga0105244_10104891 | |||
| 1422 | Ga0105240_10017084 | |||
| 1423 | Ga0105240_10025233 | |||
| 1424 | Ga0105240_10303052 | |||
| 1425 | Ga0105240_10423907 | |||
| 1426 | Ga0111539_10000196 | |||
| 1427 | Ga0111539_10000376 | |||
| 1428 | Ga0111539_10010434 | |||
| 1429 | Ga0111539_10068463 | |||
| 1430 | Ga0111539_10125812 | |||
| 1431 | Ga0105245_10001838 | |||
| 1432 | Ga0105245_10040100 | |||
| 1433 | Ga0105247_10000844 | |||
| 1434 | Ga0105247_10098942 | |||
| 1435 | Ga0114129_10010654 | |||
| 1436 | Ga0114129_10011780 | |||
| 1437 | Ga0114129_10016386 | |||
| 1438 | Ga0114129_10089838 | |||
| 1439 | Ga0114129_10134685 | |||
| 1440 | Ga0105243_10002666 | |||
| 1441 | Ga0105243_10033223 | |||
| 1442 | Ga0105243_10043352 | |||
| 1443 | Ga0105243_10267486 | |||
| 1444 | Ga0105241_10004421 | |||
| 1445 | Ga0105241_10173764 | |||
| 1446 | Ga0105241_10225526 | |||
| 1447 | Ga0105242_10006586 | |||
| 1448 | Ga0105242_10029473 | |||
| 1449 | Ga0105242_10485285 | |||
| 1450 | Ga0105248_10000500 | |||
| 1451 | Ga0105248_10049476 | |||
| 1452 | Ga0105248_10110811 | |||
| 1453 | Ga0105237_10010999 | |||
| 1454 | Ga0105237_10223516 | |||
| 1455 | Ga0105237_10288125 | |||
| 1456 | Ga0105238_10084920 | |||
| 1457 | Ga0105238_10109250 | |||
| 1458 | Ga0105238_10178648 | |||
| 1459 | Ga0105249_10014148 | |||
| 1460 | Ga0105249_10072442 | |||
| 1461 | Ga0105239_10008765 | |||
| 1462 | Ga0105239_10052422 | |||
| 1463 | Ga0105239_10057594 | |||
| 1464 | Ga0105239_10170571 | |||
| 1465 | Ga0105239_10275788 | |||
| 1466 | Ga0105246_10000033 | |||
| 1467 | Ga0105246_10015886 | |||
| 1468 | Ga0105246_10137277 | |||
| 1469 | Ga0157342_1000140 | |||
| 1470 | Ga0157342_1000149 | |||
| 1471 | Ga0157373_10007875 | |||
| 1472 | Ga0157373_10031343 | |||
| 1473 | Ga0157371_10006432 | |||
| 1474 | Ga0157371_10080644 | |||
| 1475 | Ga0157370_10030840 | |||
| 1476 | Ga0157370_10196034 | |||
| 1477 | Ga0157369_10233946 | |||
| 1478 | Ga0157369_10541240 | |||
| 1479 | Ga0171462_1039 | |||
| 1480 | Ga0157374_10003002 | |||
| 1481 | Ga0157374_10029483 | |||
| 1482 | Ga0157374_10216440 | |||
| 1483 | Ga0157378_10002195 | |||
| 1484 | Ga0157378_10122484 | |||
| 1485 | Ga0163162_10001526 | |||
| 1486 | Ga0163162_10079449 | |||
| 1487 | Ga0157372_10049188 | |||
| 1488 | Ga0157372_10198111 | |||
| 1489 | Ga0157372_10212591 | |||
| 1490 | Ga0157375_10000124 | |||
| 1491 | Ga0157375_10204393 | |||
| 1492 | Ga0163163_10000745 | |||
| 1493 | Ga0163163_10013111 | |||
| 1494 | Ga0157380_10000140 | |||
| 1495 | Ga0157380_10488530 | |||
| 1496 | Ga0157377_10000117 | |||
| 1497 | Ga0157379_10000785 | |||
| 1498 | Ga0157379_10021545 | |||
| 1499 | Ga0157379_10090285 | |||
| 1500 | Ga0157379_10131578 | |||
| 1501 | Ga0157379_10131771 | |||
| 1502 | Ga0157376_10000034 | |||
| 1503 | Ga0157376_10078444 | |||
| 1504 | Ga0157376_10516039 | |||
| 1505 | Ga0163161_10000448 | |||
| 1506 | Ga0213874_10037206 | |||
| 1507 | Ga0209233_1005206 | |||
| 1508 | Ga0207666_1000017 | |||
| 1509 | Ga0209130_1000930 | |||
| 1510 | Ga0209675_1003692 | |||
| 1511 | Ga0209025_1000357 | |||
| 1512 | Ga0209025_1006354 | |||
| 1513 | Ga0209025_1027376 | |||
| 1514 | Ga0209564_1000580 | |||
| 1515 | Ga0209564_1000790 | |||
| 1516 | Ga0209256_1000504 | |||
| 1517 | Ga0209256_1000695 | |||
| 1518 | Ga0207697_10000009 | |||
| 1519 | Ga0207653_10005862 | |||
| 1520 | Ga0207653_10006516 | |||
| 1521 | Ga0207682_10000016 | |||
| 1522 | Ga0207692_10006732 | |||
| 1523 | Ga0207692_10049334 | |||
| 1524 | Ga0207692_10081307 | |||
| 1525 | Ga0207642_10001066 | |||
| 1526 | Ga0207710_10000872 | |||
| 1527 | Ga0207710_10042878 | |||
| 1528 | Ga0207688_10000012 | |||
| 1529 | Ga0207688_10000724 | |||
| 1530 | Ga0207688_10012750 | |||
| 1531 | Ga0207680_10004638 | |||
| 1532 | Ga0207680_10007328 | |||
| 1533 | Ga0207647_10000675 | |||
| 1534 | Ga0207685_10002531 | |||
