F490835

General Info

Members Datasets Scaffolds Average Seq Length
1149 410 2298 165

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0202516|Ga0495674_0202516_928_1410
Length 160
Sequence VSESQAKPAMILSAQALTRIDHEIAKYPSDQKRSAVMAALAIAQDEKGWLSTETMDFVAGATFYEMYNTEPIGRFKLTICTNLPCALQSASEAAEHLKRKLGIGFGETTPDRMFTLKQGECFGACGDAPVVLVNNKRMCSWMRPAELDRLLAELAAEPAP

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
253 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
274 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
275 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
281 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
311 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
356 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
357 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
382 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
383 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
384 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
385 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
404 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
405 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
408 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
409 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
410 2818991436 Collimonas arenae 515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 3.57
Rhizosphere 94.26
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0202516 3300047319 Bacteria 1646
2 JGI24034J26672_10025931 3300002239 Bacteria 939
3 JGI25162J39368_1000001 3300002737 Bacteria 740113
4 JGI25164J39214_1007850 3300002772 Bacteria 1075
5 JGI25165J46597_1000001 3300003214 Bacteria 1111887
6 Ga0055538_1000001 3300003751 Bacteria 1111887
7 Ga0055539_1000001 3300003752 Bacteria 1111887
8 Ga0055533_1000003 3300003756 Bacteria 1111887
9 Ga0055525_1000003 3300003759 Bacteria 962094
10 Ga0055541_1000001 3300003841 Bacteria 1111887
11 Ga0065715_10561781 3300005293 Bacteria 730
12 Ga0070676_10000072 3300005328 Bacteria 34018
13 Ga0070676_10149977 3300005328 Bacteria 1492
14 Ga0070683_100161839 3300005329 Bacteria 2124
15 Ga0070683_101074175 3300005329 Bacteria 773
16 Ga0070690_100002867 3300005330 Bacteria 9296
17 Ga0070690_100074179 3300005330 Bacteria 2215
18 Ga0070690_100315672 3300005330 Bacteria 1124
19 Ga0070690_101056408 3300005330 Bacteria 642
20 Ga0070690_101201813 3300005330 Bacteria 605
21 Ga0070670_100096413 3300005331 Bacteria 2544
22 Ga0070670_100117661 3300005331 Bacteria 2292
23 Ga0070670_100262774 3300005331 Bacteria 1505
24 Ga0070670_101264614 3300005331 Bacteria 675
25 Ga0070670_101885225 3300005331 Bacteria 550
26 Ga0070677_10000170 3300005333 Bacteria 22499
27 Ga0068869_100012083 3300005334 Bacteria 5692
28 Ga0068869_100013977 3300005334 Bacteria 5354
29 Ga0068869_100153654 3300005334 Bacteria 1787
30 Ga0068869_100338471 3300005334 Bacteria 1224
31 Ga0068869_101347236 3300005334 Bacteria 630
32 Ga0068869_101394355 3300005334 Bacteria 620
33 Ga0070666_10006410 3300005335 Bacteria 7235
34 Ga0070666_10007649 3300005335 Bacteria 6670
35 Ga0070666_10647812 3300005335 Bacteria 773
36 Ga0070680_100124951 3300005336 Bacteria 2149
37 Ga0070680_100249515 3300005336 Bacteria 1500
38 Ga0070682_100105552 3300005337 Bacteria 1868
39 Ga0070682_100289267 3300005337 Bacteria 1198
40 Ga0068868_100027054 3300005338 Bacteria 4374
41 Ga0068868_100117644 3300005338 Bacteria 2165
42 Ga0068868_100297177 3300005338 Bacteria 1371
43 Ga0068868_100452445 3300005338 Bacteria 1117
44 Ga0070660_100025820 3300005339 Bacteria 4369
45 Ga0070660_100381078 3300005339 Bacteria 1164
46 Ga0070660_101249062 3300005339 Bacteria 630
47 Ga0070689_100054677 3300005340 Bacteria 3091
48 Ga0070689_100066936 3300005340 Bacteria 2799
49 Ga0070689_101310609 3300005340 Bacteria 652
50 Ga0070691_10207235 3300005341 Bacteria 1033
51 Ga0070687_100021059 3300005343 Bacteria 3058
52 Ga0070687_100241755 3300005343 Bacteria 1117
53 Ga0070661_100219671 3300005344 Bacteria 1457
54 Ga0070661_100707818 3300005344 Bacteria 821
55 Ga0070692_10080451 3300005345 Bacteria 1754
56 Ga0070692_10461690 3300005345 Bacteria 815
57 Ga0070692_10473969 3300005345 Bacteria 806
58 Ga0070668_100035176 3300005347 Bacteria 3819
59 Ga0070668_100404266 3300005347 Bacteria 1166
60 Ga0070668_100795725 3300005347 Bacteria 840
61 Ga0070669_100039846 3300005353 Bacteria 3414
62 Ga0070669_100137721 3300005353 Bacteria 1879
63 Ga0070669_100408258 3300005353 Bacteria 1113
64 Ga0070669_100420649 3300005353 Bacteria 1097
65 Ga0070675_100000543 3300005354 Bacteria 25849
66 Ga0070671_100020291 3300005355 Bacteria 5419
67 Ga0070671_100027112 3300005355 Bacteria 4713
68 Ga0070671_100054157 3300005355 Bacteria 3335
69 Ga0070671_100163977 3300005355 Bacteria 1879
70 Ga0070671_100187344 3300005355 Bacteria 1753
71 Ga0070671_100346000 3300005355 Bacteria 1269
72 Ga0070671_101440471 3300005355 Bacteria 609
73 Ga0070674_100002257 3300005356 Bacteria 10631
74 Ga0070674_100075380 3300005356 Bacteria 2396
75 Ga0070674_100078199 3300005356 Bacteria 2357
76 Ga0070673_100000251 3300005364 Bacteria 27227
77 Ga0070673_100009977 3300005364 Bacteria 6404
78 Ga0070673_100396102 3300005364 Bacteria 1234
79 Ga0070673_100937619 3300005364 Bacteria 804
80 Ga0070673_101253684 3300005364 Bacteria 695
81 Ga0070688_100001386 3300005365 Bacteria 12053
82 Ga0070688_100224327 3300005365 Bacteria 1326
83 Ga0070659_100040641 3300005366 Bacteria 3635
84 Ga0070659_100073192 3300005366 Bacteria 2727
85 Ga0070659_100298389 3300005366 Bacteria 1343
86 Ga0070667_100065246 3300005367 Bacteria 3091
87 Ga0070667_100078305 3300005367 Bacteria 2824
88 Ga0070667_100184789 3300005367 Bacteria 1845
89 Ga0070667_100214808 3300005367 Bacteria 1710
90 Ga0070667_100369281 3300005367 Bacteria 1301
91 Ga0070667_100620974 3300005367 Bacteria 997
92 Ga0070667_101086518 3300005367 Bacteria 748
93 Ga0070667_101163169 3300005367 Bacteria 722
94 Ga0070709_10143754 3300005434 Bacteria 1641
95 Ga0070714_100199160 3300005435 Bacteria 1831
96 Ga0070713_100000033 3300005436 Bacteria 86758
97 Ga0070713_100020841 3300005436 Bacteria 5032
98 Ga0070713_100023278 3300005436 Bacteria 4803
99 Ga0070710_10162844 3300005437 Bacteria 1385
100 Ga0070701_10081040 3300005438 Bacteria 1757
101 Ga0070701_10159993 3300005438 Bacteria 1304
102 Ga0070711_100011100 3300005439 Bacteria 5590
103 Ga0070711_100119878 3300005439 Bacteria 1944
104 Ga0070705_100013604 3300005440 Bacteria 4166
105 Ga0070705_100036353 3300005440 Bacteria 2768
106 Ga0070705_100108366 3300005440 Bacteria 1769
107 Ga0070705_100153212 3300005440 Bacteria 1532
108 Ga0070705_100302450 3300005440 Bacteria 1147
109 Ga0070700_100001013 3300005441 Bacteria 13883
110 Ga0070700_100513667 3300005441 Bacteria 924
111 Ga0070694_100007797 3300005444 Bacteria 6532
112 Ga0070694_100011859 3300005444 Bacteria 5406
113 Ga0070694_100025031 3300005444 Bacteria 3857
114 Ga0070694_100035603 3300005444 Bacteria 3293
115 Ga0070694_100329843 3300005444 Bacteria 1177
116 Ga0070694_100362435 3300005444 Bacteria 1126
117 Ga0070708_100021761 3300005445 Bacteria 5429
118 Ga0070708_100271852 3300005445 Bacteria 1594
119 Ga0070708_100555468 3300005445 Bacteria 1083
120 Ga0070663_100198342 3300005455 Bacteria 1565
121 Ga0070663_100277780 3300005455 Bacteria 1334
122 Ga0070663_100489892 3300005455 Bacteria 1019
123 Ga0070663_100905767 3300005455 Bacteria 762
124 Ga0070663_101637777 3300005455 Bacteria 574
125 Ga0070678_100014041 3300005456 Bacteria 5039
126 Ga0070678_100105868 3300005456 Bacteria 2190
127 Ga0070678_100292288 3300005456 Bacteria 1382
128 Ga0070678_100327823 3300005456 Bacteria 1309
129 Ga0070678_100601781 3300005456 Bacteria 981
130 Ga0070678_101065516 3300005456 Bacteria 745
131 Ga0070662_100045566 3300005457 Bacteria 3147
132 Ga0070662_100073181 3300005457 Bacteria 2531
133 Ga0070662_100077812 3300005457 Bacteria 2462
134 Ga0070662_100099536 3300005457 Bacteria 2198
135 Ga0070662_100428966 3300005457 Bacteria 1095
136 Ga0070681_10013221 3300005458 Bacteria 8202
137 Ga0070681_10014534 3300005458 Bacteria 7834
138 Ga0070681_10178920 3300005458 Bacteria 2042
139 Ga0068867_100087960 3300005459 Bacteria 2353
140 Ga0068867_100168931 3300005459 Bacteria 1731
141 Ga0068867_101001466 3300005459 Bacteria 758
142 Ga0068867_101489589 3300005459 Bacteria 630
143 Ga0070685_10001553 3300005466 Bacteria 12102
144 Ga0070685_10135317 3300005466 Bacteria 1545
145 Ga0070706_100005369 3300005467 Bacteria 12210
146 Ga0070706_100201743 3300005467 Bacteria 1858
147 Ga0070706_100229256 3300005467 Bacteria 1734
148 Ga0070706_100243274 3300005467 Bacteria 1680
149 Ga0070707_100031454 3300005468 Bacteria 5056
150 Ga0070707_100099482 3300005468 Bacteria 2817
151 Ga0070707_100689745 3300005468 Bacteria 984
152 Ga0070698_100111856 3300005471 Bacteria 2696
153 Ga0070698_100118004 3300005471 Bacteria 2615
154 Ga0070698_100344771 3300005471 Bacteria 1421
155 Ga0070699_100009169 3300005518 Bacteria 8578
156 Ga0070699_100191200 3300005518 Bacteria 1818
157 Ga0070699_100530270 3300005518 Bacteria 1071
158 Ga0070699_100618637 3300005518 Bacteria 988
159 Ga0070699_100698845 3300005518 Bacteria 926
160 Ga0070679_100072479 3300005530 Bacteria 3436
161 Ga0070679_100128718 3300005530 Bacteria 2513
162 Ga0070679_100262530 3300005530 Bacteria 1682
163 Ga0070697_100002415 3300005536 Bacteria 14379
164 Ga0070697_100014086 3300005536 Bacteria 6279
165 Ga0070697_100063553 3300005536 Bacteria 3014
166 Ga0070697_100089287 3300005536 Bacteria 2546
167 Ga0070697_100242523 3300005536 Bacteria 1539
168 Ga0070697_100452401 3300005536 Bacteria 1119
169 Ga0070697_101109239 3300005536 Bacteria 704
170 Ga0068853_100004519 3300005539 Bacteria 10792
171 Ga0068853_100047075 3300005539 Bacteria 3701
172 Ga0068853_100082344 3300005539 Bacteria 2819
173 Ga0068853_100436885 3300005539 Bacteria 1229
174 Ga0068853_100811959 3300005539 Bacteria 896
175 Ga0070672_100000757 3300005543 Bacteria 19233
176 Ga0070672_100121871 3300005543 Bacteria 2135
177 Ga0070672_100697281 3300005543 Bacteria 889
178 Ga0070672_101348160 3300005543 Bacteria 637
179 Ga0070686_100095690 3300005544 Bacteria 1995
180 Ga0070686_100461823 3300005544 Bacteria 978
181 Ga0070686_100823400 3300005544 Bacteria 750
182 Ga0070695_100095580 3300005545 Bacteria 1992
183 Ga0070695_101158210 3300005545 Bacteria 635
184 Ga0070695_101396607 3300005545 Bacteria 581
185 Ga0070696_100024455 3300005546 Bacteria 4105
186 Ga0070696_100051826 3300005546 Bacteria 2854
187 Ga0070696_100250352 3300005546 Bacteria 1340
188 Ga0070696_100318204 3300005546 Bacteria 1197
189 Ga0070696_100380670 3300005546 Bacteria 1100
190 Ga0070696_100431838 3300005546 Bacteria 1036
191 Ga0070693_100034357 3300005547 Bacteria 2805
192 Ga0070693_100081645 3300005547 Bacteria 1929
