F490822
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1148 | 637 | 2296 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10103974|Ga0157375_101039743 |
| Length | 339 |
| Sequence | MDRFTSLTAFVRVVENGGFSAAARRLNMSTTMVSNHVQALEDRLGVRLLNRTTRKVSLTEIGKAYYDRSTQILADLEQADDIAGALQSTPRGTLRIHTATHMVPFVAPVMAEFLATYPEVKVDLRMGETNVDLIEEGFDLALRMVAPPDSSLIVRSLATWRHVLCCSHGYIEAHGRVQTLEELAGHNCVRHINYPFDEWRFFDRKGTPASVRVSGNLITNSGEALREAALQGAGISLAAGFLVGDDLDAGRLVRLLPEYRPVEMSMNAVYPHRHHLSAKVRTFIDMLVQHSAEQQKLINPYACDVIVPHPEERGTRVSKDEGPAGGLALRDACFASSSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 84 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 85 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 86 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 112 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 113 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 114 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 118 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 203 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 204 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 235 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 236 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 237 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 238 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 239 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 240 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 242 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 243 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 244 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 245 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 246 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 247 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 248 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 249 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 250 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 251 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 252 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 253 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 254 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 255 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 390 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 396 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 402 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 403 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 404 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 405 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 410 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 411 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 412 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 414 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 416 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 417 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 418 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 419 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 423 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 424 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 426 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 429 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 430 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 431 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 433 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 434 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 435 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 436 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 438 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 439 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 440 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 441 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 442 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 443 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 444 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 445 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 446 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 447 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 448 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 449 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 450 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 451 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 452 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 453 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 454 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 455 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 456 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 457 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 458 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 459 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 460 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 461 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 462 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 463 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 464 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 465 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 466 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 467 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 468 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 469 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 470 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 471 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 472 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 473 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 474 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 475 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 476 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 477 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 478 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 479 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 480 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 481 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 482 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 483 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 484 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 485 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 486 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 487 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 488 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 489 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 490 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 491 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 492 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 493 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 494 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 495 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 496 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 497 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 498 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 499 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 500 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 501 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 502 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 503 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 504 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 505 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 506 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 507 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 508 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 509 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 510 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 511 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 512 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 513 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 514 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 515 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 516 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 517 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 518 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 519 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 520 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 521 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 522 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 523 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 524 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 525 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 526 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 527 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 528 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 529 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 530 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 531 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 532 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 533 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 534 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 535 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 536 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 537 | 2904699407 | |||
| 538 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 539 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 540 | 2906610324 | |||
| 541 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 542 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 543 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 544 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 545 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 546 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 547 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 548 | 2922368715 | |||
| 549 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 550 | 2922425934 | |||
| 551 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 552 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 553 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 554 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 555 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 556 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 557 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 558 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 559 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 560 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 561 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 562 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 563 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 564 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 565 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 566 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 567 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 568 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 569 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 570 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 571 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 572 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 573 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 574 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 575 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 576 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 577 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 578 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 579 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 580 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 581 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 582 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 583 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 584 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 585 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 586 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 587 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 588 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 589 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 590 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 591 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 592 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 593 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 594 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 595 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 596 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 597 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 598 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 599 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 600 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 601 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 602 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 603 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 604 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 605 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 606 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 607 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 608 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 609 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 610 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 611 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 612 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 613 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 614 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 615 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 616 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 617 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 618 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 619 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 620 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 621 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 622 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 623 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 624 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 625 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 626 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 627 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 628 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 629 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 630 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 631 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 632 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 633 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 634 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 635 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 636 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 637 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.87 |
| Metatranscriptomes | 0 |
