F490874

General Info

Members Datasets Scaffolds Average Seq Length
1152 349 2304 169

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0992070|Ga0373937_0992070_96_626
Length 176
Sequence MIMRPGQQLLLPANPLFILGSLGLALVLNMVQNVGFWGRAAWTPDLMALVLLFWGVHQPRRVGIGTAFVFGLLMDVHQGSVLGQHALAYSVLNFLAVSIHRRLFWFTVPAQALQLLPLFAASHAVELAVRLMVGGTFPGFLLLLAPVIESLLWPLANFLLLLPQRRAPDPDANRPI

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
72 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
126 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
127 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
128 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
143 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
241 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
283 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
284 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
285 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
286 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
287 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
293 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
298 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
299 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
302 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
303 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
304 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
305 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
306 2643221556 Massilia sp. Root1485 Isolate Unclassified
307 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
308 2643221645 Massilia sp. Root351 Isolate Unclassified
309 2643221664 Massilia sp. Root418 Isolate Unclassified
310 2643221684 Massilia sp. Root133 Isolate Unclassified
311 2738541280 Massilia sp. GV090 Isolate Unclassified
312 2738541300 Massilia sp. GV016 Isolate Unclassified
313 2738543018 Massilia sp. GV045 Isolate Unclassified
314 2738543030 Massilia sp. GV097 Isolate Unclassified
315 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
316 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
317 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
318 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
319 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
320 2818991436 Collimonas arenae 515 Isolate Unclassified
321 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
322 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
323 2821131069 Duganella sp. 1224 Isolate Unclassified
324 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
325 2842711865 Duganella sp. R-73148 Isolate Unclassified
326 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
327 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
328 2857553236 Duganella sp. R-74557 Isolate Unclassified
329 2857558681 Duganella sp. R-74565 Isolate Unclassified
330 2857564685 Duganella sp. R-74599 Isolate Unclassified
331 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
332 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
333 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
334 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
335 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
336 2904424332 Duganella sp. 1411 Isolate Rhizosphere
337 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
338 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
339 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
340 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
341 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
342 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
343 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
344 2919476304 Duganella sp. 3397 Isolate Unclassified
345 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
346 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
347 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
348 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
349 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0.17
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 0.69
Rhizoplane 4.17
Rhizosphere 79.51
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0992070 3300036401 Unclassified 789
2 JGI25155J39150_1000140 3300002704 Bacteria 34372
3 JGI25155J39150_1000167 3300002704 Bacteria 29016
4 JGI25156J39149_1002433 3300002705 Bacteria 6677
5 JGI25156J39149_1025861 3300002705 Bacteria 937
6 JGI25162J39368_1000023 3300002737 Bacteria 236658
7 JGI25154J39366_1000372 3300002738 Bacteria 24998
8 JGI25154J39366_1000748 3300002738 Bacteria 14564
9 JGI25157J39369_1000294 3300002741 Bacteria 36390
10 JGI25157J39369_1000325 3300002741 Bacteria 33856
11 JGI25163J39215_1002428 3300002771 Bacteria 1920
12 JGI25152J39213_1000994 3300002773 Bacteria 13747
13 JGI25150J39212_1000752 3300002774 Bacteria 11338
14 JGI25150J39212_1013251 3300002774 Bacteria 1435
15 JGI25159J45721_1009822 3300002987 Bacteria 2492
16 JGI25165J46597_1000030 3300003214 Bacteria 305254
17 JGI25153J46596_10004853 3300003215 Bacteria 7163
18 JGI25153J46596_10018261 3300003215 Bacteria 2732
19 rootL2_10105411 3300003322 Bacteria 4824
20 rootH1_10039759 3300003323 Bacteria 1368
21 rootH1_10115661 3300003323 Bacteria 1088