193 Ga0070693_100194827 3300005547 Bacteria 1313
194 Ga0070665_100002227 3300005548 Bacteria 21612
195 Ga0070665_100004533 3300005548 Bacteria 14554
196 Ga0070665_100034082 3300005548 Bacteria 5120
197 Ga0070665_100235316 3300005548 Bacteria 1832
198 Ga0070665_100686800 3300005548 Bacteria 1037
199 Ga0070665_101355487 3300005548 Bacteria 721
200 Ga0070704_100044797 3300005549 Bacteria 3076
201 Ga0070704_100127247 3300005549 Bacteria 1968
202 Ga0070704_100173908 3300005549 Bacteria 1716
203 Ga0070704_100198723 3300005549 Bacteria 1617
204 Ga0070704_100226850 3300005549 Bacteria 1521
205 Ga0070704_101262934 3300005549 Bacteria 675
206 Ga0068855_100439986 3300005563 Bacteria 1424
207 Ga0068855_101143808 3300005563 Bacteria 812
208 Ga0070664_100160350 3300005564 Bacteria 1990
209 Ga0068857_100096584 3300005577 Bacteria 2648
210 Ga0068854_100003089 3300005578 Bacteria 10367
211 Ga0068854_100068470 3300005578 Bacteria 2588
212 Ga0068854_100478558 3300005578 Bacteria 1045
213 Ga0068856_100030254 3300005614 Bacteria 5293
214 Ga0068856_100505285 3300005614 Bacteria 1230
215 Ga0070702_100165943 3300005615 Bacteria 1432
216 Ga0070702_100267918 3300005615 Bacteria 1166
217 Ga0070702_100623315 3300005615 Bacteria 812
218 Ga0070702_100663916 3300005615 Bacteria 790
219 Ga0068852_100009278 3300005616 Bacteria 7293
220 Ga0068852_100060431 3300005616 Bacteria 3289
221 Ga0068852_100160391 3300005616 Bacteria 2099
222 Ga0068852_100197030 3300005616 Bacteria 1904
223 Ga0068852_100741588 3300005616 Bacteria 994
224 Ga0068852_101708142 3300005616 Bacteria 652
225 Ga0068852_101781318 3300005616 Bacteria 638
226 Ga0068859_100001101 3300005617 Bacteria 27548
227 Ga0068859_100004143 3300005617 Bacteria 14805
228 Ga0068859_100118593 3300005617 Bacteria 2712
229 Ga0068859_100344804 3300005617 Bacteria 1584
230 Ga0068859_100421609 3300005617 Bacteria 1431
231 Ga0068859_100564936 3300005617 Bacteria 1232
232 Ga0068864_100001698 3300005618 Bacteria 18102
233 Ga0068864_100015530 3300005618 Bacteria 6331
234 Ga0068864_100018582 3300005618 Bacteria 5810
235 Ga0068864_100075317 3300005618 Bacteria 2946
236 Ga0068864_100085019 3300005618 Bacteria 2781
237 Ga0068864_100089679 3300005618 Bacteria 2709
238 Ga0068864_101208836 3300005618 Bacteria 754
239 Ga0068866_10023568 3300005718 Bacteria 2866
240 Ga0068866_10025262 3300005718 Bacteria 2791
241 Ga0068866_10365037 3300005718 Bacteria 921
242 Ga0068866_10912206 3300005718 Bacteria 619
243 Ga0068861_100022064 3300005719 Bacteria 4582
244 Ga0068861_100111242 3300005719 Bacteria 2195
245 Ga0068861_100150212 3300005719 Bacteria 1911
246 Ga0068861_100813762 3300005719 Bacteria 878
247 Ga0068861_100924498 3300005719 Bacteria 828
248 Ga0068851_10022458 3300005834 Bacteria 3074
249 Ga0068851_10062919 3300005834 Bacteria 1905
250 Ga0068870_10012793 3300005840 Bacteria 3928
251 Ga0068870_10027059 3300005840 Bacteria 2865
252 Ga0068870_10027240 3300005840 Bacteria 2857
253 Ga0068863_100024216 3300005841 Bacteria 5790
254 Ga0068863_100027522 3300005841 Bacteria 5423
255 Ga0068863_100031027 3300005841 Bacteria 5103
256 Ga0068863_100034144 3300005841 Bacteria 4846
257 Ga0068863_100653550 3300005841 Bacteria 1043
258 Ga0068863_101608968 3300005841 Bacteria 659
259 Ga0068858_100001243 3300005842 Bacteria 26335
260 Ga0068858_100001448 3300005842 Bacteria 24421
261 Ga0068858_100125407 3300005842 Bacteria 2404
262 Ga0068858_100126739 3300005842 Bacteria 2391
263 Ga0068858_100195790 3300005842 Bacteria 1910
264 Ga0068858_100759951 3300005842 Bacteria 945
265 Ga0068858_101395383 3300005842 Bacteria 690
266 Ga0068860_100062103 3300005843 Bacteria 3550
267 Ga0068860_100483451 3300005843 Bacteria 1234
268 Ga0068860_100486951 3300005843 Bacteria 1230
269 Ga0068862_100140937 3300005844 Bacteria 2140
270 Ga0068862_101061603 3300005844 Bacteria 803
271 Ga0081539_10000805 3300005985 Bacteria 61020
272 Ga0070717_10187237 3300006028 Bacteria 1807
273 Ga0070715_10107151 3300006163 Bacteria 1313
274 Ga0070715_10260604 3300006163 Bacteria 910
275 Ga0070716_100165349 3300006173 Bacteria 1438
276 Ga0070712_100034746 3300006175 Bacteria 3418
277 Ga0070712_100120470 3300006175 Bacteria 1973
278 Ga0097621_100002521 3300006237 Bacteria 12549
279 Ga0097621_100008534 3300006237 Bacteria 7379
280 Ga0097621_100022358 3300006237 Bacteria 4908
281 Ga0097621_100103464 3300006237 Bacteria 2398
282 Ga0097621_100167357 3300006237 Bacteria 1893
283 Ga0097621_100336484 3300006237 Bacteria 1340
284 Ga0097621_100396827 3300006237 Bacteria 1234
285 Ga0097621_100649972 3300006237 Bacteria 967
286 Ga0097621_101195491 3300006237 Bacteria 716
287 Ga0068871_100004365 3300006358 Bacteria 9830
288 Ga0068871_100041227 3300006358 Bacteria 3701
289 Ga0068871_100076099 3300006358 Bacteria 2772
290 Ga0068871_100261839 3300006358 Bacteria 1509
291 Ga0068871_100551525 3300006358 Bacteria 1044
292 Ga0068871_100666348 3300006358 Bacteria 951
293 Ga0068871_100739535 3300006358 Bacteria 903
294 Ga0075430_100021691 3300006846 Bacteria 5459
295 Ga0075430_100022384 3300006846 Bacteria 5377
296 Ga0075430_100110168 3300006846 Bacteria 2296
297 Ga0075431_100005031 3300006847 Bacteria 13007
298 Ga0075433_10412026 3300006852 Bacteria 1192
299 Ga0075433_10487354 3300006852 Bacteria 1086
300 Ga0075434_100000484 3300006871 Bacteria 29868
301 Ga0075434_100160654 3300006871 Bacteria 2266
302 Ga0075434_100497625 3300006871 Bacteria 1240
303 Ga0075434_101138293 3300006871 Bacteria 793
304 Ga0075434_101340721 3300006871 Bacteria 726
305 Ga0075429_100045494 3300006880 Bacteria 3819
306 Ga0075429_100167210 3300006880 Bacteria 1926
307 Ga0068865_100072899 3300006881 Bacteria 2440
308 Ga0068865_100082328 3300006881 Bacteria 2313
309 Ga0068865_100118585 3300006881 Bacteria 1964
310 Ga0068865_100342468 3300006881 Bacteria 1209
311 Ga0075436_100000593 3300006914 Bacteria 23748
312 Ga0075436_100030087 3300006914 Bacteria 3736
313 Ga0075436_100046822 3300006914 Bacteria 2982
314 Ga0075436_100148145 3300006914 Bacteria 1650
315 Ga0075436_100292335 3300006914 Bacteria 1166
316 Ga0075436_100340350 3300006914 Bacteria 1080
317 Ga0097620_100001101 3300006931 Bacteria 27548
318 Ga0097620_100004143 3300006931 Bacteria 14805
319 Ga0097620_100118591 3300006931 Bacteria 2712
320 Ga0097620_100344820 3300006931 Bacteria 1584
321 Ga0097620_100421603 3300006931 Bacteria 1431
322 Ga0097620_100564943 3300006931 Bacteria 1232
323 Ga0075435_100130708 3300007076 Bacteria 2101
324 Ga0075435_100177974 3300007076 Bacteria 1797
325 Ga0075435_100213264 3300007076 Bacteria 1638
326 Ga0075435_100234384 3300007076 Bacteria 1560
327 Ga0099794_10038371 3300007265 Bacteria 2269
328 Ga0099794_10043650 3300007265 Bacteria 2141
329 Ga0099794_10090944 3300007265 Bacteria 1514
330 Ga0099794_10100975 3300007265 Bacteria 1440
331 Ga0099794_10189342 3300007265 Bacteria 1052
332 Ga0099795_10039408 3300007788 Bacteria 1672
333 Ga0105251_10242635 3300009011 Bacteria 812
334 Ga0105240_10603196 3300009093 Bacteria 1208
335 Ga0111539_10001053 3300009094 Bacteria 36307
336 Ga0111539_10016781 3300009094 Bacteria 9072
337 Ga0111539_10151848 3300009094 Bacteria 2711
338 Ga0111539_10800328 3300009094 Bacteria 1097
339 Ga0111539_10932848 3300009094 Bacteria 1009
340 Ga0111539_11692320 3300009094 Bacteria 734
341 Ga0111539_12975142 3300009094 Unclassified 548
342 Ga0105245_10000207 3300009098 Bacteria 55562
343 Ga0105245_10123931 3300009098 Bacteria 2416
344 Ga0105245_10209682 3300009098 Bacteria 1875
345 Ga0105245_10383677 3300009098 Bacteria 1400
346 Ga0105245_10410722 3300009098 Bacteria 1355
347 Ga0105245_10451951 3300009098 Bacteria 1293
348 Ga0105245_10460184 3300009098 Bacteria 1282
349 Ga0105245_10817410 3300009098 Bacteria 971
350 Ga0105245_11069593 3300009098 Bacteria 852
351 Ga0105247_10044964 3300009101 Bacteria 2709
352 Ga0105247_10344858 3300009101 Bacteria 1046
353 Ga0114129_10993796 3300009147 Bacteria 1057
354 Ga0105243_10666547 3300009148 Bacteria 1010
355 Ga0105243_11482630 3300009148 Bacteria 701
356 Ga0105241_10167204 3300009174 Bacteria 1813
357 Ga0105241_10217483 3300009174 Bacteria 1604
358 Ga0105241_10934072 3300009174 Bacteria 808
359 Ga0105242_10221835 3300009176 Bacteria 1690
360 Ga0105242_10602608 3300009176 Bacteria 1061
361 Ga0105242_10697852 3300009176 Bacteria 992
362 Ga0105242_11101892 3300009176 Bacteria 808
363 Ga0105242_11881934 3300009176 Bacteria 638
364 Ga0105248_10002218 3300009177 Bacteria 21485
365 Ga0105248_10308283 3300009177 Bacteria 1783
366 Ga0105248_10315991 3300009177 Bacteria 1759
367 Ga0105248_11151747 3300009177 Bacteria 877
368 Ga0105248_11851306 3300009177 Bacteria 685
369 Ga0105237_10265601 3300009545 Bacteria 1719
370 Ga0105237_10527742 3300009545 Bacteria 1187
371 Ga0105237_11090568 3300009545 Bacteria 805
372 Ga0105238_10146803 3300009551 Bacteria 2335
373 Ga0105238_10829145 3300009551 Bacteria 941
374 Ga0105238_11259084 3300009551 Bacteria 765
375 Ga0105249_10821374 3300009553 Bacteria 994
376 Ga0105249_11002136 3300009553 Bacteria 904
377 Ga0105249_11106389 3300009553 Bacteria 862
378 Ga0105249_12432486 3300009553 Bacteria 596
379 Ga0099796_10025359 3300010159 Bacteria 1871
380 Ga0105239_10166516 3300010375 Bacteria 2465
381 Ga0105239_10373346 3300010375 Bacteria 1612
382 Ga0105239_11048648 3300010375 Bacteria 938
383 Ga0105239_11667005 3300010375 Bacteria 738
384 Ga0105246_10062859 3300011119 Bacteria 2587
385 Ga0105246_10189276 3300011119 Bacteria 1592
386 Ga0157373_10311327 3300013100 Bacteria 1119
387 Ga0157373_10358395 3300013100 Bacteria 1041
388 Ga0157371_10250382 3300013102 Bacteria 1275
389 Ga0157371_11066066 3300013102 Bacteria 619
390 Ga0157370_10266430 3300013104 Bacteria 1583
391 Ga0157369_10037398 3300013105 Bacteria 5313
392 Ga0157369_10719551 3300013105 Bacteria 1028
393 Ga0157374_10014294 3300013296 Bacteria 6945
394 Ga0157374_10150237 3300013296 Bacteria 2264
395 Ga0157374_10264089 3300013296 Bacteria 1696
396 Ga0157374_10675431 3300013296 Bacteria 1045
397 Ga0157378_10051663 3300013297 Bacteria 3657
398 Ga0157378_10208931 3300013297 Bacteria 1850
399 Ga0157378_10393456 3300013297 Bacteria 1364
400 Ga0157378_10712517 3300013297 Bacteria 1024
401 Ga0157378_10776966 3300013297 Bacteria 982
402 Ga0157378_10859028 3300013297 Bacteria 936
403 Ga0157378_11137268 3300013297 Bacteria 819
404 Ga0157378_11475590 3300013297 Bacteria 724
405 Ga0163162_10140906 3300013306 Bacteria 2524
406 Ga0163162_10306385 3300013306 Bacteria 1720
407 Ga0163162_10585527 3300013306 Bacteria 1242
408 Ga0163162_10690853 3300013306 Bacteria 1142
409 Ga0157372_10098712 3300013307 Bacteria 3332
410 Ga0157372_10617056 3300013307 Bacteria 1264
411 Ga0157372_10796076 3300013307 Bacteria 1098
412 Ga0157372_11018966 3300013307 Bacteria 959
413 Ga0157375_10011033 3300013308 Bacteria 7969