| Isolates | 17.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.93 |
| Nodule | 13.41 |
| Rhizoplane | 6.79 |
| Rhizosphere | 55.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157375_10103974 | 3300013308 | Bacteria | 2928 |
| 2 | MRS2a_Contig_38 | 2124908027 | Bacteria | 10858 |
| 3 | JGI25152J39213_1002024 | 3300002773 | Bacteria | 7992 |
| 4 | JGI25151J46595_10001595 | 3300003187 | Bacteria | 15062 |
| 5 | JGI25151J46595_10040452 | 3300003187 | Bacteria | 1706 |
| 6 | JGI25406J46586_10000064 | 3300003203 | Bacteria | 49110 |
| 7 | JGI25153J46596_10001739 | 3300003215 | Bacteria | 12925 |
| 8 | JGI25153J46596_10002780 | 3300003215 | Bacteria | 9952 |
| 9 | JGI25153J46596_10004236 | 3300003215 | Bacteria | 7761 |
| 10 | rootH1_10079142 | 3300003316 | Bacteria | 7746 |
| 11 | rootH2_10178384 | 3300003320 | Bacteria | 2086 |
| 12 | rootL2_10208118 | 3300003322 | Plasmid | 4255 |
| 13 | rootH1_10036200 | 3300003323 | Bacteria | 4603 |
| 14 | rootH1_10052176 | 3300003323 | Bacteria | 1691 |
| 15 | JGI25160J50197_1004224 | 3300003354 | Bacteria | 6243 |
| 16 | JGI25160J50197_1016674 | 3300003354 | Bacteria | 2357 |
| 17 | JGI25161J50226_1008987 | 3300003374 | Bacteria | 1475 |
| 18 | Ga0055531_10007654 | 3300003794 | Bacteria | 5847 |
| 19 | Ga0055543_1014121 | 3300004625 | Bacteria | 1563 |
| 20 | Ga0065165_1001009 | 3300005262 | Bacteria | 34332 |
| 21 | Ga0065165_1001177 | 3300005262 | Bacteria | 30398 |
| 22 | Ga0065165_1006388 | 3300005262 | Bacteria | 6204 |
| 23 | Ga0065165_1010110 | 3300005262 | Bacteria | 4133 |
| 24 | Ga0065165_1021093 | 3300005262 | Bacteria | 2271 |
| 25 | Ga0065714_10000030 | 3300005288 | Bacteria | 18150 |
| 26 | Ga0065714_10003214 | 3300005288 | Bacteria | 11083 |
| 27 | Ga0065714_10008328 | 3300005288 | Bacteria | 2925 |
| 28 | Ga0065712_10085937 | 3300005290 | Bacteria | 2656 |
| 29 | Ga0065712_10170727 | 3300005290 | Bacteria | 1245 |
| 30 | Ga0070658_10059139 | 3300005327 | Bacteria | 3121 |
| 31 | Ga0070676_10225571 | 3300005328 | Bacteria | 1240 |
| 32 | Ga0070683_100003885 | 3300005329 | Bacteria | 12224 |
| 33 | Ga0070683_100016009 | 3300005329 | Bacteria | 6599 |
| 34 | Ga0070683_100301249 | 3300005329 | Bacteria | 1525 |
| 35 | Ga0070683_100396443 | 3300005329 | Bacteria | 1316 |
| 36 | Ga0068869_100004206 | 3300005334 | Bacteria | 8935 |
| 37 | Ga0070680_100086609 | 3300005336 | Bacteria | 2589 |
| 38 | Ga0068868_100038484 | 3300005338 | Bacteria | 3713 |
| 39 | Ga0068868_100229560 | 3300005338 | Bacteria | 1557 |
| 40 | Ga0070660_100071897 | 3300005339 | Bacteria | 2702 |
| 41 | Ga0070661_100076627 | 3300005344 | Bacteria | 2465 |
| 42 | Ga0070661_100084773 | 3300005344 | Bacteria | 2341 |
| 43 | Ga0070668_100007896 | 3300005347 | Bacteria | 7901 |
| 44 | Ga0070668_100419218 | 3300005347 | Bacteria | 1146 |
| 45 | Ga0070675_100104813 | 3300005354 | Bacteria | 2386 |
| 46 | Ga0070671_100027281 | 3300005355 | Bacteria | 4698 |
| 47 | Ga0070671_100087093 | 3300005355 | Bacteria | 2613 |
| 48 | Ga0070667_100107939 | 3300005367 | Bacteria | 2411 |
| 49 | Ga0070709_10001276 | 3300005434 | Bacteria | 13760 |
| 50 | Ga0070714_100028550 | 3300005435 | Bacteria | 4631 |
| 51 | Ga0070713_100001422 | 3300005436 | Bacteria | 15343 |
| 52 | Ga0070713_100053939 | 3300005436 | Bacteria | 3333 |
| 53 | Ga0070713_100170778 | 3300005436 | Bacteria | 1948 |
| 54 | Ga0070713_100191548 | 3300005436 | Bacteria | 1843 |
| 55 | Ga0070710_10000994 | 3300005437 | Bacteria | 13487 |
| 56 | Ga0070710_10290629 | 3300005437 | Bacteria | 1064 |
| 57 | Ga0070711_100006005 | 3300005439 | Bacteria | 7290 |
| 58 | Ga0070711_100015159 | 3300005439 | Bacteria | 4873 |
| 59 | Ga0070705_100334923 | 3300005440 | Bacteria | 1098 |
| 60 | Ga0070700_100287764 | 3300005441 | Bacteria | 1194 |
| 61 | Ga0070663_100015963 | 3300005455 | Bacteria | 4863 |
| 62 | Ga0070663_100038183 | 3300005455 | Bacteria | 3348 |
| 63 | Ga0070663_100043016 | 3300005455 | Bacteria | 3177 |
| 64 | Ga0070663_100074727 | 3300005455 | Bacteria | 2475 |
| 65 | Ga0070678_100019312 | 3300005456 | Bacteria | 4439 |
| 66 | Ga0070678_100523055 | 3300005456 | Bacteria | 1050 |
| 67 | Ga0070662_100033266 | 3300005457 | Bacteria | 3629 |
| 68 | Ga0070681_10089303 | 3300005458 | Bacteria | 3033 |
| 69 | Ga0070681_10093759 | 3300005458 | Bacteria | 2951 |
| 70 | Ga0070706_100069633 | 3300005467 | Bacteria | 3254 |
| 71 | Ga0070698_100060180 | 3300005471 | Bacteria | 3833 |
| 72 | Ga0070698_100072452 | 3300005471 | Bacteria | 3453 |
| 73 | Ga0070679_100021567 | 3300005530 | Bacteria | 6290 |
| 74 | Ga0070679_100099264 | 3300005530 | Bacteria | 2899 |
| 75 | Ga0070684_100010618 | 3300005535 | Bacteria | 7303 |
| 76 | Ga0070684_100120125 | 3300005535 | Bacteria | 2364 |
| 77 | Ga0070697_100054583 | 3300005536 | Bacteria | 3248 |
| 78 | Ga0068853_100193472 | 3300005539 | Bacteria | 1849 |
| 79 | Ga0068853_100217054 | 3300005539 | Bacteria | 1745 |
| 80 | Ga0070665_100005999 | 3300005548 | Bacteria | 12427 |
| 81 | Ga0070665_100086056 | 3300005548 | Bacteria | 3149 |
| 82 | Ga0070665_100288633 | 3300005548 | Bacteria | 1643 |
| 83 | Ga0068855_100038944 | 3300005563 | Bacteria | 5644 |
| 84 | Ga0068855_100053068 | 3300005563 | Bacteria | 4771 |
| 85 | Ga0068855_100061622 | 3300005563 | Bacteria | 4382 |
| 86 | Ga0068855_100197687 | 3300005563 | Bacteria | 2265 |
| 87 | Ga0070664_100049101 | 3300005564 | Bacteria | 3568 |
| 88 | Ga0068857_100029668 | 3300005577 | Bacteria | 4827 |
| 89 | Ga0068857_100116419 | 3300005577 | Bacteria | 2405 |
| 90 | Ga0068857_100406127 | 3300005577 | Bacteria | 1268 |
| 91 | Ga0068854_100031752 | 3300005578 | Bacteria | 3672 |
| 92 | Ga0068854_100098007 | 3300005578 | Bacteria | 2193 |
| 93 | Ga0068856_100000046 | 3300005614 | Bacteria | 109174 |
| 94 | Ga0068856_100145712 | 3300005614 | Bacteria | 2376 |
| 95 | Ga0068852_100021670 | 3300005616 | Bacteria | 5138 |
| 96 | Ga0068852_100024160 | 3300005616 | Bacteria | 4908 |
| 97 | Ga0068852_100121228 | 3300005616 | Bacteria | 2395 |
| 98 | Ga0068859_100152894 | 3300005617 | Bacteria | 2383 |
| 99 | Ga0068859_100190731 | 3300005617 | Bacteria | 2134 |
| 100 | Ga0068864_100393064 | 3300005618 | Bacteria | 1317 |
| 101 | Ga0068866_10069126 | 3300005718 | Bacteria | 1859 |
| 102 | Ga0068861_100064503 | 3300005719 | Bacteria | 2818 |
| 103 | Ga0068851_10021906 | 3300005834 | Bacteria | 3106 |
| 104 | Ga0068851_10026465 | 3300005834 | Bacteria | 2850 |
| 105 | Ga0068870_10064621 | 3300005840 | Bacteria | 1977 |
| 106 | Ga0068863_100260758 | 3300005841 | Bacteria | 1675 |
| 107 | Ga0068858_100448932 | 3300005842 | Bacteria | 1242 |
| 108 | Ga0068860_100083205 | 3300005843 | Bacteria | 3043 |
| 109 | Ga0068862_100482337 | 3300005844 | Bacteria | 1174 |
| 110 | Ga0081455_10005388 | 3300005937 | Bacteria | 14045 |
| 111 | Ga0081540_1001405 | 3300005983 | Bacteria | 20829 |
| 112 | Ga0081540_1008509 | 3300005983 | Bacteria | 7163 |
| 113 | Ga0081540_1017686 | 3300005983 | Bacteria | 4403 |
| 114 | Ga0081540_1027389 | 3300005983 | Bacteria | 3230 |
| 115 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 116 | Ga0081539_10017228 | 3300005985 | Bacteria | 5086 |
| 117 | Ga0070717_10000329 | 3300006028 | Bacteria | 30746 |
| 118 | Ga0070717_10011544 | 3300006028 | Bacteria | 6710 |
| 119 | Ga0070717_10099419 | 3300006028 | Bacteria | 2468 |
| 120 | Ga0075365_10010639 | 3300006038 | Bacteria | 5372 |
| 121 | Ga0075365_10013105 | 3300006038 | Bacteria | 4944 |
| 122 | Ga0075365_10045370 | 3300006038 | Bacteria | 2883 |
| 123 | Ga0075365_10101803 | 3300006038 | Bacteria | 1967 |
| 124 | Ga0075368_10006133 | 3300006042 | Bacteria | 4181 |
| 125 | Ga0075363_100006017 | 3300006048 | Bacteria | 5468 |
| 126 | Ga0075363_100030102 | 3300006048 | Bacteria | 2808 |
| 127 | Ga0075364_10027600 | 3300006051 | Bacteria | 3627 |
| 128 | Ga0075364_10035756 | 3300006051 | Bacteria | 3210 |
| 129 | Ga0075364_10149184 | 3300006051 | Bacteria | 1575 |
| 130 | Ga0070716_100319262 | 3300006173 | Bacteria | 1088 |
| 131 | Ga0070712_100005262 | 3300006175 | Bacteria | 8006 |
| 132 | Ga0070712_100180436 | 3300006175 | Bacteria | 1645 |
| 133 | Ga0075362_10047140 | 3300006177 | Bacteria | 1918 |
| 134 | Ga0075362_10072923 | 3300006177 | Bacteria | 1571 |
| 135 | Ga0075367_10008911 | 3300006178 | Bacteria | 5220 |
| 136 | Ga0075367_10012598 | 3300006178 | Bacteria | 4517 |
| 137 | Ga0075367_10042478 | 3300006178 | Bacteria | 2660 |
| 138 | Ga0075367_10078077 | 3300006178 | Bacteria | 1999 |
| 139 | Ga0075367_10146867 | 3300006178 | Bacteria | 1463 |
| 140 | Ga0075367_10166599 | 3300006178 | Bacteria | 1371 |
| 141 | Ga0075369_10105892 | 3300006186 | Bacteria | 1265 |
| 142 | Ga0075366_10021249 | 3300006195 | Bacteria | 3772 |
| 143 | Ga0097621_100222279 | 3300006237 | Bacteria | 1646 |
| 144 | Ga0075370_10000887 | 3300006353 | Bacteria | 12232 |
| 145 | Ga0075370_10128961 | 3300006353 | Bacteria | 1475 |
| 146 | Ga0075370_10192044 | 3300006353 | Bacteria | 1203 |
| 147 | Ga0075370_10201260 | 3300006353 | Bacteria | 1175 |
| 148 | Ga0075434_100310303 | 3300006871 | Bacteria | 1598 |
| 149 | Ga0068865_100399899 | 3300006881 | Bacteria | 1125 |
| 150 | Ga0097620_100152889 | 3300006931 | Bacteria | 2383 |
| 151 | Ga0097620_100190729 | 3300006931 | Bacteria | 2134 |
| 152 | Ga0099825_1030979 | 3300006941 | Bacteria | 2315 |
| 153 | Ga0099824_1019557 | 3300006942 | Bacteria | 5235 |
| 154 | Ga0099822_1000157 | 3300006943 | Bacteria | 48143 |
| 155 | Ga0079104_1000787 | 3300006946 | Bacteria | 26944 |
| 156 | Ga0099795_10081858 | 3300007788 | Bacteria | 1237 |
| 157 | Ga0105250_10044375 | 3300009092 | Bacteria | 1783 |
| 158 | Ga0105240_10003907 | 3300009093 | Bacteria | 23021 |
| 159 | Ga0105240_10004081 | 3300009093 | Bacteria | 22462 |
| 160 | Ga0105240_10015110 | 3300009093 | Bacteria | 10508 |
| 161 | Ga0105240_10095255 | 3300009093 | Bacteria | 3630 |
| 162 | Ga0105240_10128094 | 3300009093 | Bacteria | 3048 |
| 163 | Ga0105240_10133934 | 3300009093 | Bacteria | 2969 |
| 164 | Ga0105245_10003170 | 3300009098 | Bacteria | 14710 |
| 165 | Ga0105245_10019653 | 3300009098 | Bacteria | 5919 |
| 166 | Ga0105247_10033412 | 3300009101 | Bacteria | 3129 |
| 167 | Ga0105247_10120736 | 3300009101 | Bacteria | 1698 |
| 168 | Ga0105243_10103827 | 3300009148 | Bacteria | 2364 |
| 169 | Ga0105241_10009831 | 3300009174 | Bacteria | 7030 |
| 170 | Ga0105241_10026367 | 3300009174 | Bacteria | 4323 |
| 171 | Ga0105241_10076730 | 3300009174 | Bacteria | 2607 |
| 172 | Ga0105241_10078586 | 3300009174 | Bacteria | 2578 |
| 173 | Ga0105241_10102836 | 3300009174 | Bacteria | 2274 |
| 174 | Ga0105242_10184463 | 3300009176 | Bacteria | 1843 |
| 175 | Ga0105248_10027379 | 3300009177 | Bacteria | 6345 |
| 176 | Ga0105248_10083709 | 3300009177 | Bacteria | 3588 |
| 177 | Ga0105248_10311924 | 3300009177 | Bacteria | 1772 |
| 178 | Ga0105237_10014809 | 3300009545 | Bacteria | 8138 |
| 179 | Ga0105237_10018581 | 3300009545 | Bacteria | 7192 |
| 180 | Ga0105237_10019593 | 3300009545 | Bacteria | 6988 |
| 181 | Ga0105237_10035169 | 3300009545 | Bacteria | 5070 |
| 182 | Ga0105237_10055074 | 3300009545 | Bacteria | 3983 |
| 183 | Ga0105237_10168649 | 3300009545 | Bacteria | 2189 |
| 184 | Ga0105237_10175721 | 3300009545 | Bacteria | 2141 |
| 185 | Ga0105237_10181288 | 3300009545 | Bacteria | 2106 |
| 186 | Ga0105237_10224056 | 3300009545 | Bacteria | 1881 |
| 187 | Ga0105237_10379864 | 3300009545 | Bacteria | 1417 |
| 188 | Ga0105238_10008597 | 3300009551 | Bacteria | 10215 |
| 189 | Ga0105238_10081866 | 3300009551 | Bacteria | 3218 |
| 190 | Ga0105238_10176869 | 3300009551 | Bacteria | 2111 |
| 191 | Ga0105238_10186851 | 3300009551 | Bacteria | 2049 |
| 192 | Ga0105238_10435001 | 3300009551 | Bacteria | 1308 |
| 193 | Ga0105238_10495779 | 3300009551 | Bacteria | 1222 |
| 194 | Ga0105249_10368185 | 3300009553 | Bacteria | 1460 |
| 195 | Ga0099796_10071874 | 3300010159 | Bacteria | 1251 |
| 196 | Ga0105239_10010063 | 3300010375 | Bacteria | 10602 |
| 197 | Ga0105239_10016514 | 3300010375 | Bacteria | 8164 |
| 198 | Ga0105239_10045655 | 3300010375 | Bacteria | 4802 |
| 199 | Ga0105239_10097236 | 3300010375 | Bacteria | 3254 |
| 200 | Ga0105239_10097626 | 3300010375 | Bacteria | 3247 |
| 201 | Ga0105239_10133455 | 3300010375 | Bacteria | 2763 |
| 202 | Ga0105239_10134406 | 3300010375 | Bacteria | 2753 |
| 203 | Ga0105239_10223622 | 3300010375 | Bacteria | 2111 |
| 204 | Ga0105239_10316775 | 3300010375 | Bacteria | 1758 |
| 205 | Ga0105239_10401253 | 3300010375 | Bacteria | 1551 |
| 206 | Ga0105246_10029590 | 3300011119 | Bacteria | 3608 |
| 207 | Ga0105246_10039737 | 3300011119 | Bacteria | 3171 |
| 208 | Ga0105246_10348322 | 3300011119 | Bacteria | 1213 |
| 209 | Ga0157373_10260929 | 3300013100 | Bacteria | 1226 |
| 210 | Ga0157370_10018582 | 3300013104 | Bacteria | 6988 |
| 211 | Ga0157370_10040326 | 3300013104 | Bacteria | 4508 |
| 212 | Ga0157370_10099145 | 3300013104 | Bacteria | 2731 |
| 213 | Ga0157370_10164412 | 3300013104 | Bacteria | 2064 |
| 214 | Ga0157369_10004364 | 3300013105 | Bacteria | 16692 |
| 215 | Ga0157369_10011444 | 3300013105 | Bacteria | 10076 |
| 216 | Ga0157369_10048648 | 3300013105 | Bacteria | 4601 |
| 217 | Ga0157369_10259659 | 3300013105 | Bacteria | 1812 |
| 218 | Ga0157374_10169956 | 3300013296 | Bacteria | 2126 |
| 219 | Ga0157378_10200748 | 3300013297 | Bacteria | 1886 |
| 220 | Ga0163162_10025283 | 3300013306 | Bacteria | 5867 |
| 221 | Ga0163162_10147251 | 3300013306 | Bacteria | 2471 |
| 222 | Ga0163162_10291140 | 3300013306 | Bacteria | 1765 |
| 223 | Ga0163162_10659836 | 3300013306 | Bacteria | 1169 |
| 224 | Ga0157375_10011859 | 3300013308 | Bacteria | 7710 |
| 225 | Ga0157375_10220409 | 3300013308 | Bacteria | 2055 |
| 226 | Ga0157375_10491953 | 3300013308 | Bacteria | 1391 |
| 227 | Ga0163163_10085257 | 3300014325 | Bacteria | 3167 |
| 228 | Ga0163163_10097593 | 3300014325 | Bacteria | 2959 |
| 229 | Ga0157377_10019291 | 3300014745 | Bacteria | 3561 |
| 230 | Ga0157379_10052255 | 3300014968 | Bacteria | 3650 |
| 231 | Ga0157379_10104243 | 3300014968 | Bacteria | 2545 |
| 232 | Ga0214544_1016991 | 3300021320 | Bacteria | 6750 |
| 233 | Ga0214542_1018249 | 3300021321 | Bacteria | 6004 |
| 234 | Ga0214545_1015672 | 3300021324 | Bacteria | 8171 |
| 235 | Ga0214543_1023767 | 3300021327 | Bacteria | 3968 |
| 236 | Ga0213872_10026158 | 3300021361 | Bacteria | 2681 |
| 237 | Ga0213875_10145017 | 3300021388 | Bacteria | 1112 |
| 238 | Ga0213871_10034911 | 3300021441 | Bacteria | 1327 |
| 239 | Ga0209563_102259 | 3300025230 | Bacteria | 4450 |
| 240 | Ga0207425_1017079 | 3300025245 | Bacteria | 1601 |
| 241 | Ga0209677_100943 | 3300025253 | Bacteria | 14198 |
| 242 | Ga0209148_1000717 | 3300025254 | Bacteria | 26299 |
| 243 | Ga0209129_1000250 | 3300025258 | Bacteria | 56427 |
| 244 | Ga0209233_1001778 | 3300025261 | Bacteria | 8306 |
| 245 | Ga0209233_1006780 | 3300025261 | Bacteria | 3665 |
| 246 | Ga0209233_1014750 | 3300025261 | Bacteria | 2192 |
| 247 | Ga0209455_1002361 | 3300025272 | Bacteria | 7353 |
| 248 | Ga0209455_1005285 | 3300025272 | Bacteria | 4026 |
| 249 | Ga0209455_1016716 | 3300025272 | Bacteria | 1566 |
| 250 | Ga0209455_1020830 | 3300025272 | Bacteria | 1288 |
| 251 | Ga0209676_1026585 | 3300025292 | Unclassified | 1835 |