22 JGI25161J50226_1012496 3300003374 Bacteria 1014
23 Ga0055538_1000017 3300003751 Bacteria 305254
24 Ga0055538_1000024 3300003751 Bacteria 241526
25 Ga0055539_1000022 3300003752 Bacteria 305254
26 Ga0055539_1000031 3300003752 Bacteria 241526
27 Ga0055533_1000030 3300003756 Bacteria 305254
28 Ga0055533_1000041 3300003756 Bacteria 241526
29 Ga0055532_1000074 3300003758 Bacteria 125513
30 Ga0055525_1000034 3300003759 Bacteria 305254
31 Ga0055525_1000049 3300003759 Bacteria 241526
32 Ga0055525_1000179 3300003759 Bacteria 78692
33 Ga0055535_1005537 3300003761 Bacteria 2741
34 Ga0055529_1000027 3300003763 Bacteria 292744
35 Ga0055526_1001365 3300003771 Bacteria 17475
36 Ga0055526_1001772 3300003771 Bacteria 14997
37 Ga0055537_1000172 3300003773 Bacteria 48382
38 Ga0055524_1000022 3300003775 Bacteria 224103
39 Ga0055524_1001210 3300003775 Bacteria 15311
40 Ga0055524_1002507 3300003775 Bacteria 9425
41 Ga0055534_1000169 3300003784 Bacteria 48382
42 Ga0055528_1000482 3300003790 Bacteria 31599
43 Ga0055528_1000486 3300003790 Bacteria 31484
44 Ga0055541_1000015 3300003841 Bacteria 305254
45 Ga0055541_1000022 3300003841 Bacteria 241526
46 Ga0065165_1000882 3300005262 Bacteria 38756
47 Ga0065165_1004612 3300005262 Bacteria 8378
48 Ga0065165_1041648 3300005262 Bacteria 1362
49 Ga0065165_1046410 3300005262 Bacteria 1260
50 Ga0065165_1062279 3300005262 Bacteria 1018
51 Ga0065165_1070869 3300005262 Bacteria 927
52 Ga0065715_10200078 3300005293 Bacteria 1366
53 Ga0070658_10348972 3300005327 Bacteria 1266
54 Ga0070658_10974423 3300005327 Bacteria 737
55 Ga0070676_10584703 3300005328 Bacteria 803
56 Ga0070670_100005639 3300005331 Bacteria 10563
57 Ga0070666_10913056 3300005335 Bacteria 649
58 Ga0070680_100274743 3300005336 Bacteria 1427
59 Ga0070682_100027341 3300005337 Bacteria 3423
60 Ga0070660_100018318 3300005339 Bacteria 5115
61 Ga0070660_100028962 3300005339 Bacteria 4147
62 Ga0070660_100079477 3300005339 Bacteria 2573
63 Ga0070661_100008198 3300005344 Bacteria 7206
64 Ga0070659_100001280 3300005366 Bacteria 18222
65 Ga0070659_100233173 3300005366 Bacteria 1521
66 Ga0070659_100672983 3300005366 Bacteria 893
67 Ga0070663_100457055 3300005455 Bacteria 1053
68 Ga0068853_100383036 3300005539 Bacteria 1314
69 Ga0068855_100004477 3300005563 Bacteria 17071
70 Ga0068855_100005723 3300005563 Bacteria 15175
71 Ga0068855_100062139 3300005563 Bacteria 4361
72 Ga0068855_100116543 3300005563 Bacteria 3061
73 Ga0070664_100065165 3300005564 Bacteria 3108
74 Ga0070664_100078854 3300005564 Bacteria 2833
75 Ga0070664_100198424 3300005564 Bacteria 1790
76 Ga0068857_100045181 3300005577 Bacteria 3907
77 Ga0068857_101331131 3300005577 Bacteria 698
78 Ga0068854_100024293 3300005578 Bacteria 4147
79 Ga0068856_100385673 3300005614 Bacteria 1421
80 Ga0068856_100461677 3300005614 Bacteria 1291
81 Ga0068856_100949085 3300005614 Bacteria 879
82 Ga0068852_100058152 3300005616 Bacteria 3348
83 Ga0068852_100303035 3300005616 Bacteria 1547
84 Ga0068852_101203897 3300005616 Bacteria 778
85 Ga0068851_10148005 3300005834 Bacteria 1282
86 Ga0070717_10125503 3300006028 Bacteria 2203
87 Ga0070712_100021282 3300006175 Bacteria 4258
88 Ga0075366_10254317 3300006195 Bacteria 1072
89 Ga0099823_1126674 3300006944 Bacteria 632
90 Ga0079104_1008805 3300006946 Bacteria 3477
91 Ga0099826_10000006 3300006948 Bacteria 432260
92 Ga0105244_10002568 3300009036 Bacteria 13635
93 Ga0105244_10021821 3300009036 Bacteria 3532
94 Ga0105244_10050256 3300009036 Bacteria 2127
95 Ga0105240_10000718 3300009093 Bacteria 60617
96 Ga0105240_10002320 3300009093 Bacteria 30796
97 Ga0105241_10024076 3300009174 Bacteria 4521
98 Ga0105237_10004756 3300009545 Bacteria 15613
99 Ga0105237_10037524 3300009545 Bacteria 4897
100 Ga0105237_10104871 3300009545 Bacteria 2818
101 Ga0105238_10000107 3300009551 Bacteria 91765
102 Ga0105238_10234605 3300009551 Bacteria 1812
103 Ga0105238_10241190 3300009551 Bacteria 1785
104 Ga0105239_10000289 3300010375 Bacteria 74109
105 Ga0105239_11963486 3300010375 Bacteria 679
106 Ga0105246_10059845 3300011119 Bacteria 2644
107 Ga0105246_10230040 3300011119 Bacteria 1459
108 Ga0157373_10087839 3300013100 Bacteria 2190
109 Ga0157371_10000153 3300013102 Bacteria 101298
110 Ga0157369_10765435 3300013105 Bacteria 993
111 Ga0182008_10001831 3300014497 Bacteria 13867
112 Ga0182008_10017379 3300014497 Bacteria 3732
113 Ga0182008_10018149 3300014497 Bacteria 3644
114 Ga0182006_1000030 3300015261 Bacteria 242894
115 Ga0182006_1000138 3300015261 Bacteria 78470
116 Ga0182006_1018305 3300015261 Bacteria 2962
117 Ga0182006_1029740 3300015261 Bacteria 2212
118 Ga0182006_1064314 3300015261 Bacteria 1376
119 Ga0182007_10000037 3300015262 Bacteria 123677
120 Ga0182007_10001653 3300015262 Bacteria 11801
121 Ga0182007_10006560 3300015262 Bacteria 4986
122 Ga0182007_10019533 3300015262 Bacteria 2434
123 Ga0182007_10070104 3300015262 Bacteria 1148
124 Ga0182007_10091026 3300015262 Bacteria 1005
125 Ga0182005_1000021 3300015265 Bacteria 272185
126 Ga0182005_1000046 3300015265 Bacteria 138133
127 Ga0182005_1000207 3300015265 Bacteria 39631
128 Ga0163161_10004787 3300017792 Bacteria 9426
129 Ga0163161_10476551 3300017792 Bacteria 1013
130 Ga0213872_10000403 3300021361 Bacteria 35721