414 Ga0157375_10016586 3300013308 Bacteria 6623
415 Ga0157375_10042038 3300013308 Bacteria 4420
416 Ga0157375_10374368 3300013308 Bacteria 1591
417 Ga0157375_10436880 3300013308 Bacteria 1475
418 Ga0157375_11503106 3300013308 Bacteria 795
419 Ga0157375_12045523 3300013308 Bacteria 681
420 Ga0163163_10009593 3300014325 Bacteria 8649
421 Ga0163163_10066625 3300014325 Bacteria 3577
422 Ga0157380_10108260 3300014326 Bacteria 2329
423 Ga0157380_10183103 3300014326 Bacteria 1842
424 Ga0157380_10573010 3300014326 Bacteria 1112
425 Ga0157380_11375449 3300014326 Bacteria 756
426 Ga0157380_11920684 3300014326 Bacteria 653
427 Ga0157377_10078631 3300014745 Bacteria 1923
428 Ga0157379_10006994 3300014968 Bacteria 9753
429 Ga0157379_10245270 3300014968 Bacteria 1625
430 Ga0157379_10365806 3300014968 Bacteria 1322
431 Ga0157376_10033466 3300014969 Bacteria 4138
432 Ga0157376_10069688 3300014969 Bacteria 2982
433 Ga0157376_10167905 3300014969 Bacteria 1995
434 Ga0157376_10369635 3300014969 Bacteria 1378
435 Ga0157376_10543339 3300014969 Bacteria 1149
436 Ga0182006_1032825 3300015261 Bacteria 2084
437 Ga0182007_10050203 3300015262 Bacteria 1377
438 Ga0182005_1013443 3300015265 Bacteria 2302
439 Ga0163161_10013389 3300017792 Bacteria 5707
440 Ga0163161_10039723 3300017792 Bacteria 3379
441 Ga0163161_10094176 3300017792 Bacteria 2220
442 Ga0209760_101465 3300025207 Bacteria 2483
443 Ga0209566_100004 3300025225 Bacteria 1531866
444 Ga0209674_100006 3300025226 Bacteria 1531866
445 Ga0209563_100009 3300025230 Bacteria 1378156
446 Ga0207427_100293 3300025231 Bacteria 35384
447 Ga0209437_100004 3300025233 Bacteria 1378156
448 Ga0209677_100005 3300025253 Bacteria 1378156
449 Ga0209233_1000005 3300025261 Bacteria 1531866
450 Ga0207656_10001172 3300025321 Bacteria 8631
451 Ga0207656_10118445 3300025321 Bacteria 1230
452 Ga0207682_10024633 3300025893 Bacteria 2384
453 Ga0207682_10035821 3300025893 Bacteria 2006
454 Ga0207682_10040949 3300025893 Bacteria 1890
455 Ga0207682_10233052 3300025893 Bacteria 854
456 Ga0207692_10917195 3300025898 Bacteria 576
457 Ga0207642_10052105 3300025899 Bacteria 1855
458 Ga0207642_10075839 3300025899 Bacteria 1616
459 Ga0207710_10015450 3300025900 Bacteria 3226
460 Ga0207710_10287665 3300025900 Bacteria 828
461 Ga0207688_10172243 3300025901 Bacteria 1287
462 Ga0207688_10183712 3300025901 Bacteria 1248
463 Ga0207680_10007196 3300025903 Bacteria 5410
464 Ga0207680_10246988 3300025903 Bacteria 1231
465 Ga0207685_10002834 3300025905 Bacteria 4074
466 Ga0207699_10070113 3300025906 Bacteria 2140
467 Ga0207645_10000686 3300025907 Bacteria 28086
468 Ga0207645_10229484 3300025907 Bacteria 1225
469 Ga0207645_10602803 3300025907 Bacteria 746
470 Ga0207643_10007629 3300025908 Bacteria 5814
471 Ga0207643_10011915 3300025908 Bacteria 4694
472 Ga0207643_10027879 3300025908 Bacteria 3134
473 Ga0207643_10090879 3300025908 Bacteria 1780
474 Ga0207684_10098891 3300025910 Bacteria 2492
475 Ga0207684_10126212 3300025910 Bacteria 2196
476 Ga0207684_10167442 3300025910 Bacteria 1894
477 Ga0207684_11708245 3300025910 Bacteria 507
478 Ga0207654_10148730 3300025911 Bacteria 1501
479 Ga0207707_10017447 3300025912 Bacteria 6258
480 Ga0207707_10026843 3300025912 Bacteria 5033
481 Ga0207707_10261257 3300025912 Bacteria 1502
482 Ga0207707_10527371 3300025912 Bacteria 1005
483 Ga0207695_10780147 3300025913 Bacteria 836
484 Ga0207671_10013515 3300025914 Bacteria 6499
485 Ga0207671_10040925 3300025914 Bacteria 3430
486 Ga0207693_10025102 3300025915 Bacteria 4728
487 Ga0207693_10046169 3300025915 Bacteria 3422
488 Ga0207693_10076236 3300025915 Bacteria 2626
489 Ga0207663_10104065 3300025916 Bacteria 1913
490 Ga0207660_10654290 3300025917 Bacteria 857
491 Ga0207662_10079839 3300025918 Bacteria 1994
492 Ga0207657_10014919 3300025919 Bacteria 7555
493 Ga0207652_10055337 3300025921 Bacteria 3411
494 Ga0207652_10355688 3300025921 Bacteria 1322
495 Ga0207646_10470666 3300025922 Bacteria 1133
496 Ga0207681_10062298 3300025923 Bacteria 2568
497 Ga0207681_10197824 3300025923 Bacteria 1542
498 Ga0207681_10488648 3300025923 Bacteria 1006
499 Ga0207694_10982735 3300025924 Bacteria 714
500 Ga0207650_10079817 3300025925 Bacteria 2479
501 Ga0207650_10196981 3300025925 Bacteria 1612
502 Ga0207650_10203115 3300025925 Bacteria 1588
503 Ga0207650_10210188 3300025925 Bacteria 1562
504 Ga0207650_11284864 3300025925 Unclassified 623
505 Ga0207650_11516181 3300025925 Bacteria 570
506 Ga0207659_10027966 3300025926 Bacteria 3825
507 Ga0207659_10036324 3300025926 Bacteria 3412
508 Ga0207659_10662271 3300025926 Bacteria 893
509 Ga0207687_10002891 3300025927 Bacteria 11663
510 Ga0207687_10170079 3300025927 Bacteria 1680
511 Ga0207687_10224223 3300025927 Bacteria 1482
512 Ga0207687_10376736 3300025927 Bacteria 1162
513 Ga0207687_10547113 3300025927 Bacteria 971
514 Ga0207700_10000099 3300025928 Bacteria 53179
515 Ga0207700_10031130 3300025928 Bacteria 3787
516 Ga0207700_10051938 3300025928 Bacteria 3063
517 Ga0207664_10002486 3300025929 Bacteria 12199
518 Ga0207644_10004698 3300025931 Bacteria 8874
519 Ga0207644_10009912 3300025931 Bacteria 6268
520 Ga0207644_10049097 3300025931 Bacteria 3019
521 Ga0207644_10166745 3300025931 Bacteria 1716
522 Ga0207690_10131805 3300025932 Bacteria 1830
523 Ga0207690_10406579 3300025932 Bacteria 1086
524 Ga0207690_10474155 3300025932 Bacteria 1009
525 Ga0207706_10029707 3300025933 Bacteria 4878
526 Ga0207706_10040580 3300025933 Bacteria 4125
527 Ga0207706_10098770 3300025933 Bacteria 2568
528 Ga0207706_10145093 3300025933 Bacteria 2088
529 Ga0207706_10326444 3300025933 Bacteria 1335
530 Ga0207706_10564523 3300025933 Bacteria 979
531 Ga0207706_11010902 3300025933 Bacteria 698
532 Ga0207686_10000488 3300025934 Bacteria 26043
533 Ga0207686_10165660 3300025934 Bacteria 1554
534 Ga0207686_10374764 3300025934 Bacteria 1078
535 Ga0207686_10653210 3300025934 Bacteria 832
536 Ga0207709_10003546 3300025935 Bacteria 9232
537 Ga0207670_10037772 3300025936 Bacteria 3149
538 Ga0207670_10195194 3300025936 Bacteria 1534
539 Ga0207670_10256476 3300025936 Bacteria 1354
540 Ga0207670_11144842 3300025936 Bacteria 658
541 Ga0207669_10085486 3300025937 Bacteria 2036
542 Ga0207669_10088399 3300025937 Bacteria 2009
543 Ga0207669_10354658 3300025937 Bacteria 1134
544 Ga0207669_10695343 3300025937 Bacteria 835
545 Ga0207669_11048761 3300025937 Bacteria 687
546 Ga0207704_10407710 3300025938 Bacteria 1074
547 Ga0207704_10656940 3300025938 Bacteria 864
548 Ga0207665_10008468 3300025939 Bacteria 6776
549 Ga0207665_10048319 3300025939 Bacteria 2856
550 Ga0207665_10129285 3300025939 Bacteria 1791
551 Ga0207691_10000367 3300025940 Bacteria 45445
552 Ga0207691_10080128 3300025940 Bacteria 2937
553 Ga0207691_10170606 3300025940 Bacteria 1905
554 Ga0207691_10245380 3300025940 Bacteria 1547
555 Ga0207691_10305182 3300025940 Bacteria 1367
556 Ga0207691_10517493 3300025940 Bacteria 1013
557 Ga0207711_10001033 3300025941 Bacteria 26678
558 Ga0207711_10144793 3300025941 Bacteria 2140
559 Ga0207711_10215806 3300025941 Bacteria 1753
560 Ga0207711_10332300 3300025941 Bacteria 1406
561 Ga0207689_10001526 3300025942 Bacteria 22022
562 Ga0207689_10080987 3300025942 Bacteria 2669
563 Ga0207689_10089949 3300025942 Bacteria 2522
564 Ga0207689_10090458 3300025942 Bacteria 2515
565 Ga0207689_10284134 3300025942 Bacteria 1370
566 Ga0207661_10624998 3300025944 Bacteria 989
567 Ga0207661_10789797 3300025944 Bacteria 874
568 Ga0207661_11387302 3300025944 Bacteria 645
569 Ga0207679_10178247 3300025945 Bacteria 1756
570 Ga0207679_10750990 3300025945 Bacteria 887
571 Ga0207679_11428312 3300025945 Bacteria 635
572 Ga0207667_10243928 3300025949 Bacteria 1838
573 Ga0207651_10001584 3300025960 Bacteria 10419
574 Ga0207651_10003957 3300025960 Bacteria 7358
575 Ga0207651_10629223 3300025960 Bacteria 940
576 Ga0207651_10728505 3300025960 Bacteria 875
577 Ga0207712_10366705 3300025961 Bacteria 1201
578 Ga0207668_10026322 3300025972 Bacteria 3775
579 Ga0207668_10064287 3300025972 Bacteria 2592
580 Ga0207668_10140898 3300025972 Bacteria 1854
581 Ga0207668_10338096 3300025972 Bacteria 1255
582 Ga0207668_10371735 3300025972 Bacteria 1201
583 Ga0207640_10039707 3300025981 Bacteria 2981
584 Ga0207640_10052298 3300025981 Bacteria 2660
585 Ga0207658_10041343 3300025986 Bacteria 3337
586 Ga0207658_10052812 3300025986 Bacteria 3000
587 Ga0207658_10121457 3300025986 Bacteria 2084
588 Ga0207658_10125323 3300025986 Bacteria 2054
589 Ga0207658_10243630 3300025986 Bacteria 1524
590 Ga0207658_10401217 3300025986 Bacteria 1205
591 Ga0207658_10688705 3300025986 Bacteria 923
592 Ga0207677_10002051 3300026023 Bacteria 10615
593 Ga0207677_10045023 3300026023 Bacteria 2945
594 Ga0207677_10062363 3300026023 Bacteria 2585
595 Ga0207677_10097557 3300026023 Bacteria 2153
596 Ga0207677_10231540 3300026023 Bacteria 1489
597 Ga0207677_10296131 3300026023 Bacteria 1335
598 Ga0207677_10449756 3300026023 Bacteria 1103
599 Ga0207677_10640560 3300026023 Bacteria 937
600 Ga0207677_10644287 3300026023 Bacteria 934
601 Ga0207703_10001709 3300026035 Bacteria 19718
602 Ga0207703_10004881 3300026035 Bacteria 10902
603 Ga0207703_10250399 3300026035 Bacteria 1596
604 Ga0207703_10592930 3300026035 Bacteria 1048
605 Ga0207703_10974247 3300026035 Bacteria 813
606 Ga0207703_11160505 3300026035 Bacteria 742
607 Ga0207639_10016008 3300026041 Bacteria 5296
608 Ga0207639_10030737 3300026041 Bacteria 3941
609 Ga0207639_10243640 3300026041 Bacteria 1564
610 Ga0207639_10259421 3300026041 Bacteria 1519
611 Ga0207678_10039057 3300026067 Bacteria 4121
612 Ga0207678_10179040 3300026067 Bacteria 1810
613 Ga0207678_10223448 3300026067 Bacteria 1612
614 Ga0207678_10261753 3300026067 Bacteria 1482
615 Ga0207702_10335483 3300026078 Bacteria 1443
616 Ga0207702_10796015 3300026078 Bacteria 934
617 Ga0207641_10007244 3300026088 Bacteria 9243
618 Ga0207641_10014486 3300026088 Bacteria 6461
619 Ga0207641_10033425 3300026088 Bacteria 4273
620 Ga0207641_10074117 3300026088 Bacteria 2935
621 Ga0207641_10352461 3300026088 Bacteria 1403
622 Ga0207648_10023103 3300026089 Bacteria 5578
623 Ga0207648_10036862 3300026089 Bacteria 4307
624 Ga0207648_10059692 3300026089 Bacteria 3326
625 Ga0207648_10208856 3300026089 Bacteria 1733
626 Ga0207648_10722118 3300026089 Bacteria 924
627 Ga0207676_10000174 3300026095 Bacteria 56439
628 Ga0207676_10000548 3300026095 Bacteria 31359
629 Ga0207676_10014818 3300026095 Bacteria 5617
630 Ga0207676_10050997 3300026095 Bacteria 3229
631 Ga0207676_10162303 3300026095 Bacteria 1937
632 Ga0207676_10588374 3300026095 Bacteria 1067
633 Ga0207676_11299082 3300026095 Bacteria 722
634 Ga0207674_10018138 3300026116 Bacteria 7657
635 Ga0207674_10065150 3300026116 Bacteria 3674
636 Ga0207674_10551097 3300026116 Bacteria 1114