| 1535 | Ga0207685_10003645 | |||
| 1536 | Ga0207699_10000471 | |||
| 1537 | Ga0207699_10058348 | |||
| 1538 | Ga0207645_10000124 | |||
| 1539 | Ga0207645_10014691 | |||
| 1540 | Ga0207643_10000075 | |||
| 1541 | Ga0207643_10002257 | |||
| 1542 | Ga0207684_10028032 | |||
| 1543 | Ga0207654_10001577 | |||
| 1544 | Ga0207654_10102791 | |||
| 1545 | Ga0207654_10160888 | |||
| 1546 | Ga0207707_10006050 | |||
| 1547 | Ga0207707_10017365 | |||
| 1548 | Ga0207707_10153684 | |||
| 1549 | Ga0207707_10200959 | |||
| 1550 | Ga0207707_10288018 | |||
| 1551 | Ga0207671_10004598 | |||
| 1552 | Ga0207693_10007591 | |||
| 1553 | Ga0207693_10007801 | |||
| 1554 | Ga0207693_10009539 | |||
| 1555 | Ga0207693_10010807 | |||
| 1556 | Ga0207693_10080348 | |||
| 1557 | Ga0207693_10087329 | |||
| 1558 | Ga0207693_10098075 | |||
| 1559 | Ga0207663_10033218 | |||
| 1560 | Ga0207663_10054700 | |||
| 1561 | Ga0207663_10066103 | |||
| 1562 | Ga0207663_10119156 | |||
| 1563 | Ga0207660_10000489 | |||
| 1564 | Ga0207660_10066164 | |||
| 1565 | Ga0207660_10082119 | |||
| 1566 | Ga0207662_10000466 | |||
| 1567 | Ga0207662_10003107 | |||
| 1568 | Ga0207662_10029187 | |||
| 1569 | Ga0207657_10000162 | |||
| 1570 | Ga0207657_10020188 | |||
| 1571 | Ga0207657_10025969 | |||
| 1572 | Ga0207649_10000411 | |||
| 1573 | Ga0207649_10265672 | |||
| 1574 | Ga0207652_10007710 | |||
| 1575 | Ga0207652_10141802 | |||
| 1576 | Ga0207652_10181365 | |||
| 1577 | Ga0207646_10169050 | |||
| 1578 | Ga0207681_10001617 | |||
| 1579 | Ga0207694_10079957 | |||
| 1580 | Ga0207650_10005173 | |||
| 1581 | Ga0207650_10017729 | |||
| 1582 | Ga0207659_10000017 | |||
| 1583 | Ga0207687_10000417 | |||
| 1584 | Ga0207687_10033527 | |||
| 1585 | Ga0207687_10065475 | |||
| 1586 | Ga0207700_10001122 | |||
| 1587 | Ga0207700_10005932 | |||
| 1588 | Ga0207700_10019154 | |||
| 1589 | Ga0207700_10058890 | |||
| 1590 | Ga0207700_10174603 | |||
| 1591 | Ga0207664_10017837 | |||
| 1592 | Ga0207644_10002417 | |||
| 1593 | Ga0207644_10007214 | |||
| 1594 | Ga0207644_10030185 | |||
| 1595 | Ga0207690_10000151 | |||
| 1596 | Ga0207690_10022512 | |||
| 1597 | Ga0207690_10105350 | |||
| 1598 | Ga0207706_10000368 | |||
| 1599 | Ga0207706_10002835 | |||
| 1600 | Ga0207706_10017875 | |||
| 1601 | Ga0207706_10035451 | |||
| 1602 | Ga0207686_10002957 | |||
| 1603 | Ga0207686_10134991 | |||
| 1604 | Ga0207709_10000256 | |||
| 1605 | Ga0207709_10048397 | |||
| 1606 | Ga0207670_10000086 | |||
| 1607 | Ga0207669_10000398 | |||
| 1608 | Ga0207669_10306386 | |||
| 1609 | Ga0207704_10000139 | |||
| 1610 | Ga0207704_10020379 | |||
| 1611 | Ga0207704_10185629 | |||
| 1612 | Ga0207665_10000204 | |||
| 1613 | Ga0207665_10006321 | |||
| 1614 | Ga0207665_10014646 | |||
| 1615 | Ga0207665_10221950 | |||
| 1616 | Ga0207691_10000303 | |||
| 1617 | Ga0207691_10016212 | |||
| 1618 | Ga0207711_10049816 | |||
| 1619 | Ga0207689_10000109 | |||
| 1620 | Ga0207689_10003705 | |||
| 1621 | Ga0207689_10359761 | |||
| 1622 | Ga0207661_10000074 | |||
| 1623 | Ga0207661_10102176 | |||
| 1624 | Ga0207679_10000031 | |||
| 1625 | Ga0207667_10031004 | |||
| 1626 | Ga0207667_10131935 | |||
| 1627 | Ga0207667_10516451 | |||
| 1628 | Ga0207651_10000044 | |||
| 1629 | Ga0207651_10261780 | |||
| 1630 | Ga0207712_10007106 | |||
| 1631 | Ga0207712_10098775 | |||
| 1632 | Ga0207668_10000345 | |||
| 1633 | Ga0207668_10068502 | |||
| 1634 | Ga0207640_10001716 | |||
| 1635 | Ga0207640_10131110 | |||
| 1636 | Ga0207658_10005012 | |||
| 1637 | Ga0207658_10051910 | |||
| 1638 | Ga0207658_10060072 | |||
| 1639 | Ga0207658_10141485 | |||
| 1640 | Ga0207677_10002560 | |||
| 1641 | Ga0207677_10012300 | |||
| 1642 | Ga0207703_10002483 | |||
| 1643 | Ga0207703_10011289 | |||
| 1644 | Ga0207639_10004898 | |||
| 1645 | Ga0207678_10000158 | |||
| 1646 | Ga0207678_10003070 | |||
| 1647 | Ga0207708_10000098 | |||
| 1648 | Ga0207708_10000416 | |||