131 Ga0213872_10016939 3300021361 Bacteria 3375
132 Ga0213872_10061308 3300021361 Bacteria 1701
133 Ga0213872_10292951 3300021361 Bacteria 677
134 Ga0209435_100055 3300025206 Bacteria 86115
135 Ga0209435_100248 3300025206 Bacteria 14274
136 Ga0209760_102502 3300025207 Bacteria 1713
137 Ga0209784_100018 3300025224 Bacteria 456816
138 Ga0209784_100034 3300025224 Bacteria 305504
139 Ga0209566_100016 3300025225 Bacteria 456824
140 Ga0209566_100038 3300025225 Bacteria 305504
141 Ga0209674_100030 3300025226 Bacteria 456824
142 Ga0209674_100056 3300025226 Bacteria 305504
143 Ga0209147_100097 3300025229 Bacteria 164034
144 Ga0209563_100034 3300025230 Bacteria 456824
145 Ga0209563_100057 3300025230 Bacteria 305604
146 Ga0209563_100143 3300025230 Bacteria 78744
147 Ga0207427_100929 3300025231 Bacteria 12491
148 Ga0209437_100071 3300025233 Bacteria 305604
149 Ga0209437_100234 3300025233 Bacteria 92856
150 Ga0209437_103273 3300025233 Bacteria 2956
151 Ga0209437_112155 3300025233 Bacteria 1265
152 Ga0209258_100192 3300025242 Bacteria 125565
153 Ga0207425_1000013 3300025245 Bacteria 497384
154 Ga0207425_1000675 3300025245 Bacteria 18625
155 Ga0209646_1000103 3300025246 Bacteria 164034
156 Ga0209646_1000120 3300025246 Bacteria 146035
157 Ga0209646_1000346 3300025246 Bacteria 34384
158 Ga0209026_1000134 3300025250 Bacteria 117098
159 Ga0209026_1003217 3300025250 Bacteria 5505
160 Ga0209677_100019 3300025253 Bacteria 456824
161 Ga0209677_100035 3300025253 Bacteria 305504
162 Ga0209148_1000229 3300025254 Bacteria 91956
163 Ga0209148_1029102 3300025254 Bacteria 837
164 Ga0209759_1000091 3300025256 Bacteria 164034
165 Ga0209759_1000857 3300025256 Bacteria 23573
166 Ga0209129_1000152 3300025258 Bacteria 112977
167 Ga0209233_1000094 3300025261 Bacteria 305604
168 Ga0209565_1000159 3300025263 Bacteria 90295
169 Ga0209565_1002041 3300025263 Bacteria 7773
170 Ga0209565_1012655 3300025263 Bacteria 2004
171 Ga0209455_1000033 3300025272 Bacteria 504606
172 Ga0209455_1019307 3300025272 Bacteria 1381
173 Ga0209673_1000006 3300025273 Bacteria 650600
174 Ga0209130_1000521 3300025284 Bacteria 38770
175 Ga0209675_1000005 3300025291 Bacteria 849192
176 Ga0209025_1027918 3300025294 Bacteria 2782
177 Ga0209564_1000028 3300025295 Bacteria 510986
178 Ga0209564_1000154 3300025295 Bacteria 166849
179 Ga0209564_1000774 3300025295 Bacteria 44427
180 Ga0209758_1000031 3300025297 Bacteria 497252
181 Ga0209758_1000354 3300025297 Bacteria 83217
182 Ga0209256_1000035 3300025299 Bacteria 386754
183 Ga0209256_1000274 3300025299 Bacteria 90266
184 Ga0209256_1000414 3300025299 Bacteria 67073
185 Ga0207655_1003180 3300025728 Bacteria 12394
186 Ga0207655_1006901 3300025728 Bacteria 7452
187 Ga0207655_1032122 3300025728 Bacteria 2404
188 Ga0207655_1043720 3300025728 Bacteria 1890
189 Ga0207713_1125677 3300025735 Bacteria 855
190 Ga0207705_10000950 3300025909 Bacteria 23658
191 Ga0207654_10007071 3300025911 Bacteria 5655
192 Ga0207695_10001004 3300025913 Bacteria 49973
193 Ga0207695_10009358 3300025913 Bacteria 12115
194 Ga0207695_10011110 3300025913 Bacteria 10932
195 Ga0207671_10001366 3300025914 Bacteria 28480
196 Ga0207671_10079791 3300025914 Bacteria 2452
197 Ga0207693_10037313 3300025915 Bacteria 3830
198 Ga0207657_10003467 3300025919 Bacteria 16832
199 Ga0207657_10025565 3300025919 Bacteria 5442
200 Ga0207657_10110326 3300025919 Bacteria 2272
201 Ga0207649_10035025 3300025920 Bacteria 3013
202 Ga0207694_10000130 3300025924 Bacteria 77624
203 Ga0207694_10144929 3300025924 Bacteria 1911
204 Ga0207694_10307499 3300025924 Bacteria 1306
205 Ga0207694_10357442 3300025924 Bacteria 1210
206 Ga0207650_10002315 3300025925 Bacteria 13271
207 Ga0207687_10464897 3300025927 Bacteria 1051
208 Ga0207690_10021179 3300025932 Bacteria 4028
209 Ga0207706_10184350 3300025933 Bacteria 1833
210 Ga0207679_10018193 3300025945 Bacteria 4703
211 Ga0207679_10037047 3300025945 Bacteria 3464
212 Ga0207679_10050816 3300025945 Bacteria 3031
213 Ga0207679_10204249 3300025945 Bacteria 1653
214 Ga0207667_10000110 3300025949 Bacteria 131872
215 Ga0207667_10008069 3300025949 Bacteria 12548
216 Ga0207667_10046934 3300025949 Bacteria 4573
217 Ga0207667_10076894 3300025949 Bacteria 3463
218 Ga0207667_10907143 3300025949 Bacteria 873
219 Ga0207651_10257997 3300025960 Bacteria 1430
220 Ga0207640_10004306 3300025981 Bacteria 7706
221 Ga0207640_10149379 3300025981 Bacteria 1715
222 Ga0207639_10686613 3300026041 Bacteria 949
223 Ga0207678_10144850 3300026067 Bacteria 2028
224 Ga0207702_10179549 3300026078 Bacteria 1948
225 Ga0207702_10331012 3300026078 Bacteria 1453
226 Ga0207674_10654529 3300026116 Bacteria 1014
227 Ga0207683_10261884 3300026121 Bacteria 1579
228 Ga0207698_10006700 3300026142 Bacteria 7196
229 Ga0207698_10254551 3300026142 Bacteria 1609
230 Ga0209281_1005409 3300027111 Bacteria 3549
231 Ga0209282_1000003 3300027666 Bacteria 856377
232 Ga0307515_10294022 3300028794 Bacteria 1317
233 Ga0316177_1167103 3300030731 Bacteria 1047
234 Ga0316178_1105865 3300030735 Bacteria 1051
235 Ga0316180_1103778 3300030736 Bacteria 4304
236 Ga0316181_1213610 3300030744 Bacteria 1160
237 Ga0307408_100000129 3300031548 Bacteria 84251
238 Ga0265314_10352591 3300031711 Bacteria 809