| 252 | Ga0209025_1000172 | 3300025294 | Bacteria | 160407 |
| 253 | Ga0209025_1001389 | 3300025294 | Bacteria | 32297 |
| 254 | Ga0209564_1006829 | 3300025295 | Bacteria | 6028 |
| 255 | Ga0209564_1014454 | 3300025295 | Unclassified | 3282 |
| 256 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 257 | Ga0209758_1000344 | 3300025297 | Bacteria | 85133 |
| 258 | Ga0209758_1000727 | 3300025297 | Bacteria | 48235 |
| 259 | Ga0209758_1002307 | 3300025297 | Bacteria | 19725 |
| 260 | Ga0209758_1004919 | 3300025297 | Bacteria | 10740 |
| 261 | Ga0207426_1000374 | 3300025302 | Bacteria | 78498 |
| 262 | Ga0207426_1000440 | 3300025302 | Bacteria | 66997 |
| 263 | Ga0209051_1025177 | 3300025303 | Bacteria | 2428 |
| 264 | Ga0209257_1000819 | 3300025304 | Bacteria | 45046 |
| 265 | Ga0207697_10010752 | 3300025315 | Bacteria | 3899 |
| 266 | Ga0207697_10045186 | 3300025315 | Bacteria | 1813 |
| 267 | Ga0207696_1010110 | 3300025711 | Bacteria | 3479 |
| 268 | Ga0207713_1001320 | 3300025735 | Bacteria | 20345 |
| 269 | Ga0207692_10000950 | 3300025898 | Bacteria | 10525 |
| 270 | Ga0207692_10060829 | 3300025898 | Bacteria | 1955 |
| 271 | Ga0207710_10009198 | 3300025900 | Bacteria | 4157 |
| 272 | Ga0207710_10040474 | 3300025900 | Bacteria | 2065 |
| 273 | Ga0207710_10115441 | 3300025900 | Bacteria | 1278 |
| 274 | Ga0207688_10007649 | 3300025901 | Bacteria | 5884 |
| 275 | Ga0207699_10004122 | 3300025906 | Bacteria | 6965 |
| 276 | Ga0207699_10005422 | 3300025906 | Bacteria | 6107 |
| 277 | Ga0207645_10175655 | 3300025907 | Bacteria | 1405 |
| 278 | Ga0207684_10281389 | 3300025910 | Bacteria | 1434 |
| 279 | Ga0207654_10006128 | 3300025911 | Bacteria | 6039 |
| 280 | Ga0207654_10031548 | 3300025911 | Bacteria | 2920 |
| 281 | Ga0207654_10102693 | 3300025911 | Bacteria | 1764 |
| 282 | Ga0207707_10092026 | 3300025912 | Bacteria | 2650 |
| 283 | Ga0207707_10178167 | 3300025912 | Bacteria | 1856 |
| 284 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 285 | Ga0207695_10005085 | 3300025913 | Bacteria | 17629 |
| 286 | Ga0207695_10040362 | 3300025913 | Bacteria | 5006 |
| 287 | Ga0207695_10260488 | 3300025913 | Bacteria | 1632 |
| 288 | Ga0207671_10015866 | 3300025914 | Bacteria | 5876 |
| 289 | Ga0207671_10029344 | 3300025914 | Bacteria | 4107 |
| 290 | Ga0207671_10051164 | 3300025914 | Bacteria | 3060 |
| 291 | Ga0207671_10058049 | 3300025914 | Bacteria | 2869 |
| 292 | Ga0207671_10122492 | 3300025914 | Bacteria | 1988 |
| 293 | Ga0207671_10146443 | 3300025914 | Bacteria | 1822 |
| 294 | Ga0207671_10207287 | 3300025914 | Bacteria | 1532 |
| 295 | Ga0207693_10006734 | 3300025915 | Bacteria | 9487 |
| 296 | Ga0207693_10176320 | 3300025915 | Bacteria | 1682 |
| 297 | Ga0207663_10001982 | 3300025916 | Bacteria | 9709 |
| 298 | Ga0207663_10042409 | 3300025916 | Bacteria | 2779 |
| 299 | Ga0207660_10023116 | 3300025917 | Bacteria | 4195 |
| 300 | Ga0207662_10311794 | 3300025918 | Bacteria | 1048 |
| 301 | Ga0207657_10104345 | 3300025919 | Bacteria | 2348 |
| 302 | Ga0207649_10459465 | 3300025920 | Bacteria | 962 |
| 303 | Ga0207652_10064224 | 3300025921 | Bacteria | 3176 |
| 304 | Ga0207681_10267319 | 3300025923 | Bacteria | 1341 |
| 305 | Ga0207694_10010612 | 3300025924 | Bacteria | 6952 |
| 306 | Ga0207694_10162876 | 3300025924 | Bacteria | 1802 |
| 307 | Ga0207694_10187899 | 3300025924 | Bacteria | 1677 |
| 308 | Ga0207694_10228855 | 3300025924 | Bacteria | 1518 |
| 309 | Ga0207694_10422397 | 3300025924 | Bacteria | 1111 |
| 310 | Ga0207650_10278043 | 3300025925 | Bacteria | 1362 |
| 311 | Ga0207687_10005780 | 3300025927 | Bacteria | 8185 |
| 312 | Ga0207687_10030420 | 3300025927 | Bacteria | 3641 |
| 313 | Ga0207700_10032399 | 3300025928 | Bacteria | 3727 |
| 314 | Ga0207700_10253363 | 3300025928 | Bacteria | 1505 |
| 315 | Ga0207664_10046631 | 3300025929 | Bacteria | 3403 |
| 316 | Ga0207706_10082744 | 3300025933 | Bacteria | 2821 |
| 317 | Ga0207709_10124830 | 3300025935 | Bacteria | 1744 |
| 318 | Ga0207665_10039168 | 3300025939 | Bacteria | 3159 |
| 319 | Ga0207665_10073303 | 3300025939 | Bacteria | 2341 |
| 320 | Ga0207665_10260175 | 3300025939 | Bacteria | 1285 |
| 321 | Ga0207711_10051359 | 3300025941 | Bacteria | 3530 |
| 322 | Ga0207711_10399585 | 3300025941 | Bacteria | 1277 |
| 323 | Ga0207689_10012072 | 3300025942 | Bacteria | 7400 |
| 324 | Ga0207661_10000159 | 3300025944 | Bacteria | 43412 |
| 325 | Ga0207661_10007747 | 3300025944 | Bacteria | 7647 |
| 326 | Ga0207661_10261709 | 3300025944 | Bacteria | 1541 |
| 327 | Ga0207661_10484254 | 3300025944 | Bacteria | 1130 |
| 328 | Ga0207679_10091055 | 3300025945 | Bacteria | 2360 |
| 329 | Ga0207667_10182182 | 3300025949 | Bacteria | 2157 |
| 330 | Ga0207667_10234577 | 3300025949 | Bacteria | 1878 |
| 331 | Ga0207667_10293472 | 3300025949 | Bacteria | 1661 |
| 332 | Ga0207668_10026879 | 3300025972 | Bacteria | 3743 |
| 333 | Ga0207640_10011507 | 3300025981 | Bacteria | 5012 |
| 334 | Ga0207640_10289813 | 3300025981 | Bacteria | 1290 |
| 335 | Ga0207658_10195843 | 3300025986 | Bacteria | 1683 |
| 336 | Ga0207677_10202945 | 3300026023 | Bacteria | 1577 |
| 337 | Ga0207703_10004022 | 3300026035 | Bacteria | 12161 |
| 338 | Ga0207639_10035250 | 3300026041 | Bacteria | 3702 |
| 339 | Ga0207639_10106523 | 3300026041 | Bacteria | 2276 |
| 340 | Ga0207639_10275222 | 3300026041 | Bacteria | 1478 |
| 341 | Ga0207678_10019057 | 3300026067 | Bacteria | 6026 |
| 342 | Ga0207678_10036642 | 3300026067 | Bacteria | 4270 |
| 343 | Ga0207678_10038497 | 3300026067 | Bacteria | 4155 |
| 344 | Ga0207678_10144096 | 3300026067 | Bacteria | 2033 |
| 345 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 346 | Ga0207702_10000778 | 3300026078 | Bacteria | 33764 |
| 347 | Ga0207702_10082590 | 3300026078 | Bacteria | 2794 |
| 348 | Ga0207702_10594871 | 3300026078 | Bacteria | 1085 |
| 349 | Ga0207641_10103852 | 3300026088 | Bacteria | 2508 |
| 350 | Ga0207648_10148444 | 3300026089 | Bacteria | 2068 |
| 351 | Ga0207676_10085962 | 3300026095 | Bacteria | 2568 |
| 352 | Ga0207676_10099196 | 3300026095 | Bacteria | 2410 |
| 353 | Ga0207674_10015148 | 3300026116 | Bacteria | 8485 |
| 354 | Ga0207674_10023890 | 3300026116 | Bacteria | 6539 |
| 355 | Ga0207674_10065051 | 3300026116 | Bacteria | 3677 |
| 356 | Ga0207674_10599686 | 3300026116 | Bacteria | 1064 |
| 357 | Ga0207675_100044663 | 3300026118 | Bacteria | 4141 |
| 358 | Ga0207675_100203285 | 3300026118 | Bacteria | 1903 |
| 359 | Ga0207683_10014293 | 3300026121 | Bacteria | 6763 |
| 360 | Ga0207683_10238098 | 3300026121 | Bacteria | 1660 |
| 361 | Ga0207698_10011045 | 3300026142 | Bacteria | 5839 |
| 362 | Ga0207698_10020518 | 3300026142 | Bacteria | 4550 |
| 363 | Ga0209281_1001398 | 3300027111 | Bacteria | 14624 |
| 364 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 365 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 366 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 367 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 368 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 369 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 370 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 371 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 372 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 373 | Ga0209179_1019929 | 3300027512 | Bacteria | 1297 |
| 374 | Ga0268266_10004934 | 3300028379 | Bacteria | 12639 |
| 375 | Ga0268266_10076638 | 3300028379 | Bacteria | 2906 |
| 376 | Ga0268266_10121189 | 3300028379 | Bacteria | 2328 |
| 377 | Ga0268266_10233095 | 3300028379 | Bacteria | 1696 |
| 378 | Ga0268265_10302724 | 3300028380 | Bacteria | 1440 |
| 379 | Ga0268264_10130142 | 3300028381 | Bacteria | 2229 |
| 380 | Ga0265334_10032115 | 3300028573 | Bacteria | 2095 |
| 381 | Ga0307517_10000176 | 3300028786 | Bacteria | 105402 |
| 382 | Ga0307511_10052899 | 3300030521 | Bacteria | 3227 |
| 383 | Ga0265330_10096058 | 3300031235 | Bacteria | 1270 |
| 384 | Ga0265332_10049653 | 3300031238 | Bacteria | 1804 |
| 385 | Ga0265332_10120589 | 3300031238 | Bacteria | 1102 |
| 386 | Ga0265331_10036158 | 3300031250 | Bacteria | 2427 |
| 387 | Ga0307509_10070621 | 3300031507 | Bacteria | 3646 |
| 388 | Ga0265313_10000021 | 3300031595 | Bacteria | 144949 |
| 389 | Ga0307508_10000019 | 3300031616 | Bacteria | 197575 |
| 390 | Ga0307508_10040340 | 3300031616 | Bacteria | 4191 |
| 391 | Ga0307508_10074508 | 3300031616 | Bacteria | 2970 |
| 392 | Ga0307508_10355671 | 3300031616 | Bacteria | 1056 |
| 393 | Ga0265314_10006820 | 3300031711 | Bacteria | 10008 |
| 394 | Ga0265314_10135985 | 3300031711 | Bacteria | 1526 |
| 395 | Ga0265314_10172159 | 3300031711 | Bacteria | 1306 |
| 396 | Ga0265342_10006714 | 3300031712 | Bacteria | 8526 |
| 397 | Ga0307516_10016176 | 3300031730 | Bacteria | 7815 |
| 398 | Ga0307516_10158324 | 3300031730 | Bacteria | 2017 |
| 399 | Ga0307516_10162658 | 3300031730 | Bacteria | 1981 |
| 400 | Ga0307516_10357243 | 3300031730 | Bacteria | 1126 |
| 401 | Ga0307507_10091909 | 3300033179 | Bacteria | 2594 |
| 402 | Ga0307510_10009428 | 3300033180 | Bacteria | 11628 |
| 403 | Ga0307510_10080667 | 3300033180 | Bacteria | 3162 |
| 404 | Ga0307510_10089893 | 3300033180 | Bacteria | 2921 |
| 405 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 406 | Ga0373926_0025505 | 3300035083 | Bacteria | 2063 |
| 407 | Ga0373934_0016595 | 3300035086 | Bacteria | 2800 |
| 408 | Ga0373934_0045831 | 3300035086 | Bacteria | 1729 |
| 409 | Ga0373944_0071462 | 3300035089 | Bacteria | 1131 |
| 410 | Ga0373923_0004220 | 3300035111 | Bacteria | 4745 |
| 411 | Ga0373923_0103224 | 3300035111 | Bacteria | 1259 |
| 412 | Ga0373936_0003181 | 3300035113 | Bacteria | 6150 |
| 413 | Ga0373939_0078399 | 3300035114 | Bacteria | 1092 |
| 414 | Ga0373945_0044114 | 3300035116 | Bacteria | 1620 |
| 415 | Ga0373953_0001405 | 3300035117 | Bacteria | 6949 |
| 416 | Ga0373953_0034625 | 3300035117 | Bacteria | 1980 |
| 417 | Ga0373954_0002625 | 3300035118 | Bacteria | 7566 |
| 418 | Ga0373954_0014730 | 3300035118 | Bacteria | 3489 |
| 419 | Ga0373956_0001441 | 3300035119 | Bacteria | 9830 |
| 420 | Ga0373956_0042396 | 3300035119 | Bacteria | 2023 |
| 421 | Ga0373957_0056128 | 3300035120 | Bacteria | 1516 |
| 422 | Ga0373943_0069114 | 3300035170 | Bacteria | 1784 |
| 423 | Ga0373946_0031873 | 3300035171 | Bacteria | 2114 |
| 424 | Ga0373946_0102799 | 3300035171 | Bacteria | 1283 |
| 425 | Ga0373955_0003007 | 3300035172 | Bacteria | 7388 |
| 426 | Ga0373931_0037491 | 3300035691 | Bacteria | 2531 |
| 427 | Ga0373935_0026657 | 3300035692 | Bacteria | 3570 |
| 428 | Ga0373935_0027876 | 3300035692 | Bacteria | 3490 |
| 429 | Ga0373927_0022158 | 3300035695 | Bacteria | 4162 |
| 430 | Ga0373927_0028241 | 3300035695 | Bacteria | 3660 |
| 431 | Ga0373927_0126045 | 3300035695 | Bacteria | 1671 |
| 432 | Ga0373927_0219696 | 3300035695 | Bacteria | 1248 |
| 433 | Ga0373933_0000017 | 3300035724 | Bacteria | 100816 |
| 434 | Ga0373933_0004005 | 3300035724 | Bacteria | 8119 |
| 435 | Ga0373933_0061333 | 3300035724 | Bacteria | 2269 |
| 436 | Ga0373947_0047131 | 3300035725 | Bacteria | 2582 |
| 437 | Ga0373947_0052252 | 3300035725 | Bacteria | 2461 |
| 438 | Ga0373947_0062310 | 3300035725 | Bacteria | 2269 |
| 439 | Ga0373937_0039344 | 3300036401 | Bacteria | 4309 |
| 440 | Ga0373937_0090247 | 3300036401 | Bacteria | 2838 |
| 441 | Ga0373937_0296683 | 3300036401 | Bacteria | 1527 |
| 442 | Ga0373925_0136210 | 3300037068 | Bacteria | 1919 |
| 443 | Ga0395899_0019065 | 3300037312 | Bacteria | 5214 |
| 444 | Ga0395900_0009818 | 3300037418 | Bacteria | 9807 |
| 445 | Ga0395900_0075964 | 3300037418 | Bacteria | 3453 |
| 446 | Ga0395900_0095378 | 3300037418 | Bacteria | 3057 |
| 447 | Ga0395900_0131320 | 3300037418 | Bacteria | 2567 |
| 448 | Ga0395900_0139541 | 3300037418 | Bacteria | 2483 |
| 449 | Ga0395898_0027602 | 3300037466 | Bacteria | 5695 |
| 450 | Ga0395898_0036317 | 3300037466 | Bacteria | 4892 |
| 451 | Ga0395898_0059367 | 3300037466 | Bacteria | 3721 |
| 452 | Ga0395898_0146854 | 3300037466 | Bacteria | 2257 |
| 453 | Ga0395898_0317777 | 3300037466 | Bacteria | 1485 |
| 454 | Ga0395898_0345973 | 3300037466 | Bacteria | 1418 |
| 455 | Ga0395905_0014293 | 3300037471 | Bacteria | 7585 |
| 456 | Ga0395905_0118735 | 3300037471 | Bacteria | 2486 |
| 457 | Ga0395905_0488800 | 3300037471 | Bacteria | 1130 |
| 458 | Ga0395905_0655678 | 3300037471 | Bacteria | 952 |
| 459 | Ga0436364_0110679 | 3300037853 | Bacteria | 2129 |
| 460 | Ga0436364_1368074 | 3300037853 | Bacteria | 1241 |
| 461 | Ga0395901_0018476 | 3300038443 | Bacteria | 7116 |
| 462 | Ga0395901_0056802 | 3300038443 | Bacteria | 4072 |
| 463 | Ga0395901_0100706 | 3300038443 | Bacteria | 3031 |
| 464 | Ga0395901_0180548 | 3300038443 | Bacteria | 2214 |
| 465 | Ga0395901_0579261 | 3300038443 | Bacteria | 1134 |
| 466 | Ga0436365_0410685 | 3300039437 | Bacteria | 2278 |
| 467 | Ga0436365_0731519 | 3300039437 | Bacteria | 2447 |
| 468 | Ga0436360_0372111 | 3300039438 | Bacteria | 2159 |
| 469 | Ga0436360_1187358 | 3300039438 | Bacteria | 2917 |
| 470 | Ga0436361_0211533 | 3300039447 | Bacteria | 960 |
| 471 | Ga0436361_0354363 | 3300039447 | Bacteria | 1323 |
| 472 | Ga0436361_1057951 | 3300039447 | Bacteria | 4358 |
| 473 | Ga0436361_1092874 | 3300039447 | Bacteria | 4553 |
| 474 | Ga0436363_1138567 | 3300039450 | Bacteria | 1341 |
| 475 | Ga0436363_1203192 | 3300039450 | Bacteria | 1685 |
| 476 | Ga0436362_1061629 | 3300039453 | Bacteria | 4284 |
| 477 | Ga0439438_008107 | 3300041405 | Bacteria | 3524 |
| 478 | Ga0439438_021948 | 3300041405 | Bacteria | 1775 |
| 479 | Ga0439447_000064 | 3300041407 | Bacteria | 37780 |
| 480 | Ga0439466_0022280 | 3300041411 | Bacteria | 2237 |
| 481 | Ga0439466_0022749 | 3300041411 | Bacteria | 2209 |
| 482 | Ga0451789_0206198 | 3300041443 | Bacteria | 1483 |
| 483 | Ga0451853_3196519 | 3300041512 | Bacteria | 1683 |
| 484 | Ga0439431_0002590 | 3300041997 | Bacteria | 3997 |
| 485 | Ga0439432_002080 | 3300042006 | Bacteria | 7558 |
| 486 | Ga0439452_007138 | 3300042010 | Bacteria | 3440 |
| 487 | Ga0439452_008006 | 3300042010 | Bacteria | 3200 |
| 488 | Ga0439456_002130 | 3300042013 | Bacteria | 3997 |
| 489 | Ga0450911_000005 | 3300042115 | Bacteria | 233469 |
| 490 | Ga0450911_000549 | 3300042115 | Bacteria | 11658 |
| 491 | Ga0450911_003131 | 3300042115 | Bacteria | 2998 |
| 492 | Ga0450907_000003 | 3300042146 | Bacteria | 138102 |
| 493 | Ga0439446_0005793 | 3300042156 | Bacteria | 3194 |
| 494 | Ga0450909_000718 | 3300042185 | Bacteria | 4446 |
| 495 | Ga0439434_0000112 | 3300042435 | Bacteria | 21210 |
| 496 | Ga0439459_0004696 | 3300042438 | Bacteria | 2210 |
| 497 | Ga0439460_0005838 | 3300042461 | Bacteria | 3035 |
| 498 | Ga0450893_0004087 | 3300042532 | Bacteria | 2320 |
| 499 | Ga0466969_0108660 | 3300044656 | Bacteria | 1300 |
| 500 | Ga0466972_0000179 | 3300044658 | Bacteria | 49010 |
| 501 | Ga0466966_0000830 | 3300044684 | Bacteria | 19703 |
| 502 | Ga0466961_0000023 | 3300044693 | Bacteria | 97134 |
| 503 | Ga0466963_0051498 | 3300044694 | Bacteria | 2729 |
| 504 | Ga0466963_0118741 | 3300044694 | Bacteria | 1819 |
| 505 | Ga0466968_0007926 | 3300044735 | Bacteria | 4057 |
| 506 | Ga0466968_0046654 | 3300044735 | Bacteria | 1841 |