| 1649 | Ga0207702_10014157 | |||
| 1650 | Ga0207702_10269951 | |||
| 1651 | Ga0207702_10306472 | |||
| 1652 | Ga0207641_10000408 | |||
| 1653 | Ga0207641_10143181 | |||
| 1654 | Ga0207641_10270308 | |||
| 1655 | Ga0207648_10000696 | |||
| 1656 | Ga0207648_10005386 | |||
| 1657 | Ga0207648_10010270 | |||
| 1658 | Ga0207648_10022337 | |||
| 1659 | Ga0207676_10006295 | |||
| 1660 | Ga0207676_10074682 | |||
| 1661 | Ga0207674_10000420 | |||
| 1662 | Ga0207674_10087738 | |||
| 1663 | Ga0207674_10277455 | |||
| 1664 | Ga0207675_100001146 | |||
| 1665 | Ga0207675_100001268 | |||
| 1666 | Ga0207675_100061395 | |||
| 1667 | Ga0207675_100220445 | |||
| 1668 | Ga0207683_10000004 | |||
| 1669 | Ga0207683_10001766 | |||
| 1670 | Ga0207683_10006982 | |||
| 1671 | Ga0207698_10001253 | |||
| 1672 | Ga0207698_10098636 | |||
| 1673 | Ga0209967_1012008 | |||
| 1674 | Ga0210002_1000731 | |||
| 1675 | Ga0209983_1018941 | |||
| 1676 | Ga0209966_1003032 | |||
| 1677 | Ga0209998_10000945 | |||
| 1678 | Ga0209974_10000117 | |||
| 1679 | Ga0209974_10077748 | |||
| 1680 | Ga0207428_10000250 | |||
| 1681 | Ga0207428_10001707 | |||
| 1682 | Ga0207428_10002343 | |||
| 1683 | Ga0268265_10000752 | |||
| 1684 | Ga0268265_10131359 | |||
| 1685 | Ga0268265_10258375 | |||
| 1686 | Ga0268264_10002529 | |||
| 1687 | Ga0268264_10038211 | |||
| 1688 | Ga0265337_1002301 | |||
| 1689 | Ga0265324_10032758 | |||
| 1690 | Ga0265325_10000039 | |||
| 1691 | Ga0265325_10002499 | |||
| 1692 | Ga0265325_10003454 | |||
| 1693 | Ga0265325_10036910 | |||
| 1694 | Ga0265325_10052094 | |||
| 1695 | Ga0265340_10052354 | |||
| 1696 | Ga0265339_10006717 | |||
| 1697 | Ga0265339_10016529 | |||
| 1698 | Ga0265339_10024016 | |||
| 1699 | Ga0265331_10001218 | |||
| 1700 | Ga0265331_10029044 | |||
| 1701 | Ga0265316_10148171 | |||
| 1702 | Ga0265313_10000021 | |||
| 1703 | Ga0265313_10000057 | |||
| 1704 | Ga0265313_10002016 | |||
| 1705 | Ga0265313_10017419 | |||
| 1706 | Ga0265313_10029421 | |||
| 1707 | Ga0265313_10039737 | |||
| 1708 | Ga0265313_10052558 | |||
| 1709 | Ga0265314_10004299 | |||
| 1710 | Ga0265314_10005478 | |||
| 1711 | Ga0265314_10009434 | |||
| 1712 | Ga0265342_10003392 | |||
| 1713 | Ga0265342_10025747 | |||
| 1714 | Ga0265342_10039196 | |||
| 1715 | Ga0316576_10323306 | |||
| 1716 | Ga0316583_10008041 | |||
| 1717 | Ga0373930_0003658 | |||
| 1718 | Ga0373948_0000331 | |||
| 1719 | Ga0373950_0000525 | |||
| 1720 | Ga0373950_0002206 | |||
| 1721 | Ga0373950_0009375 | |||
| 1722 | Ga0373958_0001188 | |||
| 1723 | Ga0373959_0003250 | |||
| 1724 | Ga0373938_0003628 | |||
| 1725 | Ga0373926_0004729 | |||
| 1726 | Ga0373926_0013859 | |||
| 1727 | Ga0373928_0002766 | |||
| 1728 | Ga0373929_0000934 | |||
| 1729 | Ga0373929_0005827 | |||
| 1730 | Ga0373934_0038218 | |||
| 1731 | Ga0373934_0114124 | |||
| 1732 | Ga0373940_0000070 | |||
| 1733 | Ga0373944_0000293 | |||
| 1734 | Ga0373949_0000878 | |||
| 1735 | Ga0373949_0002003 | |||
| 1736 | Ga0373951_0001550 | |||
| 1737 | Ga0373951_0006833 | |||
| 1738 | Ga0373952_0002820 | |||
| 1739 | Ga0373952_0008501 | |||
| 1740 | Ga0373923_0021776 | |||
| 1741 | Ga0373923_0057726 | |||
| 1742 | Ga0373932_0000094 | |||
| 1743 | Ga0373936_0004221 | |||
| 1744 | Ga0373939_0000436 | |||
| 1745 | Ga0373939_0004620 | |||
| 1746 | Ga0373941_0000404 | |||
| 1747 | Ga0373941_0000909 | |||
| 1748 | Ga0373945_0051977 | |||
| 1749 | Ga0373953_0001892 | |||
| 1750 | Ga0373953_0002543 | |||
| 1751 | Ga0373953_0028516 | |||
| 1752 | Ga0373954_0002451 | |||
| 1753 | Ga0373954_0017633 | |||
| 1754 | Ga0373956_0005141 | |||
| 1755 | Ga0373957_0008056 | |||
| 1756 | Ga0373960_0003391 | |||
| 1757 | Ga0373960_0006721 | |||
| 1758 | Ga0373960_0019556 | |||
| 1759 | Ga0373943_0000574 | |||
| 1760 | Ga0373943_0038255 | |||
| 1761 | Ga0373943_0055379 | |||
| 1762 | Ga0373943_0092472 | |||
| 1763 | Ga0373946_0001887 | |||