637 Ga0207675_100001059 3300026118 Bacteria 27297
638 Ga0207675_100028790 3300026118 Bacteria 5175
639 Ga0207675_100029308 3300026118 Bacteria 5129
640 Ga0207675_100274530 3300026118 Bacteria 1637
641 Ga0207683_10000246 3300026121 Bacteria 48193
642 Ga0207683_10017870 3300026121 Bacteria 6048
643 Ga0207683_10023679 3300026121 Bacteria 5282
644 Ga0207683_10051897 3300026121 Bacteria 3593
645 Ga0207683_10691031 3300026121 Bacteria 946
646 Ga0207683_11262684 3300026121 Bacteria 684
647 Ga0207698_10046357 3300026142 Bacteria 3282
648 Ga0207698_10147975 3300026142 Bacteria 2034
649 Ga0207698_10284124 3300026142 Bacteria 1532
650 Ga0207698_10662793 3300026142 Bacteria 1035
651 Ga0209179_1070318 3300027512 Bacteria 766
652 Ga0209999_1049327 3300027543 Bacteria 794
653 Ga0209588_1003394 3300027671 Bacteria 4416
654 Ga0209588_1065024 3300027671 Bacteria 1179
655 Ga0209588_1096392 3300027671 Bacteria 953
656 Ga0207428_10002514 3300027907 Bacteria 18299
657 Ga0268266_10006669 3300028379 Bacteria 10534
658 Ga0268266_10008065 3300028379 Bacteria 9410
659 Ga0268266_10008592 3300028379 Bacteria 9072
660 Ga0268266_10231835 3300028379 Bacteria 1701
661 Ga0268266_10370436 3300028379 Bacteria 1349
662 Ga0268265_10060666 3300028380 Bacteria 2899
663 Ga0268265_10099483 3300028380 Bacteria 2345
664 Ga0268264_10021756 3300028381 Bacteria 5234
665 Ga0268264_10037732 3300028381 Bacteria 3985
666 Ga0268264_10059516 3300028381 Bacteria 3200
667 Ga0268264_10424362 3300028381 Bacteria 1283
668 Ga0268264_10481944 3300028381 Bacteria 1207
669 Ga0268264_10646841 3300028381 Bacteria 1046
670 Ga0268264_11869806 3300028381 Bacteria 610
671 Ga0265318_10050404 3300028577 Bacteria 1564
672 Ga0265318_10149264 3300028577 Bacteria 858
673 Ga0265332_10000293 3300031238 Bacteria 39227
674 Ga0265332_10133399 3300031238 Bacteria 1041
675 Ga0265328_10003416 3300031239 Bacteria 7015
676 Ga0265320_10021332 3300031240 Bacteria 3488
677 Ga0265325_10011509 3300031241 Bacteria 5082
678 Ga0265329_10015880 3300031242 Bacteria 2620
679 Ga0265329_10019337 3300031242 Bacteria 2314
680 Ga0265339_10034852 3300031249 Bacteria 2827
681 Ga0265339_10080478 3300031249 Bacteria 1723
682 Ga0265331_10000348 3300031250 Bacteria 49051
683 Ga0265331_10004434 3300031250 Bacteria 8766
684 Ga0265327_10128619 3300031251 Bacteria 1193
685 Ga0265316_10018947 3300031344 Bacteria 5905
686 Ga0265316_10041874 3300031344 Bacteria 3662
687 Ga0307408_100017559 3300031548 Bacteria 4789
688 Ga0265313_10044904 3300031595 Bacteria 2154
689 Ga0265314_10000245 3300031711 Bacteria 79757
690 Ga0265314_10028151 3300031711 Bacteria 4193
691 Ga0265342_10007670 3300031712 Bacteria 7860
692 Ga0307405_10069390 3300031731 Bacteria 2259
693 Ga0307413_10036789 3300031824 Bacteria 2822
694 Ga0307413_10087117 3300031824 Bacteria 2022
695 Ga0307410_10002755 3300031852 Bacteria 8598
696 Ga0307406_10013059 3300031901 Bacteria 4747
697 Ga0307407_10068837 3300031903 Bacteria 2098
698 Ga0307409_100243044 3300031995 Bacteria 1640
699 Ga0307409_100274323 3300031995 Bacteria 1555
700 Ga0307416_100014893 3300032002 Bacteria 5348
701 Ga0307416_101158796 3300032002 Bacteria 878
702 Ga0307414_10010426 3300032004 Bacteria 5391
703 Ga0307414_10235708 3300032004 Bacteria 1512
704 Ga0307414_10461762 3300032004 Bacteria 1116
705 Ga0307411_10098093 3300032005 Bacteria 2064
706 Ga0307411_10228757 3300032005 Bacteria 1448
707 Ga0307411_10262761 3300032005 Bacteria 1364
708 Ga0307415_100007490 3300032126 Bacteria 5974
709 Ga0307415_100100576 3300032126 Bacteria 2119
710 Ga0307415_100258270 3300032126 Bacteria 1420
711 Ga0307415_100646664 3300032126 Bacteria 947
712 Ga0316583_10061686 3300032133 Bacteria 1313
713 Ga0307507_10082957 3300033179 Bacteria 2806
714 Ga0307510_10402365 3300033180 Bacteria 812
715 Ga0373928_0037831 3300035084 Bacteria 1096
716 Ga0373934_0019815 3300035086 Bacteria 2584
717 Ga0373934_0022793 3300035086 Bacteria 2416
718 Ga0373951_0160852 3300035091 Bacteria 635
719 Ga0373952_0012716 3300035092 Bacteria 1660
720 Ga0373923_0001906 3300035111 Bacteria 6228
721 Ga0373923_0270828 3300035111 Bacteria 798
722 Ga0373932_0067634 3300035112 Bacteria 1100
723 Ga0373936_0060619 3300035113 Bacteria 1544
724 Ga0373939_0144472 3300035114 Bacteria 860
725 Ga0373941_0039851 3300035115 Bacteria 1446
726 Ga0373945_0152612 3300035116 Bacteria 937
727 Ga0373953_0037940 3300035117 Bacteria 1904
728 Ga0373954_0002636 3300035118 Bacteria 7548
729 Ga0373954_0003489 3300035118 Bacteria 6675
730 Ga0373954_0048171 3300035118 Bacteria 1996
731 Ga0373954_0056289 3300035118 Bacteria 1850
732 Ga0373956_0000615 3300035119 Bacteria 14591
733 Ga0373956_0199774 3300035119 Bacteria 947
734 Ga0373956_0284901 3300035119 Bacteria 786
735 Ga0373956_0454136 3300035119 Bacteria 611
736 Ga0373957_0001592 3300035120 Bacteria 6205
737 Ga0373957_0007229 3300035120 Bacteria 3545
738 Ga0373943_0220334 3300035170 Bacteria 1056
739 Ga0373943_0336008 3300035170 Unclassified 863
740 Ga0373943_0444095 3300035170 Bacteria 753
741 Ga0373946_0009606 3300035171 Bacteria 3567
742 Ga0373946_0282720 3300035171 Bacteria 817
743 Ga0373946_0419147 3300035171 Bacteria 678
744 Ga0373946_0434634 3300035171 Bacteria 666
745 Ga0373955_0055591 3300035172 Bacteria 2168
746 Ga0373955_0250107 3300035172 Bacteria 1062
747 Ga0373942_0105566 3300035207 Bacteria 865
748 Ga0373942_0296105 3300035207 Bacteria 561
749 Ga0373961_0069131 3300035241 Bacteria 1089
750 Ga0373961_0102214 3300035241 Bacteria 929
751 Ga0316574_0000854 3300035398 Bacteria 13382
752 Ga0373924_0032663 3300035410 Bacteria 2097
753 Ga0373924_0195895 3300035410 Bacteria 890
754 Ga0373931_0105884 3300035691 Bacteria 1589
755 Ga0373931_0463267 3300035691 Bacteria 812
756 Ga0373935_0196674 3300035692 Bacteria 1391
757 Ga0373935_0231964 3300035692 Bacteria 1286
758 Ga0373935_0269439 3300035692 Bacteria 1196
759 Ga0373935_0571033 3300035692 Bacteria 826
760 Ga0373927_0032781 3300035695 Bacteria 3383
761 Ga0373927_0035616 3300035695 Bacteria 3236
762 Ga0373927_0217954 3300035695 Bacteria 1254
763 Ga0373927_0343639 3300035695 Bacteria 983
764 Ga0373933_0024477 3300035724 Bacteria 3456
765 Ga0373933_0071872 3300035724 Bacteria 2107
766 Ga0373933_0190804 3300035724 Bacteria 1309
767 Ga0373933_0417170 3300035724 Bacteria 877
768 Ga0373947_0186236 3300035725 Bacteria 1353
769 Ga0373937_0001406 3300036401 Bacteria 20084
770 Ga0373937_0017208 3300036401 Bacteria 6435
771 Ga0373937_0167403 3300036401 Bacteria 2061
772 Ga0373937_0450001 3300036401 Bacteria 1223
773 Ga0373925_0124010 3300037068 Bacteria 2008
774 Ga0373925_0152252 3300037068 Bacteria 1817
775 Ga0373925_0201818 3300037068 Bacteria 1581
776 Ga0373925_0361527 3300037068 Bacteria 1180
777 Ga0395900_0088037 3300037418 Bacteria 3192
778 Ga0395900_0147511 3300037418 Bacteria 2405
779 Ga0395905_1021611 3300037471 Bacteria 730
780 Ga0395901_0180064 3300038443 Bacteria 2217
781 Ga0395901_0449952 3300038443 Bacteria 1317
782 Ga0242420_013094 3300038996 Bacteria 1410
783 Ga0436365_1097290 3300039437 Bacteria 961
784 Ga0436360_1169165 3300039438 Bacteria 624
785 Ga0439436_0128967 3300041404 Bacteria 709
786 Ga0451843_0690997 3300041509 Bacteria 848
787 Ga0439448_0120657 3300042005 Bacteria 900
788 Ga0439432_076975 3300042006 Bacteria 1013
789 Ga0439434_0067858 3300042435 Bacteria 1120
790 Ga0451577_0317631 3300042876 Bacteria 1412
791 Ga0466972_0000070 3300044658 Bacteria 100242
792 Ga0453683_0125552 3300044673 Bacteria 1616
793 Ga0453683_0497285 3300044673 Bacteria 791
794 Ga0466964_0108427 3300044706 Bacteria 1235
795 Ga0453684_0426012 3300044712 Bacteria 1481
796 Ga0453684_0637922 3300044712 Bacteria 1164
797 Ga0453684_0792130 3300044712 Bacteria 1023
798 Ga0451576_0342806 3300045051 Bacteria 1564
799 Ga0466967_1056839 3300045976 Bacteria 809
800 Ga0495592_0005285 3300046454 Bacteria 9518
801 Ga0495592_0029233 3300046454 Bacteria 4173
802 Ga0495592_0110125 3300046454 Bacteria 1949
803 Ga0495592_0120496 3300046454 Bacteria 1846
804 Ga0495592_0357605 3300046454 Bacteria 934
805 Ga0495603_0232197 3300046455 Bacteria 1063
806 Ga0495629_0096580 3300046459 Bacteria 2061
807 Ga0495641_0015988 3300046461 Bacteria 3972
808 Ga0495651_0002995 3300046462 Bacteria 13035
809 Ga0495651_0010022 3300046462 Bacteria 7283
810 Ga0495651_0070933 3300046462 Bacteria 2649
811 Ga0495651_0092033 3300046462 Bacteria 2272
812 Ga0495653_0006836 3300046463 Bacteria 9370
813 Ga0495653_0259517 3300046463 Bacteria 1149
814 Ga0495653_0427796 3300046463 Bacteria 837
815 Ga0495580_0075522 3300046472 Bacteria 2351
816 Ga0495580_0086177 3300046472 Bacteria 2187
817 Ga0495580_0270829 3300046472 Bacteria 1160
818 Ga0495580_0617171 3300046472 Bacteria 715
819 Ga0495582_0060468 3300046473 Bacteria 2090
820 Ga0495639_0005155 3300046475 Bacteria 5614
821 Ga0495639_0069678 3300046475 Bacteria 1622
822 Ga0495662_0008790 3300046476 Bacteria 4967
823 Ga0495664_0146787 3300046477 Bacteria 1430
824 Ga0495664_0147593 3300046477 Bacteria 1426
825 Ga0495664_0336942 3300046477 Bacteria 909
826 Ga0495594_0060051 3300046499 Bacteria 2103
827 Ga0495607_0049730 3300046501 Bacteria 2443
828 Ga0495606_0000011 3300046507 Bacteria 296816
829 Ga0495608_0042788 3300046511 Bacteria 3028
830 Ga0495608_0080156 3300046511 Bacteria 2122
831 Ga0495608_0111859 3300046511 Bacteria 1756
832 Ga0495608_0288797 3300046511 Bacteria 1017
833 Ga0495618_0215600 3300046514 Bacteria 1212
834 Ga0495618_0508427 3300046514 Bacteria 725
835 Ga0495628_0002021 3300046516 Bacteria 18381
836 Ga0495628_0004647 3300046516 Bacteria 12116
837 Ga0495628_0020880 3300046516 Bacteria 5394
838 Ga0495628_0117806 3300046516 Bacteria 2039
839 Ga0495628_0120479 3300046516 Bacteria 2013
840 Ga0495628_0432395 3300046516 Bacteria 958
841 Ga0495628_0594943 3300046516 Bacteria 790
842 Ga0495630_0018882 3300046517 Bacteria 5068
843 Ga0495630_0039136 3300046517 Bacteria 3546
844 Ga0495630_0139652 3300046517 Bacteria 1842
845 Ga0495666_0007731 3300046526 Bacteria 5379
846 Ga0495666_0223315 3300046526 Bacteria 862
847 Ga0495652_0021112 3300046529 Bacteria 5788
848 Ga0495652_0035269 3300046529 Bacteria 4355
849 Ga0495652_0065263 3300046529 Bacteria 3059
850 Ga0495652_0069034 3300046529 Bacteria 2959
851 Ga0495652_0139381 3300046529 Bacteria 1909
852 Ga0495652_0260501 3300046529 Bacteria 1280
853 Ga0495652_0325645 3300046529 Bacteria 1108
854 Ga0495652_0346393 3300046529 Bacteria 1066
855 Ga0495665_0022228 3300046531 Bacteria 3409
856 Ga0495665_0143694 3300046531 Bacteria 1246
857 Ga0495640_0025633 3300046533 Bacteria 4273
858 Ga0495640_0068176 3300046533 Bacteria 2394
859 Ga0495586_0027285 3300046535 Bacteria 3056
860 Ga0495586_0583704 3300046535 Bacteria 645
861 Ga0495586_0647300 3300046535 Bacteria 610
862 Ga0495586_0754492 3300046535 Bacteria 561
863 Ga0495587_0050070 3300046536 Bacteria 2471