| 507 | Ga0466970_0038498 | 3300044765 | Bacteria | 2537 |
| 508 | Ga0466970_0063803 | 3300044765 | Bacteria | 1975 |
| 509 | Ga0466957_0016453 | 3300044842 | Bacteria | 4327 |
| 510 | Ga0466957_0247536 | 3300044842 | Bacteria | 1184 |
| 511 | Ga0466957_0297564 | 3300044842 | Bacteria | 1083 |
| 512 | Ga0466959_0004204 | 3300045049 | Bacteria | 9592 |
| 513 | Ga0466959_0104549 | 3300045049 | Bacteria | 2025 |
| 514 | Ga0466967_0028473 | 3300045976 | Bacteria | 4663 |
| 515 | Ga0466967_0245110 | 3300045976 | Bacteria | 1710 |
| 516 | Ga0466967_0497807 | 3300045976 | Bacteria | 1196 |
| 517 | Ga0495617_007615 | 3300046452 | Bacteria | 3750 |
| 518 | Ga0495627_000846 | 3300046453 | Bacteria | 21913 |
| 519 | Ga0495592_0004997 | 3300046454 | Bacteria | 9764 |
| 520 | Ga0495592_0005401 | 3300046454 | Bacteria | 9433 |
| 521 | Ga0495592_0006661 | 3300046454 | Bacteria | 8610 |
| 522 | Ga0495592_0082295 | 3300046454 | Bacteria | 2327 |
| 523 | Ga0495603_0015774 | 3300046455 | Bacteria | 4568 |
| 524 | Ga0495603_0034772 | 3300046455 | Bacteria | 3029 |
| 525 | Ga0495603_0053926 | 3300046455 | Bacteria | 2385 |
| 526 | Ga0495603_0067448 | 3300046455 | Bacteria | 2106 |
| 527 | Ga0495590_0001558 | 3300046457 | Bacteria | 9834 |
| 528 | Ga0495590_0063511 | 3300046457 | Bacteria | 1292 |
| 529 | Ga0495590_0081180 | 3300046457 | Bacteria | 1142 |
| 530 | Ga0495590_0126268 | 3300046457 | Bacteria | 918 |
| 531 | Ga0495591_000839 | 3300046458 | Bacteria | 21717 |
| 532 | Ga0495591_003940 | 3300046458 | Bacteria | 7451 |
| 533 | Ga0495591_016598 | 3300046458 | Bacteria | 2557 |
| 534 | Ga0495629_0001206 | 3300046459 | Bacteria | 20341 |
| 535 | Ga0495629_0003280 | 3300046459 | Bacteria | 12242 |
| 536 | Ga0495629_0015109 | 3300046459 | Bacteria | 5550 |
| 537 | Ga0495629_0079094 | 3300046459 | Bacteria | 2296 |
| 538 | Ga0495629_0087126 | 3300046459 | Bacteria | 2179 |
| 539 | Ga0495638_0000770 | 3300046460 | Bacteria | 34035 |
| 540 | Ga0495638_0004796 | 3300046460 | Bacteria | 10185 |
| 541 | Ga0495651_0003825 | 3300046462 | Bacteria | 11507 |
| 542 | Ga0495651_0025211 | 3300046462 | Bacteria | 4627 |
| 543 | Ga0495651_0029906 | 3300046462 | Bacteria | 4247 |
| 544 | Ga0495651_0119080 | 3300046462 | Bacteria | 1942 |
| 545 | Ga0495651_0349597 | 3300046462 | Bacteria | 977 |
| 546 | Ga0495653_0007406 | 3300046463 | Bacteria | 8989 |
| 547 | Ga0495580_0142177 | 3300046472 | Bacteria | 1663 |
| 548 | Ga0495580_0318292 | 3300046472 | Bacteria | 1057 |
| 549 | Ga0495582_0022137 | 3300046473 | Bacteria | 3477 |
| 550 | Ga0495582_0187786 | 3300046473 | Bacteria | 1178 |
| 551 | Ga0495605_0060725 | 3300046474 | Bacteria | 1811 |
| 552 | Ga0495605_0185259 | 3300046474 | Bacteria | 913 |
| 553 | Ga0495639_0008174 | 3300046475 | Bacteria | 4493 |
| 554 | Ga0495639_0035021 | 3300046475 | Bacteria | 2246 |
| 555 | Ga0495662_0001398 | 3300046476 | Bacteria | 11971 |
| 556 | Ga0495662_0084231 | 3300046476 | Bacteria | 1547 |
| 557 | Ga0495662_0142342 | 3300046476 | Bacteria | 1181 |
| 558 | Ga0495664_0008348 | 3300046477 | Bacteria | 5776 |
| 559 | Ga0495664_0020816 | 3300046477 | Bacteria | 3787 |
| 560 | Ga0495664_0043327 | 3300046477 | Bacteria | 2666 |
| 561 | Ga0495664_0046150 | 3300046477 | Bacteria | 2585 |
| 562 | Ga0495584_0082300 | 3300046491 | Bacteria | 1620 |
| 563 | Ga0495585_0000120 | 3300046492 | Bacteria | 85123 |
| 564 | Ga0495585_0003146 | 3300046492 | Bacteria | 11303 |
| 565 | Ga0495585_0041192 | 3300046492 | Bacteria | 2591 |
| 566 | Ga0495594_0037242 | 3300046499 | Bacteria | 2653 |
| 567 | Ga0495607_0011043 | 3300046501 | Bacteria | 6032 |
| 568 | Ga0495607_0163530 | 3300046501 | Bacteria | 1129 |
| 569 | Ga0495583_0130576 | 3300046506 | Bacteria | 1051 |
| 570 | Ga0495606_0007020 | 3300046507 | Bacteria | 10215 |
| 571 | Ga0495606_0042892 | 3300046507 | Bacteria | 3022 |
| 572 | Ga0495608_0007803 | 3300046511 | Bacteria | 7530 |
| 573 | Ga0495608_0157625 | 3300046511 | Bacteria | 1444 |
| 574 | Ga0495608_0208446 | 3300046511 | Bacteria | 1229 |
| 575 | Ga0495616_0017122 | 3300046513 | Bacteria | 4000 |
| 576 | Ga0495618_0177264 | 3300046514 | Bacteria | 1355 |
| 577 | Ga0495620_0017568 | 3300046515 | Bacteria | 3562 |
| 578 | Ga0495628_0002925 | 3300046516 | Bacteria | 15306 |
| 579 | Ga0495628_0011177 | 3300046516 | Bacteria | 7597 |
| 580 | Ga0495628_0107283 | 3300046516 | Bacteria | 2150 |
| 581 | Ga0495628_0251861 | 3300046516 | Bacteria | 1318 |
| 582 | Ga0495630_0011377 | 3300046517 | Bacteria | 6443 |
| 583 | Ga0495632_0005178 | 3300046519 | Bacteria | 8702 |
| 584 | Ga0495632_0008641 | 3300046519 | Bacteria | 6218 |
| 585 | Ga0495632_0009586 | 3300046519 | Bacteria | 5822 |
| 586 | Ga0495632_0038010 | 3300046519 | Bacteria | 2438 |
| 587 | Ga0495637_0000137 | 3300046520 | Bacteria | 55149 |
| 588 | Ga0495637_0019214 | 3300046520 | Bacteria | 3160 |
| 589 | Ga0495643_0017880 | 3300046522 | Bacteria | 4134 |
| 590 | Ga0495643_0120441 | 3300046522 | Bacteria | 1326 |
| 591 | Ga0495644_0000161 | 3300046523 | Bacteria | 31795 |
| 592 | Ga0495644_0001284 | 3300046523 | Bacteria | 10296 |
| 593 | Ga0495648_0000649 | 3300046524 | Bacteria | 37131 |
| 594 | Ga0495648_0001976 | 3300046524 | Bacteria | 19476 |
| 595 | Ga0495648_0012322 | 3300046524 | Bacteria | 6386 |
| 596 | Ga0495648_0037442 | 3300046524 | Bacteria | 3117 |
| 597 | Ga0495648_0130779 | 3300046524 | Bacteria | 1335 |
| 598 | Ga0495666_0073311 | 3300046526 | Bacteria | 1625 |
| 599 | Ga0495652_0011496 | 3300046529 | Bacteria | 8003 |
| 600 | Ga0495652_0044229 | 3300046529 | Bacteria | 3835 |
| 601 | Ga0495652_0062313 | 3300046529 | Bacteria | 3145 |
| 602 | Ga0495652_0069453 | 3300046529 | Bacteria | 2949 |
| 603 | Ga0495652_0143402 | 3300046529 | Bacteria | 1876 |
| 604 | Ga0495654_0001967 | 3300046530 | Bacteria | 13552 |
| 605 | Ga0495654_0013147 | 3300046530 | Bacteria | 4432 |
| 606 | Ga0495665_0024184 | 3300046531 | Bacteria | 3263 |
| 607 | Ga0495640_0018920 | 3300046533 | Bacteria | 5095 |
| 608 | Ga0495640_0025800 | 3300046533 | Bacteria | 4256 |
| 609 | Ga0495640_0026588 | 3300046533 | Bacteria | 4179 |
| 610 | Ga0495587_0009536 | 3300046536 | Bacteria | 6218 |
| 611 | Ga0495587_0011834 | 3300046536 | Bacteria | 5515 |
| 612 | Ga0495609_0041572 | 3300046538 | Bacteria | 2066 |
| 613 | Ga0495597_0058190 | 3300046542 | Bacteria | 1689 |
| 614 | Ga0495645_0008632 | 3300046543 | Bacteria | 7115 |
| 615 | Ga0495622_0000641 | 3300046557 | Bacteria | 20138 |
| 616 | Ga0495622_0005644 | 3300046557 | Bacteria | 5804 |
| 617 | Ga0495667_0015120 | 3300046559 | Bacteria | 5210 |
| 618 | Ga0495667_0047583 | 3300046559 | Bacteria | 2833 |
| 619 | Ga0495656_0039602 | 3300046615 | Bacteria | 1959 |
| 620 | Ga0495668_0111629 | 3300046616 | Bacteria | 1495 |
| 621 | Ga0495668_0154461 | 3300046616 | Bacteria | 1257 |
| 622 | Ga0495634_0012302 | 3300046642 | Bacteria | 6201 |
| 623 | Ga0495634_0026082 | 3300046642 | Bacteria | 4081 |
| 624 | Ga0495611_0003177 | 3300046648 | Bacteria | 7276 |
| 625 | Ga0495611_0045941 | 3300046648 | Bacteria | 1957 |
| 626 | Ga0495625_0003452 | 3300046660 | Bacteria | 15748 |
| 627 | Ga0495625_0029779 | 3300046660 | Bacteria | 4080 |
| 628 | Ga0495625_0034090 | 3300046660 | Bacteria | 3759 |
| 629 | Ga0495625_0072611 | 3300046660 | Bacteria | 2413 |
| 630 | Ga0495625_0165102 | 3300046660 | Bacteria | 1481 |
| 631 | Ga0495635_0001663 | 3300046663 | Bacteria | 14979 |
| 632 | Ga0495635_0002216 | 3300046663 | Bacteria | 13218 |
| 633 | Ga0495635_0149373 | 3300046663 | Bacteria | 1590 |
| 634 | Ga0495635_0261816 | 3300046663 | Bacteria | 1164 |
| 635 | Ga0495661_0030728 | 3300046665 | Bacteria | 3417 |
| 636 | Ga0495588_0011960 | 3300046674 | Bacteria | 4088 |
| 637 | Ga0495588_0015861 | 3300046674 | Bacteria | 3634 |
| 638 | Ga0495657_0013034 | 3300046675 | Bacteria | 6149 |
| 639 | Ga0495657_0016822 | 3300046675 | Bacteria | 5319 |
| 640 | Ga0495657_0053223 | 3300046675 | Bacteria | 2709 |
| 641 | Ga0495623_0064402 | 3300046679 | Bacteria | 2294 |
| 642 | Ga0495623_0070733 | 3300046679 | Bacteria | 2173 |
| 643 | Ga0495623_0113234 | 3300046679 | Bacteria | 1641 |
| 644 | Ga0495646_0013364 | 3300046680 | Bacteria | 5217 |
| 645 | Ga0495646_0125280 | 3300046680 | Bacteria | 1450 |
| 646 | Ga0495646_0164924 | 3300046680 | Bacteria | 1224 |
| 647 | Ga0495647_0018790 | 3300046681 | Bacteria | 2465 |
| 648 | Ga0495647_0176340 | 3300046681 | Bacteria | 928 |
| 649 | Ga0495658_0004777 | 3300046683 | Bacteria | 6644 |
| 650 | Ga0495658_0018697 | 3300046683 | Bacteria | 3607 |
| 651 | Ga0495613_0004714 | 3300046689 | Bacteria | 10235 |
| 652 | Ga0495613_0032112 | 3300046689 | Bacteria | 3900 |
| 653 | Ga0495613_0033036 | 3300046689 | Bacteria | 3845 |
| 654 | Ga0495613_0098996 | 3300046689 | Bacteria | 2107 |
| 655 | Ga0495613_0203252 | 3300046689 | Bacteria | 1396 |
| 656 | Ga0495624_0019160 | 3300046690 | Bacteria | 4571 |
| 657 | Ga0495624_0030593 | 3300046690 | Bacteria | 3505 |
| 658 | Ga0495670_0002597 | 3300046691 | Bacteria | 8929 |
| 659 | Ga0495671_0009785 | 3300046692 | Bacteria | 5341 |
| 660 | Ga0495671_0118593 | 3300046692 | Bacteria | 1291 |
| 661 | Ga0495649_0003782 | 3300046694 | Bacteria | 10037 |
| 662 | Ga0495649_0016940 | 3300046694 | Bacteria | 4123 |
| 663 | Ga0495589_0009082 | 3300046794 | Bacteria | 5169 |
| 664 | Ga0495600_0007305 | 3300046809 | Bacteria | 6752 |
| 665 | Ga0495600_0059968 | 3300046809 | Bacteria | 2484 |
| 666 | Ga0495600_0062672 | 3300046809 | Bacteria | 2429 |
| 667 | Ga0495600_0168663 | 3300046809 | Bacteria | 1413 |
| 668 | Ga0495581_0009027 | 3300047315 | Bacteria | 5769 |
| 669 | Ga0495581_0133243 | 3300047315 | Bacteria | 1448 |
| 670 | Ga0495604_0003216 | 3300047317 | Bacteria | 13049 |
| 671 | Ga0495604_0035080 | 3300047317 | Bacteria | 3963 |
| 672 | Ga0495604_0059194 | 3300047317 | Bacteria | 2937 |
| 673 | Ga0495604_0093192 | 3300047317 | Bacteria | 2229 |
| 674 | Ga0495674_0001841 | 3300047319 | Bacteria | 20895 |
| 675 | Ga0495674_0011669 | 3300047319 | Bacteria | 8286 |
| 676 | Ga0495674_0025810 | 3300047319 | Bacteria | 5381 |
| 677 | Ga0495672_0000022 | 3300047320 | Bacteria | 420632 |
| 678 | Ga0495672_0001231 | 3300047320 | Bacteria | 25711 |
| 679 | Ga0495672_0004150 | 3300047320 | Bacteria | 12039 |
| 680 | Ga0495672_0064675 | 3300047320 | Bacteria | 2093 |
| 681 | Ga0495676_0022111 | 3300047321 | Bacteria | 5540 |
| 682 | Ga0495676_0136037 | 3300047321 | Bacteria | 1767 |
| 683 | Ga0495676_0178857 | 3300047321 | Bacteria | 1488 |
| 684 | Ga0495680_0001322 | 3300047322 | Bacteria | 27035 |
| 685 | Ga0495680_0097500 | 3300047322 | Bacteria | 2194 |
| 686 | Ga0495683_0001454 | 3300047323 | Bacteria | 15542 |
| 687 | Ga0495683_0010917 | 3300047323 | Bacteria | 4789 |
| 688 | Ga0495683_0062796 | 3300047323 | Bacteria | 1837 |
| 689 | Ga0495683_0097402 | 3300047323 | Bacteria | 1418 |
| 690 | Ga0495687_013888 | 3300047443 | Bacteria | 4173 |
| 691 | Ga0495675_0002252 | 3300047444 | Bacteria | 11525 |
| 692 | Ga0495675_0024161 | 3300047444 | Bacteria | 3875 |
| 693 | Ga0495673_0009535 | 3300047469 | Bacteria | 5370 |
| 694 | Ga0495673_0043609 | 3300047469 | Bacteria | 2006 |
| 695 | Ga0495673_0086065 | 3300047469 | Bacteria | 1292 |
| 696 | Ga0495681_0000791 | 3300047470 | Bacteria | 24342 |
| 697 | Ga0495681_0006002 | 3300047470 | Bacteria | 8051 |
| 698 | Ga0495681_0007042 | 3300047470 | Bacteria | 7260 |
| 699 | Ga0495684_0000954 | 3300047471 | Bacteria | 23525 |
| 700 | Ga0495684_0019271 | 3300047471 | Bacteria | 5253 |
| 701 | Ga0495684_0132616 | 3300047471 | Bacteria | 1870 |
| 702 | Ga0495686_0011048 | 3300047472 | Bacteria | 6387 |
| 703 | Ga0495686_0086299 | 3300047472 | Bacteria | 1910 |
| 704 | Ga0495686_0115335 | 3300047472 | Bacteria | 1607 |
| 705 | Ga0495593_0003081 | 3300047673 | Bacteria | 10023 |
| 706 | Ga0495593_0014242 | 3300047673 | Bacteria | 4522 |
| 707 | Ga0495593_0025568 | 3300047673 | Bacteria | 3268 |
| 708 | Ga0495602_0001522 | 3300048088 | Bacteria | 23067 |
| 709 | Ga0495602_0062602 | 3300048088 | Bacteria | 3227 |
| 710 | Ga0495602_0173870 | 3300048088 | Bacteria | 1669 |
| 711 | Ga0495602_0242542 | 3300048088 | Bacteria | 1347 |
| 712 | Ga0496100_0069785 | 3300048903 | Bacteria | 2341 |
| 713 | Ga0496100_0170465 | 3300048903 | Bacteria | 1567 |
| 714 | Ga0496101_0002163 | 3300048904 | Bacteria | 12008 |
| 715 | Ga0496101_0042583 | 3300048904 | Bacteria | 3241 |
| 716 | Ga0496101_0064684 | 3300048904 | Bacteria | 2665 |
| 717 | Ga0496101_0110474 | 3300048904 | Bacteria | 2069 |
| 718 | Ga0496101_0432051 | 3300048904 | Bacteria | 1038 |
| 719 | Ga0496102_0004735 | 3300048905 | Bacteria | 11526 |
| 720 | Ga0496102_0065003 | 3300048905 | Bacteria | 3343 |
| 721 | Ga0496102_0205255 | 3300048905 | Bacteria | 1858 |
| 722 | Ga0496102_0212067 | 3300048905 | Bacteria | 1826 |
| 723 | Ga0496103_0009240 | 3300048906 | Bacteria | 5840 |
| 724 | Ga0496103_0025569 | 3300048906 | Bacteria | 3569 |
| 725 | Ga0496103_0105567 | 3300048906 | Bacteria | 1786 |
| 726 | Ga0496104_0008224 | 3300048907 | Bacteria | 9262 |
| 727 | Ga0496104_0017315 | 3300048907 | Bacteria | 6559 |
| 728 | Ga0496104_0018507 | 3300048907 | Bacteria | 6355 |
| 729 | Ga0496104_0040514 | 3300048907 | Bacteria | 4366 |
| 730 | Ga0496104_0053148 | 3300048907 | Bacteria | 3826 |
| 731 | Ga0496104_0215342 | 3300048907 | Bacteria | 1832 |
| 732 | Ga0496104_0255260 | 3300048907 | Bacteria | 1666 |
| 733 | Ga0496105_0003309 | 3300048908 | Bacteria | 11905 |
| 734 | Ga0496105_0017237 | 3300048908 | Bacteria | 5786 |
| 735 | Ga0496105_0034661 | 3300048908 | Bacteria | 4152 |
| 736 | Ga0496105_0050225 | 3300048908 | Bacteria | 3445 |
| 737 | Ga0496105_0114605 | 3300048908 | Bacteria | 2223 |
| 738 | Ga0496106_0001650 | 3300048909 | Bacteria | 16749 |
| 739 | Ga0496106_0007189 | 3300048909 | Bacteria | 8223 |
| 740 | Ga0496106_0014553 | 3300048909 | Bacteria | 5813 |
| 741 | Ga0496106_0258400 | 3300048909 | Bacteria | 1393 |
| 742 | Ga0496106_0360447 | 3300048909 | Bacteria | 1168 |
| 743 | Ga0496107_0006125 | 3300048910 | Bacteria | 8261 |
| 744 | Ga0496107_0014195 | 3300048910 | Bacteria | 5578 |
| 745 | Ga0496107_0014488 | 3300048910 | Bacteria | 5521 |
| 746 | Ga0496107_0126816 | 3300048910 | Bacteria | 1883 |
| 747 | Ga0496107_0226489 | 3300048910 | Bacteria | 1391 |
| 748 | Ga0496107_0416119 | 3300048910 | Bacteria | 999 |
| 749 | Ga0496108_0000392 | 3300048911 | Bacteria | 36249 |
| 750 | Ga0496108_0050615 | 3300048911 | Bacteria | 3477 |
| 751 | Ga0496108_0062618 | 3300048911 | Bacteria | 3132 |
| 752 | Ga0496108_0144678 | 3300048911 | Bacteria | 2049 |
| 753 | Ga0496108_0317099 | 3300048911 | Bacteria | 1359 |
| 754 | Ga0496109_0000509 | 3300048912 | Bacteria | 33001 |
| 755 | Ga0496109_0108526 | 3300048912 | Bacteria | 2579 |
| 756 | Ga0496109_0294980 | 3300048912 | Bacteria | 1529 |
| 757 | Ga0496109_0496125 | 3300048912 | Bacteria | 1152 |
| 758 | Ga0496110_0002823 | 3300048913 | Bacteria | 13112 |
| 759 | Ga0496110_0021817 | 3300048913 | Bacteria | 5429 |
| 760 | Ga0496110_0027818 | 3300048913 | Bacteria | 4850 |
| 761 | Ga0496110_0031189 | 3300048913 | Bacteria | 4598 |
| 762 | Ga0496110_0225812 | 3300048913 | Bacteria | 1703 |
| 763 | Ga0496110_0226093 | 3300048913 | Bacteria | 1702 |