| 1764 | Ga0373946_0030093 | |||
| 1765 | Ga0373955_0000179 | |||
| 1766 | Ga0373955_0000573 | |||
| 1767 | Ga0373955_0009737 | |||
| 1768 | Ga0373955_0052874 | |||
| 1769 | Ga0373942_0003796 | |||
| 1770 | Ga0373942_0004402 | |||
| 1771 | Ga0373961_0003554 | |||
| 1772 | Ga0373962_0000137 | |||
| 1773 | Ga0373962_0001436 | |||
| 1774 | Ga0373962_0010790 | |||
| 1775 | Ga0316574_0003710 | |||
| 1776 | Ga0373924_0000231 | |||
| 1777 | Ga0373924_0003315 | |||
| 1778 | Ga0373924_0039594 | |||
| 1779 | Ga0373924_0050973 | |||
| 1780 | Ga0373924_0080610 | |||
| 1781 | Ga0373931_0000034 | |||
| 1782 | Ga0373931_0004201 | |||
| 1783 | Ga0373931_0168071 | |||
| 1784 | Ga0373935_0000041 | |||
| 1785 | Ga0373935_0027233 | |||
| 1786 | Ga0373927_0013903 | |||
| 1787 | Ga0373927_0067208 | |||
| 1788 | Ga0373927_0103055 | |||
| 1789 | Ga0373927_0106884 | |||
| 1790 | Ga0373927_0133573 | |||
| 1791 | Ga0373933_0000827 | |||
| 1792 | Ga0373933_0000876 | |||
| 1793 | Ga0373933_0004375 | |||
| 1794 | Ga0373933_0038252 | |||
| 1795 | Ga0373933_0044678 | |||
| 1796 | Ga0373933_0190104 | |||
| 1797 | Ga0373947_0000606 | |||
| 1798 | Ga0373947_0039421 | |||
| 1799 | Ga0373947_0066320 | |||
| 1800 | Ga0373937_0000458 | |||
| 1801 | Ga0373937_0004869 | |||
| 1802 | Ga0373937_0011492 | |||
| 1803 | Ga0373937_0011831 | |||
| 1804 | Ga0373937_0015291 | |||
| 1805 | Ga0373937_0016247 | |||
| 1806 | Ga0373937_0049613 | |||
| 1807 | Ga0373937_0141643 | |||
| 1808 | Ga0316582_0223725 | |||
| 1809 | Ga0373925_0000084 | |||
| 1810 | Ga0373925_0023174 | |||
| 1811 | Ga0373925_0048639 | |||
| 1812 | Ga0373925_0144652 | |||
| 1813 | Ga0373925_0258493 | |||
| 1814 | Ga0373925_0279066 | |||
| 1815 | Ga0373925_0293022 | |||
| 1816 | Ga0436364_0815578 | |||
| 1817 | Ga0436364_1454102 | |||
| 1818 | Ga0436360_0478773 | |||
| 1819 | Ga0436360_0682085 | |||
| 1820 | Ga0436360_0961521 | |||
| 1821 | Ga0436361_0003682 | |||
| 1822 | Ga0436363_1560263 | |||
| 1823 | Ga0466967_0078916 | |||
| 1824 | Ga0495617_026205 | |||
| 1825 | Ga0495627_041952 | |||
| 1826 | Ga0495592_0000026 | |||
| 1827 | Ga0495592_0007769 | |||
| 1828 | Ga0495592_0013078 | |||
| 1829 | Ga0495592_0027747 | |||
| 1830 | Ga0495592_0082742 | |||
| 1831 | Ga0495629_0002921 | |||
| 1832 | Ga0495629_0010593 | |||
| 1833 | Ga0495638_0063532 | |||
| 1834 | Ga0495641_0050150 | |||
| 1835 | Ga0495641_0067144 | |||
| 1836 | Ga0495651_0001559 | |||
| 1837 | Ga0495651_0009033 | |||
| 1838 | Ga0495651_0014408 | |||
| 1839 | Ga0495651_0030845 | |||
| 1840 | Ga0495653_0000003 | |||
| 1841 | Ga0495653_0007399 | |||
| 1842 | Ga0495582_0066961 | |||
| 1843 | Ga0495582_0149324 | |||
| 1844 | Ga0495582_0164943 | |||
| 1845 | Ga0495639_0022520 | |||
| 1846 | Ga0495639_0024518 | |||
| 1847 | Ga0495662_0024038 | |||
| 1848 | Ga0495664_0000001 | |||
| 1849 | Ga0495664_0005683 | |||
| 1850 | Ga0495584_0028231 | |||
| 1851 | Ga0495584_0043390 | |||
| 1852 | Ga0495584_0128304 | |||
| 1853 | Ga0495585_0002362 | |||
| 1854 | Ga0495594_0062544 | |||
| 1855 | Ga0495607_0007810 | |||
| 1856 | Ga0495583_0036681 | |||
| 1857 | Ga0495608_0000012 | |||
| 1858 | Ga0495608_0006328 | |||
| 1859 | Ga0495608_0051798 | |||
| 1860 | Ga0495618_0008669 | |||
| 1861 | Ga0495618_0029856 | |||
| 1862 | Ga0495628_0000095 | |||
| 1863 | Ga0495628_0006043 | |||
| 1864 | Ga0495628_0018089 | |||
| 1865 | Ga0495628_0064924 | |||
| 1866 | Ga0495630_0002688 | |||
| 1867 | Ga0495630_0015138 | |||
| 1868 | Ga0495630_0026641 | |||
| 1869 | Ga0495630_0160924 | |||
| 1870 | Ga0495631_0058073 | |||
| 1871 | Ga0495644_0003320 | |||
| 1872 | Ga0495644_0010527 | |||
| 1873 | Ga0495663_0008764 | |||
| 1874 | Ga0495666_0006722 | |||
| 1875 | Ga0495652_0000001 | |||
| 1876 | Ga0495652_0023334 | |||
| 1877 | Ga0495652_0024406 | |||
| 1878 | Ga0495665_0027624 | |||
| 1879 | Ga0495665_0028821 | |||
| 1880 | Ga0495640_0000010 | |||