239 Ga0307405_10609832 3300031731 Bacteria 892
240 Ga0307414_10298102 3300032004 Bacteria 1362
241 Ga0395899_0000085 3300037312 Bacteria 159118
242 Ga0395899_0004514 3300037312 Bacteria 10849
243 Ga0395899_0007052 3300037312 Bacteria 8695
244 Ga0395899_0010060 3300037312 Bacteria 7252
245 Ga0395899_0011675 3300037312 Bacteria 6723
246 Ga0395899_0134464 3300037312 Bacteria 1763
247 Ga0395900_0001335 3300037418 Bacteria 29867
248 Ga0395900_0003249 3300037418 Bacteria 17597
249 Ga0395900_0014771 3300037418 Bacteria 7959
250 Ga0395900_0022682 3300037418 Bacteria 6424
251 Ga0395900_0061072 3300037418 Bacteria 3876
252 Ga0395900_0114650 3300037418 Bacteria 2765
253 Ga0395900_0119224 3300037418 Bacteria 2708
254 Ga0395900_0191356 3300037418 Bacteria 2075
255 Ga0395900_0214740 3300037418 Bacteria 1941
256 Ga0395900_0307545 3300037418 Bacteria 1569
257 Ga0395900_0453785 3300037418 Bacteria 1238
258 Ga0395898_0057144 3300037466 Bacteria 3802
259 Ga0395898_0277812 3300037466 Bacteria 1597
260 Ga0395898_0391224 3300037466 Bacteria 1325
261 Ga0395898_0810600 3300037466 Bacteria 876
262 Ga0395898_1001335 3300037466 Bacteria 771
263 Ga0395905_0001092 3300037471 Bacteria 34107
264 Ga0395905_0017352 3300037471 Bacteria 6836
265 Ga0395905_0315836 3300037471 Bacteria 1451
266 Ga0395905_0398289 3300037471 Bacteria 1271
267 Ga0395905_0722211 3300037471 Bacteria 898
268 Ga0395905_0850321 3300037471 Bacteria 815
269 Ga0395901_0000227 3300038443 Bacteria 70721
270 Ga0395901_0000802 3300038443 Bacteria 34910
271 Ga0395901_0012410 3300038443 Bacteria 8644
272 Ga0395901_0155196 3300038443 Bacteria 2404
273 Ga0395901_0175195 3300038443 Bacteria 2250
274 Ga0395901_0358287 3300038443 Bacteria 1504
275 Ga0395901_0381932 3300038443 Bacteria 1449
276 Ga0395901_0528235 3300038443 Bacteria 1198
277 Ga0395901_0928229 3300038443 Bacteria 850
278 Ga0395901_1010201 3300038443 Bacteria 807
279 Ga0436361_0632131 3300039447 Bacteria 10675
280 Ga0436361_0768404 3300039447 Bacteria 16876
281 Ga0436361_0851270 3300039447 Bacteria 59752
282 Ga0436361_0939283 3300039447 Bacteria 6148
283 Ga0439461_0065964 3300041410 Bacteria 831
284 Ga0451853_3903632 3300041512 Bacteria 845
285 Ga0439449_0030747 3300042007 Bacteria 2001
286 Ga0450911_026543 3300042115 Bacteria 751
287 Ga0450904_001673 3300042139 Bacteria 2964
288 Ga0466972_0000269 3300044658 Bacteria 33053
289 Ga0466972_0001677 3300044658 Bacteria 10841
290 Ga0466972_0003487 3300044658 Bacteria 7805
291 Ga0466972_0049442 3300044658 Bacteria 2031
292 Ga0466965_0010946 3300044683 Bacteria 4241
293 Ga0466965_0012191 3300044683 Bacteria 4040
294 Ga0466965_0013044 3300044683 Bacteria 3915
295 Ga0466966_0002043 3300044684 Bacteria 13112
296 Ga0466966_0175461 3300044684 Bacteria 1301
297 Ga0466966_0238467 3300044684 Bacteria 1096
298 Ga0466966_0729305 3300044684 Bacteria 597
299 Ga0466961_0076365 3300044693 Bacteria 2123
300 Ga0466961_0260079 3300044693 Bacteria 1064
301 Ga0466964_0000857 3300044706 Bacteria 9953
302 Ga0466964_0045734 3300044706 Bacteria 1782
303 Ga0466968_0015183 3300044735 Bacteria 3049
304 Ga0466968_0019136 3300044735 Bacteria 2754
305 Ga0466957_0000040 3300044842 Bacteria 47080
306 Ga0466957_0044592 3300044842 Bacteria 2687
307 Ga0466957_0064109 3300044842 Bacteria 2260
308 Ga0466957_0363041 3300044842 Bacteria 984
309 Ga0466960_0555270 3300044901 Bacteria 678
310 Ga0466959_0019683 3300045049 Bacteria 4966
311 Ga0466959_0203265 3300045049 Bacteria 1378
312 Ga0466959_0297627 3300045049 Bacteria 1105
313 Ga0466958_0050128 3300045836 Bacteria 2527
314 Ga0466967_0015803 3300045976 Bacteria 5930
315 Ga0466967_0159673 3300045976 Bacteria 2115
316 Ga0495617_000046 3300046452 Bacteria 115430
317 Ga0495617_001784 3300046452 Bacteria 9187
318 Ga0495617_003526 3300046452 Bacteria 5857
319 Ga0495617_029413 3300046452 Bacteria 1847
320 Ga0495627_000006 3300046453 Bacteria 581750
321 Ga0495627_001231 3300046453 Bacteria 15945
322 Ga0495627_030329 3300046453 Bacteria 1714
323 Ga0495627_041752 3300046453 Bacteria 1407
324 Ga0495592_0007848 3300046454 Bacteria 7997
325 Ga0495603_0015177 3300046455 Bacteria 4660
326 Ga0495603_0038699 3300046455 Bacteria 2859
327 Ga0495590_0000022 3300046457 Bacteria 205122
328 Ga0495590_0000134 3300046457 Bacteria 43957
329 Ga0495590_0000881 3300046457 Bacteria 13450
330 Ga0495590_0019594 3300046457 Bacteria 2408
331 Ga0495590_0023892 3300046457 Bacteria 2155
332 Ga0495590_0036774 3300046457 Bacteria 1707
333 Ga0495590_0057200 3300046457 Bacteria 1363
334 Ga0495591_002085 3300046458 Bacteria 11521
335 Ga0495629_0017454 3300046459 Bacteria 5142
336 Ga0495629_0054672 3300046459 Bacteria 2792
337 Ga0495629_0300915 3300046459 Bacteria 1098
338 Ga0495629_0483226 3300046459 Bacteria 836
339 Ga0495638_0000099 3300046460 Bacteria 139325
340 Ga0495638_0011848 3300046460 Bacteria 5998
341 Ga0495638_0014511 3300046460 Bacteria 5319
342 Ga0495638_0030851 3300046460 Bacteria 3447
343 Ga0495638_0081329 3300046460 Bacteria 1967
344 Ga0495638_0090340 3300046460 Bacteria 1846
345 Ga0495638_0133951 3300046460 Bacteria 1453
346 Ga0495638_0246244 3300046460 Bacteria 987
347 Ga0495651_0008564 3300046462 Bacteria 7839
348 Ga0495651_0082486 3300046462 Bacteria 2425