| 764 | Ga0496110_0282262 | 3300048913 | Bacteria | 1512 |
| 765 | Ga0496110_0462409 | 3300048913 | Bacteria | 1156 |
| 766 | Ga0496111_0025389 | 3300048914 | Bacteria | 4182 |
| 767 | Ga0496111_0086009 | 3300048914 | Bacteria | 2300 |
| 768 | Ga0496111_0105418 | 3300048914 | Bacteria | 2074 |
| 769 | Ga0496111_0173146 | 3300048914 | Bacteria | 1604 |
| 770 | Ga0496112_0001604 | 3300048915 | Bacteria | 17489 |
| 771 | Ga0496112_0051559 | 3300048915 | Bacteria | 4036 |
| 772 | Ga0496112_0090293 | 3300048915 | Bacteria | 3032 |
| 773 | Ga0496112_0213498 | 3300048915 | Bacteria | 1886 |
| 774 | Ga0496112_0242842 | 3300048915 | Bacteria | 1753 |
| 775 | Ga0496112_0302736 | 3300048915 | Bacteria | 1544 |
| 776 | Ga0496113_0016979 | 3300048916 | Bacteria | 5040 |
| 777 | Ga0496113_0047173 | 3300048916 | Bacteria | 3201 |
| 778 | Ga0496113_0133933 | 3300048916 | Bacteria | 1946 |
| 779 | Ga0496114_0009197 | 3300048917 | Bacteria | 7837 |
| 780 | Ga0496114_0053750 | 3300048917 | Bacteria | 3357 |
| 781 | Ga0496114_0302775 | 3300048917 | Bacteria | 1411 |
| 782 | Ga0496115_0007018 | 3300048918 | Bacteria | 8275 |
| 783 | Ga0496115_0033979 | 3300048918 | Bacteria | 4030 |
| 784 | Ga0496115_0086582 | 3300048918 | Bacteria | 2556 |
| 785 | Ga0496115_0128384 | 3300048918 | Bacteria | 2089 |
| 786 | Ga0496115_0207611 | 3300048918 | Bacteria | 1618 |
| 787 | Ga0496115_0446926 | 3300048918 | Bacteria | 1044 |
| 788 | Ga0496116_0051256 | 3300048919 | Unclassified | 2743 |
| 789 | Ga0496116_0104204 | 3300048919 | Bacteria | 1686 |
| 790 | Ga0496117_0025017 | 3300048920 | Bacteria | 4703 |
| 791 | Ga0496117_0034853 | 3300048920 | Bacteria | 3786 |
| 792 | Ga0496117_0116121 | 3300048920 | Bacteria | 1655 |
| 793 | Ga0496118_0005110 | 3300048921 | Bacteria | 15080 |
| 794 | Ga0496118_0008904 | 3300048921 | Bacteria | 10255 |
| 795 | Ga0496118_0027152 | 3300048921 | Bacteria | 4853 |
| 796 | Ga0496118_0144791 | 3300048921 | Bacteria | 1498 |
| 797 | Ga0496118_0188331 | 3300048921 | Bacteria | 1237 |
| 798 | Ga0496118_0239130 | 3300048921 | Bacteria | 1041 |
| 799 | Ga0496119_0010875 | 3300048922 | Bacteria | 7605 |
| 800 | Ga0496119_0019680 | 3300048922 | Bacteria | 4957 |
| 801 | Ga0496119_0061747 | 3300048922 | Bacteria | 2236 |
| 802 | Ga0496119_0075867 | 3300048922 | Bacteria | 1952 |
| 803 | Ga0496119_0086688 | 3300048922 | Bacteria | 1789 |
| 804 | Ga0496120_0015228 | 3300048923 | Bacteria | 5083 |
| 805 | Ga0496121_0002211 | 3300048924 | Bacteria | 30371 |
| 806 | Ga0496121_0005384 | 3300048924 | Bacteria | 16445 |
| 807 | Ga0496121_0006122 | 3300048924 | Bacteria | 15119 |
| 808 | Ga0496121_0007564 | 3300048924 | Bacteria | 13091 |
| 809 | Ga0496121_0029453 | 3300048924 | Bacteria | 5075 |
| 810 | Ga0496121_0050711 | 3300048924 | Bacteria | 3503 |
| 811 | Ga0496121_0134483 | 3300048924 | Bacteria | 1844 |
| 812 | Ga0496121_0140272 | 3300048924 | Bacteria | 1794 |
| 813 | Ga0496121_0141723 | 3300048924 | Bacteria | 1782 |
| 814 | Ga0496122_0011882 | 3300048925 | Bacteria | 8749 |
| 815 | Ga0496122_0029923 | 3300048925 | Bacteria | 4576 |
| 816 | Ga0496122_0154439 | 3300048925 | Bacteria | 1411 |
| 817 | Ga0496123_0046151 | 3300048926 | Bacteria | 2958 |
| 818 | Ga0496124_0002457 | 3300048927 | Bacteria | 24235 |
| 819 | Ga0496124_0004902 | 3300048927 | Bacteria | 15384 |
| 820 | Ga0496124_0050320 | 3300048927 | Bacteria | 3551 |
| 821 | Ga0496124_0060263 | 3300048927 | Bacteria | 3184 |
| 822 | Ga0496124_0114306 | 3300048927 | Bacteria | 2168 |
| 823 | Ga0496125_0003200 | 3300048928 | Bacteria | 20213 |
| 824 | Ga0496125_0009674 | 3300048928 | Bacteria | 9850 |
| 825 | Ga0496125_0037461 | 3300048928 | Bacteria | 4216 |
| 826 | Ga0496125_0047818 | 3300048928 | Bacteria | 3573 |
| 827 | Ga0496125_0065846 | 3300048928 | Bacteria | 2867 |
| 828 | Ga0496125_0117069 | 3300048928 | Bacteria | 1912 |
| 829 | Ga0496126_0004444 | 3300048929 | Bacteria | 16767 |
| 830 | Ga0496126_0005846 | 3300048929 | Bacteria | 13893 |
| 831 | Ga0496126_0009950 | 3300048929 | Bacteria | 10041 |
| 832 | Ga0496126_0023151 | 3300048929 | Bacteria | 6022 |
| 833 | Ga0496126_0044635 | 3300048929 | Bacteria | 4080 |
| 834 | Ga0496126_0222600 | 3300048929 | Bacteria | 1584 |
| 835 | Ga0496126_0270812 | 3300048929 | Bacteria | 1409 |
| 836 | Ga0495682_0009825 | 3300049460 | Bacteria | 3724 |
| 837 | Ga0495682_0064829 | 3300049460 | Bacteria | 1317 |
| 838 | Ga0501031_0070321 | 3300049568 | Bacteria | 2280 |
| 839 | Ga0501032_0041582 | 3300049569 | Bacteria | 3120 |
| 840 | Ga0501033_0037135 | 3300049570 | Bacteria | 3647 |
| 841 | Ga0501034_0055623 | 3300049571 | Bacteria | 3981 |
| 842 | Ga0501037_0042157 | 3300049573 | Bacteria | 3354 |
| 843 | Ga0501037_0152126 | 3300049573 | Bacteria | 1653 |
| 844 | Ga0501038_0027269 | 3300049574 | Bacteria | 5084 |
| 845 | Ga0501046_0003627 | 3300049580 | Bacteria | 14138 |
| 846 | Ga0501046_0052618 | 3300049580 | Bacteria | 3209 |
| 847 | Ga0501047_0018650 | 3300049581 | Bacteria | 6653 |
| 848 | Ga0501047_0056995 | 3300049581 | Bacteria | 3779 |
| 849 | Ga0501048_0105878 | 3300049582 | Bacteria | 1985 |
| 850 | Ga0501068_0047132 | 3300049584 | Bacteria | 2599 |
| 851 | Ga0501068_0098335 | 3300049584 | Bacteria | 1812 |
| 852 | Ga0501069_0032288 | 3300049585 | Bacteria | 2881 |
| 853 | Ga0501070_0013043 | 3300049586 | Bacteria | 7003 |
| 854 | Ga0501070_0027820 | 3300049586 | Bacteria | 4742 |
| 855 | Ga0501070_0053403 | 3300049586 | Bacteria | 3352 |
| 856 | Ga0501073_0018585 | 3300049589 | Bacteria | 5024 |
| 857 | Ga0501073_0019878 | 3300049589 | Bacteria | 4845 |
| 858 | Ga0501073_0056506 | 3300049589 | Bacteria | 2745 |
| 859 | Ga0501074_0118723 | 3300049590 | Bacteria | 1891 |
| 860 | Ga0501080_0014293 | 3300049742 | Bacteria | 7310 |
| 861 | Ga0501080_0018117 | 3300049742 | Bacteria | 6519 |
| 862 | Ga0501080_0027468 | 3300049742 | Bacteria | 5292 |
| 863 | Ga0501083_0016311 | 3300049744 | Bacteria | 5202 |
| 864 | Ga0501083_0149968 | 3300049744 | Bacteria | 1527 |
| 865 | Ga0501044_0094711 | 3300049823 | Bacteria | 3010 |
| 866 | Ga0501044_0167888 | 3300049823 | Bacteria | 2167 |
| 867 | nmdc:mga03683_75605_c1 | 3300050489 | Bacteria | 1446 |
| 868 | nmdc:mga03n38_24910_c1 | 3300050490 | Bacteria | 2451 |
| 869 | nmdc:mga03n38_54072_c1 | 3300050490 | Bacteria | 1803 |
| 870 | nmdc:mga03n38_56533_c1 | 3300050490 | Bacteria | 1771 |
| 871 | nmdc:mga00v17_141485_c1 | 3300050491 | Bacteria | 1543 |
| 872 | nmdc:mga00v17_15899_c1 | 3300050491 | Bacteria | 4233 |
| 873 | nmdc:mga00v17_29554_c1 | 3300050491 | Bacteria | 3217 |
| 874 | nmdc:mga0yw44_18086_c1 | 3300050492 | Bacteria | 3853 |
| 875 | nmdc:mga0yw44_8312_c1 | 3300050492 | Bacteria | 5160 |
| 876 | nmdc:mga06z11_87688_c1 | 3300050494 | Bacteria | 1683 |
| 877 | nmdc:mga07m45_6537_c1 | 3300050496 | Bacteria | 5900 |
| 878 | nmdc:mga07m45_69190_c1 | 3300050496 | Bacteria | 2007 |
| 879 | nmdc:mga08x19_45300_c1 | 3300050514 | Bacteria | 2811 |
| 880 | nmdc:mga0sz30_117073_c1 | 3300050516 | Bacteria | 1170 |
| 881 | nmdc:mga0sz30_27037_c1 | 3300050516 | Bacteria | 2355 |
| 882 | Ga0495601_0033606 | 3300053077 | Bacteria | 3196 |
| 883 | Ga0495601_0068597 | 3300053077 | Bacteria | 2260 |
| 884 | Ga0495601_0079166 | 3300053077 | Bacteria | 2107 |
| 885 | Ga0495601_0109546 | 3300053077 | Bacteria | 1788 |
| 886 | Ga0495612_0022403 | 3300053078 | Bacteria | 2532 |
| 887 | Ga0500635_0004567 | 3300053080 | Bacteria | 3574 |
| 888 | Ga0495595_0002427 | 3300053084 | Bacteria | 7285 |
| 889 | Ga0495619_0003494 | 3300053085 | Bacteria | 10138 |
| 890 | Ga0495619_0109300 | 3300053085 | Bacteria | 1888 |
| 891 | Ga0495619_0189676 | 3300053085 | Bacteria | 1423 |
| 892 | Ga0500578_0066448 | 3300053086 | Bacteria | 2300 |
| 893 | Ga0500578_0107010 | 3300053086 | Bacteria | 1766 |
| 894 | Ga0500643_000180 | 3300053087 | Bacteria | 61907 |
| 895 | Ga0500647_0019188 | 3300053091 | Bacteria | 3173 |
| 896 | Ga0500583_0001516 | 3300053092 | Bacteria | 6694 |
| 897 | Ga0500566_0001981 | 3300053094 | Bacteria | 12085 |
| 898 | Ga0500566_0002691 | 3300053094 | Bacteria | 10590 |
| 899 | Ga0500566_0058583 | 3300053094 | Bacteria | 2186 |
| 900 | Ga0500566_0169479 | 3300053094 | Bacteria | 1130 |
| 901 | Ga0500641_0050602 | 3300053096 | Bacteria | 1708 |
| 902 | Ga0500650_0089625 | 3300053098 | Bacteria | 1439 |
| 903 | Ga0500555_002554 | 3300053103 | Bacteria | 5241 |
| 904 | Ga0500557_000046 | 3300053105 | Bacteria | 59508 |
| 905 | Ga0500562_002380 | 3300053108 | Bacteria | 4723 |
| 906 | Ga0500569_004047 | 3300053109 | Bacteria | 3052 |
| 907 | Ga0500572_000826 | 3300053111 | Bacteria | 9761 |
| 908 | Ga0500572_000837 | 3300053111 | Bacteria | 9643 |
| 909 | Ga0500594_0028309 | 3300053118 | Bacteria | 1457 |
| 910 | Ga0500595_000904 | 3300053119 | Bacteria | 16936 |
| 911 | Ga0500595_016720 | 3300053119 | Bacteria | 2726 |
| 912 | Ga0500595_032662 | 3300053119 | Bacteria | 1735 |
| 913 | Ga0500607_052045 | 3300053121 | Bacteria | 2175 |
| 914 | Ga0500608_019442 | 3300053122 | Bacteria | 3115 |
| 915 | Ga0500614_004818 | 3300053123 | Bacteria | 2838 |
| 916 | Ga0500614_040038 | 3300053123 | Bacteria | 1187 |
| 917 | Ga0500642_0000038 | 3300053130 | Bacteria | 98299 |
| 918 | Ga0500642_0009511 | 3300053130 | Bacteria | 3377 |
| 919 | Ga0500658_0050273 | 3300053134 | Bacteria | 1701 |
| 920 | Ga0500559_0000713 | 3300053136 | Bacteria | 21844 |
| 921 | Ga0500559_0003599 | 3300053136 | Bacteria | 7575 |
| 922 | Ga0500559_0011212 | 3300053136 | Bacteria | 3831 |
| 923 | Ga0500559_0021473 | 3300053136 | Bacteria | 2736 |
| 924 | Ga0500568_0006310 | 3300053139 | Bacteria | 5969 |
| 925 | Ga0500589_087718 | 3300053147 | Bacteria | 1377 |
| 926 | Ga0500590_075504 | 3300053148 | Bacteria | 1667 |
| 927 | Ga0500590_079869 | 3300053148 | Bacteria | 1609 |
| 928 | Ga0500590_142204 | 3300053148 | Bacteria | 1094 |
| 929 | Ga0500603_000871 | 3300053150 | Bacteria | 7198 |
| 930 | Ga0500603_001934 | 3300053150 | Bacteria | 4616 |
| 931 | Ga0500603_047886 | 3300053150 | Bacteria | 1161 |
| 932 | Ga0500622_0119775 | 3300053156 | Bacteria | 1277 |
| 933 | Ga0500624_008032 | 3300053157 | Bacteria | 1469 |
| 934 | Ga0500627_0018853 | 3300053158 | Bacteria | 2738 |
| 935 | Ga0500630_004527 | 3300053159 | Bacteria | 6758 |
| 936 | Ga0500638_008873 | 3300053162 | Bacteria | 4312 |
| 937 | Ga0500639_000035 | 3300053163 | Bacteria | 66883 |
| 938 | Ga0500639_054340 | 3300053163 | Bacteria | 2081 |
| 939 | Ga0500636_0000475 | 3300053177 | Bacteria | 21849 |
| 940 | Ga0500636_0028854 | 3300053177 | Bacteria | 3276 |
| 941 | Ga0500637_0031149 | 3300053178 | Bacteria | 2971 |
| 942 | Ga0500576_041564 | 3300053725 | Bacteria | 2067 |
| 943 | Ga0500657_061588 | 3300053728 | Bacteria | 1676 |
| 944 | Ga0500601_000021 | 3300053737 | Bacteria | 37192 |
| 945 | Ga0500601_001501 | 3300053737 | Bacteria | 2555 |
| 946 | Ga0501084_0051457 | 3300054114 | Bacteria | 3447 |
| 947 | Ga0500661_008074 | 3300055283 | Bacteria | 1937 |
| 948 | Ga0500661_008655 | 3300055283 | Bacteria | 1871 |
| 949 | 2507512050 | 2507262055 | Bacteria | 8048963 |
| 950 | 2508545711 | 2508501009 | Bacteria | 7784016 |
| 951 | 2508694534 | 2508501042 | Bacteria | 8719808 |
| 952 | 2509151259 | 2508501128 | Bacteria | 8613869 |
| 953 | 2511398163 | 2511231028 | Bacteria | 8046582 |
| 954 | 2513624553 | 2513237092 | Bacteria | 8341956 |
| 955 | 2513638586 | 2513237094 | Bacteria | 8789602 |
| 956 | 2513650031 | 2513237095 | Bacteria | 8976980 |
| 957 | 2513655527 | 2513237096 | Bacteria | 8722461 |
| 958 | 2513678475 | 2513237098 | Bacteria | 9902361 |
| 959 | 2513704178 | 2513237102 | Bacteria | 7703324 |
| 960 | 2513720182 | 2513237104 | Bacteria | 10034502 |
| 961 | 2513859788 | 2513237137 | Bacteria | 9558895 |
| 962 | 2513874316 | 2513237139 | Bacteria | 8737671 |
| 963 | 2513887927 | 2513237141 | Bacteria | 8496279 |
| 964 | 2513916395 | 2513237145 | Bacteria | 8979722 |
| 965 | 2514016808 | 2513237161 | Bacteria | 8871253 |
| 966 | 2515624536 | 2515154112 | Bacteria | 8294334 |
| 967 | 2517104535 | 2517093001 | Bacteria | 9002274 |
| 968 | 2517889992 | 2517572143 | Bacteria | 9484767 |
| 969 | 2524438494 | 2524023205 | Bacteria | 8918781 |
| 970 | 2524466291 | 2524023210 | Bacteria | 9029266 |
| 971 | 2524534964 | 2524023228 | Bacteria | 10118060 |
| 972 | 2528850209 | 2528768022 | Bacteria | 10457665 |
| 973 | 2585268692 | 2582581306 | Bacteria | 6450535 |
| 974 | 2585389332 | 2582581865 | Bacteria | 6644329 |
| 975 | 2617353153 | 2617270735 | Bacteria | 9163226 |
| 976 | 2617374522 | 2617270741 | Bacteria | 8201522 |
| 977 | 2643842605 | 2643221565 | Bacteria | 6216018 |
| 978 | 2671120977 | 2667528175 | Bacteria | 7532676 |
| 979 | 2728749098 | 2728368998 | Bacteria | 8720350 |
| 980 | 2745078347 | 2744054633 | Bacteria | 8678936 |
| 981 | 2774119922 | 2773857670 | Bacteria | 6407454 |
| 982 | 2784312148 | 2784132072 | Bacteria | 6596533 |
| 983 | 2793059454 | 2791355196 | Bacteria | 7323613 |
| 984 | 2793068039 | 2791355197 | Bacteria | 8420563 |
| 985 | 2818242982 | 2816332527 | Bacteria | 8933356 |
| 986 | 2819687869 | 2818991461 | Bacteria | 7026071 |
| 987 | 2824604474 | 2824600985 | Bacteria | 8488197 |
| 988 | 2824614985 | 2824609381 | Bacteria | 8672835 |
| 989 | 2824624303 | 2824617872 | Bacteria | 8814715 |
| 990 | 2824633076 | 2824626560 | Bacteria | 8813858 |
| 991 | 2824640666 | 2824635225 | Bacteria | 8785348 |
| 992 | 2824650115 | 2824644064 | Bacteria | 8743947 |
| 993 | 2824657492 | 2824653114 | Bacteria | 8493680 |
| 994 | 2824665163 | 2824661429 | Bacteria | 9877870 |
| 995 | 2824674015 | 2824671348 | Bacteria | 8369588 |
| 996 | 2824680209 | 2824679649 | Bacteria | 8248951 |
| 997 | 2824691242 | 2824687955 | Bacteria | 8360029 |
| 998 | 2824700931 | 2824696289 | Bacteria | 8335049 |
| 999 | 2824710545 | 2824704595 | Bacteria | 9667483 |
| 1000 | 2824720013 | 2824714736 | Bacteria | 8717648 |
| 1001 | 2824728141 | 2824723954 | Bacteria | 8758240 |
| 1002 | 2824736140 | 2824732956 | Bacteria | 7810675 |
| 1003 | 2824748016 | 2824746037 | Bacteria | 7911610 |
| 1004 | 2824759303 | 2824753945 | Bacteria | 9787441 |
| 1005 | 2824768567 | 2824763712 | Bacteria | 9792355 |
| 1006 | 2824778302 | 2824773399 | Bacteria | 8360218 |
| 1007 | 2838128571 | 2838122688 | Bacteria | 8803140 |
| 1008 | 2841942427 | 2841941048 | Bacteria | 8688029 |
| 1009 | 2841953227 | 2841949485 | Bacteria | 8680857 |
| 1010 | 2841960757 | 2841957949 | Bacteria | 8652217 |
| 1011 | 2841973884 | 2841966195 | Bacteria | 8673214 |
| 1012 | 2841982949 | 2841974524 | Bacteria | 8931498 |
| 1013 | 2841984444 | 2841983080 | Bacteria | 8395090 |
| 1014 | 2842041833 | 2842038055 | Bacteria | 8002051 |
| 1015 | 2842049875 | 2842045827 | Bacteria | 8006841 |
| 1016 | 2844321278 | 2844315083 | Bacteria | 8138177 |
| 1017 | 2847932131 | 2847930680 | Bacteria | 9342022 |
| 1018 | 2847943363 | 2847939898 | Bacteria | 8606328 |
| 1019 | 2849077086 | 2849076700 | Bacteria | 7039503 |
| 1020 | 2857514621 | 2857509624 | Bacteria | 7472071 |
| 1021 | 2874595769 | 2874590934 | Bacteria | 8299676 |
| 1022 | 2874614957 | 2874612657 | Bacteria | 8252029 |
| 1023 | 2874624178 | 2874620515 | Bacteria | 8290088 |
| 1024 | 2874630368 | 2874628541 | Bacteria | 8630250 |