| 1881 | Ga0495640_0011907 | |||
| 1882 | Ga0495640_0032087 | |||
| 1883 | Ga0495586_0028866 | |||
| 1884 | Ga0495586_0123593 | |||
| 1885 | Ga0495587_0000003 | |||
| 1886 | Ga0495587_0000784 | |||
| 1887 | Ga0495587_0014912 | |||
| 1888 | Ga0495587_0038540 | |||
| 1889 | Ga0495609_0023490 | |||
| 1890 | Ga0495645_0000026 | |||
| 1891 | Ga0495645_0001504 | |||
| 1892 | Ga0495645_0010117 | |||
| 1893 | Ga0495622_0015371 | |||
| 1894 | Ga0495667_0000001 | |||
| 1895 | Ga0495667_0005788 | |||
| 1896 | Ga0495667_0011936 | |||
| 1897 | Ga0495667_0036076 | |||
| 1898 | Ga0495667_0048298 | |||
| 1899 | Ga0495656_0004129 | |||
| 1900 | Ga0495656_0004992 | |||
| 1901 | Ga0495634_0000037 | |||
| 1902 | Ga0495634_0016507 | |||
| 1903 | Ga0495634_0170556 | |||
| 1904 | Ga0495635_0000011 | |||
| 1905 | Ga0495635_0004840 | |||
| 1906 | Ga0495635_0033836 | |||
| 1907 | Ga0495635_0136158 | |||
| 1908 | Ga0495635_0176270 | |||
| 1909 | Ga0495659_0007435 | |||
| 1910 | Ga0495661_0097359 | |||
| 1911 | Ga0495588_0003043 | |||
| 1912 | Ga0495657_0000050 | |||
| 1913 | Ga0495657_0000582 | |||
| 1914 | Ga0495599_0000004 | |||
| 1915 | Ga0495599_0006216 | |||
| 1916 | Ga0495599_0031357 | |||
| 1917 | Ga0495599_0046099 | |||
| 1918 | Ga0495623_0000081 | |||
| 1919 | Ga0495623_0006875 | |||
| 1920 | Ga0495623_0013754 | |||
| 1921 | Ga0495623_0035106 | |||
| 1922 | Ga0495646_0000010 | |||
| 1923 | Ga0495646_0000200 | |||
| 1924 | Ga0495646_0022383 | |||
| 1925 | Ga0495647_0001076 | |||
| 1926 | Ga0495647_0014060 | |||
| 1927 | Ga0495658_0001728 | |||
| 1928 | Ga0495658_0003067 | |||
| 1929 | Ga0495658_0134353 | |||
| 1930 | Ga0495658_0207945 | |||
| 1931 | Ga0495613_0008422 | |||
| 1932 | Ga0495613_0035259 | |||
| 1933 | Ga0495624_0011303 | |||
| 1934 | Ga0495624_0014992 | |||
| 1935 | Ga0495624_0042983 | |||
| 1936 | Ga0495671_0027293 | |||
| 1937 | Ga0495600_0000007 | |||
| 1938 | Ga0495600_0001285 | |||
| 1939 | Ga0495600_0007437 | |||
| 1940 | Ga0495600_0011093 | |||
| 1941 | Ga0495581_0002943 | |||
| 1942 | Ga0495581_0011203 | |||
| 1943 | Ga0495581_0062533 | |||
| 1944 | Ga0495581_0097487 | |||
| 1945 | Ga0495604_0000010 | |||
| 1946 | Ga0495604_0005339 | |||
| 1947 | Ga0495604_0012612 | |||
| 1948 | Ga0495604_0012983 | |||
| 1949 | Ga0495604_0024305 | |||
| 1950 | Ga0495604_0035103 | |||
| 1951 | Ga0495604_0123084 | |||
| 1952 | Ga0495674_0000013 | |||
| 1953 | Ga0495674_0146698 | |||
| 1954 | Ga0495674_0258991 | |||
| 1955 | Ga0495674_0334528 | |||
| 1956 | Ga0495676_0017489 | |||
| 1957 | Ga0495676_0052021 | |||
| 1958 | Ga0495676_0069527 | |||
| 1959 | Ga0495676_0091904 | |||
| 1960 | Ga0495676_0126249 | |||
| 1961 | Ga0495680_0000078 | |||
| 1962 | Ga0495680_0001872 | |||
| 1963 | Ga0495680_0004686 | |||
| 1964 | Ga0495680_0004980 | |||
| 1965 | Ga0495680_0012957 | |||
| 1966 | Ga0495680_0039186 | |||
| 1967 | Ga0495680_0205747 | |||
| 1968 | Ga0495675_0000305 | |||
| 1969 | Ga0495675_0006007 | |||
| 1970 | Ga0495675_0013982 | |||
| 1971 | Ga0495681_0101166 | |||
| 1972 | Ga0495684_0000008 | |||
| 1973 | Ga0495684_0059040 | |||
| 1974 | Ga0495684_0062269 | |||
| 1975 | Ga0495593_0000145 | |||
| 1976 | Ga0495593_0002171 | |||
| 1977 | Ga0495593_0006743 | |||
| 1978 | Ga0495602_0000002 | |||
| 1979 | Ga0495602_0009411 | |||
| 1980 | Ga0495602_0015651 | |||
| 1981 | Ga0495602_0015918 | |||
| 1982 | Ga0495602_0160995 | |||
| 1983 | Ga0495614_0012218 | |||
| 1984 | Ga0496100_0000679 | |||
| 1985 | Ga0496100_0005609 | |||
| 1986 | Ga0496100_0010839 | |||
| 1987 | Ga0496100_0020414 | |||
| 1988 | Ga0496100_0049389 | |||
| 1989 | Ga0496100_0080139 | |||
| 1990 | Ga0496101_0000121 | |||
| 1991 | Ga0496101_0002379 | |||
| 1992 | Ga0496101_0072114 | |||
| 1993 | Ga0496102_0001800 | |||
| 1994 | Ga0496102_0003585 | |||
| 1995 | Ga0496102_0142914 | |||
| 1996 | Ga0496102_0146266 | |||
| 1997 | Ga0496103_0002140 | |||