349 Ga0495653_0000102 3300046463 Bacteria 70205
350 Ga0495653_0002192 3300046463 Bacteria 15456
351 Ga0495653_0006028 3300046463 Bacteria 9926
352 Ga0495653_0027015 3300046463 Bacteria 4596
353 Ga0495653_0086375 3300046463 Bacteria 2305
354 Ga0495653_0269847 3300046463 Bacteria 1121
355 Ga0495653_0428136 3300046463 Bacteria 836
356 Ga0495650_0000248 3300046471 Bacteria 106527
357 Ga0495650_0000297 3300046471 Bacteria 90619
358 Ga0495650_0000356 3300046471 Bacteria 80805
359 Ga0495650_0001404 3300046471 Bacteria 23556
360 Ga0495650_0001655 3300046471 Bacteria 20604
361 Ga0495650_0002354 3300046471 Bacteria 15586
362 Ga0495650_0102520 3300046471 Bacteria 1073
363 Ga0495580_0311600 3300046472 Bacteria 1070
364 Ga0495580_0749259 3300046472 Bacteria 636
365 Ga0495582_0001046 3300046473 Bacteria 15523
366 Ga0495582_0008353 3300046473 Bacteria 5713
367 Ga0495582_0066525 3300046473 Bacteria 1991
368 Ga0495605_0000041 3300046474 Bacteria 193873
369 Ga0495605_0000284 3300046474 Bacteria 56120
370 Ga0495605_0000614 3300046474 Bacteria 27775
371 Ga0495605_0001332 3300046474 Bacteria 16335
372 Ga0495605_0010904 3300046474 Bacteria 5078
373 Ga0495605_0028409 3300046474 Bacteria 2887
374 Ga0495605_0031730 3300046474 Bacteria 2696
375 Ga0495605_0040483 3300046474 Bacteria 2326
376 Ga0495605_0070154 3300046474 Bacteria 1658
377 Ga0495605_0075370 3300046474 Bacteria 1586
378 Ga0495605_0102670 3300046474 Bacteria 1312
379 Ga0495605_0140134 3300046474 Bacteria 1085
380 Ga0495605_0290276 3300046474 Bacteria 693
381 Ga0495639_0023100 3300046475 Bacteria 2731
382 Ga0495584_0000013 3300046491 Bacteria 185735
383 Ga0495584_0000550 3300046491 Bacteria 25389
384 Ga0495584_0000972 3300046491 Bacteria 17980
385 Ga0495584_0002502 3300046491 Bacteria 10416
386 Ga0495584_0002582 3300046491 Bacteria 10214
387 Ga0495584_0005273 3300046491 Bacteria 6847
388 Ga0495584_0006292 3300046491 Bacteria 6220
389 Ga0495584_0012174 3300046491 Bacteria 4396
390 Ga0495584_0013174 3300046491 Bacteria 4219
391 Ga0495584_0029083 3300046491 Bacteria 2800
392 Ga0495584_0043842 3300046491 Bacteria 2258
393 Ga0495584_0047551 3300046491 Bacteria 2163
394 Ga0495584_0051293 3300046491 Bacteria 2077
395 Ga0495584_0057245 3300046491 Bacteria 1961
396 Ga0495584_0060960 3300046491 Bacteria 1896
397 Ga0495584_0067904 3300046491 Bacteria 1791
398 Ga0495584_0071291 3300046491 Bacteria 1746
399 Ga0495584_0247397 3300046491 Bacteria 906
400 Ga0495584_0276406 3300046491 Bacteria 853
401 Ga0495584_0321837 3300046491 Bacteria 785
402 Ga0495584_0333284 3300046491 Bacteria 770
403 Ga0495584_0401622 3300046491 Bacteria 696
404 Ga0495585_0000150 3300046492 Bacteria 75556
405 Ga0495585_0001052 3300046492 Bacteria 22828
406 Ga0495585_0001416 3300046492 Bacteria 18867
407 Ga0495585_0002993 3300046492 Bacteria 11666
408 Ga0495585_0007714 3300046492 Bacteria 6559
409 Ga0495585_0007869 3300046492 Bacteria 6483
410 Ga0495585_0008104 3300046492 Bacteria 6384
411 Ga0495585_0019082 3300046492 Bacteria 3957
412 Ga0495585_0037639 3300046492 Bacteria 2724
413 Ga0495585_0044444 3300046492 Bacteria 2481
414 Ga0495585_0054812 3300046492 Bacteria 2203
415 Ga0495585_0099319 3300046492 Bacteria 1558
416 Ga0495585_0115280 3300046492 Bacteria 1425
417 Ga0495585_0152892 3300046492 Bacteria 1202
418 Ga0495585_0159253 3300046492 Bacteria 1172
419 Ga0495585_0263363 3300046492 Bacteria 856
420 Ga0495585_0378113 3300046492 Bacteria 684
421 Ga0495594_0001996 3300046499 Bacteria 10636
422 Ga0495594_0003575 3300046499 Bacteria 7996
423 Ga0495594_0014485 3300046499 Bacteria 4133
424 Ga0495594_0020297 3300046499 Bacteria 3538
425 Ga0495594_0039661 3300046499 Bacteria 2575
426 Ga0495594_0073199 3300046499 Bacteria 1906
427 Ga0495596_0001797 3300046500 Bacteria 11937
428 Ga0495596_0001970 3300046500 Bacteria 11330
429 Ga0495596_0003353 3300046500 Bacteria 8139
430 Ga0495596_0005506 3300046500 Bacteria 5966
431 Ga0495596_0005656 3300046500 Bacteria 5870
432 Ga0495596_0012488 3300046500 Bacteria 3636
433 Ga0495596_0021655 3300046500 Bacteria 2621
434 Ga0495596_0027006 3300046500 Bacteria 2311
435 Ga0495596_0229092 3300046500 Bacteria 721
436 Ga0495607_0001687 3300046501 Bacteria 19018
437 Ga0495607_0001951 3300046501 Bacteria 17425
438 Ga0495607_0003768 3300046501 Bacteria 11464
439 Ga0495607_0012121 3300046501 Bacteria 5701
440 Ga0495607_0012539 3300046501 Bacteria 5589
441 Ga0495607_0021678 3300046501 Bacteria 4040
442 Ga0495607_0026290 3300046501 Bacteria 3612
443 Ga0495607_0035582 3300046501 Bacteria 3010
444 Ga0495607_0043495 3300046501 Bacteria 2655
445 Ga0495607_0047731 3300046501 Bacteria 2506
446 Ga0495607_0049899 3300046501 Bacteria 2438
447 Ga0495607_0100280 3300046501 Bacteria 1552
448 Ga0495607_0169549 3300046501 Bacteria 1103
449 Ga0495607_0173833 3300046501 Bacteria 1085
450 Ga0495607_0233644 3300046501 Bacteria 893
451 Ga0495583_0000063 3300046506 Bacteria 194362
452 Ga0495583_0000161 3300046506 Bacteria 113144
453 Ga0495583_0000220 3300046506 Bacteria 96267
454 Ga0495583_0000573 3300046506 Bacteria 50614
455 Ga0495583_0000839 3300046506 Bacteria 37397
456 Ga0495583_0003352 3300046506 Bacteria 12345
457 Ga0495583_0004154 3300046506 Bacteria 10584
458 Ga0495583_0012805 3300046506 Bacteria 4720