| 1025 | 2874651599 | 2874645413 | Bacteria | 8214782 |
| 1026 | 2876767604 | 2876761206 | Bacteria | 10111113 |
| 1027 | 2876775966 | 2876771140 | Bacteria | 8287509 |
| 1028 | 2876821174 | 2876818435 | Bacteria | 8274608 |
| 1029 | 2879080055 | 2879074833 | Bacteria | 8279565 |
| 1030 | 2879083323 | 2879083081 | Bacteria | 8587928 |
| 1031 | 2879106469 | 2879099564 | Bacteria | 10442239 |
| 1032 | 2879132717 | 2879127579 | Bacteria | 8294491 |
| 1033 | 2879146502 | 2879142872 | Bacteria | 8267021 |
| 1034 | 2881367552 | 2881364244 | Bacteria | 7710352 |
| 1035 | 2881669265 | 2881665667 | Bacteria | 8175609 |
| 1036 | 2885374564 | 2885366525 | Bacteria | 8326213 |
| 1037 | 2885378678 | 2885374607 | Bacteria | 8927485 |
| 1038 | 2885387969 | 2885383462 | Bacteria | 9473874 |
| 1039 | 2885417336 | 2885409591 | Bacteria | 9235467 |
| 1040 | 2888387576 | 2888378607 | Bacteria | 9652610 |
| 1041 | 2888391628 | 2888388044 | Bacteria | 7304136 |
| 1042 | 2888426796 | 2888419890 | Bacteria | 7857137 |
| 1043 | 2903731531 | 2903727486 | Bacteria | 8281579 |
| 1044 | 2903753189 | 2903748898 | Bacteria | 9972761 |
| 1045 | 2903775645 | 2903768456 | Bacteria | 9749579 |
| 1046 | 2904670889 | 2904666416 | Bacteria | 8226587 |
| 1047 | 2904697685 | 2904690495 | Bacteria | 9412302 |
| 1048 | 2904711023 | |||
| 1049 | 2904713484 | 2904711408 | Bacteria | 9771557 |
| 1050 | 2906607892 | 2906602504 | Bacteria | 8295279 |
| 1051 | 2906612253 | |||
| 1052 | 2906633125 | 2906626472 | Bacteria | 8826946 |
| 1053 | 2906638404 | 2906635258 | Bacteria | 8601019 |
| 1054 | 2906645701 | 2906643746 | Bacteria | 8722424 |
| 1055 | 2906663311 | 2906660503 | Bacteria | 8595048 |
| 1056 | 2908740214 | 2908739725 | Bacteria | 8628932 |
| 1057 | 2908757791 | 2908756301 | Bacteria | 8864324 |
| 1058 | 2908777001 | 2908775508 | Bacteria | 8092255 |
| 1059 | 2922376553 | |||
| 1060 | 2922393395 | 2922393267 | Bacteria | 8285685 |
| 1061 | 2922427049 | |||
| 1062 | 2932789616 | 2932784394 | Bacteria | 9704911 |
| 1063 | 2932796710 | 2932794094 | Bacteria | 7915132 |
| 1064 | 2932802509 | 2932801729 | Bacteria | 7987968 |
| 1065 | 2932814878 | 2932809354 | Bacteria | 9135765 |
| 1066 | 2932824265 | 2932818245 | Bacteria | 9955613 |
| 1067 | 2932834007 | 2932828146 | Bacteria | 9745859 |
| 1068 | 2935623603 | 2935616580 | Bacteria | 9032984 |
| 1069 | 2935633194 | 2935630451 | Bacteria | 8169952 |
| 1070 | 2935644990 | 2935638405 | Bacteria | 10015038 |
| 1071 | 2935653819 | 2935648319 | Bacteria | 8801166 |
| 1072 | 2935662568 | 2935656913 | Bacteria | 8965014 |
| 1073 | 2935672039 | 2935665750 | Bacteria | 9571747 |
| 1074 | 2935683035 | 2935675223 | Bacteria | 9928132 |
| 1075 | 2935689205 | 2935684952 | Bacteria | 9590419 |
| 1076 | 2935697537 | 2935694250 | Bacteria | 9291695 |
| 1077 | 2935711114 | 2935703347 | Bacteria | 10242284 |
| 1078 | 2935720151 | 2935713505 | Bacteria | 9608509 |
| 1079 | 2935728232 | 2935722832 | Bacteria | 9608746 |
| 1080 | 2935737171 | 2935732158 | Bacteria | 9706831 |
| 1081 | 2935746768 | 2935741537 | Bacteria | 9707219 |
| 1082 | 2935757735 | 2935750917 | Bacteria | 9590372 |
| 1083 | 2935764115 | 2935760218 | Bacteria | 9817913 |
| 1084 | 2935776398 | 2935769743 | Bacteria | 7878163 |
| 1085 | 2935784341 | 2935777560 | Bacteria | 8077691 |
| 1086 | 2935792377 | 2935785616 | Bacteria | 7962367 |
| 1087 | 2935800540 | 2935793552 | Bacteria | 8012592 |
| 1088 | 2935808703 | 2935801545 | Bacteria | 9301974 |
| 1089 | 2935817499 | 2935810662 | Bacteria | 9401221 |
| 1090 | 2935834164 | 2935827899 | Bacteria | 10038562 |
| 1091 | 2935844766 | 2935837841 | Bacteria | 9454360 |
| 1092 | 2935861790 | 2935855204 | Bacteria | 9035059 |
| 1093 | 2935868574 | 2935864058 | Bacteria | 9784707 |
| 1094 | 2935879348 | 2935873716 | Bacteria | 9632195 |
| 1095 | 2935887050 | 2935883170 | Bacteria | 7964738 |
| 1096 | 2935965943 | 2935959822 | Bacteria | 7869783 |
| 1097 | 2935980003 | 2935975950 | Bacteria | 8347125 |
| 1098 | 2935989429 | 2935984226 | Bacteria | 8302647 |
| 1099 | 2935998484 | 2935992306 | Bacteria | 9802711 |
| 1100 | 2936009055 | 2936002035 | Bacteria | 9362176 |
| 1101 | 2936016784 | 2936011229 | Bacteria | 8801034 |
| 1102 | 2936025417 | 2936019824 | Bacteria | 8804134 |
| 1103 | 2936034345 | 2936028420 | Bacteria | 8965941 |
| 1104 | 2936044296 | 2936037263 | Bacteria | 9446081 |
| 1105 | 2936052402 | 2936046547 | Bacteria | 8903709 |
| 1106 | 2936060684 | 2936055302 | Bacteria | 8785755 |
| 1107 | 2940563443 | 2940556831 | Bacteria | 9590747 |
| 1108 | 2941509504 | 2941507105 | Bacteria | 8166816 |
| 1109 | 2941517333 | 2941515067 | Bacteria | 8166720 |
| 1110 | 2941526714 | 2941523033 | Bacteria | 8169134 |
| 1111 | 2941531858 | 2941531003 | Bacteria | 7653939 |
| 1112 | 2941545339 | 2941538514 | Bacteria | 9402094 |
| 1113 | 3005476229 | 3005474847 | Bacteria | 9259049 |
| 1114 | 3005485858 | 3005483717 | Bacteria | 7877331 |
| 1115 | 3005506723 | 3005506211 | Bacteria | 6943378 |
| 1116 | 3005588849 | 3005587118 | Bacteria | 7794411 |
| 1117 | 3005601615 | 3005594810 | Bacteria | 8716512 |
| 1118 | 3005717350 | 3005710791 | Bacteria | 7622528 |
| 1119 | 3005724309 | 3005718088 | Bacteria | 8283608 |
| 1120 | 8006932188 | 8006926726 | Bacteria | 6749210 |
| 1121 | 8006937533 | 8006933436 | Bacteria | 10410654 |
| 1122 | 8006977561 | 8006973647 | Bacteria | 10679141 |
| 1123 | 8016519285 | 8016511872 | Bacteria | 9921665 |
| 1124 | 8016525054 | 8016522445 | Bacteria | 8156687 |
| 1125 | 8016538632 | 8016530956 | Bacteria | 8155261 |
| 1126 | 8016542919 | 8016539877 | Bacteria | 8155419 |
| 1127 | 8016550372 | 8016548790 | Bacteria | 8155074 |
| 1128 | 8016568312 | 8016566248 | Bacteria | 8158151 |
| 1129 | 8016587773 | 8016583857 | Bacteria | 10421953 |
| 1130 | 8016596756 | 8016595262 | Bacteria | 8149947 |
| 1131 | 8016607646 | 8016603502 | Bacteria | 8731218 |
| 1132 | 8016630170 | 8016622563 | Bacteria | 7999408 |
| 1133 | 8017066228 | 8017057580 | Bacteria | 10023680 |
| 1134 | 8019538301 | 8019530166 | Bacteria | 8155624 |
| 1135 | 8019541678 | 8019538911 | Bacteria | 7872763 |
| 1136 | 8019549109 | 8019547302 | Bacteria | 7996444 |
| 1137 | 8019561073 | 8019555841 | Bacteria | 9642137 |
| 1138 | 8019571160 | 8019565922 | Bacteria | 9639779 |
| 1139 | 8019578397 | 8019576017 | Bacteria | 10049540 |
| 1140 | 8019596435 | 8019586578 | Bacteria | 10212056 |
| 1141 | 8019638084 | 8019629233 | Bacteria | 8687553 |
| 1142 | 8019641553 | 8019638758 | Bacteria | 9062356 |
| 1143 | 8019666002 | 8019659431 | Bacteria | 8577854 |
| 1144 | 8019675520 | 8019668869 | Bacteria | 8791617 |
| 1145 | 8055750302 | 8055742211 | Bacteria | 9226248 |
| 1146 | 8056686023 | 8056681323 | Bacteria | 8472857 |
| 1147 | 8056694785 | 8056689827 | Bacteria | 6712655 |
| 1148 | 8056976077 | 8056967851 | Bacteria | 9038162 |
| 1149 | Ga0157375_10103974 | |||
| 1150 | MRS2a_Contig_38 | |||
| 1151 | JGI25152J39213_1002024 | |||
| 1152 | JGI25151J46595_10001595 | |||
| 1153 | JGI25151J46595_10040452 | |||
| 1154 | JGI25406J46586_10000064 | |||
| 1155 | JGI25153J46596_10001739 | |||
| 1156 | JGI25153J46596_10002780 | |||
| 1157 | JGI25153J46596_10004236 | |||
| 1158 | rootH1_10079142 | |||
| 1159 | rootH2_10178384 | |||
| 1160 | rootL2_10208118 | |||
| 1161 | rootH1_10036200 | |||
| 1162 | rootH1_10052176 | |||
| 1163 | JGI25160J50197_1004224 | |||
| 1164 | JGI25160J50197_1016674 | |||
| 1165 | JGI25161J50226_1008987 | |||
| 1166 | Ga0055531_10007654 | |||
| 1167 | Ga0055543_1014121 | |||
| 1168 | Ga0065165_1001009 | |||
| 1169 | Ga0065165_1001177 | |||
| 1170 | Ga0065165_1006388 | |||
| 1171 | Ga0065165_1010110 | |||
| 1172 | Ga0065165_1021093 | |||
| 1173 | Ga0065714_10000030 | |||
| 1174 | Ga0065714_10003214 | |||
| 1175 | Ga0065714_10008328 | |||
| 1176 | Ga0065712_10085937 | |||
| 1177 | Ga0065712_10170727 | |||
| 1178 | Ga0070658_10059139 | |||
| 1179 | Ga0070676_10225571 | |||
| 1180 | Ga0070683_100003885 | |||
| 1181 | Ga0070683_100016009 | |||
| 1182 | Ga0070683_100301249 | |||
| 1183 | Ga0070683_100396443 | |||
| 1184 | Ga0068869_100004206 | |||
| 1185 | Ga0070680_100086609 | |||
| 1186 | Ga0068868_100038484 | |||
| 1187 | Ga0068868_100229560 | |||
| 1188 | Ga0070660_100071897 | |||
| 1189 | Ga0070661_100076627 | |||
| 1190 | Ga0070661_100084773 | |||
| 1191 | Ga0070668_100007896 | |||
| 1192 | Ga0070668_100419218 | |||
| 1193 | Ga0070675_100104813 | |||
| 1194 | Ga0070671_100027281 | |||
| 1195 | Ga0070671_100087093 | |||
| 1196 | Ga0070667_100107939 | |||
| 1197 | Ga0070709_10001276 | |||
| 1198 | Ga0070714_100028550 | |||
| 1199 | Ga0070713_100001422 | |||
| 1200 | Ga0070713_100053939 | |||
| 1201 | Ga0070713_100170778 | |||
| 1202 | Ga0070713_100191548 | |||
| 1203 | Ga0070710_10000994 | |||
| 1204 | Ga0070710_10290629 | |||
| 1205 | Ga0070711_100006005 | |||
| 1206 | Ga0070711_100015159 | |||
| 1207 | Ga0070705_100334923 | |||
| 1208 | Ga0070700_100287764 | |||
| 1209 | Ga0070663_100015963 | |||
| 1210 | Ga0070663_100038183 | |||
| 1211 | Ga0070663_100043016 | |||
| 1212 | Ga0070663_100074727 | |||
| 1213 | Ga0070678_100019312 | |||
| 1214 | Ga0070678_100523055 | |||
| 1215 | Ga0070662_100033266 | |||
| 1216 | Ga0070681_10089303 | |||
| 1217 | Ga0070681_10093759 | |||
| 1218 | Ga0070706_100069633 | |||
| 1219 | Ga0070698_100060180 | |||
| 1220 | Ga0070698_100072452 | |||
| 1221 | Ga0070679_100021567 | |||
| 1222 | Ga0070679_100099264 | |||
| 1223 | Ga0070684_100010618 | |||
| 1224 | Ga0070684_100120125 | |||
| 1225 | Ga0070697_100054583 | |||
| 1226 | Ga0068853_100193472 | |||
| 1227 | Ga0068853_100217054 | |||
| 1228 | Ga0070665_100005999 | |||
| 1229 | Ga0070665_100086056 | |||
| 1230 | Ga0070665_100288633 | |||
| 1231 | Ga0068855_100038944 | |||
| 1232 | Ga0068855_100053068 | |||
| 1233 | Ga0068855_100061622 | |||
| 1234 | Ga0068855_100197687 | |||
| 1235 | Ga0070664_100049101 | |||
| 1236 | Ga0068857_100029668 | |||
| 1237 | Ga0068857_100116419 | |||
| 1238 | Ga0068857_100406127 | |||
| 1239 | Ga0068854_100031752 | |||
| 1240 | Ga0068854_100098007 | |||
| 1241 | Ga0068856_100000046 | |||
| 1242 | Ga0068856_100145712 | |||
| 1243 | Ga0068852_100021670 | |||
| 1244 | Ga0068852_100024160 | |||
| 1245 | Ga0068852_100121228 | |||
| 1246 | Ga0068859_100152894 | |||
| 1247 | Ga0068859_100190731 | |||
| 1248 | Ga0068864_100393064 | |||
| 1249 | Ga0068866_10069126 | |||
| 1250 | Ga0068861_100064503 | |||
| 1251 | Ga0068851_10021906 | |||
| 1252 | Ga0068851_10026465 | |||
| 1253 | Ga0068870_10064621 | |||
| 1254 | Ga0068863_100260758 | |||
| 1255 | Ga0068858_100448932 | |||
| 1256 | Ga0068860_100083205 | |||
| 1257 | Ga0068862_100482337 | |||
| 1258 | Ga0081455_10005388 | |||
| 1259 | Ga0081540_1001405 | |||
| 1260 | Ga0081540_1008509 | |||
| 1261 | Ga0081540_1017686 | |||
| 1262 | Ga0081540_1027389 | |||
| 1263 | Ga0081539_10000099 | |||
| 1264 | Ga0081539_10017228 | |||
| 1265 | Ga0070717_10000329 | |||
| 1266 | Ga0070717_10011544 | |||
| 1267 | Ga0070717_10099419 | |||
| 1268 | Ga0075365_10010639 | |||
| 1269 | Ga0075365_10013105 | |||
| 1270 | Ga0075365_10045370 | |||
| 1271 | Ga0075365_10101803 | |||
| 1272 | Ga0075368_10006133 | |||
| 1273 | Ga0075363_100006017 | |||
| 1274 | Ga0075363_100030102 | |||
| 1275 | Ga0075364_10027600 | |||
| 1276 | Ga0075364_10035756 | |||
| 1277 | Ga0075364_10149184 | |||
| 1278 | Ga0070716_100319262 | |||
| 1279 | Ga0070712_100005262 | |||
| 1280 | Ga0070712_100180436 | |||
| 1281 | Ga0075362_10047140 | |||
| 1282 | Ga0075362_10072923 | |||
| 1283 | Ga0075367_10008911 | |||
| 1284 | Ga0075367_10012598 | |||
| 1285 | Ga0075367_10042478 | |||
| 1286 | Ga0075367_10078077 | |||
| 1287 | Ga0075367_10146867 | |||
| 1288 | Ga0075367_10166599 | |||
| 1289 | Ga0075369_10105892 | |||
| 1290 | Ga0075366_10021249 | |||
| 1291 | Ga0097621_100222279 | |||
| 1292 | Ga0075370_10000887 | |||
| 1293 | Ga0075370_10128961 | |||
| 1294 | Ga0075370_10192044 | |||
| 1295 | Ga0075370_10201260 | |||
| 1296 | Ga0075434_100310303 | |||
| 1297 | Ga0068865_100399899 | |||
| 1298 | Ga0097620_100152889 | |||
| 1299 | Ga0097620_100190729 | |||
| 1300 | Ga0099825_1030979 | |||
| 1301 | Ga0099824_1019557 | |||
| 1302 | Ga0099822_1000157 | |||
| 1303 | Ga0079104_1000787 | |||
| 1304 | Ga0099795_10081858 | |||
| 1305 | Ga0105250_10044375 | |||
| 1306 | Ga0105240_10003907 | |||
| 1307 | Ga0105240_10004081 | |||
| 1308 | Ga0105240_10015110 | |||
| 1309 | Ga0105240_10095255 | |||
| 1310 | Ga0105240_10128094 | |||
| 1311 | Ga0105240_10133934 | |||
| 1312 | Ga0105245_10003170 | |||
| 1313 | Ga0105245_10019653 | |||
| 1314 | Ga0105247_10033412 | |||
| 1315 | Ga0105247_10120736 | |||
| 1316 | Ga0105243_10103827 | |||
| 1317 | Ga0105241_10009831 | |||
| 1318 | Ga0105241_10026367 | |||
| 1319 | Ga0105241_10076730 | |||
| 1320 | Ga0105241_10078586 | |||
| 1321 | Ga0105241_10102836 | |||
| 1322 | Ga0105242_10184463 | |||
| 1323 | Ga0105248_10027379 | |||
| 1324 | Ga0105248_10083709 | |||
| 1325 | Ga0105248_10311924 | |||
| 1326 | Ga0105237_10014809 | |||
| 1327 | Ga0105237_10018581 | |||
| 1328 | Ga0105237_10019593 | |||
| 1329 | Ga0105237_10035169 | |||
| 1330 | Ga0105237_10055074 | |||
| 1331 | Ga0105237_10168649 | |||
| 1332 | Ga0105237_10175721 | |||
| 1333 | Ga0105237_10181288 | |||
| 1334 | Ga0105237_10224056 | |||
| 1335 | Ga0105237_10379864 | |||
| 1336 | Ga0105238_10008597 | |||
| 1337 | Ga0105238_10081866 | |||
| 1338 | Ga0105238_10176869 | |||
| 1339 | Ga0105238_10186851 | |||
| 1340 | Ga0105238_10435001 | |||
| 1341 | Ga0105238_10495779 | |||
| 1342 | Ga0105249_10368185 | |||
| 1343 | Ga0099796_10071874 | |||
| 1344 | Ga0105239_10010063 | |||
| 1345 | Ga0105239_10016514 | |||
| 1346 | Ga0105239_10045655 | |||
| 1347 | Ga0105239_10097236 | |||
| 1348 | Ga0105239_10097626 | |||
| 1349 | Ga0105239_10133455 | |||
| 1350 | Ga0105239_10134406 | |||
| 1351 | Ga0105239_10223622 | |||
| 1352 | Ga0105239_10316775 | |||
| 1353 | Ga0105239_10401253 | |||
| 1354 | Ga0105246_10029590 | |||
| 1355 | Ga0105246_10039737 | |||
| 1356 | Ga0105246_10348322 | |||
| 1357 | Ga0157373_10260929 | |||
| 1358 | Ga0157370_10018582 | |||
| 1359 | Ga0157370_10040326 | |||
| 1360 | Ga0157370_10099145 | |||
| 1361 | Ga0157370_10164412 | |||
| 1362 | Ga0157369_10004364 | |||
| 1363 | Ga0157369_10011444 | |||
| 1364 | Ga0157369_10048648 | |||
| 1365 | Ga0157369_10259659 | |||
| 1366 | Ga0157374_10169956 | |||
| 1367 | Ga0157378_10200748 | |||
| 1368 | Ga0163162_10025283 | |||
| 1369 | Ga0163162_10147251 | |||
| 1370 | Ga0163162_10291140 | |||
| 1371 | Ga0163162_10659836 | |||
| 1372 | Ga0157375_10011859 | |||
| 1373 | Ga0157375_10220409 | |||
| 1374 | Ga0157375_10491953 | |||
| 1375 | Ga0163163_10085257 | |||
| 1376 | Ga0163163_10097593 | |||
| 1377 | Ga0157377_10019291 | |||
| 1378 | Ga0157379_10052255 | |||
| 1379 | Ga0157379_10104243 | |||
| 1380 | Ga0214544_1016991 | |||
| 1381 | Ga0214542_1018249 | |||
| 1382 | Ga0214545_1015672 | |||
| 1383 | Ga0214543_1023767 | |||
| 1384 | Ga0213872_10026158 | |||
| 1385 | Ga0213875_10145017 | |||
| 1386 | Ga0213871_10034911 | |||
| 1387 | Ga0209563_102259 | |||
| 1388 | Ga0207425_1017079 | |||
| 1389 | Ga0209677_100943 | |||
| 1390 | Ga0209148_1000717 | |||
| 1391 | Ga0209129_1000250 | |||