| 1998 | Ga0496103_0002528 | |||
| 1999 | Ga0496103_0019764 | |||
| 2000 | Ga0496104_0000575 | |||
| 2001 | Ga0496104_0009294 | |||
| 2002 | Ga0496104_0033246 | |||
| 2003 | Ga0496104_0060319 | |||
| 2004 | Ga0496104_0061472 | |||
| 2005 | Ga0496105_0005756 | |||
| 2006 | Ga0496105_0014700 | |||
| 2007 | Ga0496105_0026365 | |||
| 2008 | Ga0496105_0037340 | |||
| 2009 | Ga0496105_0038085 | |||
| 2010 | Ga0496105_0274656 | |||
| 2011 | Ga0496106_0000133 | |||
| 2012 | Ga0496106_0004497 | |||
| 2013 | Ga0496106_0029780 | |||
| 2014 | Ga0496106_0036322 | |||
| 2015 | Ga0496106_0055385 | |||
| 2016 | Ga0496106_0195346 | |||
| 2017 | Ga0496107_0001229 | |||
| 2018 | Ga0496107_0011864 | |||
| 2019 | Ga0496107_0026643 | |||
| 2020 | Ga0496107_0054233 | |||
| 2021 | Ga0496107_0070643 | |||
| 2022 | Ga0496107_0150469 | |||
| 2023 | Ga0496107_0259886 | |||
| 2024 | Ga0496108_0005937 | |||
| 2025 | Ga0496108_0006248 | |||
| 2026 | Ga0496108_0010047 | |||
| 2027 | Ga0496108_0013329 | |||
| 2028 | Ga0496108_0016034 | |||
| 2029 | Ga0496108_0149094 | |||
| 2030 | Ga0496108_0389807 | |||
| 2031 | Ga0496109_0006607 | |||
| 2032 | Ga0496109_0006735 | |||
| 2033 | Ga0496109_0006919 | |||
| 2034 | Ga0496109_0016552 | |||
| 2035 | Ga0496109_0163386 | |||
| 2036 | Ga0496110_0006375 | |||
| 2037 | Ga0496110_0025620 | |||
| 2038 | Ga0496110_0040058 | |||
| 2039 | Ga0496110_0082707 | |||
| 2040 | Ga0496110_0101737 | |||
| 2041 | Ga0496110_0161381 | |||
| 2042 | Ga0496110_0237387 | |||
| 2043 | Ga0496111_0008013 | |||
| 2044 | Ga0496111_0012311 | |||
| 2045 | Ga0496111_0023099 | |||
| 2046 | Ga0496111_0023383 | |||
| 2047 | Ga0496111_0023811 | |||
| 2048 | Ga0496111_0028981 | |||
| 2049 | Ga0496111_0045320 | |||
| 2050 | Ga0496111_0235273 | |||
| 2051 | Ga0496111_0293535 | |||
| 2052 | Ga0496112_0001095 | |||
| 2053 | Ga0496112_0028750 | |||
| 2054 | Ga0496112_0103617 | |||
| 2055 | Ga0496112_0137026 | |||
| 2056 | Ga0496112_0184414 | |||
| 2057 | Ga0496112_0286534 | |||
| 2058 | Ga0496113_0006833 | |||
| 2059 | Ga0496113_0010461 | |||
| 2060 | Ga0496113_0030136 | |||
| 2061 | Ga0496113_0034994 | |||
| 2062 | Ga0496113_0102121 | |||
| 2063 | Ga0496113_0244011 | |||
| 2064 | Ga0496113_0251316 | |||
| 2065 | Ga0496114_0024196 | |||
| 2066 | Ga0496114_0061556 | |||
| 2067 | Ga0496114_0142440 | |||
| 2068 | Ga0496115_0004251 | |||
| 2069 | Ga0496115_0044425 | |||
| 2070 | Ga0496115_0052630 | |||
| 2071 | Ga0496115_0053974 | |||
| 2072 | Ga0496115_0056919 | |||
| 2073 | Ga0496115_0089844 | |||
| 2074 | Ga0496117_0074455 | |||
| 2075 | Ga0496122_0018456 | |||
| 2076 | Ga0496122_0132407 | |||
| 2077 | Ga0496123_0011563 | |||
| 2078 | Ga0496123_0030058 | |||
| 2079 | Ga0496123_0093631 | |||
| 2080 | Ga0501031_0001650 | |||
| 2081 | Ga0501032_0016718 | |||
| 2082 | Ga0501032_0045230 | |||
| 2083 | Ga0501032_0084246 | |||
| 2084 | Ga0501032_0132560 | |||
| 2085 | Ga0501033_0049551 | |||
| 2086 | Ga0501033_0055120 | |||
| 2087 | Ga0501033_0074193 | |||
| 2088 | Ga0501034_0000032 | |||
| 2089 | Ga0501034_0000623 | |||
| 2090 | Ga0501034_0011296 | |||
| 2091 | Ga0501034_0015888 | |||
| 2092 | Ga0501034_0036635 | |||
| 2093 | Ga0501034_0044949 | |||
| 2094 | Ga0501034_0078963 | |||
| 2095 | Ga0501034_0081950 | |||
| 2096 | Ga0501034_0146865 | |||
| 2097 | Ga0501034_0380316 | |||
| 2098 | Ga0501034_0424268 | |||
| 2099 | Ga0501036_0007360 | |||
| 2100 | Ga0501036_0010284 | |||
| 2101 | Ga0501036_0048396 | |||
| 2102 | Ga0501036_0054322 | |||
| 2103 | Ga0501036_0070649 | |||
| 2104 | Ga0501037_0004970 | |||
| 2105 | Ga0501037_0005615 | |||
| 2106 | Ga0501037_0009466 | |||
| 2107 | Ga0501037_0013851 | |||
| 2108 | Ga0501037_0075101 | |||
| 2109 | Ga0501037_0099786 | |||
| 2110 | Ga0501038_0008677 | |||
| 2111 | Ga0501038_0011705 | |||
| 2112 | Ga0501038_0043948 | |||
| 2113 | Ga0501038_0048763 | |||
| 2114 | Ga0501038_0098638 | |||