864 Ga0495587_0338538 3300046536 Bacteria 839
865 Ga0495598_0211432 3300046537 Bacteria 705
866 Ga0495621_0059231 3300046539 Bacteria 1387
867 Ga0495621_0115474 3300046539 Bacteria 1033
868 Ga0495621_0133107 3300046539 Bacteria 969
869 Ga0495621_0174986 3300046539 Bacteria 854
870 Ga0495645_0005439 3300046543 Bacteria 8741
871 Ga0495645_0017006 3300046543 Bacteria 5206
872 Ga0495645_0057856 3300046543 Bacteria 2813
873 Ga0495645_0217465 3300046543 Bacteria 1287
874 Ga0495622_0074613 3300046557 Bacteria 1564
875 Ga0495667_0113960 3300046559 Bacteria 1747
876 Ga0495667_0341704 3300046559 Bacteria 946
877 Ga0495667_0422824 3300046559 Bacteria 838
878 Ga0495634_0068620 3300046642 Bacteria 2341
879 Ga0495634_0076539 3300046642 Bacteria 2196
880 Ga0495634_0460080 3300046642 Bacteria 749
881 Ga0495635_0086714 3300046663 Bacteria 2142
882 Ga0495635_0105657 3300046663 Bacteria 1923
883 Ga0495635_0453472 3300046663 Bacteria 848
884 Ga0495659_0094401 3300046664 Bacteria 1152
885 Ga0495588_0041459 3300046674 Bacteria 2351
886 Ga0495657_0040563 3300046675 Bacteria 3192
887 Ga0495657_0068721 3300046675 Bacteria 2320
888 Ga0495657_0085760 3300046675 Bacteria 2029
889 Ga0495657_0537611 3300046675 Bacteria 679
890 Ga0495657_0558572 3300046675 Bacteria 664
891 Ga0495599_0002888 3300046678 Bacteria 9995
892 Ga0495599_0026654 3300046678 Bacteria 3623
893 Ga0495599_0149340 3300046678 Bacteria 1448
894 Ga0495623_0047566 3300046679 Bacteria 2723
895 Ga0495623_0631191 3300046679 Bacteria 554
896 Ga0495646_0014979 3300046680 Bacteria 4926
897 Ga0495647_0002471 3300046681 Bacteria 5840
898 Ga0495647_0008547 3300046681 Bacteria 3444
899 Ga0495658_0044428 3300046683 Bacteria 2489
900 Ga0495658_0122548 3300046683 Bacteria 1574
901 Ga0495658_0814862 3300046683 Bacteria 597
902 Ga0495669_0205120 3300046684 Bacteria 943
903 Ga0495613_0018189 3300046689 Bacteria 5239
904 Ga0495624_0104714 3300046690 Bacteria 1741
905 Ga0495600_0000916 3300046809 Bacteria 15803
906 Ga0495581_0009710 3300047315 Bacteria 5570
907 Ga0495604_0042840 3300047317 Bacteria 3545
908 Ga0495604_0085018 3300047317 Bacteria 2361
909 Ga0495604_0398243 3300047317 Bacteria 907
910 Ga0495636_0003634 3300047318 Bacteria 5988
911 Ga0495680_0070233 3300047322 Bacteria 2671
912 Ga0495680_0631761 3300047322 Bacteria 713
913 Ga0495680_0631773 3300047322 Bacteria 713
914 Ga0495675_0012907 3300047444 Bacteria 5264
915 Ga0495675_0147540 3300047444 Bacteria 1455
916 Ga0495675_0467693 3300047444 Bacteria 727
917 Ga0495684_0041075 3300047471 Bacteria 3545
918 Ga0495686_0000248 3300047472 Bacteria 97017
919 Ga0495686_0044312 3300047472 Bacteria 2816
920 Ga0495593_0052595 3300047673 Bacteria 2152
921 Ga0495602_0078562 3300048088 Bacteria 2787
922 Ga0495602_0539921 3300048088 Bacteria 809
923 Ga0495602_0788261 3300048088 Bacteria 639
924 Ga0495614_0047249 3300048089 Bacteria 1846
925 Ga0496100_0203137 3300048903 Bacteria 1445
926 Ga0496101_0089547 3300048904 Bacteria 2287
927 Ga0496101_0419498 3300048904 Bacteria 1055
928 Ga0496102_0958535 3300048905 Bacteria 776
929 Ga0496102_1080148 3300048905 Bacteria 722
930 Ga0496102_1575481 3300048905 Bacteria 575
931 Ga0496103_0469964 3300048906 Bacteria 806
932 Ga0496104_0009650 3300048907 Bacteria 8596
933 Ga0496104_0210310 3300048907 Bacteria 1857
934 Ga0496105_0102103 3300048908 Bacteria 2368
935 Ga0496106_0272991 3300048909 Bacteria 1354
936 Ga0496106_0898634 3300048909 Bacteria 699
937 Ga0496107_0155182 3300048910 Bacteria 1695
938 Ga0496107_0349298 3300048910 Bacteria 1101
939 Ga0496107_0501178 3300048910 Bacteria 901
940 Ga0496107_1001937 3300048910 Bacteria 606
941 Ga0496108_0013970 3300048911 Bacteria 6550
942 Ga0496108_0187926 3300048911 Bacteria 1790
943 Ga0496108_0520627 3300048911 Bacteria 1038
944 Ga0496109_0011013 3300048912 Bacteria 7751
945 Ga0496109_0085357 3300048912 Bacteria 2914
946 Ga0496110_0595808 3300048913 Bacteria 1003
947 Ga0496110_0837121 3300048913 Bacteria 825
948 Ga0496110_1292361 3300048913 Bacteria 639
949 Ga0496110_1470886 3300048913 Unclassified 591
950 Ga0496111_0091997 3300048914 Bacteria 2223
951 Ga0496111_0484431 3300048914 Bacteria 911
952 Ga0496112_0005841 3300048915 Bacteria 10715
953 Ga0496112_0014201 3300048915 Bacteria 7381
954 Ga0496112_0234806 3300048915 Bacteria 1788
955 Ga0496112_0394210 3300048915 Bacteria 1325
956 Ga0496113_0298344 3300048916 Bacteria 1290
957 Ga0496113_0401697 3300048916 Bacteria 1100
958 Ga0496114_0012661 3300048917 Bacteria 6756
959 Ga0496114_0022120 3300048917 Bacteria 5179
960 Ga0496114_0022604 3300048917 Bacteria 5126
961 Ga0496114_0659150 3300048917 Bacteria 920
962 Ga0496114_1431973 3300048917 Unclassified 578
963 Ga0496115_0179858 3300048918 Bacteria 1749
964 Ga0496115_0248852 3300048918 Bacteria 1464
965 Ga0496115_0602332 3300048918 Bacteria 873
966 Ga0496124_0485288 3300048927 Bacteria 833
967 Ga0501298_033786 3300049521 Bacteria 1015
968 Ga0501031_0045354 3300049568 Bacteria 2868
969 Ga0501031_0070945 3300049568 Bacteria 2269
970 Ga0501032_0001741 3300049569 Bacteria 17208
971 Ga0501032_0023567 3300049569 Bacteria 4249
972 Ga0501032_0131161 3300049569 Bacteria 1653
973 Ga0501032_0729344 3300049569 Unclassified 627
974 Ga0501033_0000364 3300049570 Bacteria 43293
975 Ga0501033_0005262 3300049570 Bacteria 10267
976 Ga0501033_0010897 3300049570 Bacteria 6970
977 Ga0501033_0211631 3300049570 Bacteria 1382
978 Ga0501033_0775504 3300049570 Bacteria 649
979 Ga0501034_0005376 3300049571 Bacteria 14011
980 Ga0501034_0012071 3300049571 Bacteria 8931
981 Ga0501034_0138359 3300049571 Bacteria 2415
982 Ga0501036_0004793 3300049572 Bacteria 10935
983 Ga0501036_0006729 3300049572 Bacteria 9343
984 Ga0501036_0044802 3300049572 Bacteria 3748
985 Ga0501036_0117508 3300049572 Bacteria 2246
986 Ga0501036_0139132 3300049572 Bacteria 2049
987 Ga0501036_1081035 3300049572 Bacteria 655
988 Ga0501037_0000162 3300049573 Bacteria 62629
989 Ga0501037_0037962 3300049573 Bacteria 3551
990 Ga0501037_0124832 3300049573 Bacteria 1849
991 Ga0501037_0323169 3300049573 Bacteria 1068
992 Ga0501038_0003864 3300049574 Bacteria 13921
993 Ga0501038_0008423 3300049574 Bacteria 9485
994 Ga0501038_0071876 3300049574 Bacteria 2933
995 Ga0501038_0103831 3300049574 Bacteria 2363
996 Ga0501038_0124809 3300049574 Bacteria 2120
997 Ga0501038_0190761 3300049574 Bacteria 1649
998 Ga0501038_0232637 3300049574 Bacteria 1466
999 Ga0501038_0743440 3300049574 Bacteria 732
1000 Ga0501039_0003351 3300049575 Bacteria 11972
1001 Ga0501039_0008184 3300049575 Bacteria 7972
1002 Ga0501039_0035202 3300049575 Bacteria 3863
1003 Ga0501039_0046891 3300049575 Bacteria 3339
1004 Ga0501039_0199951 3300049575 Bacteria 1571
1005 Ga0501039_0215832 3300049575 Bacteria 1508
1006 Ga0501039_0595776 3300049575 Bacteria 866
1007 Ga0501040_0003740 3300049576 Bacteria 9860
1008 Ga0501040_0009844 3300049576 Bacteria 6242
1009 Ga0501040_0092397 3300049576 Bacteria 2104
1010 Ga0501040_0097200 3300049576 Bacteria 2051
1011 Ga0501041_0222845 3300049577 Bacteria 1183
1012 Ga0501041_0394962 3300049577 Bacteria 876
1013 Ga0501042_0000536 3300049578 Bacteria 19889
1014 Ga0501042_0018299 3300049578 Bacteria 4849
1015 Ga0501042_0196429 3300049578 Bacteria 1455
1016 Ga0501042_0342215 3300049578 Bacteria 1081
1017 Ga0501043_0022331 3300049579 Bacteria 4964
1018 Ga0501043_0060318 3300049579 Bacteria 2977
1019 Ga0501043_0224156 3300049579 Bacteria 1453
1020 Ga0501043_0245920 3300049579 Bacteria 1379
1021 Ga0501043_0304519 3300049579 Bacteria 1217
1022 Ga0501043_0362633 3300049579 Bacteria 1100
1023 Ga0501043_0419990 3300049579 Bacteria 1008
1024 Ga0501046_0026489 3300049580 Bacteria 4736
1025 Ga0501046_0068985 3300049580 Bacteria 2751
1026 Ga0501046_0101642 3300049580 Bacteria 2205
1027 Ga0501048_0008305 3300049582 Bacteria 7851
1028 Ga0501048_0056461 3300049582 Bacteria 2785
1029 Ga0501048_0119705 3300049582 Bacteria 1860
1030 Ga0501067_0213849 3300049583 Bacteria 1074
1031 Ga0501067_0597602 3300049583 Bacteria 619
1032 Ga0501068_0018157 3300049584 Bacteria 4072
1033 Ga0501068_0158079 3300049584 Bacteria 1428
1034 Ga0501068_0275918 3300049584 Bacteria 1074
1035 Ga0501068_0530611 3300049584 Bacteria 764
1036 Ga0501069_0719078 3300049585 Bacteria 603
1037 Ga0501071_0013396 3300049587 Bacteria 5587
1038 Ga0501071_0050832 3300049587 Bacteria 2986
1039 Ga0501071_0435034 3300049587 Bacteria 1003
1040 Ga0501072_0001399 3300049588 Bacteria 18156
1041 Ga0501072_0091526 3300049588 Bacteria 2415
1042 Ga0501072_0179258 3300049588 Bacteria 1690
1043 Ga0501072_0192537 3300049588 Bacteria 1626
1044 Ga0501072_0480728 3300049588 Bacteria 983
1045 Ga0501072_0750219 3300049588 Bacteria 766
1046 Ga0501073_0359056 3300049589 Bacteria 1006
1047 Ga0501074_0214122 3300049590 Bacteria 1372
1048 Ga0501074_0732549 3300049590 Bacteria 697
1049 Ga0501075_0010270 3300049591 Bacteria 6578
1050 Ga0501075_0023115 3300049591 Bacteria 4549
1051 Ga0501075_0239449 3300049591 Bacteria 1383
1052 Ga0501076_0012795 3300049592 Bacteria 6282
1053 Ga0501076_0014474 3300049592 Bacteria 5943
1054 Ga0501076_0019562 3300049592 Bacteria 5177
1055 Ga0501076_0342384 3300049592 Bacteria 1227
1056 Ga0501077_0011579 3300049593 Bacteria 5511
1057 Ga0501077_0108178 3300049593 Bacteria 1761
1058 Ga0501077_0163235 3300049593 Bacteria 1414
1059 Ga0501235_195656 3300049669 Bacteria 545
1060 Ga0501250_071032 3300049680 Bacteria 575
1061 Ga0501079_0004210 3300049741 Bacteria 10672
1062 Ga0501079_0077016 3300049741 Bacteria 2580
1063 Ga0501079_0390417 3300049741 Bacteria 1091
1064 Ga0501079_1381767 3300049741 Bacteria 554
1065 Ga0501080_0006958 3300049742 Bacteria 10203
1066 Ga0501080_0219411 3300049742 Bacteria 1741
1067 Ga0501080_0299631 3300049742 Bacteria 1458
1068 Ga0501081_0000465 3300049743 Bacteria 22458
1069 Ga0501081_0012671 3300049743 Bacteria 5544
1070 Ga0501081_0272525 3300049743 Bacteria 1238
1071 Ga0501081_0396329 3300049743 Bacteria 1022
1072 Ga0501083_0686660 3300049744 Bacteria 666
1073 Ga0501035_0005055 3300049822 Bacteria 12496
1074 Ga0501035_0010038 3300049822 Bacteria 8787
1075 Ga0501035_0025464 3300049822 Bacteria 5424
1076 Ga0501035_0060352 3300049822 Bacteria 3376
1077 Ga0501035_0084580 3300049822 Bacteria 2797
1078 Ga0501035_0093559 3300049822 Bacteria 2644
1079 Ga0501035_0137626 3300049822 Bacteria 2125
1080 Ga0501035_0147964 3300049822 Bacteria 2039
1081 Ga0501035_0161001 3300049822 Bacteria 1942
1082 Ga0501035_0274206 3300049822 Bacteria 1427
1083 Ga0501044_0000076 3300049823 Bacteria 120755
1084 Ga0501044_0001481 3300049823 Bacteria 27531
1085 Ga0501044_0003222 3300049823 Bacteria 18385
1086 Ga0501044_0012028 3300049823 Bacteria 9376
1087 Ga0501044_0043973 3300049823 Bacteria 4638
1088 Ga0501044_0269938 3300049823 Bacteria 1637
1089 Ga0501044_1011639 3300049823 Bacteria 703