| 1392 | Ga0209233_1001778 | |||
| 1393 | Ga0209233_1006780 | |||
| 1394 | Ga0209233_1014750 | |||
| 1395 | Ga0209455_1002361 | |||
| 1396 | Ga0209455_1005285 | |||
| 1397 | Ga0209455_1016716 | |||
| 1398 | Ga0209455_1020830 | |||
| 1399 | Ga0209676_1026585 | |||
| 1400 | Ga0209025_1000172 | |||
| 1401 | Ga0209025_1001389 | |||
| 1402 | Ga0209564_1006829 | |||
| 1403 | Ga0209564_1014454 | |||
| 1404 | Ga0209758_1000106 | |||
| 1405 | Ga0209758_1000344 | |||
| 1406 | Ga0209758_1000727 | |||
| 1407 | Ga0209758_1002307 | |||
| 1408 | Ga0209758_1004919 | |||
| 1409 | Ga0207426_1000374 | |||
| 1410 | Ga0207426_1000440 | |||
| 1411 | Ga0209051_1025177 | |||
| 1412 | Ga0209257_1000819 | |||
| 1413 | Ga0207697_10010752 | |||
| 1414 | Ga0207697_10045186 | |||
| 1415 | Ga0207696_1010110 | |||
| 1416 | Ga0207713_1001320 | |||
| 1417 | Ga0207692_10000950 | |||
| 1418 | Ga0207692_10060829 | |||
| 1419 | Ga0207710_10009198 | |||
| 1420 | Ga0207710_10040474 | |||
| 1421 | Ga0207710_10115441 | |||
| 1422 | Ga0207688_10007649 | |||
| 1423 | Ga0207699_10004122 | |||
| 1424 | Ga0207699_10005422 | |||
| 1425 | Ga0207645_10175655 | |||
| 1426 | Ga0207684_10281389 | |||
| 1427 | Ga0207654_10006128 | |||
| 1428 | Ga0207654_10031548 | |||
| 1429 | Ga0207654_10102693 | |||
| 1430 | Ga0207707_10092026 | |||
| 1431 | Ga0207707_10178167 | |||
| 1432 | Ga0207695_10000123 | |||
| 1433 | Ga0207695_10005085 | |||
| 1434 | Ga0207695_10040362 | |||
| 1435 | Ga0207695_10260488 | |||
| 1436 | Ga0207671_10015866 | |||
| 1437 | Ga0207671_10029344 | |||
| 1438 | Ga0207671_10051164 | |||
| 1439 | Ga0207671_10058049 | |||
| 1440 | Ga0207671_10122492 | |||
| 1441 | Ga0207671_10146443 | |||
| 1442 | Ga0207671_10207287 | |||
| 1443 | Ga0207693_10006734 | |||
| 1444 | Ga0207693_10176320 | |||
| 1445 | Ga0207663_10001982 | |||
| 1446 | Ga0207663_10042409 | |||
| 1447 | Ga0207660_10023116 | |||
| 1448 | Ga0207662_10311794 | |||
| 1449 | Ga0207657_10104345 | |||
| 1450 | Ga0207649_10459465 | |||
| 1451 | Ga0207652_10064224 | |||
| 1452 | Ga0207681_10267319 | |||
| 1453 | Ga0207694_10010612 | |||
| 1454 | Ga0207694_10162876 | |||
| 1455 | Ga0207694_10187899 | |||
| 1456 | Ga0207694_10228855 | |||
| 1457 | Ga0207694_10422397 | |||
| 1458 | Ga0207650_10278043 | |||
| 1459 | Ga0207687_10005780 | |||
| 1460 | Ga0207687_10030420 | |||
| 1461 | Ga0207700_10032399 | |||
| 1462 | Ga0207700_10253363 | |||
| 1463 | Ga0207664_10046631 | |||
| 1464 | Ga0207706_10082744 | |||
| 1465 | Ga0207709_10124830 | |||
| 1466 | Ga0207665_10039168 | |||
| 1467 | Ga0207665_10073303 | |||
| 1468 | Ga0207665_10260175 | |||
| 1469 | Ga0207711_10051359 | |||
| 1470 | Ga0207711_10399585 | |||
| 1471 | Ga0207689_10012072 | |||
| 1472 | Ga0207661_10000159 | |||
| 1473 | Ga0207661_10007747 | |||
| 1474 | Ga0207661_10261709 | |||
| 1475 | Ga0207661_10484254 | |||
| 1476 | Ga0207679_10091055 | |||
| 1477 | Ga0207667_10182182 | |||
| 1478 | Ga0207667_10234577 | |||
| 1479 | Ga0207667_10293472 | |||
| 1480 | Ga0207668_10026879 | |||
| 1481 | Ga0207640_10011507 | |||
| 1482 | Ga0207640_10289813 | |||
| 1483 | Ga0207658_10195843 | |||
| 1484 | Ga0207677_10202945 | |||
| 1485 | Ga0207703_10004022 | |||
| 1486 | Ga0207639_10035250 | |||
| 1487 | Ga0207639_10106523 | |||
| 1488 | Ga0207639_10275222 | |||
| 1489 | Ga0207678_10019057 | |||
| 1490 | Ga0207678_10036642 | |||
| 1491 | Ga0207678_10038497 | |||
| 1492 | Ga0207678_10144096 | |||
| 1493 | Ga0207702_10000014 | |||
| 1494 | Ga0207702_10000778 | |||
| 1495 | Ga0207702_10082590 | |||
| 1496 | Ga0207702_10594871 | |||
| 1497 | Ga0207641_10103852 | |||
| 1498 | Ga0207648_10148444 | |||
| 1499 | Ga0207676_10085962 | |||
| 1500 | Ga0207676_10099196 | |||
| 1501 | Ga0207674_10015148 | |||
| 1502 | Ga0207674_10023890 | |||
| 1503 | Ga0207674_10065051 | |||
| 1504 | Ga0207674_10599686 | |||
| 1505 | Ga0207675_100044663 | |||
| 1506 | Ga0207675_100203285 | |||
| 1507 | Ga0207683_10014293 | |||
| 1508 | Ga0207683_10238098 | |||
| 1509 | Ga0207698_10011045 | |||
| 1510 | Ga0207698_10020518 | |||
| 1511 | Ga0209281_1001398 | |||
| 1512 | Ga0209389_1000016 | |||
| 1513 | Ga0209389_1000027 | |||
| 1514 | Ga0209589_1000005 | |||
| 1515 | Ga0209589_1000031 | |||
| 1516 | Ga0209489_100005 | |||
| 1517 | Ga0209489_100057 | |||
| 1518 | Ga0209489_100063 | |||
| 1519 | Ga0209700_100006 | |||
| 1520 | Ga0209700_100012 | |||
| 1521 | Ga0209179_1019929 | |||
| 1522 | Ga0268266_10004934 | |||
| 1523 | Ga0268266_10076638 | |||
| 1524 | Ga0268266_10121189 | |||
| 1525 | Ga0268266_10233095 | |||
| 1526 | Ga0268265_10302724 | |||
| 1527 | Ga0268264_10130142 | |||
| 1528 | Ga0265334_10032115 | |||
| 1529 | Ga0307517_10000176 | |||
| 1530 | Ga0307511_10052899 | |||
| 1531 | Ga0265330_10096058 | |||
| 1532 | Ga0265332_10049653 | |||
| 1533 | Ga0265332_10120589 | |||
| 1534 | Ga0265331_10036158 | |||
| 1535 | Ga0307509_10070621 | |||
| 1536 | Ga0265313_10000021 | |||
| 1537 | Ga0307508_10000019 | |||
| 1538 | Ga0307508_10040340 | |||
| 1539 | Ga0307508_10074508 | |||
| 1540 | Ga0307508_10355671 | |||
| 1541 | Ga0265314_10006820 | |||
| 1542 | Ga0265314_10135985 | |||
| 1543 | Ga0265314_10172159 | |||
| 1544 | Ga0265342_10006714 | |||
| 1545 | Ga0307516_10016176 | |||
| 1546 | Ga0307516_10158324 | |||
| 1547 | Ga0307516_10162658 | |||
| 1548 | Ga0307516_10357243 | |||
| 1549 | Ga0307507_10091909 | |||
| 1550 | Ga0307510_10009428 | |||
| 1551 | Ga0307510_10080667 | |||
| 1552 | Ga0307510_10089893 | |||
| 1553 | Ga0315911_1000005 | |||
| 1554 | Ga0373926_0025505 | |||
| 1555 | Ga0373934_0016595 | |||
| 1556 | Ga0373934_0045831 | |||
| 1557 | Ga0373944_0071462 | |||
| 1558 | Ga0373923_0004220 | |||
| 1559 | Ga0373923_0103224 | |||
| 1560 | Ga0373936_0003181 | |||
| 1561 | Ga0373939_0078399 | |||
| 1562 | Ga0373945_0044114 | |||
| 1563 | Ga0373953_0001405 | |||
| 1564 | Ga0373953_0034625 | |||
| 1565 | Ga0373954_0002625 | |||
| 1566 | Ga0373954_0014730 | |||
| 1567 | Ga0373956_0001441 | |||
| 1568 | Ga0373956_0042396 | |||
| 1569 | Ga0373957_0056128 | |||
| 1570 | Ga0373943_0069114 | |||
| 1571 | Ga0373946_0031873 | |||
| 1572 | Ga0373946_0102799 | |||
| 1573 | Ga0373955_0003007 | |||
| 1574 | Ga0373931_0037491 | |||
| 1575 | Ga0373935_0026657 | |||
| 1576 | Ga0373935_0027876 | |||
| 1577 | Ga0373927_0022158 | |||
| 1578 | Ga0373927_0028241 | |||
| 1579 | Ga0373927_0126045 | |||
| 1580 | Ga0373927_0219696 | |||
| 1581 | Ga0373933_0000017 | |||
| 1582 | Ga0373933_0004005 | |||
| 1583 | Ga0373933_0061333 | |||
| 1584 | Ga0373947_0047131 | |||
| 1585 | Ga0373947_0052252 | |||
| 1586 | Ga0373947_0062310 | |||
| 1587 | Ga0373937_0039344 | |||
| 1588 | Ga0373937_0090247 | |||
| 1589 | Ga0373937_0296683 | |||
| 1590 | Ga0373925_0136210 | |||
| 1591 | Ga0395899_0019065 | |||
| 1592 | Ga0395900_0009818 | |||
| 1593 | Ga0395900_0075964 | |||
| 1594 | Ga0395900_0095378 | |||
| 1595 | Ga0395900_0131320 | |||
| 1596 | Ga0395900_0139541 | |||
| 1597 | Ga0395898_0027602 | |||
| 1598 | Ga0395898_0036317 | |||
| 1599 | Ga0395898_0059367 | |||
| 1600 | Ga0395898_0146854 | |||
| 1601 | Ga0395898_0317777 | |||
| 1602 | Ga0395898_0345973 | |||
| 1603 | Ga0395905_0014293 | |||
| 1604 | Ga0395905_0118735 | |||
| 1605 | Ga0395905_0488800 | |||
| 1606 | Ga0395905_0655678 | |||
| 1607 | Ga0436364_0110679 | |||
| 1608 | Ga0436364_1368074 | |||
| 1609 | Ga0395901_0018476 | |||
| 1610 | Ga0395901_0056802 | |||
| 1611 | Ga0395901_0100706 | |||
| 1612 | Ga0395901_0180548 | |||
| 1613 | Ga0395901_0579261 | |||
| 1614 | Ga0436365_0410685 | |||
| 1615 | Ga0436365_0731519 | |||
| 1616 | Ga0436360_0372111 | |||
| 1617 | Ga0436360_1187358 | |||
| 1618 | Ga0436361_0211533 | |||
| 1619 | Ga0436361_0354363 | |||
| 1620 | Ga0436361_1057951 | |||
| 1621 | Ga0436361_1092874 | |||
| 1622 | Ga0436363_1138567 | |||
| 1623 | Ga0436363_1203192 | |||
| 1624 | Ga0436362_1061629 | |||
| 1625 | Ga0439438_008107 | |||
| 1626 | Ga0439438_021948 | |||
| 1627 | Ga0439447_000064 | |||
| 1628 | Ga0439466_0022280 | |||
| 1629 | Ga0439466_0022749 | |||
| 1630 | Ga0451789_0206198 | |||
| 1631 | Ga0451853_3196519 | |||
| 1632 | Ga0439431_0002590 | |||
| 1633 | Ga0439432_002080 | |||
| 1634 | Ga0439452_007138 | |||
| 1635 | Ga0439452_008006 | |||
| 1636 | Ga0439456_002130 | |||
| 1637 | Ga0450911_000005 | |||
| 1638 | Ga0450911_000549 | |||
| 1639 | Ga0450911_003131 | |||
| 1640 | Ga0450907_000003 | |||
| 1641 | Ga0439446_0005793 | |||
| 1642 | Ga0450909_000718 | |||
| 1643 | Ga0439434_0000112 | |||
| 1644 | Ga0439459_0004696 | |||
| 1645 | Ga0439460_0005838 | |||
| 1646 | Ga0450893_0004087 | |||
| 1647 | Ga0466969_0108660 | |||
| 1648 | Ga0466972_0000179 | |||
| 1649 | Ga0466966_0000830 | |||
| 1650 | Ga0466961_0000023 | |||
| 1651 | Ga0466963_0051498 | |||
| 1652 | Ga0466963_0118741 | |||
| 1653 | Ga0466968_0007926 | |||
| 1654 | Ga0466968_0046654 | |||
| 1655 | Ga0466970_0038498 | |||
| 1656 | Ga0466970_0063803 | |||
| 1657 | Ga0466957_0016453 | |||
| 1658 | Ga0466957_0247536 | |||
| 1659 | Ga0466957_0297564 | |||
| 1660 | Ga0466959_0004204 | |||
| 1661 | Ga0466959_0104549 | |||
| 1662 | Ga0466967_0028473 | |||
| 1663 | Ga0466967_0245110 | |||
| 1664 | Ga0466967_0497807 | |||
| 1665 | Ga0495617_007615 | |||
| 1666 | Ga0495627_000846 | |||
| 1667 | Ga0495592_0004997 | |||
| 1668 | Ga0495592_0005401 | |||
| 1669 | Ga0495592_0006661 | |||
| 1670 | Ga0495592_0082295 | |||
| 1671 | Ga0495603_0015774 | |||
| 1672 | Ga0495603_0034772 | |||
| 1673 | Ga0495603_0053926 | |||
| 1674 | Ga0495603_0067448 | |||
| 1675 | Ga0495590_0001558 | |||
| 1676 | Ga0495590_0063511 | |||
| 1677 | Ga0495590_0081180 | |||
| 1678 | Ga0495590_0126268 | |||
| 1679 | Ga0495591_000839 | |||
| 1680 | Ga0495591_003940 | |||
| 1681 | Ga0495591_016598 | |||
| 1682 | Ga0495629_0001206 | |||
| 1683 | Ga0495629_0003280 | |||
| 1684 | Ga0495629_0015109 | |||
| 1685 | Ga0495629_0079094 | |||
| 1686 | Ga0495629_0087126 | |||
| 1687 | Ga0495638_0000770 | |||
| 1688 | Ga0495638_0004796 | |||
| 1689 | Ga0495651_0003825 | |||
| 1690 | Ga0495651_0025211 | |||
| 1691 | Ga0495651_0029906 | |||
| 1692 | Ga0495651_0119080 | |||
| 1693 | Ga0495651_0349597 | |||
| 1694 | Ga0495653_0007406 | |||
| 1695 | Ga0495580_0142177 | |||
| 1696 | Ga0495580_0318292 | |||
| 1697 | Ga0495582_0022137 | |||
| 1698 | Ga0495582_0187786 | |||
| 1699 | Ga0495605_0060725 | |||
| 1700 | Ga0495605_0185259 | |||
| 1701 | Ga0495639_0008174 | |||
| 1702 | Ga0495639_0035021 | |||
| 1703 | Ga0495662_0001398 | |||
| 1704 | Ga0495662_0084231 | |||
| 1705 | Ga0495662_0142342 | |||
| 1706 | Ga0495664_0008348 | |||
| 1707 | Ga0495664_0020816 | |||
| 1708 | Ga0495664_0043327 | |||
| 1709 | Ga0495664_0046150 | |||
| 1710 | Ga0495584_0082300 | |||
| 1711 | Ga0495585_0000120 | |||
| 1712 | Ga0495585_0003146 | |||
| 1713 | Ga0495585_0041192 | |||
| 1714 | Ga0495594_0037242 | |||
| 1715 | Ga0495607_0011043 | |||
| 1716 | Ga0495607_0163530 | |||
| 1717 | Ga0495583_0130576 | |||
| 1718 | Ga0495606_0007020 | |||
| 1719 | Ga0495606_0042892 | |||
| 1720 | Ga0495608_0007803 | |||
| 1721 | Ga0495608_0157625 | |||
| 1722 | Ga0495608_0208446 | |||
| 1723 | Ga0495616_0017122 | |||
| 1724 | Ga0495618_0177264 | |||
| 1725 | Ga0495620_0017568 | |||
| 1726 | Ga0495628_0002925 | |||
| 1727 | Ga0495628_0011177 | |||
| 1728 | Ga0495628_0107283 | |||
| 1729 | Ga0495628_0251861 | |||
| 1730 | Ga0495630_0011377 | |||
| 1731 | Ga0495632_0005178 | |||
| 1732 | Ga0495632_0008641 | |||
| 1733 | Ga0495632_0009586 | |||
| 1734 | Ga0495632_0038010 | |||
| 1735 | Ga0495637_0000137 | |||
| 1736 | Ga0495637_0019214 | |||
| 1737 | Ga0495643_0017880 | |||
| 1738 | Ga0495643_0120441 | |||
| 1739 | Ga0495644_0000161 | |||
| 1740 | Ga0495644_0001284 | |||
| 1741 | Ga0495648_0000649 | |||
| 1742 | Ga0495648_0001976 | |||
| 1743 | Ga0495648_0012322 | |||
| 1744 | Ga0495648_0037442 | |||
| 1745 | Ga0495648_0130779 | |||
| 1746 | Ga0495666_0073311 | |||
| 1747 | Ga0495652_0011496 | |||
| 1748 | Ga0495652_0044229 | |||
| 1749 | Ga0495652_0062313 | |||
| 1750 | Ga0495652_0069453 | |||
| 1751 | Ga0495652_0143402 | |||
| 1752 | Ga0495654_0001967 | |||
| 1753 | Ga0495654_0013147 | |||
| 1754 | Ga0495665_0024184 | |||
| 1755 | Ga0495640_0018920 | |||
| 1756 | Ga0495640_0025800 | |||
| 1757 | Ga0495640_0026588 | |||
| 1758 | Ga0495587_0009536 | |||
| 1759 | Ga0495587_0011834 | |||
| 1760 | Ga0495609_0041572 | |||
| 1761 | Ga0495597_0058190 | |||
| 1762 | Ga0495645_0008632 | |||
| 1763 | Ga0495622_0000641 | |||
| 1764 | Ga0495622_0005644 | |||
| 1765 | Ga0495667_0015120 | |||
| 1766 | Ga0495667_0047583 | |||
| 1767 | Ga0495656_0039602 | |||
| 1768 | Ga0495668_0111629 | |||
| 1769 | Ga0495668_0154461 | |||
| 1770 | Ga0495634_0012302 | |||
| 1771 | Ga0495634_0026082 | |||
| 1772 | Ga0495611_0003177 | |||
| 1773 | Ga0495611_0045941 | |||
| 1774 | Ga0495625_0003452 | |||
| 1775 | Ga0495625_0029779 | |||
| 1776 | Ga0495625_0034090 | |||
| 1777 | Ga0495625_0072611 | |||
| 1778 | Ga0495625_0165102 | |||
| 1779 | Ga0495635_0001663 | |||
| 1780 | Ga0495635_0002216 | |||
| 1781 | Ga0495635_0149373 | |||
| 1782 | Ga0495635_0261816 | |||
| 1783 | Ga0495661_0030728 | |||
| 1784 | Ga0495588_0011960 | |||
| 1785 | Ga0495588_0015861 | |||
| 1786 | Ga0495657_0013034 | |||
| 1787 | Ga0495657_0016822 | |||
| 1788 | Ga0495657_0053223 | |||
| 1789 | Ga0495623_0064402 | |||
| 1790 | Ga0495623_0070733 | |||
| 1791 | Ga0495623_0113234 | |||
| 1792 | Ga0495646_0013364 | |||
| 1793 | Ga0495646_0125280 | |||
| 1794 | Ga0495646_0164924 | |||
| 1795 | Ga0495647_0018790 | |||
| 1796 | Ga0495647_0176340 | |||
| 1797 | Ga0495658_0004777 | |||
| 1798 | Ga0495658_0018697 | |||
| 1799 | Ga0495613_0004714 | |||
| 1800 | Ga0495613_0032112 | |||
| 1801 | Ga0495613_0033036 | |||
| 1802 | Ga0495613_0098996 | |||
| 1803 | Ga0495613_0203252 | |||
| 1804 | Ga0495624_0019160 | |||
| 1805 | Ga0495624_0030593 | |||
| 1806 | Ga0495670_0002597 | |||
| 1807 | Ga0495671_0009785 | |||
| 1808 | Ga0495671_0118593 | |||
| 1809 | Ga0495649_0003782 | |||
| 1810 | Ga0495649_0016940 | |||
| 1811 | Ga0495589_0009082 | |||
| 1812 | Ga0495600_0007305 | |||
| 1813 | Ga0495600_0059968 | |||
| 1814 | Ga0495600_0062672 | |||
| 1815 | Ga0495600_0168663 | |||
| 1816 | Ga0495581_0009027 | |||
| 1817 | Ga0495581_0133243 | |||
| 1818 | Ga0495604_0003216 | |||
| 1819 | Ga0495604_0035080 | |||
| 1820 | Ga0495604_0059194 | |||
| 1821 | Ga0495604_0093192 | |||
| 1822 | Ga0495674_0001841 | |||
| 1823 | Ga0495674_0011669 | |||
| 1824 | Ga0495674_0025810 | |||
| 1825 | Ga0495672_0000022 | |||
| 1826 | Ga0495672_0001231 | |||
| 1827 | Ga0495672_0004150 | |||
| 1828 | Ga0495672_0064675 | |||
| 1829 | Ga0495676_0022111 | |||
| 1830 | Ga0495676_0136037 | |||
| 1831 | Ga0495676_0178857 | |||
| 1832 | Ga0495680_0001322 | |||
| 1833 | Ga0495680_0097500 | |||
| 1834 | Ga0495683_0001454 | |||
| 1835 | Ga0495683_0010917 | |||
| 1836 | Ga0495683_0062796 | |||
| 1837 | Ga0495683_0097402 | |||
| 1838 | Ga0495687_013888 | |||
| 1839 | Ga0495675_0002252 | |||
| 1840 | Ga0495675_0024161 | |||
| 1841 | Ga0495673_0009535 | |||
| 1842 | Ga0495673_0043609 | |||
| 1843 | Ga0495673_0086065 | |||
| 1844 | Ga0495681_0000791 | |||
| 1845 | Ga0495681_0006002 | |||
| 1846 | Ga0495681_0007042 | |||
| 1847 | Ga0495684_0000954 | |||
| 1848 | Ga0495684_0019271 | |||