| 2115 | Ga0501039_0009153 | |||
| 2116 | Ga0501039_0014974 | |||
| 2117 | Ga0501039_0296060 | |||
| 2118 | Ga0501042_0272524 | |||
| 2119 | Ga0501043_0001573 | |||
| 2120 | Ga0501043_0014132 | |||
| 2121 | Ga0501043_0017896 | |||
| 2122 | Ga0501043_0043984 | |||
| 2123 | Ga0501043_0081974 | |||
| 2124 | Ga0501046_0009868 | |||
| 2125 | Ga0501046_0042134 | |||
| 2126 | Ga0501047_0000010 | |||
| 2127 | Ga0501047_0015576 | |||
| 2128 | Ga0501047_0021992 | |||
| 2129 | Ga0501047_0036706 | |||
| 2130 | Ga0501047_0053829 | |||
| 2131 | Ga0501047_0084142 | |||
| 2132 | Ga0501047_0129064 | |||
| 2133 | Ga0501047_0157287 | |||
| 2134 | Ga0501047_0203524 | |||
| 2135 | Ga0501048_0000168 | |||
| 2136 | Ga0501048_0014318 | |||
| 2137 | Ga0501067_0092874 | |||
| 2138 | Ga0501067_0119614 | |||
| 2139 | Ga0501068_0015863 | |||
| 2140 | Ga0501068_0030640 | |||
| 2141 | Ga0501068_0039312 | |||
| 2142 | Ga0501069_0011306 | |||
| 2143 | Ga0501069_0014514 | |||
| 2144 | Ga0501069_0046904 | |||
| 2145 | Ga0501069_0048103 | |||
| 2146 | Ga0501070_0004804 | |||
| 2147 | Ga0501070_0008692 | |||
| 2148 | Ga0501070_0018877 | |||
| 2149 | Ga0501070_0024148 | |||
| 2150 | Ga0501070_0042126 | |||
| 2151 | Ga0501070_0072099 | |||
| 2152 | Ga0501070_0073990 | |||
| 2153 | Ga0501071_0085944 | |||
| 2154 | Ga0501071_0332179 | |||
| 2155 | Ga0501072_0060633 | |||
| 2156 | Ga0501072_0105701 | |||
| 2157 | Ga0501072_0115525 | |||
| 2158 | Ga0501072_0285537 | |||
| 2159 | Ga0501073_0008770 | |||
| 2160 | Ga0501073_0009775 | |||
| 2161 | Ga0501073_0034787 | |||
| 2162 | Ga0501073_0112314 | |||
| 2163 | Ga0501073_0262691 | |||
| 2164 | Ga0501074_0011571 | |||
| 2165 | Ga0501074_0015553 | |||
| 2166 | Ga0501074_0092443 | |||
| 2167 | Ga0501075_0157073 | |||
| 2168 | Ga0501076_0224885 | |||
| 2169 | Ga0501080_0000198 | |||
| 2170 | Ga0501080_0014363 | |||
| 2171 | Ga0501080_0017519 | |||
| 2172 | Ga0501080_0038138 | |||
| 2173 | Ga0501080_0096651 | |||
| 2174 | Ga0501080_0113375 | |||
| 2175 | Ga0501080_0201842 | |||
| 2176 | Ga0501083_0001536 | |||
| 2177 | Ga0501083_0011302 | |||
| 2178 | Ga0501083_0038503 | |||
| 2179 | Ga0501035_0000994 | |||
| 2180 | Ga0501035_0027935 | |||
| 2181 | Ga0501035_0233210 | |||
| 2182 | Ga0501044_0002086 | |||
| 2183 | Ga0501044_0005135 | |||
| 2184 | Ga0501044_0014287 | |||
| 2185 | Ga0501044_0136706 | |||
| 2186 | Ga0501044_0160100 | |||
| 2187 | Ga0501044_0209404 | |||
| 2188 | Ga0501044_0339605 | |||
| 2189 | nmdc:mga03683_47548_c1 | |||
| 2190 | nmdc:mga03683_49545_c1 | |||
| 2191 | nmdc:mga03683_67690_c1 | |||
| 2192 | nmdc:mga03n38_3239_c1 | |||
| 2193 | nmdc:mga00v17_19178_c1 | |||
| 2194 | nmdc:mga00v17_87978_c1 | |||
| 2195 | nmdc:mga00v17_9160_c1 | |||
| 2196 | nmdc:mga0yw44_1900_c1 | |||
| 2197 | nmdc:mga0yw44_7593_c1 | |||
| 2198 | nmdc:mga0yw44_8643_c1 | |||
| 2199 | nmdc:mga0k408_75005_c1 | |||
| 2200 | nmdc:mga06z11_204072_c1 | |||
| 2201 | nmdc:mga06z11_82159_c1 | |||
| 2202 | nmdc:mga06z11_9433_c1 | |||
| 2203 | nmdc:mga04h51_4310_c1 | |||
| 2204 | nmdc:mga04h51_6053_c1 | |||
| 2205 | nmdc:mga05p37_2711_c2 | |||
| 2206 | nmdc:mga05p37_354_c1 | |||
| 2207 | nmdc:mga05p37_53293_c1 | |||
| 2208 | nmdc:mga05p37_7402_c1 | |||
| 2209 | nmdc:mga09592_1147_c1 | |||
| 2210 | nmdc:mga0qj67_20294_c1 | |||
| 2211 | nmdc:mga0qj67_219409_c1 | |||
| 2212 | nmdc:mga0qj67_316678_c1 | |||
| 2213 | nmdc:mga06r32_115465_c1 | |||
| 2214 | nmdc:mga06r32_147_c1 | |||
| 2215 | nmdc:mga06r32_32730_c1 | |||
| 2216 | nmdc:mga06r32_91117_c1 | |||
| 2217 | nmdc:mga08y16_289_c1 | |||
| 2218 | nmdc:mga08y16_344933_c1 | |||
| 2219 | nmdc:mga08y16_4156_c1 | |||
| 2220 | nmdc:mga08y16_49079_c1 | |||
| 2221 | nmdc:mga08y16_6983_c1 | |||
| 2222 | nmdc:mga0n895_109704_c1 | |||
| 2223 | nmdc:mga0n895_148630_c1 | |||
| 2224 | nmdc:mga0n895_191567_c1 | |||
| 2225 | nmdc:mga0n895_2287_c1 | |||
| 2226 | nmdc:mga0n895_2438_c1 | |||