1090 Ga0501045_0003218 3300049824 Bacteria 11170
1091 Ga0501045_0041989 3300049824 Bacteria 3328
1092 Ga0501045_0066885 3300049824 Bacteria 2638
1093 Ga0501045_0094485 3300049824 Bacteria 2211
1094 Ga0501045_0259793 3300049824 Bacteria 1292
1095 nmdc:mga05p37_529398_c1 3300050507 Bacteria 1346
1096 nmdc:mga05p37_732932_c1 3300050507 Bacteria 1092
1097 nmdc:mga09592_276772_c1 3300050508 Bacteria 1456
1098 nmdc:mga09592_538283_c1 3300050508 Bacteria 1004
1099 nmdc:mga0qj67_123797_c1 3300050509 Bacteria 2092
1100 nmdc:mga0qj67_549125_c1 3300050509 Bacteria 927
1101 nmdc:mga0qj67_6850_c1 3300050509 Bacteria 8379
1102 nmdc:mga0qj67_983108_c1 3300050509 Bacteria 663
1103 nmdc:mga06r32_1014_c1 3300050510 Bacteria 25210
1104 nmdc:mga06r32_308880_c1 3300050510 Bacteria 1567
1105 nmdc:mga08y16_176151_c1 3300050511 Bacteria 2221
1106 nmdc:mga08y16_19726_c1 3300050511 Bacteria 7109
1107 nmdc:mga08y16_3419_c1 3300050511 Bacteria 16470
1108 nmdc:mga0n895_163087_c1 3300050512 Bacteria 2260
1109 nmdc:mga0n895_367_c1 3300050512 Bacteria 30485
1110 nmdc:mga0n895_438924_c1 3300050512 Bacteria 1319
1111 nmdc:mga0rr50_148782_c1 3300050513 Bacteria 1890
1112 nmdc:mga0rr50_152767_c1 3300050513 Bacteria 1867
1113 nmdc:mga0rr50_158280_c1 3300050513 Bacteria 1836
1114 nmdc:mga0rr50_224730_c1 3300050513 Bacteria 1551
1115 nmdc:mga0rr50_244584_c1 3300050513 Bacteria 1488
1116 nmdc:mga0rr50_97397_c2 3300050513 Bacteria 1268
1117 nmdc:mga08x19_1118_c1 3300050514 Bacteria 16743
1118 nmdc:mga08x19_148673_c1 3300050514 Bacteria 1585
1119 nmdc:mga08x19_221693_c1 3300050514 Bacteria 1299
1120 nmdc:mga08x19_58041_c1 3300050514 Bacteria 2503
1121 nmdc:mga08x19_5900_c1 3300050514 Bacteria 7244
1122 nmdc:mga0a205_132541_c2 3300050515 Bacteria 777
1123 nmdc:mga0a205_363219_c1 3300050515 Bacteria 1314
1124 Ga0495601_0030722 3300053077 Bacteria 3337
1125 Ga0495601_0045721 3300053077 Bacteria 2754
1126 Ga0495601_0167414 3300053077 Bacteria 1436
1127 Ga0495601_0292879 3300053077 Bacteria 1061
1128 Ga0495612_0063075 3300053078 Bacteria 1537
1129 Ga0495612_0073781 3300053078 Bacteria 1426
1130 Ga0495595_0355333 3300053084 Bacteria 740
1131 Ga0495595_0370250 3300053084 Bacteria 724
1132 Ga0495595_0547639 3300053084 Bacteria 591
1133 Ga0495619_0008666 3300053085 Bacteria 6435
1134 Ga0495619_0087963 3300053085 Bacteria 2101
1135 Ga0495619_0267178 3300053085 Bacteria 1185
1136 Ga0500595_012640 3300053119 Bacteria 3257
1137 Ga0500574_009516 3300053141 Bacteria 2114
1138 Ga0501084_0021829 3300054114 Bacteria 5340
1139 Ga0501084_0410960 3300054114 Bacteria 1144
1140 Ga0501084_0599129 3300054114 Bacteria 931
1141 Ga0501082_0004016 3300060353 Bacteria 12841
1142 Ga0501082_0033898 3300060353 Bacteria 4404
1143 Ga0501082_0040072 3300060353 Bacteria 4041
1144 Ga0530510_0000170 3300061734 Bacteria 39521
1145 Ga0530510_0004733 3300061734 Bacteria 9418
1146 Ga0530510_1171410 3300061734 Bacteria 589
1147 2644028971 2643221603 Bacteria 6147767
1148 2723877061 2721755763 Bacteria 4464185
1149 2819540664 2818991436 Bacteria 5376622
1150 Ga0495674_0202516
1151 JGI24034J26672_10025931
1152 JGI25162J39368_1000001
1153 JGI25164J39214_1007850
1154 JGI25165J46597_1000001
1155 Ga0055538_1000001
1156 Ga0055539_1000001
1157 Ga0055533_1000003
1158 Ga0055525_1000003
1159 Ga0055541_1000001
1160 Ga0065715_10561781
1161 Ga0070676_10000072
1162 Ga0070676_10149977
1163 Ga0070683_100161839
1164 Ga0070683_101074175
1165 Ga0070690_100002867
1166 Ga0070690_100074179
1167 Ga0070690_100315672
1168 Ga0070690_101056408
1169 Ga0070690_101201813
1170 Ga0070670_100096413
1171 Ga0070670_100117661
1172 Ga0070670_100262774
1173 Ga0070670_101264614
1174 Ga0070670_101885225
1175 Ga0070677_10000170
1176 Ga0068869_100012083
1177 Ga0068869_100013977
1178 Ga0068869_100153654
1179 Ga0068869_100338471
1180 Ga0068869_101347236
1181 Ga0068869_101394355
1182 Ga0070666_10006410
1183 Ga0070666_10007649
1184 Ga0070666_10647812
1185 Ga0070680_100124951
1186 Ga0070680_100249515
1187 Ga0070682_100105552
1188 Ga0070682_100289267
1189 Ga0068868_100027054
1190 Ga0068868_100117644
1191 Ga0068868_100297177
1192 Ga0068868_100452445
1193 Ga0070660_100025820
1194 Ga0070660_100381078
1195 Ga0070660_101249062
1196 Ga0070689_100054677
1197 Ga0070689_100066936
1198 Ga0070689_101310609
1199 Ga0070691_10207235
1200 Ga0070687_100021059
1201 Ga0070687_100241755
1202 Ga0070661_100219671
1203 Ga0070661_100707818
1204 Ga0070692_10080451
1205 Ga0070692_10461690
1206 Ga0070692_10473969
1207 Ga0070668_100035176
1208 Ga0070668_100404266
1209 Ga0070668_100795725
1210 Ga0070669_100039846
1211 Ga0070669_100137721
1212 Ga0070669_100408258
1213 Ga0070669_100420649
1214 Ga0070675_100000543
1215 Ga0070671_100020291
1216 Ga0070671_100027112
1217 Ga0070671_100054157
1218 Ga0070671_100163977
1219 Ga0070671_100187344
1220 Ga0070671_100346000
1221 Ga0070671_101440471
1222 Ga0070674_100002257
1223 Ga0070674_100075380
1224 Ga0070674_100078199
1225 Ga0070673_100000251
1226 Ga0070673_100009977
1227 Ga0070673_100396102
1228 Ga0070673_100937619
1229 Ga0070673_101253684
1230 Ga0070688_100001386
1231 Ga0070688_100224327
1232 Ga0070659_100040641
1233 Ga0070659_100073192
1234 Ga0070659_100298389
1235 Ga0070667_100065246
1236 Ga0070667_100078305
1237 Ga0070667_100184789
1238 Ga0070667_100214808
1239 Ga0070667_100369281
1240 Ga0070667_100620974
1241 Ga0070667_101086518
1242 Ga0070667_101163169
1243 Ga0070709_10143754
1244 Ga0070714_100199160
1245 Ga0070713_100000033
1246 Ga0070713_100020841
1247 Ga0070713_100023278
1248 Ga0070710_10162844
1249 Ga0070701_10081040
1250 Ga0070701_10159993
1251 Ga0070711_100011100
1252 Ga0070711_100119878
1253 Ga0070705_100013604
1254 Ga0070705_100036353
1255 Ga0070705_100108366
1256 Ga0070705_100153212
1257 Ga0070705_100302450
1258 Ga0070700_100001013
1259 Ga0070700_100513667
1260 Ga0070694_100007797
1261 Ga0070694_100011859
1262 Ga0070694_100025031
1263 Ga0070694_100035603
1264 Ga0070694_100329843
1265 Ga0070694_100362435
1266 Ga0070708_100021761
1267 Ga0070708_100271852
1268 Ga0070708_100555468
1269 Ga0070663_100198342
1270 Ga0070663_100277780
1271 Ga0070663_100489892
1272 Ga0070663_100905767
1273 Ga0070663_101637777
1274 Ga0070678_100014041
1275 Ga0070678_100105868
1276 Ga0070678_100292288
1277 Ga0070678_100327823
1278 Ga0070678_100601781
1279 Ga0070678_101065516
1280 Ga0070662_100045566
1281 Ga0070662_100073181
1282 Ga0070662_100077812
1283 Ga0070662_100099536
1284 Ga0070662_100428966
1285 Ga0070681_10013221
1286 Ga0070681_10014534
1287 Ga0070681_10178920
1288 Ga0068867_100087960
1289 Ga0068867_100168931
1290 Ga0068867_101001466
1291 Ga0068867_101489589
1292 Ga0070685_10001553
1293 Ga0070685_10135317
1294 Ga0070706_100005369
1295 Ga0070706_100201743
1296 Ga0070706_100229256
1297 Ga0070706_100243274
1298 Ga0070707_100031454
1299 Ga0070707_100099482
1300 Ga0070707_100689745
1301 Ga0070698_100111856
1302 Ga0070698_100118004
1303 Ga0070698_100344771
1304 Ga0070699_100009169
1305 Ga0070699_100191200
1306 Ga0070699_100530270
1307 Ga0070699_100618637
1308 Ga0070699_100698845
1309 Ga0070679_100072479
1310 Ga0070679_100128718
1311 Ga0070679_100262530
1312 Ga0070697_100002415
1313 Ga0070697_100014086
1314 Ga0070697_100063553
1315 Ga0070697_100089287
1316 Ga0070697_100242523
1317 Ga0070697_100452401
1318 Ga0070697_101109239
1319 Ga0068853_100004519
1320 Ga0068853_100047075
1321 Ga0068853_100082344
1322 Ga0068853_100436885
1323 Ga0068853_100811959
1324 Ga0070672_100000757
1325 Ga0070672_100121871
1326 Ga0070672_100697281
1327 Ga0070672_101348160
1328 Ga0070686_100095690
1329 Ga0070686_100461823
1330 Ga0070686_100823400
1331 Ga0070695_100095580
1332 Ga0070695_101158210
1333 Ga0070695_101396607
1334 Ga0070696_100024455
1335 Ga0070696_100051826
1336 Ga0070696_100250352
1337 Ga0070696_100318204
1338 Ga0070696_100380670
1339 Ga0070696_100431838
1340 Ga0070693_100034357
1341 Ga0070693_100081645
1342 Ga0070693_100194827
1343 Ga0070665_100002227
1344 Ga0070665_100004533
1345 Ga0070665_100034082
1346 Ga0070665_100235316
1347 Ga0070665_100686800
1348 Ga0070665_101355487
1349 Ga0070704_100044797
1350 Ga0070704_100127247
1351 Ga0070704_100173908
1352 Ga0070704_100198723
1353 Ga0070704_100226850
1354 Ga0070704_101262934
1355 Ga0068855_100439986
1356 Ga0068855_101143808
1357 Ga0070664_100160350
1358 Ga0068857_100096584
1359 Ga0068854_100003089
1360 Ga0068854_100068470
1361 Ga0068854_100478558
1362 Ga0068856_100030254
1363 Ga0068856_100505285
1364 Ga0070702_100165943
1365 Ga0070702_100267918
1366 Ga0070702_100623315
1367 Ga0070702_100663916
1368 Ga0068852_100009278
1369 Ga0068852_100060431
1370 Ga0068852_100160391
1371 Ga0068852_100197030
1372 Ga0068852_100741588
1373 Ga0068852_101708142
1374 Ga0068852_101781318
1375 Ga0068859_100001101
1376 Ga0068859_100004143
1377 Ga0068859_100118593
1378 Ga0068859_100344804
1379 Ga0068859_100421609
1380 Ga0068859_100564936
1381 Ga0068864_100001698
1382 Ga0068864_100015530
1383 Ga0068864_100018582
1384 Ga0068864_100075317
1385 Ga0068864_100085019
1386 Ga0068864_100089679
1387 Ga0068864_101208836
1388 Ga0068866_10023568
1389 Ga0068866_10025262
1390 Ga0068866_10365037
1391 Ga0068866_10912206
1392 Ga0068861_100022064
1393 Ga0068861_100111242
1394 Ga0068861_100150212
1395 Ga0068861_100813762
1396 Ga0068861_100924498
1397 Ga0068851_10022458
1398 Ga0068851_10062919
1399 Ga0068870_10012793
1400 Ga0068870_10027059
1401 Ga0068870_10027240
1402 Ga0068863_100024216
1403 Ga0068863_100027522
1404 Ga0068863_100031027
1405 Ga0068863_100034144
1406 Ga0068863_100653550
1407 Ga0068863_101608968
1408 Ga0068858_100001243
1409 Ga0068858_100001448
1410 Ga0068858_100125407
1411 Ga0068858_100126739
1412 Ga0068858_100195790
1413 Ga0068858_100759951
1414 Ga0068858_101395383
1415 Ga0068860_100062103
1416 Ga0068860_100483451
1417 Ga0068860_100486951
1418 Ga0068862_100140937
1419 Ga0068862_101061603
1420 Ga0081539_10000805
1421 Ga0070717_10187237
1422 Ga0070715_10107151
1423 Ga0070715_10260604
1424 Ga0070716_100165349
1425 Ga0070712_100034746
1426 Ga0070712_100120470
1427 Ga0097621_100002521
1428 Ga0097621_100008534
1429 Ga0097621_100022358
1430 Ga0097621_100103464
1431 Ga0097621_100167357
1432 Ga0097621_100336484
1433 Ga0097621_100396827
1434 Ga0097621_100649972
1435 Ga0097621_101195491
1436 Ga0068871_100004365
1437 Ga0068871_100041227
1438 Ga0068871_100076099
1439 Ga0068871_100261839
1440 Ga0068871_100551525
1441 Ga0068871_100666348
1442 Ga0068871_100739535
1443 Ga0075430_100021691
1444 Ga0075430_100022384
1445 Ga0075430_100110168
1446 Ga0075431_100005031
1447 Ga0075433_10412026
1448 Ga0075433_10487354
1449 Ga0075434_100000484
1450 Ga0075434_100160654
1451 Ga0075434_100497625
1452 Ga0075434_101138293
1453 Ga0075434_101340721
1454 Ga0075429_100045494
1455 Ga0075429_100167210
1456 Ga0068865_100072899
1457 Ga0068865_100082328
1458 Ga0068865_100118585