459 Ga0495583_0019410 3300046506 Bacteria 3549
460 Ga0495583_0021539 3300046506 Bacteria 3313
461 Ga0495583_0023952 3300046506 Bacteria 3077
462 Ga0495583_0026149 3300046506 Bacteria 2900
463 Ga0495583_0070711 3300046506 Bacteria 1534
464 Ga0495583_0100302 3300046506 Bacteria 1236
465 Ga0495583_0123073 3300046506 Bacteria 1090
466 Ga0495606_0000169 3300046507 Bacteria 115434
467 Ga0495606_0000187 3300046507 Bacteria 108140
468 Ga0495606_0000494 3300046507 Bacteria 64410
469 Ga0495606_0000609 3300046507 Bacteria 56606
470 Ga0495606_0001166 3300046507 Bacteria 37155
471 Ga0495606_0003491 3300046507 Bacteria 16650
472 Ga0495606_0004057 3300046507 Bacteria 14915
473 Ga0495606_0004324 3300046507 Bacteria 14290
474 Ga0495606_0014062 3300046507 Bacteria 6270
475 Ga0495606_0014578 3300046507 Bacteria 6118
476 Ga0495606_0016249 3300046507 Bacteria 5683
477 Ga0495606_0021080 3300046507 Bacteria 4781
478 Ga0495606_0023156 3300046507 Bacteria 4509
479 Ga0495606_0027832 3300046507 Bacteria 3999
480 Ga0495606_0044441 3300046507 Bacteria 2954
481 Ga0495606_0102083 3300046507 Bacteria 1744
482 Ga0495606_0144783 3300046507 Bacteria 1400
483 Ga0495606_0153038 3300046507 Bacteria 1352
484 Ga0495606_0198937 3300046507 Bacteria 1143
485 Ga0495608_0001695 3300046511 Bacteria 15804
486 Ga0495608_0008843 3300046511 Bacteria 7047
487 Ga0495610_0001163 3300046512 Bacteria 23950
488 Ga0495610_0001852 3300046512 Bacteria 18334
489 Ga0495610_0002889 3300046512 Bacteria 13903
490 Ga0495610_0011309 3300046512 Bacteria 5464
491 Ga0495610_0026885 3300046512 Bacteria 3066
492 Ga0495610_0093974 3300046512 Bacteria 1354
493 Ga0495616_0000644 3300046513 Bacteria 25952
494 Ga0495616_0000673 3300046513 Bacteria 25344
495 Ga0495616_0000838 3300046513 Bacteria 22407
496 Ga0495616_0007456 3300046513 Bacteria 6549
497 Ga0495616_0015301 3300046513 Bacteria 4266
498 Ga0495616_0016767 3300046513 Bacteria 4047
499 Ga0495616_0019935 3300046513 Bacteria 3653
500 Ga0495616_0023226 3300046513 Bacteria 3338
501 Ga0495616_0026850 3300046513 Bacteria 3058
502 Ga0495616_0038790 3300046513 Bacteria 2443
503 Ga0495616_0039683 3300046513 Bacteria 2409
504 Ga0495616_0044942 3300046513 Bacteria 2238
505 Ga0495616_0062104 3300046513 Bacteria 1830
506 Ga0495616_0077051 3300046513 Bacteria 1601
507 Ga0495616_0220707 3300046513 Bacteria 825
508 Ga0495618_0010248 3300046514 Bacteria 5670
509 Ga0495618_0217225 3300046514 Bacteria 1207
510 Ga0495620_0018095 3300046515 Bacteria 3495
511 Ga0495628_0001477 3300046516 Bacteria 21536
512 Ga0495628_0026883 3300046516 Bacteria 4684
513 Ga0495630_0069306 3300046517 Bacteria 2653
514 Ga0495630_0182260 3300046517 Bacteria 1601
515 Ga0495631_0003439 3300046518 Bacteria 8670
516 Ga0495631_0013417 3300046518 Bacteria 3977
517 Ga0495631_0015319 3300046518 Bacteria 3675
518 Ga0495631_0028788 3300046518 Bacteria 2532
519 Ga0495631_0037142 3300046518 Bacteria 2171
520 Ga0495631_0065594 3300046518 Bacteria 1571
521 Ga0495631_0079566 3300046518 Bacteria 1414
522 Ga0495631_0092553 3300046518 Bacteria 1301
523 Ga0495632_0000280 3300046519 Bacteria 50071
524 Ga0495632_0000959 3300046519 Bacteria 25226
525 Ga0495632_0001908 3300046519 Bacteria 16676
526 Ga0495632_0006230 3300046519 Bacteria 7715
527 Ga0495632_0032737 3300046519 Bacteria 2675
528 Ga0495632_0035794 3300046519 Bacteria 2529
529 Ga0495632_0040099 3300046519 Bacteria 2360
530 Ga0495632_0048198 3300046519 Bacteria 2110
531 Ga0495637_0000029 3300046520 Bacteria 143929
532 Ga0495637_0009751 3300046520 Bacteria 4673
533 Ga0495637_0057171 3300046520 Bacteria 1612
534 Ga0495637_0060307 3300046520 Bacteria 1558
535 Ga0495637_0156117 3300046520 Bacteria 858
536 Ga0495643_0000245 3300046522 Bacteria 80531
537 Ga0495643_0000517 3300046522 Bacteria 48097
538 Ga0495643_0001674 3300046522 Bacteria 19399
539 Ga0495643_0002014 3300046522 Bacteria 16943
540 Ga0495643_0027566 3300046522 Bacteria 3191
541 Ga0495643_0034203 3300046522 Bacteria 2805
542 Ga0495643_0035434 3300046522 Bacteria 2748
543 Ga0495643_0037582 3300046522 Bacteria 2654
544 Ga0495643_0073801 3300046522 Bacteria 1787
545 Ga0495643_0081629 3300046522 Bacteria 1681
546 Ga0495643_0337667 3300046522 Bacteria 677
547 Ga0495644_0002273 3300046523 Bacteria 7685
548 Ga0495644_0003806 3300046523 Bacteria 5936
549 Ga0495644_0011649 3300046523 Bacteria 3384
550 Ga0495644_0012217 3300046523 Bacteria 3301
551 Ga0495644_0017846 3300046523 Bacteria 2710
552 Ga0495644_0052387 3300046523 Bacteria 1532
553 Ga0495644_0053352 3300046523 Bacteria 1518
554 Ga0495644_0063353 3300046523 Bacteria 1389
555 Ga0495644_0067614 3300046523 Bacteria 1342
556 Ga0495648_0000004 3300046524 Bacteria 373639
557 Ga0495648_0000047 3300046524 Bacteria 166756
558 Ga0495648_0002640 3300046524 Bacteria 16282
559 Ga0495648_0010391 3300046524 Bacteria 7092
560 Ga0495648_0012788 3300046524 Bacteria 6233
561 Ga0495648_0013386 3300046524 Bacteria 6069
562 Ga0495648_0017457 3300046524 Bacteria 5128
563 Ga0495648_0043398 3300046524 Bacteria 2819
564 Ga0495648_0057399 3300046524 Bacteria 2335
565 Ga0495648_0069338 3300046524 Bacteria 2052
566 Ga0495648_0094064 3300046524 Bacteria 1670
567 Ga0495648_0104921 3300046524 Bacteria 1551
568 Ga0495648_0162016 3300046524 Bacteria 1155