| 2227 | nmdc:mga0n895_50171_c1 | |||
| 2228 | nmdc:mga0n895_64716_c1 | |||
| 2229 | nmdc:mga0n895_70268_c1 | |||
| 2230 | nmdc:mga0rr50_52939_c1 | |||
| 2231 | nmdc:mga0rr50_60619_c1 | |||
| 2232 | nmdc:mga0rr50_866_c1 | |||
| 2233 | nmdc:mga08x19_133724_c1 | |||
| 2234 | nmdc:mga08x19_57652_c1 | |||
| 2235 | nmdc:mga0a205_47327_c1 | |||
| 2236 | nmdc:mga0a205_60_c1 | |||
| 2237 | nmdc:mga0a205_733_c1 | |||
| 2238 | nmdc:mga0sz30_32048_c1 | |||
| 2239 | Ga0495601_0000003 | |||
| 2240 | Ga0495601_0000633 | |||
| 2241 | Ga0495601_0009435 | |||
| 2242 | Ga0495601_0014499 | |||
| 2243 | Ga0495601_0039919 | |||
| 2244 | Ga0495601_0128092 | |||
| 2245 | Ga0495612_0000009 | |||
| 2246 | Ga0495612_0001588 | |||
| 2247 | Ga0495612_0008883 | |||
| 2248 | Ga0495612_0010222 | |||
| 2249 | Ga0495612_0012233 | |||
| 2250 | Ga0495655_0003034 | |||
| 2251 | Ga0495595_0000011 | |||
| 2252 | Ga0495595_0002035 | |||
| 2253 | Ga0495595_0002334 | |||
| 2254 | Ga0495595_0003065 | |||
| 2255 | Ga0495595_0003222 | |||
| 2256 | Ga0495595_0014156 | |||
| 2257 | Ga0495619_0000039 | |||
| 2258 | Ga0495619_0000859 | |||
| 2259 | Ga0495619_0000996 | |||
| 2260 | Ga0495619_0003147 | |||
| 2261 | Ga0495619_0003231 | |||
| 2262 | Ga0495619_0003678 | |||
| 2263 | Ga0495619_0035546 | |||
| 2264 | Ga0495619_0095560 | |||
| 2265 | Ga0495619_0182146 | |||
| 2266 | Ga0500644_0000321 | |||
| 2267 | Ga0500651_0012299 | |||
| 2268 | Ga0500641_0005670 | |||
| 2269 | Ga0500595_000002 | |||
| 2270 | Ga0500595_011319 | |||
| 2271 | Ga0500595_015084 | |||
| 2272 | Ga0500652_000080 | |||
| 2273 | Ga0500652_017107 | |||
| 2274 | Ga0500616_0000002 | |||
| 2275 | Ga0500616_0024210 | |||
| 2276 | Ga0500636_0034305 | |||
| 2277 | Ga0500645_000086 | |||
| 2278 | Ga0501084_0051321 | |||
| 2279 | Ga0501082_0117241 | |||
| 2280 | Ga0501082_0149258 | |||
| 2281 | Ga0530510_0241753 | |||
| 2282 | 2643756745 | |||
| 2283 | 2644734686 | |||
| 2284 | 2644746428 | |||
| 2285 | 2819722198 | |||
| 2286 | 2841765059 | |||
| 2287 | 2841912545 | |||
| 2288 | 2841918300 | |||
| 2289 | 2844105584 | |||
| 2290 | 2851183855 | |||
| 2291 | 2851249599 | |||
| 2292 | 2883578826 | |||
| 2293 | 2917703097 | |||
| 2294 | 8057532912 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5k1s-assembly1.cif.gz_B | crystal structure of aibc | 0.9181 | 38 | 314 |
| 4jbh-assembly2.cif.gz_B | 2.2a resolution structure of cobalt and zinc bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum | 0.9122 | 36 | 316 |
| 3krt-assembly1.cif.gz_D | crystal structure of putative crotonyl coa reductase from streptomyces coelicolor a3(2) | 0.9111 | 34 | 314 |
| 5k1s-assembly2.cif.gz_D | crystal structure of aibc | 0.9076 | 35 | 314 |
| 4y1b-assembly1.cif.gz_A | structure of crotonyl-coa carboxylase/reductase ante v350a in complex with nadp | 0.9074 | 36 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O65423_126_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9637 | 129 | 264 | 3.40.50.720 |
| af_A0A286Y901_130_273_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.954 | 123 | 264 | 3.40.50.720 |
| af_O65423_126_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9501 | 129 | 264 | 3.40.50.720 |
| af_I1LVH0_176_320_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9408 | 127 | 263 | 3.40.50.720 |
| af_Q54UL7_143_287_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9355 | 123 | 263 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9S5C6-F1-model_v4 | Alcohol dehydrogenase | 0.9651 | 118 | 316 |
GO:0016491
|
| AF-A0A2V7IB97-F1-model_v4 | NADPH:quinone reductase | 0.9579 | 156 | 316 |
|
| AF-X0UTV7-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9514 | 98 | 315 |
GO:0016491
|
| AF-A0A2V9S5C6-F1-model_v4 | Alcohol dehydrogenase | 0.9512 | 118 | 316 |
GO:0016491
|
| AF-A0A6B1FE41-F1-model_v4 | Zinc-binding dehydrogenase | 0.9507 | 101 | 316 |
GO:0016491
|