1459 Ga0068865_100342468
1460 Ga0075436_100000593
1461 Ga0075436_100030087
1462 Ga0075436_100046822
1463 Ga0075436_100148145
1464 Ga0075436_100292335
1465 Ga0075436_100340350
1466 Ga0097620_100001101
1467 Ga0097620_100004143
1468 Ga0097620_100118591
1469 Ga0097620_100344820
1470 Ga0097620_100421603
1471 Ga0097620_100564943
1472 Ga0075435_100130708
1473 Ga0075435_100177974
1474 Ga0075435_100213264
1475 Ga0075435_100234384
1476 Ga0099794_10038371
1477 Ga0099794_10043650
1478 Ga0099794_10090944
1479 Ga0099794_10100975
1480 Ga0099794_10189342
1481 Ga0099795_10039408
1482 Ga0105251_10242635
1483 Ga0105240_10603196
1484 Ga0111539_10001053
1485 Ga0111539_10016781
1486 Ga0111539_10151848
1487 Ga0111539_10800328
1488 Ga0111539_10932848
1489 Ga0111539_11692320
1490 Ga0111539_12975142
1491 Ga0105245_10000207
1492 Ga0105245_10123931
1493 Ga0105245_10209682
1494 Ga0105245_10383677
1495 Ga0105245_10410722
1496 Ga0105245_10451951
1497 Ga0105245_10460184
1498 Ga0105245_10817410
1499 Ga0105245_11069593
1500 Ga0105247_10044964
1501 Ga0105247_10344858
1502 Ga0114129_10993796
1503 Ga0105243_10666547
1504 Ga0105243_11482630
1505 Ga0105241_10167204
1506 Ga0105241_10217483
1507 Ga0105241_10934072
1508 Ga0105242_10221835
1509 Ga0105242_10602608
1510 Ga0105242_10697852
1511 Ga0105242_11101892
1512 Ga0105242_11881934
1513 Ga0105248_10002218
1514 Ga0105248_10308283
1515 Ga0105248_10315991
1516 Ga0105248_11151747
1517 Ga0105248_11851306
1518 Ga0105237_10265601
1519 Ga0105237_10527742
1520 Ga0105237_11090568
1521 Ga0105238_10146803
1522 Ga0105238_10829145
1523 Ga0105238_11259084
1524 Ga0105249_10821374
1525 Ga0105249_11002136
1526 Ga0105249_11106389
1527 Ga0105249_12432486
1528 Ga0099796_10025359
1529 Ga0105239_10166516
1530 Ga0105239_10373346
1531 Ga0105239_11048648
1532 Ga0105239_11667005
1533 Ga0105246_10062859
1534 Ga0105246_10189276
1535 Ga0157373_10311327
1536 Ga0157373_10358395
1537 Ga0157371_10250382
1538 Ga0157371_11066066
1539 Ga0157370_10266430
1540 Ga0157369_10037398
1541 Ga0157369_10719551
1542 Ga0157374_10014294
1543 Ga0157374_10150237
1544 Ga0157374_10264089
1545 Ga0157374_10675431
1546 Ga0157378_10051663
1547 Ga0157378_10208931
1548 Ga0157378_10393456
1549 Ga0157378_10712517
1550 Ga0157378_10776966
1551 Ga0157378_10859028
1552 Ga0157378_11137268
1553 Ga0157378_11475590
1554 Ga0163162_10140906
1555 Ga0163162_10306385
1556 Ga0163162_10585527
1557 Ga0163162_10690853
1558 Ga0157372_10098712
1559 Ga0157372_10617056
1560 Ga0157372_10796076
1561 Ga0157372_11018966
1562 Ga0157375_10011033
1563 Ga0157375_10016586
1564 Ga0157375_10042038
1565 Ga0157375_10374368
1566 Ga0157375_10436880
1567 Ga0157375_11503106
1568 Ga0157375_12045523
1569 Ga0163163_10009593
1570 Ga0163163_10066625
1571 Ga0157380_10108260
1572 Ga0157380_10183103
1573 Ga0157380_10573010
1574 Ga0157380_11375449
1575 Ga0157380_11920684
1576 Ga0157377_10078631
1577 Ga0157379_10006994
1578 Ga0157379_10245270
1579 Ga0157379_10365806
1580 Ga0157376_10033466
1581 Ga0157376_10069688
1582 Ga0157376_10167905
1583 Ga0157376_10369635
1584 Ga0157376_10543339
1585 Ga0182006_1032825
1586 Ga0182007_10050203
1587 Ga0182005_1013443
1588 Ga0163161_10013389
1589 Ga0163161_10039723
1590 Ga0163161_10094176
1591 Ga0209760_101465
1592 Ga0209566_100004
1593 Ga0209674_100006
1594 Ga0209563_100009
1595 Ga0207427_100293
1596 Ga0209437_100004
1597 Ga0209677_100005
1598 Ga0209233_1000005
1599 Ga0207656_10001172
1600 Ga0207656_10118445
1601 Ga0207682_10024633
1602 Ga0207682_10035821
1603 Ga0207682_10040949
1604 Ga0207682_10233052
1605 Ga0207692_10917195
1606 Ga0207642_10052105
1607 Ga0207642_10075839
1608 Ga0207710_10015450
1609 Ga0207710_10287665
1610 Ga0207688_10172243
1611 Ga0207688_10183712
1612 Ga0207680_10007196
1613 Ga0207680_10246988
1614 Ga0207685_10002834
1615 Ga0207699_10070113
1616 Ga0207645_10000686
1617 Ga0207645_10229484
1618 Ga0207645_10602803
1619 Ga0207643_10007629
1620 Ga0207643_10011915
1621 Ga0207643_10027879
1622 Ga0207643_10090879
1623 Ga0207684_10098891
1624 Ga0207684_10126212
1625 Ga0207684_10167442
1626 Ga0207684_11708245
1627 Ga0207654_10148730
1628 Ga0207707_10017447
1629 Ga0207707_10026843
1630 Ga0207707_10261257
1631 Ga0207707_10527371
1632 Ga0207695_10780147
1633 Ga0207671_10013515
1634 Ga0207671_10040925
1635 Ga0207693_10025102
1636 Ga0207693_10046169
1637 Ga0207693_10076236
1638 Ga0207663_10104065
1639 Ga0207660_10654290
1640 Ga0207662_10079839
1641 Ga0207657_10014919
1642 Ga0207652_10055337
1643 Ga0207652_10355688
1644 Ga0207646_10470666
1645 Ga0207681_10062298
1646 Ga0207681_10197824
1647 Ga0207681_10488648
1648 Ga0207694_10982735
1649 Ga0207650_10079817
1650 Ga0207650_10196981
1651 Ga0207650_10203115
1652 Ga0207650_10210188
1653 Ga0207650_11284864
1654 Ga0207650_11516181
1655 Ga0207659_10027966
1656 Ga0207659_10036324
1657 Ga0207659_10662271
1658 Ga0207687_10002891
1659 Ga0207687_10170079
1660 Ga0207687_10224223
1661 Ga0207687_10376736
1662 Ga0207687_10547113
1663 Ga0207700_10000099
1664 Ga0207700_10031130
1665 Ga0207700_10051938
1666 Ga0207664_10002486
1667 Ga0207644_10004698
1668 Ga0207644_10009912
1669 Ga0207644_10049097
1670 Ga0207644_10166745
1671 Ga0207690_10131805
1672 Ga0207690_10406579
1673 Ga0207690_10474155
1674 Ga0207706_10029707
1675 Ga0207706_10040580
1676 Ga0207706_10098770
1677 Ga0207706_10145093
1678 Ga0207706_10326444
1679 Ga0207706_10564523
1680 Ga0207706_11010902
1681 Ga0207686_10000488
1682 Ga0207686_10165660
1683 Ga0207686_10374764
1684 Ga0207686_10653210
1685 Ga0207709_10003546
1686 Ga0207670_10037772
1687 Ga0207670_10195194
1688 Ga0207670_10256476
1689 Ga0207670_11144842
1690 Ga0207669_10085486
1691 Ga0207669_10088399
1692 Ga0207669_10354658
1693 Ga0207669_10695343
1694 Ga0207669_11048761
1695 Ga0207704_10407710
1696 Ga0207704_10656940
1697 Ga0207665_10008468
1698 Ga0207665_10048319
1699 Ga0207665_10129285
1700 Ga0207691_10000367
1701 Ga0207691_10080128
1702 Ga0207691_10170606
1703 Ga0207691_10245380
1704 Ga0207691_10305182
1705 Ga0207691_10517493
1706 Ga0207711_10001033
1707 Ga0207711_10144793
1708 Ga0207711_10215806
1709 Ga0207711_10332300
1710 Ga0207689_10001526
1711 Ga0207689_10080987
1712 Ga0207689_10089949
1713 Ga0207689_10090458
1714 Ga0207689_10284134
1715 Ga0207661_10624998
1716 Ga0207661_10789797
1717 Ga0207661_11387302
1718 Ga0207679_10178247
1719 Ga0207679_10750990
1720 Ga0207679_11428312
1721 Ga0207667_10243928
1722 Ga0207651_10001584
1723 Ga0207651_10003957
1724 Ga0207651_10629223
1725 Ga0207651_10728505
1726 Ga0207712_10366705
1727 Ga0207668_10026322
1728 Ga0207668_10064287
1729 Ga0207668_10140898
1730 Ga0207668_10338096
1731 Ga0207668_10371735
1732 Ga0207640_10039707
1733 Ga0207640_10052298
1734 Ga0207658_10041343
1735 Ga0207658_10052812
1736 Ga0207658_10121457
1737 Ga0207658_10125323
1738 Ga0207658_10243630
1739 Ga0207658_10401217
1740 Ga0207658_10688705
1741 Ga0207677_10002051
1742 Ga0207677_10045023
1743 Ga0207677_10062363
1744 Ga0207677_10097557
1745 Ga0207677_10231540
1746 Ga0207677_10296131
1747 Ga0207677_10449756
1748 Ga0207677_10640560
1749 Ga0207677_10644287
1750 Ga0207703_10001709
1751 Ga0207703_10004881
1752 Ga0207703_10250399
1753 Ga0207703_10592930
1754 Ga0207703_10974247
1755 Ga0207703_11160505
1756 Ga0207639_10016008
1757 Ga0207639_10030737
1758 Ga0207639_10243640
1759 Ga0207639_10259421
1760 Ga0207678_10039057
1761 Ga0207678_10179040
1762 Ga0207678_10223448
1763 Ga0207678_10261753
1764 Ga0207702_10335483
1765 Ga0207702_10796015
1766 Ga0207641_10007244
1767 Ga0207641_10014486
1768 Ga0207641_10033425
1769 Ga0207641_10074117
1770 Ga0207641_10352461
1771 Ga0207648_10023103
1772 Ga0207648_10036862
1773 Ga0207648_10059692
1774 Ga0207648_10208856
1775 Ga0207648_10722118
1776 Ga0207676_10000174
1777 Ga0207676_10000548
1778 Ga0207676_10014818
1779 Ga0207676_10050997
1780 Ga0207676_10162303
1781 Ga0207676_10588374
1782 Ga0207676_11299082
1783 Ga0207674_10018138
1784 Ga0207674_10065150
1785 Ga0207674_10551097
1786 Ga0207675_100001059
1787 Ga0207675_100028790
1788 Ga0207675_100029308
1789 Ga0207675_100274530
1790 Ga0207683_10000246
1791 Ga0207683_10017870
1792 Ga0207683_10023679
1793 Ga0207683_10051897
1794 Ga0207683_10691031
1795 Ga0207683_11262684
1796 Ga0207698_10046357
1797 Ga0207698_10147975
1798 Ga0207698_10284124
1799 Ga0207698_10662793
1800 Ga0209179_1070318
1801 Ga0209999_1049327
1802 Ga0209588_1003394
1803 Ga0209588_1065024
1804 Ga0209588_1096392
1805 Ga0207428_10002514
1806 Ga0268266_10006669
1807 Ga0268266_10008065
1808 Ga0268266_10008592
1809 Ga0268266_10231835
1810 Ga0268266_10370436
1811 Ga0268265_10060666
1812 Ga0268265_10099483
1813 Ga0268264_10021756
1814 Ga0268264_10037732
1815 Ga0268264_10059516
1816 Ga0268264_10424362
1817 Ga0268264_10481944
1818 Ga0268264_10646841
1819 Ga0268264_11869806
1820 Ga0265318_10050404
1821 Ga0265318_10149264
1822 Ga0265332_10000293
1823 Ga0265332_10133399
1824 Ga0265328_10003416
1825 Ga0265320_10021332
1826 Ga0265325_10011509
1827 Ga0265329_10015880
1828 Ga0265329_10019337
1829 Ga0265339_10034852
1830 Ga0265339_10080478
1831 Ga0265331_10000348
1832 Ga0265331_10004434
1833 Ga0265327_10128619
1834 Ga0265316_10018947
1835 Ga0265316_10041874
1836 Ga0307408_100017559
1837 Ga0265313_10044904
1838 Ga0265314_10000245
1839 Ga0265314_10028151
1840 Ga0265342_10007670
1841 Ga0307405_10069390
1842 Ga0307413_10036789
1843 Ga0307413_10087117
1844 Ga0307410_10002755
1845 Ga0307406_10013059
1846 Ga0307407_10068837
1847 Ga0307409_100243044
1848 Ga0307409_100274323
1849 Ga0307416_100014893
1850 Ga0307416_101158796
1851 Ga0307414_10010426
1852 Ga0307414_10235708
1853 Ga0307414_10461762
1854 Ga0307411_10098093
1855 Ga0307411_10228757
1856 Ga0307411_10262761
1857 Ga0307415_100007490
1858 Ga0307415_100100576
1859 Ga0307415_100258270
1860 Ga0307415_100646664
1861 Ga0316583_10061686
1862 Ga0307507_10082957
1863 Ga0307510_10402365
1864 Ga0373928_0037831
1865 Ga0373934_0019815
1866 Ga0373934_0022793
1867 Ga0373951_0160852
1868 Ga0373952_0012716
1869 Ga0373923_0001906
1870 Ga0373923_0270828
1871 Ga0373932_0067634
1872 Ga0373936_0060619
1873 Ga0373939_0144472
1874 Ga0373941_0039851
1875 Ga0373945_0152612
1876 Ga0373953_0037940
1877 Ga0373954_0002636
1878 Ga0373954_0003489
1879 Ga0373954_0048171
1880 Ga0373954_0056289
1881 Ga0373956_0000615
1882 Ga0373956_0199774
1883 Ga0373956_0284901
1884 Ga0373956_0454136
1885 Ga0373957_0001592
1886 Ga0373957_0007229
1887 Ga0373943_0220334
1888 Ga0373943_0336008
1889 Ga0373943_0444095
1890 Ga0373946_0009606
1891 Ga0373946_0282720
1892 Ga0373946_0419147
1893 Ga0373946_0434634
1894 Ga0373955_0055591
1895 Ga0373955_0250107
1896 Ga0373942_0105566
1897 Ga0373942_0296105
1898 Ga0373961_0069131
1899 Ga0373961_0102214
1900 Ga0316574_0000854
1901 Ga0373924_0032663
1902 Ga0373924_0195895
1903 Ga0373931_0105884
1904 Ga0373931_0463267
1905 Ga0373935_0196674