| 1849 | Ga0495684_0132616 | |||
| 1850 | Ga0495686_0011048 | |||
| 1851 | Ga0495686_0086299 | |||
| 1852 | Ga0495686_0115335 | |||
| 1853 | Ga0495593_0003081 | |||
| 1854 | Ga0495593_0014242 | |||
| 1855 | Ga0495593_0025568 | |||
| 1856 | Ga0495602_0001522 | |||
| 1857 | Ga0495602_0062602 | |||
| 1858 | Ga0495602_0173870 | |||
| 1859 | Ga0495602_0242542 | |||
| 1860 | Ga0496100_0069785 | |||
| 1861 | Ga0496100_0170465 | |||
| 1862 | Ga0496101_0002163 | |||
| 1863 | Ga0496101_0042583 | |||
| 1864 | Ga0496101_0064684 | |||
| 1865 | Ga0496101_0110474 | |||
| 1866 | Ga0496101_0432051 | |||
| 1867 | Ga0496102_0004735 | |||
| 1868 | Ga0496102_0065003 | |||
| 1869 | Ga0496102_0205255 | |||
| 1870 | Ga0496102_0212067 | |||
| 1871 | Ga0496103_0009240 | |||
| 1872 | Ga0496103_0025569 | |||
| 1873 | Ga0496103_0105567 | |||
| 1874 | Ga0496104_0008224 | |||
| 1875 | Ga0496104_0017315 | |||
| 1876 | Ga0496104_0018507 | |||
| 1877 | Ga0496104_0040514 | |||
| 1878 | Ga0496104_0053148 | |||
| 1879 | Ga0496104_0215342 | |||
| 1880 | Ga0496104_0255260 | |||
| 1881 | Ga0496105_0003309 | |||
| 1882 | Ga0496105_0017237 | |||
| 1883 | Ga0496105_0034661 | |||
| 1884 | Ga0496105_0050225 | |||
| 1885 | Ga0496105_0114605 | |||
| 1886 | Ga0496106_0001650 | |||
| 1887 | Ga0496106_0007189 | |||
| 1888 | Ga0496106_0014553 | |||
| 1889 | Ga0496106_0258400 | |||
| 1890 | Ga0496106_0360447 | |||
| 1891 | Ga0496107_0006125 | |||
| 1892 | Ga0496107_0014195 | |||
| 1893 | Ga0496107_0014488 | |||
| 1894 | Ga0496107_0126816 | |||
| 1895 | Ga0496107_0226489 | |||
| 1896 | Ga0496107_0416119 | |||
| 1897 | Ga0496108_0000392 | |||
| 1898 | Ga0496108_0050615 | |||
| 1899 | Ga0496108_0062618 | |||
| 1900 | Ga0496108_0144678 | |||
| 1901 | Ga0496108_0317099 | |||
| 1902 | Ga0496109_0000509 | |||
| 1903 | Ga0496109_0108526 | |||
| 1904 | Ga0496109_0294980 | |||
| 1905 | Ga0496109_0496125 | |||
| 1906 | Ga0496110_0002823 | |||
| 1907 | Ga0496110_0021817 | |||
| 1908 | Ga0496110_0027818 | |||
| 1909 | Ga0496110_0031189 | |||
| 1910 | Ga0496110_0225812 | |||
| 1911 | Ga0496110_0226093 | |||
| 1912 | Ga0496110_0282262 | |||
| 1913 | Ga0496110_0462409 | |||
| 1914 | Ga0496111_0025389 | |||
| 1915 | Ga0496111_0086009 | |||
| 1916 | Ga0496111_0105418 | |||
| 1917 | Ga0496111_0173146 | |||
| 1918 | Ga0496112_0001604 | |||
| 1919 | Ga0496112_0051559 | |||
| 1920 | Ga0496112_0090293 | |||
| 1921 | Ga0496112_0213498 | |||
| 1922 | Ga0496112_0242842 | |||
| 1923 | Ga0496112_0302736 | |||
| 1924 | Ga0496113_0016979 | |||
| 1925 | Ga0496113_0047173 | |||
| 1926 | Ga0496113_0133933 | |||
| 1927 | Ga0496114_0009197 | |||
| 1928 | Ga0496114_0053750 | |||
| 1929 | Ga0496114_0302775 | |||
| 1930 | Ga0496115_0007018 | |||
| 1931 | Ga0496115_0033979 | |||
| 1932 | Ga0496115_0086582 | |||
| 1933 | Ga0496115_0128384 | |||
| 1934 | Ga0496115_0207611 | |||
| 1935 | Ga0496115_0446926 | |||
| 1936 | Ga0496116_0051256 | |||
| 1937 | Ga0496116_0104204 | |||
| 1938 | Ga0496117_0025017 | |||
| 1939 | Ga0496117_0034853 | |||
| 1940 | Ga0496117_0116121 | |||
| 1941 | Ga0496118_0005110 | |||
| 1942 | Ga0496118_0008904 | |||
| 1943 | Ga0496118_0027152 | |||
| 1944 | Ga0496118_0144791 | |||
| 1945 | Ga0496118_0188331 | |||
| 1946 | Ga0496118_0239130 | |||
| 1947 | Ga0496119_0010875 | |||
| 1948 | Ga0496119_0019680 | |||
| 1949 | Ga0496119_0061747 | |||
| 1950 | Ga0496119_0075867 | |||
| 1951 | Ga0496119_0086688 | |||
| 1952 | Ga0496120_0015228 | |||
| 1953 | Ga0496121_0002211 | |||
| 1954 | Ga0496121_0005384 | |||
| 1955 | Ga0496121_0006122 | |||
| 1956 | Ga0496121_0007564 | |||
| 1957 | Ga0496121_0029453 | |||
| 1958 | Ga0496121_0050711 | |||
| 1959 | Ga0496121_0134483 | |||
| 1960 | Ga0496121_0140272 | |||
| 1961 | Ga0496121_0141723 | |||
| 1962 | Ga0496122_0011882 | |||
| 1963 | Ga0496122_0029923 | |||
| 1964 | Ga0496122_0154439 | |||
| 1965 | Ga0496123_0046151 | |||
| 1966 | Ga0496124_0002457 | |||
| 1967 | Ga0496124_0004902 | |||
| 1968 | Ga0496124_0050320 | |||
| 1969 | Ga0496124_0060263 | |||
| 1970 | Ga0496124_0114306 | |||
| 1971 | Ga0496125_0003200 | |||
| 1972 | Ga0496125_0009674 | |||
| 1973 | Ga0496125_0037461 | |||
| 1974 | Ga0496125_0047818 | |||
| 1975 | Ga0496125_0065846 | |||
| 1976 | Ga0496125_0117069 | |||
| 1977 | Ga0496126_0004444 | |||
| 1978 | Ga0496126_0005846 | |||
| 1979 | Ga0496126_0009950 | |||
| 1980 | Ga0496126_0023151 | |||
| 1981 | Ga0496126_0044635 | |||
| 1982 | Ga0496126_0222600 | |||
| 1983 | Ga0496126_0270812 | |||
| 1984 | Ga0495682_0009825 | |||
| 1985 | Ga0495682_0064829 | |||
| 1986 | Ga0501031_0070321 | |||
| 1987 | Ga0501032_0041582 | |||
| 1988 | Ga0501033_0037135 | |||
| 1989 | Ga0501034_0055623 | |||
| 1990 | Ga0501037_0042157 | |||
| 1991 | Ga0501037_0152126 | |||
| 1992 | Ga0501038_0027269 | |||
| 1993 | Ga0501046_0003627 | |||
| 1994 | Ga0501046_0052618 | |||
| 1995 | Ga0501047_0018650 | |||
| 1996 | Ga0501047_0056995 | |||
| 1997 | Ga0501048_0105878 | |||
| 1998 | Ga0501068_0047132 | |||
| 1999 | Ga0501068_0098335 | |||
| 2000 | Ga0501069_0032288 | |||
| 2001 | Ga0501070_0013043 | |||
| 2002 | Ga0501070_0027820 | |||
| 2003 | Ga0501070_0053403 | |||
| 2004 | Ga0501073_0018585 | |||
| 2005 | Ga0501073_0019878 | |||
| 2006 | Ga0501073_0056506 | |||
| 2007 | Ga0501074_0118723 | |||
| 2008 | Ga0501080_0014293 | |||
| 2009 | Ga0501080_0018117 | |||
| 2010 | Ga0501080_0027468 | |||
| 2011 | Ga0501083_0016311 | |||
| 2012 | Ga0501083_0149968 | |||
| 2013 | Ga0501044_0094711 | |||
| 2014 | Ga0501044_0167888 | |||
| 2015 | nmdc:mga03683_75605_c1 | |||
| 2016 | nmdc:mga03n38_24910_c1 | |||
| 2017 | nmdc:mga03n38_54072_c1 | |||
| 2018 | nmdc:mga03n38_56533_c1 | |||
| 2019 | nmdc:mga00v17_141485_c1 | |||
| 2020 | nmdc:mga00v17_15899_c1 | |||
| 2021 | nmdc:mga00v17_29554_c1 | |||
| 2022 | nmdc:mga0yw44_18086_c1 | |||
| 2023 | nmdc:mga0yw44_8312_c1 | |||
| 2024 | nmdc:mga06z11_87688_c1 | |||
| 2025 | nmdc:mga07m45_6537_c1 | |||
| 2026 | nmdc:mga07m45_69190_c1 | |||
| 2027 | nmdc:mga08x19_45300_c1 | |||
| 2028 | nmdc:mga0sz30_117073_c1 | |||
| 2029 | nmdc:mga0sz30_27037_c1 | |||
| 2030 | Ga0495601_0033606 | |||
| 2031 | Ga0495601_0068597 | |||
| 2032 | Ga0495601_0079166 | |||
| 2033 | Ga0495601_0109546 | |||
| 2034 | Ga0495612_0022403 | |||
| 2035 | Ga0500635_0004567 | |||
| 2036 | Ga0495595_0002427 | |||
| 2037 | Ga0495619_0003494 | |||
| 2038 | Ga0495619_0109300 | |||
| 2039 | Ga0495619_0189676 | |||
| 2040 | Ga0500578_0066448 | |||
| 2041 | Ga0500578_0107010 | |||
| 2042 | Ga0500643_000180 | |||
| 2043 | Ga0500647_0019188 | |||
| 2044 | Ga0500583_0001516 | |||
| 2045 | Ga0500566_0001981 | |||
| 2046 | Ga0500566_0002691 | |||
| 2047 | Ga0500566_0058583 | |||
| 2048 | Ga0500566_0169479 | |||
| 2049 | Ga0500641_0050602 | |||
| 2050 | Ga0500650_0089625 | |||
| 2051 | Ga0500555_002554 | |||
| 2052 | Ga0500557_000046 | |||
| 2053 | Ga0500562_002380 | |||
| 2054 | Ga0500569_004047 | |||
| 2055 | Ga0500572_000826 | |||
| 2056 | Ga0500572_000837 | |||
| 2057 | Ga0500594_0028309 | |||
| 2058 | Ga0500595_000904 | |||
| 2059 | Ga0500595_016720 | |||
| 2060 | Ga0500595_032662 | |||
| 2061 | Ga0500607_052045 | |||
| 2062 | Ga0500608_019442 | |||
| 2063 | Ga0500614_004818 | |||
| 2064 | Ga0500614_040038 | |||
| 2065 | Ga0500642_0000038 | |||
| 2066 | Ga0500642_0009511 | |||
| 2067 | Ga0500658_0050273 | |||
| 2068 | Ga0500559_0000713 | |||
| 2069 | Ga0500559_0003599 | |||
| 2070 | Ga0500559_0011212 | |||
| 2071 | Ga0500559_0021473 | |||
| 2072 | Ga0500568_0006310 | |||
| 2073 | Ga0500589_087718 | |||
| 2074 | Ga0500590_075504 | |||
| 2075 | Ga0500590_079869 | |||
| 2076 | Ga0500590_142204 | |||
| 2077 | Ga0500603_000871 | |||
| 2078 | Ga0500603_001934 | |||
| 2079 | Ga0500603_047886 | |||
| 2080 | Ga0500622_0119775 | |||
| 2081 | Ga0500624_008032 | |||
| 2082 | Ga0500627_0018853 | |||
| 2083 | Ga0500630_004527 | |||
| 2084 | Ga0500638_008873 | |||
| 2085 | Ga0500639_000035 | |||
| 2086 | Ga0500639_054340 | |||
| 2087 | Ga0500636_0000475 | |||
| 2088 | Ga0500636_0028854 | |||
| 2089 | Ga0500637_0031149 | |||
| 2090 | Ga0500576_041564 | |||
| 2091 | Ga0500657_061588 | |||
| 2092 | Ga0500601_000021 | |||
| 2093 | Ga0500601_001501 | |||
| 2094 | Ga0501084_0051457 | |||
| 2095 | Ga0500661_008074 | |||
| 2096 | Ga0500661_008655 | |||
| 2097 | 2507512050 | |||
| 2098 | 2508545711 | |||
| 2099 | 2508694534 | |||
| 2100 | 2509151259 | |||
| 2101 | 2511398163 | |||
| 2102 | 2513624553 | |||
| 2103 | 2513638586 | |||
| 2104 | 2513650031 | |||
| 2105 | 2513655527 | |||
| 2106 | 2513678475 | |||
| 2107 | 2513704178 | |||
| 2108 | 2513720182 | |||
| 2109 | 2513859788 | |||
| 2110 | 2513874316 | |||
| 2111 | 2513887927 | |||
| 2112 | 2513916395 | |||
| 2113 | 2514016808 | |||
| 2114 | 2515624536 | |||
| 2115 | 2517104535 | |||
| 2116 | 2517889992 | |||
| 2117 | 2524438494 | |||
| 2118 | 2524466291 | |||
| 2119 | 2524534964 | |||
| 2120 | 2528850209 | |||
| 2121 | 2585268692 | |||
| 2122 | 2585389332 | |||
| 2123 | 2617353153 | |||
| 2124 | 2617374522 | |||
| 2125 | 2643842605 | |||
| 2126 | 2671120977 | |||
| 2127 | 2728749098 | |||
| 2128 | 2745078347 | |||
| 2129 | 2774119922 | |||
| 2130 | 2784312148 | |||
| 2131 | 2793059454 | |||
| 2132 | 2793068039 | |||
| 2133 | 2818242982 | |||
| 2134 | 2819687869 | |||
| 2135 | 2824604474 | |||
| 2136 | 2824614985 | |||
| 2137 | 2824624303 | |||
| 2138 | 2824633076 | |||
| 2139 | 2824640666 | |||
| 2140 | 2824650115 | |||
| 2141 | 2824657492 | |||
| 2142 | 2824665163 | |||
| 2143 | 2824674015 | |||
| 2144 | 2824680209 | |||
| 2145 | 2824691242 | |||
| 2146 | 2824700931 | |||
| 2147 | 2824710545 | |||
| 2148 | 2824720013 | |||
| 2149 | 2824728141 | |||
| 2150 | 2824736140 | |||
| 2151 | 2824748016 | |||
| 2152 | 2824759303 | |||
| 2153 | 2824768567 | |||
| 2154 | 2824778302 | |||
| 2155 | 2838128571 | |||
| 2156 | 2841942427 | |||
| 2157 | 2841953227 | |||
| 2158 | 2841960757 | |||
| 2159 | 2841973884 | |||
| 2160 | 2841982949 | |||
| 2161 | 2841984444 | |||
| 2162 | 2842041833 | |||
| 2163 | 2842049875 | |||
| 2164 | 2844321278 | |||
| 2165 | 2847932131 | |||
| 2166 | 2847943363 | |||
| 2167 | 2849077086 | |||
| 2168 | 2857514621 | |||
| 2169 | 2874595769 | |||
| 2170 | 2874614957 | |||
| 2171 | 2874624178 | |||
| 2172 | 2874630368 | |||
| 2173 | 2874651599 | |||
| 2174 | 2876767604 | |||
| 2175 | 2876775966 | |||
| 2176 | 2876821174 | |||
| 2177 | 2879080055 | |||
| 2178 | 2879083323 | |||
| 2179 | 2879106469 | |||
| 2180 | 2879132717 | |||
| 2181 | 2879146502 | |||
| 2182 | 2881367552 | |||
| 2183 | 2881669265 | |||
| 2184 | 2885374564 | |||
| 2185 | 2885378678 | |||
| 2186 | 2885387969 | |||
| 2187 | 2885417336 | |||
| 2188 | 2888387576 | |||
| 2189 | 2888391628 | |||
| 2190 | 2888426796 | |||
| 2191 | 2903731531 | |||
| 2192 | 2903753189 | |||
| 2193 | 2903775645 | |||
| 2194 | 2904670889 | |||
| 2195 | 2904697685 | |||
| 2196 | 2904711023 | |||
| 2197 | 2904713484 | |||
| 2198 | 2906607892 | |||
| 2199 | 2906612253 | |||
| 2200 | 2906633125 | |||
| 2201 | 2906638404 | |||
| 2202 | 2906645701 | |||
| 2203 | 2906663311 | |||
| 2204 | 2908740214 | |||
| 2205 | 2908757791 | |||
| 2206 | 2908777001 | |||
| 2207 | 2922376553 | |||
| 2208 | 2922393395 | |||
| 2209 | 2922427049 | |||
| 2210 | 2932789616 | |||
| 2211 | 2932796710 | |||
| 2212 | 2932802509 | |||
| 2213 | 2932814878 | |||
| 2214 | 2932824265 | |||
| 2215 | 2932834007 | |||
| 2216 | 2935623603 | |||
| 2217 | 2935633194 | |||
| 2218 | 2935644990 | |||
| 2219 | 2935653819 | |||
| 2220 | 2935662568 | |||
| 2221 | 2935672039 | |||
| 2222 | 2935683035 | |||
| 2223 | 2935689205 | |||
| 2224 | 2935697537 | |||
| 2225 | 2935711114 | |||
| 2226 | 2935720151 | |||
| 2227 | 2935728232 | |||
| 2228 | 2935737171 | |||
| 2229 | 2935746768 | |||
| 2230 | 2935757735 | |||
| 2231 | 2935764115 | |||
| 2232 | 2935776398 | |||
| 2233 | 2935784341 | |||
| 2234 | 2935792377 | |||
| 2235 | 2935800540 | |||
| 2236 | 2935808703 | |||
| 2237 | 2935817499 | |||
| 2238 | 2935834164 | |||
| 2239 | 2935844766 | |||
| 2240 | 2935861790 | |||
| 2241 | 2935868574 | |||
| 2242 | 2935879348 | |||
| 2243 | 2935887050 | |||
| 2244 | 2935965943 | |||
| 2245 | 2935980003 | |||
| 2246 | 2935989429 | |||
| 2247 | 2935998484 | |||
| 2248 | 2936009055 | |||
| 2249 | 2936016784 | |||
| 2250 | 2936025417 | |||
| 2251 | 2936034345 | |||
| 2252 | 2936044296 | |||
| 2253 | 2936052402 | |||
| 2254 | 2936060684 | |||
| 2255 | 2940563443 | |||
| 2256 | 2941509504 | |||
| 2257 | 2941517333 | |||
| 2258 | 2941526714 | |||
| 2259 | 2941531858 | |||
| 2260 | 2941545339 | |||
| 2261 | 3005476229 | |||
| 2262 | 3005485858 | |||
| 2263 | 3005506723 | |||
| 2264 | 3005588849 | |||
| 2265 | 3005601615 | |||
| 2266 | 3005717350 | |||
| 2267 | 3005724309 | |||
| 2268 | 8006932188 | |||
| 2269 | 8006937533 | |||
| 2270 | 8006977561 | |||
| 2271 | 8016519285 | |||
| 2272 | 8016525054 | |||
| 2273 | 8016538632 | |||
| 2274 | 8016542919 | |||
| 2275 | 8016550372 | |||
| 2276 | 8016568312 | |||
| 2277 | 8016587773 | |||
| 2278 | 8016596756 | |||
| 2279 | 8016607646 | |||
| 2280 | 8016630170 | |||
| 2281 | 8017066228 | |||
| 2282 | 8019538301 | |||
| 2283 | 8019541678 | |||
| 2284 | 8019549109 | |||
| 2285 | 8019561073 | |||
| 2286 | 8019571160 | |||
| 2287 | 8019578397 | |||
| 2288 | 8019596435 | |||
| 2289 | 8019638084 | |||
| 2290 | 8019641553 | |||
| 2291 | 8019666002 | |||
| 2292 | 8019675520 | |||
| 2293 | 8055750302 | |||
| 2294 | 8056686023 | |||
| 2295 | 8056694785 | |||
| 2296 | 8056976077 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhf-assembly1.cif.gz_A | structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. | 0.9082 | 62 | 267 |
| 3hhf-assembly1.cif.gz_B | structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. | 0.9006 | 62 | 267 |
| 3hhf-assembly1.cif.gz_A | structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. | 0.8997 | 62 | 267 |
| 3hhf-assembly1.cif.gz_B | structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. | 0.8922 | 62 | 267 |
| 5x0o-assembly1.cif.gz_B | regulatory domain of aphb treated with cumene hydroperoxide from vibrio vulnificus | 0.8808 | 63 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5mmhB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.912 | 65 | 130 | 3.40.190.10 |
| 4wkmA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.898 | 63 | 130 | 3.40.190.10 |
| 3szpA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.8811 | 63 | 267 | 3.40.190.290 |
| af_P39376_183_267_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8807 | 185 | 227 | 3.40.190.10 |
| 3szpA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.873 | 63 | 267 | 3.40.190.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E9AYH9-F1-model_v4 | LysR family transcriptional regulator | 0.932 | 125 | 269 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A5E9AYH9-F1-model_v4 | LysR family transcriptional regulator | 0.9197 | 125 | 269 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A519Y4A3-F1-model_v4 | deleted | 0.912 | 77 | 267 |
|
| AF-A0A7Y4T7C7-F1-model_v4 | LysR family transcriptional regulator | 0.904 | 81 | 267 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A447T6W0-F1-model_v4 | D-malate degradation protein R | 0.901 | 59 | 267 |
GO:0003700
GO:0006351 GO:0043565 |