569 Ga0495648_0176469 3300046524 Bacteria 1090
570 Ga0495663_0010443 3300046525 Bacteria 2584
571 Ga0495663_0014291 3300046525 Bacteria 2224
572 Ga0495663_0067581 3300046525 Bacteria 1133
573 Ga0495663_0067646 3300046525 Bacteria 1133
574 Ga0495663_0139130 3300046525 Bacteria 823
575 Ga0495666_0005439 3300046526 Bacteria 6416
576 Ga0495666_0005509 3300046526 Bacteria 6375
577 Ga0495666_0010419 3300046526 Bacteria 4635
578 Ga0495666_0035199 3300046526 Bacteria 2441
579 Ga0495666_0080157 3300046526 Bacteria 1545
580 Ga0495642_0000707 3300046528 Bacteria 16603
581 Ga0495642_0000925 3300046528 Bacteria 13753
582 Ga0495642_0008048 3300046528 Bacteria 4033
583 Ga0495642_0010762 3300046528 Bacteria 3504
584 Ga0495642_0014975 3300046528 Bacteria 3009
585 Ga0495642_0019680 3300046528 Bacteria 2647
586 Ga0495642_0026945 3300046528 Bacteria 2285
587 Ga0495642_0037955 3300046528 Bacteria 1950
588 Ga0495642_0043182 3300046528 Bacteria 1838
589 Ga0495642_0064902 3300046528 Bacteria 1519
590 Ga0495642_0069488 3300046528 Bacteria 1471
591 Ga0495642_0084868 3300046528 Bacteria 1336
592 Ga0495642_0085552 3300046528 Bacteria 1331
593 Ga0495642_0088305 3300046528 Bacteria 1310
594 Ga0495642_0107585 3300046528 Bacteria 1190
595 Ga0495642_0108713 3300046528 Bacteria 1184
596 Ga0495642_0222244 3300046528 Bacteria 824
597 Ga0495652_0011499 3300046529 Bacteria 8002
598 Ga0495652_0031560 3300046529 Bacteria 4638
599 Ga0495652_0072781 3300046529 Bacteria 2863
600 Ga0495652_0262714 3300046529 Bacteria 1273
601 Ga0495654_0000025 3300046530 Bacteria 236572
602 Ga0495654_0004114 3300046530 Bacteria 8728
603 Ga0495654_0034180 3300046530 Bacteria 2567
604 Ga0495654_0045637 3300046530 Bacteria 2161
605 Ga0495654_0054823 3300046530 Bacteria 1932
606 Ga0495654_0061427 3300046530 Bacteria 1804
607 Ga0495654_0094153 3300046530 Bacteria 1386
608 Ga0495665_0004037 3300046531 Bacteria 7920
609 Ga0495665_0030778 3300046531 Bacteria 2871
610 Ga0495665_0042804 3300046531 Bacteria 2409
611 Ga0495665_0078944 3300046531 Bacteria 1731
612 Ga0495665_0082842 3300046531 Bacteria 1686
613 Ga0495640_0235064 3300046533 Bacteria 1151
614 Ga0495640_0547966 3300046533 Bacteria 701
615 Ga0495586_0008401 3300046535 Bacteria 5495
616 Ga0495586_0013058 3300046535 Bacteria 4401
617 Ga0495586_0013968 3300046535 Bacteria 4260
618 Ga0495586_0109707 3300046535 Bacteria 1535
619 Ga0495587_0027319 3300046536 Bacteria 3475
620 Ga0495587_0199040 3300046536 Bacteria 1133
621 Ga0495598_0005700 3300046537 Bacteria 2777
622 Ga0495609_0000005 3300046538 Bacteria 439165
623 Ga0495609_0001551 3300046538 Bacteria 15042
624 Ga0495609_0002450 3300046538 Bacteria 11408
625 Ga0495609_0002738 3300046538 Bacteria 10611
626 Ga0495609_0004216 3300046538 Bacteria 7954
627 Ga0495609_0017751 3300046538 Bacteria 3301
628 Ga0495609_0021227 3300046538 Bacteria 2996
629 Ga0495609_0049904 3300046538 Bacteria 1866
630 Ga0495609_0051853 3300046538 Bacteria 1826
631 Ga0495609_0073300 3300046538 Bacteria 1502
632 Ga0495609_0079009 3300046538 Bacteria 1439
633 Ga0495609_0089366 3300046538 Bacteria 1340
634 Ga0495609_0141949 3300046538 Bacteria 1024
635 Ga0495621_0022367 3300046539 Bacteria 2095
636 Ga0495621_0140321 3300046539 Bacteria 945
637 Ga0495597_0000563 3300046542 Bacteria 30796
638 Ga0495597_0002604 3300046542 Bacteria 11239
639 Ga0495597_0003147 3300046542 Bacteria 9878
640 Ga0495597_0003284 3300046542 Bacteria 9574
641 Ga0495597_0005953 3300046542 Bacteria 6362
642 Ga0495597_0007880 3300046542 Bacteria 5372
643 Ga0495597_0019916 3300046542 Bacteria 3132
644 Ga0495597_0023976 3300046542 Bacteria 2819
645 Ga0495597_0045024 3300046542 Bacteria 1960
646 Ga0495597_0050654 3300046542 Bacteria 1832
647 Ga0495597_0076977 3300046542 Bacteria 1430
648 Ga0495597_0103959 3300046542 Bacteria 1195
649 Ga0495597_0175037 3300046542 Bacteria 869
650 Ga0495645_0013561 3300046543 Bacteria 5767
651 Ga0495645_0077035 3300046543 Bacteria 2398
652 Ga0495622_0000157 3300046557 Bacteria 57030
653 Ga0495622_0000500 3300046557 Bacteria 24597
654 Ga0495622_0016343 3300046557 Bacteria 3454
655 Ga0495622_0016775 3300046557 Bacteria 3411
656 Ga0495622_0017778 3300046557 Bacteria 3310
657 Ga0495622_0061564 3300046557 Bacteria 1737
658 Ga0495622_0068054 3300046557 Bacteria 1645
659 Ga0495622_0116639 3300046557 Bacteria 1220
660 Ga0495622_0277991 3300046557 Bacteria 732
661 Ga0495633_0000467 3300046558 Bacteria 41402
662 Ga0495633_0000472 3300046558 Bacteria 40822
663 Ga0495633_0003329 3300046558 Bacteria 10790
664 Ga0495633_0003381 3300046558 Bacteria 10675
665 Ga0495633_0005433 3300046558 Bacteria 7787
666 Ga0495633_0006297 3300046558 Bacteria 7067
667 Ga0495633_0007489 3300046558 Bacteria 6275
668 Ga0495633_0010420 3300046558 Bacteria 5071
669 Ga0495633_0011181 3300046558 Bacteria 4858
670 Ga0495633_0012377 3300046558 Bacteria 4541
671 Ga0495633_0014107 3300046558 Bacteria 4188
672 Ga0495633_0024284 3300046558 Bacteria 2997
673 Ga0495633_0029432 3300046558 Bacteria 2672
674 Ga0495633_0059713 3300046558 Bacteria 1787
675 Ga0495633_0064498 3300046558 Bacteria 1712
676 Ga0495633_0101075 3300046558 Bacteria 1338
677 Ga0495633_0235731 3300046558 Bacteria 836
678 Ga0495633_0387080 3300046558 Bacteria 632