1906 Ga0373935_0231964
1907 Ga0373935_0269439
1908 Ga0373935_0571033
1909 Ga0373927_0032781
1910 Ga0373927_0035616
1911 Ga0373927_0217954
1912 Ga0373927_0343639
1913 Ga0373933_0024477
1914 Ga0373933_0071872
1915 Ga0373933_0190804
1916 Ga0373933_0417170
1917 Ga0373947_0186236
1918 Ga0373937_0001406
1919 Ga0373937_0017208
1920 Ga0373937_0167403
1921 Ga0373937_0450001
1922 Ga0373925_0124010
1923 Ga0373925_0152252
1924 Ga0373925_0201818
1925 Ga0373925_0361527
1926 Ga0395900_0088037
1927 Ga0395900_0147511
1928 Ga0395905_1021611
1929 Ga0395901_0180064
1930 Ga0395901_0449952
1931 Ga0242420_013094
1932 Ga0436365_1097290
1933 Ga0436360_1169165
1934 Ga0439436_0128967
1935 Ga0451843_0690997
1936 Ga0439448_0120657
1937 Ga0439432_076975
1938 Ga0439434_0067858
1939 Ga0451577_0317631
1940 Ga0466972_0000070
1941 Ga0453683_0125552
1942 Ga0453683_0497285
1943 Ga0466964_0108427
1944 Ga0453684_0426012
1945 Ga0453684_0637922
1946 Ga0453684_0792130
1947 Ga0451576_0342806
1948 Ga0466967_1056839
1949 Ga0495592_0005285
1950 Ga0495592_0029233
1951 Ga0495592_0110125
1952 Ga0495592_0120496
1953 Ga0495592_0357605
1954 Ga0495603_0232197
1955 Ga0495629_0096580
1956 Ga0495641_0015988
1957 Ga0495651_0002995
1958 Ga0495651_0010022
1959 Ga0495651_0070933
1960 Ga0495651_0092033
1961 Ga0495653_0006836
1962 Ga0495653_0259517
1963 Ga0495653_0427796
1964 Ga0495580_0075522
1965 Ga0495580_0086177
1966 Ga0495580_0270829
1967 Ga0495580_0617171
1968 Ga0495582_0060468
1969 Ga0495639_0005155
1970 Ga0495639_0069678
1971 Ga0495662_0008790
1972 Ga0495664_0146787
1973 Ga0495664_0147593
1974 Ga0495664_0336942
1975 Ga0495594_0060051
1976 Ga0495607_0049730
1977 Ga0495606_0000011
1978 Ga0495608_0042788
1979 Ga0495608_0080156
1980 Ga0495608_0111859
1981 Ga0495608_0288797
1982 Ga0495618_0215600
1983 Ga0495618_0508427
1984 Ga0495628_0002021
1985 Ga0495628_0004647
1986 Ga0495628_0020880
1987 Ga0495628_0117806
1988 Ga0495628_0120479
1989 Ga0495628_0432395
1990 Ga0495628_0594943
1991 Ga0495630_0018882
1992 Ga0495630_0039136
1993 Ga0495630_0139652
1994 Ga0495666_0007731
1995 Ga0495666_0223315
1996 Ga0495652_0021112
1997 Ga0495652_0035269
1998 Ga0495652_0065263
1999 Ga0495652_0069034
2000 Ga0495652_0139381
2001 Ga0495652_0260501
2002 Ga0495652_0325645
2003 Ga0495652_0346393
2004 Ga0495665_0022228
2005 Ga0495665_0143694
2006 Ga0495640_0025633
2007 Ga0495640_0068176
2008 Ga0495586_0027285
2009 Ga0495586_0583704
2010 Ga0495586_0647300
2011 Ga0495586_0754492
2012 Ga0495587_0050070
2013 Ga0495587_0338538
2014 Ga0495598_0211432
2015 Ga0495621_0059231
2016 Ga0495621_0115474
2017 Ga0495621_0133107
2018 Ga0495621_0174986
2019 Ga0495645_0005439
2020 Ga0495645_0017006
2021 Ga0495645_0057856
2022 Ga0495645_0217465
2023 Ga0495622_0074613
2024 Ga0495667_0113960
2025 Ga0495667_0341704
2026 Ga0495667_0422824
2027 Ga0495634_0068620
2028 Ga0495634_0076539
2029 Ga0495634_0460080
2030 Ga0495635_0086714
2031 Ga0495635_0105657
2032 Ga0495635_0453472
2033 Ga0495659_0094401
2034 Ga0495588_0041459
2035 Ga0495657_0040563
2036 Ga0495657_0068721
2037 Ga0495657_0085760
2038 Ga0495657_0537611
2039 Ga0495657_0558572
2040 Ga0495599_0002888
2041 Ga0495599_0026654
2042 Ga0495599_0149340
2043 Ga0495623_0047566
2044 Ga0495623_0631191
2045 Ga0495646_0014979
2046 Ga0495647_0002471
2047 Ga0495647_0008547
2048 Ga0495658_0044428
2049 Ga0495658_0122548
2050 Ga0495658_0814862
2051 Ga0495669_0205120
2052 Ga0495613_0018189
2053 Ga0495624_0104714
2054 Ga0495600_0000916
2055 Ga0495581_0009710
2056 Ga0495604_0042840
2057 Ga0495604_0085018
2058 Ga0495604_0398243
2059 Ga0495636_0003634
2060 Ga0495680_0070233
2061 Ga0495680_0631761
2062 Ga0495680_0631773
2063 Ga0495675_0012907
2064 Ga0495675_0147540
2065 Ga0495675_0467693
2066 Ga0495684_0041075
2067 Ga0495686_0000248
2068 Ga0495686_0044312
2069 Ga0495593_0052595
2070 Ga0495602_0078562
2071 Ga0495602_0539921
2072 Ga0495602_0788261
2073 Ga0495614_0047249
2074 Ga0496100_0203137
2075 Ga0496101_0089547
2076 Ga0496101_0419498
2077 Ga0496102_0958535
2078 Ga0496102_1080148
2079 Ga0496102_1575481
2080 Ga0496103_0469964
2081 Ga0496104_0009650
2082 Ga0496104_0210310
2083 Ga0496105_0102103
2084 Ga0496106_0272991
2085 Ga0496106_0898634
2086 Ga0496107_0155182
2087 Ga0496107_0349298
2088 Ga0496107_0501178
2089 Ga0496107_1001937
2090 Ga0496108_0013970
2091 Ga0496108_0187926
2092 Ga0496108_0520627
2093 Ga0496109_0011013
2094 Ga0496109_0085357
2095 Ga0496110_0595808
2096 Ga0496110_0837121
2097 Ga0496110_1292361
2098 Ga0496110_1470886
2099 Ga0496111_0091997
2100 Ga0496111_0484431
2101 Ga0496112_0005841
2102 Ga0496112_0014201
2103 Ga0496112_0234806
2104 Ga0496112_0394210
2105 Ga0496113_0298344
2106 Ga0496113_0401697
2107 Ga0496114_0012661
2108 Ga0496114_0022120
2109 Ga0496114_0022604
2110 Ga0496114_0659150
2111 Ga0496114_1431973
2112 Ga0496115_0179858
2113 Ga0496115_0248852
2114 Ga0496115_0602332
2115 Ga0496124_0485288
2116 Ga0501298_033786
2117 Ga0501031_0045354
2118 Ga0501031_0070945
2119 Ga0501032_0001741
2120 Ga0501032_0023567
2121 Ga0501032_0131161
2122 Ga0501032_0729344
2123 Ga0501033_0000364
2124 Ga0501033_0005262
2125 Ga0501033_0010897
2126 Ga0501033_0211631
2127 Ga0501033_0775504
2128 Ga0501034_0005376
2129 Ga0501034_0012071
2130 Ga0501034_0138359
2131 Ga0501036_0004793
2132 Ga0501036_0006729
2133 Ga0501036_0044802
2134 Ga0501036_0117508
2135 Ga0501036_0139132
2136 Ga0501036_1081035
2137 Ga0501037_0000162
2138 Ga0501037_0037962
2139 Ga0501037_0124832
2140 Ga0501037_0323169
2141 Ga0501038_0003864
2142 Ga0501038_0008423
2143 Ga0501038_0071876
2144 Ga0501038_0103831
2145 Ga0501038_0124809
2146 Ga0501038_0190761
2147 Ga0501038_0232637
2148 Ga0501038_0743440
2149 Ga0501039_0003351
2150 Ga0501039_0008184
2151 Ga0501039_0035202
2152 Ga0501039_0046891
2153 Ga0501039_0199951
2154 Ga0501039_0215832
2155 Ga0501039_0595776
2156 Ga0501040_0003740
2157 Ga0501040_0009844
2158 Ga0501040_0092397
2159 Ga0501040_0097200
2160 Ga0501041_0222845
2161 Ga0501041_0394962
2162 Ga0501042_0000536
2163 Ga0501042_0018299
2164 Ga0501042_0196429
2165 Ga0501042_0342215
2166 Ga0501043_0022331
2167 Ga0501043_0060318
2168 Ga0501043_0224156
2169 Ga0501043_0245920
2170 Ga0501043_0304519
2171 Ga0501043_0362633
2172 Ga0501043_0419990
2173 Ga0501046_0026489
2174 Ga0501046_0068985
2175 Ga0501046_0101642
2176 Ga0501048_0008305
2177 Ga0501048_0056461
2178 Ga0501048_0119705
2179 Ga0501067_0213849
2180 Ga0501067_0597602
2181 Ga0501068_0018157
2182 Ga0501068_0158079
2183 Ga0501068_0275918
2184 Ga0501068_0530611
2185 Ga0501069_0719078
2186 Ga0501071_0013396
2187 Ga0501071_0050832
2188 Ga0501071_0435034
2189 Ga0501072_0001399
2190 Ga0501072_0091526
2191 Ga0501072_0179258
2192 Ga0501072_0192537
2193 Ga0501072_0480728
2194 Ga0501072_0750219
2195 Ga0501073_0359056
2196 Ga0501074_0214122
2197 Ga0501074_0732549
2198 Ga0501075_0010270
2199 Ga0501075_0023115
2200 Ga0501075_0239449
2201 Ga0501076_0012795
2202 Ga0501076_0014474
2203 Ga0501076_0019562
2204 Ga0501076_0342384
2205 Ga0501077_0011579
2206 Ga0501077_0108178
2207 Ga0501077_0163235
2208 Ga0501235_195656
2209 Ga0501250_071032
2210 Ga0501079_0004210
2211 Ga0501079_0077016
2212 Ga0501079_0390417
2213 Ga0501079_1381767
2214 Ga0501080_0006958
2215 Ga0501080_0219411
2216 Ga0501080_0299631
2217 Ga0501081_0000465
2218 Ga0501081_0012671
2219 Ga0501081_0272525
2220 Ga0501081_0396329
2221 Ga0501083_0686660
2222 Ga0501035_0005055
2223 Ga0501035_0010038
2224 Ga0501035_0025464
2225 Ga0501035_0060352
2226 Ga0501035_0084580
2227 Ga0501035_0093559
2228 Ga0501035_0137626
2229 Ga0501035_0147964
2230 Ga0501035_0161001
2231 Ga0501035_0274206
2232 Ga0501044_0000076
2233 Ga0501044_0001481
2234 Ga0501044_0003222
2235 Ga0501044_0012028
2236 Ga0501044_0043973
2237 Ga0501044_0269938
2238 Ga0501044_1011639
2239 Ga0501045_0003218
2240 Ga0501045_0041989
2241 Ga0501045_0066885
2242 Ga0501045_0094485
2243 Ga0501045_0259793
2244 nmdc:mga05p37_529398_c1
2245 nmdc:mga05p37_732932_c1
2246 nmdc:mga09592_276772_c1
2247 nmdc:mga09592_538283_c1
2248 nmdc:mga0qj67_123797_c1
2249 nmdc:mga0qj67_549125_c1
2250 nmdc:mga0qj67_6850_c1
2251 nmdc:mga0qj67_983108_c1
2252 nmdc:mga06r32_1014_c1
2253 nmdc:mga06r32_308880_c1
2254 nmdc:mga08y16_176151_c1
2255 nmdc:mga08y16_19726_c1
2256 nmdc:mga08y16_3419_c1
2257 nmdc:mga0n895_163087_c1
2258 nmdc:mga0n895_367_c1
2259 nmdc:mga0n895_438924_c1
2260 nmdc:mga0rr50_148782_c1
2261 nmdc:mga0rr50_152767_c1
2262 nmdc:mga0rr50_158280_c1
2263 nmdc:mga0rr50_224730_c1
2264 nmdc:mga0rr50_244584_c1
2265 nmdc:mga0rr50_97397_c2
2266 nmdc:mga08x19_1118_c1
2267 nmdc:mga08x19_148673_c1
2268 nmdc:mga08x19_221693_c1
2269 nmdc:mga08x19_58041_c1
2270 nmdc:mga08x19_5900_c1
2271 nmdc:mga0a205_132541_c2
2272 nmdc:mga0a205_363219_c1
2273 Ga0495601_0030722
2274 Ga0495601_0045721
2275 Ga0495601_0167414
2276 Ga0495601_0292879
2277 Ga0495612_0063075
2278 Ga0495612_0073781
2279 Ga0495595_0355333
2280 Ga0495595_0370250
2281 Ga0495595_0547639
2282 Ga0495619_0008666
2283 Ga0495619_0087963
2284 Ga0495619_0267178
2285 Ga0500595_012640
2286 Ga0500574_009516
2287 Ga0501084_0021829
2288 Ga0501084_0410960
2289 Ga0501084_0599129
2290 Ga0501082_0004016
2291 Ga0501082_0033898
2292 Ga0501082_0040072
2293 Ga0530510_0000170
2294 Ga0530510_0004733
2295 Ga0530510_1171410
2296 2644028971
2297 2723877061
2298 2819540664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

20

155

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.8993 12 165
6zjy-assembly1.cif.gz_2 respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.8835 15 168
3iam-assembly1.cif.gz_2 crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh 0.8829 17 171
7a24-assembly1.cif.gz_B assembly intermediate of the plant mitochondrial complex i 0.8682 12 172
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.8675 12 165
ID Description Score Start End Superfamily
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.936 83 165 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9294 84 172 3.40.30.10
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9282 12 83 1.10.10.1590
2fug202 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9193 85 171 3.40.30.10
af_P0AFD1_13_82_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9159 12 82 1.10.10.1590
ID Description Score Start End GO Terms
AF-A0A534WXL5-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9192 40 169 GO:0003954
GO:0046872
GO:0051537
AF-A0A5E4JMT3-F1-model_v4 Thioredoxin-like [2Fe-2S] ferredoxin 0.9157 36 166 GO:0016491
GO:0046872
GO:0051537
AF-A0A016QR90-F1-model_v4 NADH-quinone oxidoreductase subunit E 0.9151 40 172 GO:0003954
GO:0046872
GO:0051537
AF-A0A1G0H2P2-F1-model_v4 NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) 0.9097 12 168 GO:0003954
GO:0046872
GO:0051537
AF-A0A3A0FDS5-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.9071 12 168 GO:0003954
GO:0046872
GO:0051537

Map