679 Ga0495656_0010881 3300046615 Bacteria 3324
680 Ga0495656_0011715 3300046615 Bacteria 3221
681 Ga0495656_0343044 3300046615 Bacteria 773
682 Ga0495656_0510488 3300046615 Bacteria 638
683 Ga0495668_0000210 3300046616 Bacteria 84755
684 Ga0495668_0000219 3300046616 Bacteria 83081
685 Ga0495668_0000333 3300046616 Bacteria 64401
686 Ga0495668_0001190 3300046616 Bacteria 26426
687 Ga0495668_0004052 3300046616 Bacteria 10657
688 Ga0495668_0004067 3300046616 Bacteria 10617
689 Ga0495668_0004388 3300046616 Bacteria 10054
690 Ga0495668_0007970 3300046616 Bacteria 6677
691 Ga0495668_0013030 3300046616 Bacteria 4920
692 Ga0495668_0014801 3300046616 Bacteria 4566
693 Ga0495668_0018764 3300046616 Bacteria 3997
694 Ga0495668_0020133 3300046616 Bacteria 3838
695 Ga0495668_0024867 3300046616 Bacteria 3405
696 Ga0495668_0045191 3300046616 Bacteria 2447
697 Ga0495668_0428710 3300046616 Bacteria 727
698 Ga0495634_0010701 3300046642 Bacteria 6713
699 Ga0495634_0277526 3300046642 Bacteria 1019
700 Ga0495611_0000336 3300046648 Bacteria 30672
701 Ga0495611_0001499 3300046648 Bacteria 11585
702 Ga0495611_0001565 3300046648 Bacteria 11204
703 Ga0495611_0010689 3300046648 Bacteria 3886
704 Ga0495611_0013278 3300046648 Bacteria 3504
705 Ga0495611_0017678 3300046648 Bacteria 3052
706 Ga0495611_0041172 3300046648 Bacteria 2060
707 Ga0495611_0068028 3300046648 Bacteria 1625
708 Ga0495611_0091520 3300046648 Bacteria 1406
709 Ga0495611_0117584 3300046648 Bacteria 1239
710 Ga0495611_0126570 3300046648 Bacteria 1191
711 Ga0495611_0161329 3300046648 Bacteria 1047
712 Ga0495625_0000412 3300046660 Bacteria 64883
713 Ga0495625_0000821 3300046660 Bacteria 42765
714 Ga0495625_0001604 3300046660 Bacteria 26732
715 Ga0495625_0002389 3300046660 Bacteria 20388
716 Ga0495625_0010280 3300046660 Bacteria 7758
717 Ga0495625_0015331 3300046660 Bacteria 6073
718 Ga0495625_0018833 3300046660 Bacteria 5376
719 Ga0495625_0026294 3300046660 Bacteria 4400
720 Ga0495625_0027262 3300046660 Bacteria 4304
721 Ga0495625_0037139 3300046660 Bacteria 3575
722 Ga0495625_0166697 3300046660 Bacteria 1472
723 Ga0495625_0253278 3300046660 Bacteria 1142
724 Ga0495625_0283143 3300046660 Bacteria 1066
725 Ga0495635_0005531 3300046663 Bacteria 8790
726 Ga0495635_0022214 3300046663 Bacteria 4418
727 Ga0495635_0393322 3300046663 Bacteria 921
728 Ga0495659_0000010 3300046664 Bacteria 87574
729 Ga0495659_0012562 3300046664 Bacteria 2745
730 Ga0495659_0018764 3300046664 Bacteria 2308
731 Ga0495659_0028004 3300046664 Bacteria 1947
732 Ga0495659_0066207 3300046664 Bacteria 1345
733 Ga0495661_0000613 3300046665 Bacteria 36356
734 Ga0495661_0000794 3300046665 Bacteria 29925
735 Ga0495661_0002649 3300046665 Bacteria 13700
736 Ga0495661_0007511 3300046665 Bacteria 7598
737 Ga0495661_0011228 3300046665 Bacteria 6079
738 Ga0495661_0013468 3300046665 Bacteria 5490
739 Ga0495661_0014914 3300046665 Bacteria 5194
740 Ga0495661_0015701 3300046665 Bacteria 5047
741 Ga0495661_0021272 3300046665 Bacteria 4230
742 Ga0495661_0026984 3300046665 Bacteria 3692
743 Ga0495661_0037400 3300046665 Bacteria 3030
744 Ga0495661_0044511 3300046665 Bacteria 2720
745 Ga0495661_0093555 3300046665 Bacteria 1705
746 Ga0495661_0096071 3300046665 Bacteria 1676
747 Ga0495661_0117592 3300046665 Bacteria 1472
748 Ga0495661_0181574 3300046665 Bacteria 1115
749 Ga0495661_0189947 3300046665 Bacteria 1082
750 Ga0495661_0222464 3300046665 Bacteria 977
751 Ga0495661_0252868 3300046665 Bacteria 898
752 Ga0495588_0000059 3300046674 Bacteria 263358
753 Ga0495588_0014575 3300046674 Bacteria 3763
754 Ga0495588_0014966 3300046674 Bacteria 3723
755 Ga0495588_0020374 3300046674 Bacteria 3258
756 Ga0495588_0025634 3300046674 Bacteria 2939
757 Ga0495588_0037690 3300046674 Bacteria 2457
758 Ga0495588_0091166 3300046674 Bacteria 1597
759 Ga0495588_0114443 3300046674 Bacteria 1421
760 Ga0495588_0117194 3300046674 Bacteria 1403
761 Ga0495588_0124438 3300046674 Bacteria 1359
762 Ga0495588_0130369 3300046674 Bacteria 1326
763 Ga0495588_0158389 3300046674 Bacteria 1197
764 Ga0495588_0195908 3300046674 Bacteria 1067
765 Ga0495657_0015496 3300046675 Bacteria 5577
766 Ga0495657_0525874 3300046675 Bacteria 688
767 Ga0495599_0058762 3300046678 Bacteria 2405
768 Ga0495599_0144623 3300046678 Bacteria 1474
769 Ga0495623_0007728 3300046679 Bacteria 6989
770 Ga0495623_0014841 3300046679 Bacteria 5038
771 Ga0495623_0015129 3300046679 Bacteria 4988
772 Ga0495623_0087224 3300046679 Bacteria 1922
773 Ga0495646_0001070 3300046680 Bacteria 15892
774 Ga0495646_0007728 3300046680 Bacteria 6833
775 Ga0495646_0170595 3300046680 Bacteria 1199
776 Ga0495658_0127742 3300046683 Bacteria 1544
777 Ga0495669_0000240 3300046684 Bacteria 32062
778 Ga0495669_0000324 3300046684 Bacteria 26117
779 Ga0495669_0007418 3300046684 Bacteria 4599
780 Ga0495669_0019826 3300046684 Bacteria 2904
781 Ga0495669_0028499 3300046684 Bacteria 2446
782 Ga0495669_0029737 3300046684 Bacteria 2396
783 Ga0495613_0039779 3300046689 Bacteria 3485
784 Ga0495613_0043486 3300046689 Bacteria 3323
785 Ga0495613_0048789 3300046689 Bacteria 3126
786 Ga0495624_0028520 3300046690 Bacteria 3647
787 Ga0495624_0162046 3300046690 Bacteria 1366
788 Ga0495624_0437914 3300046690 Bacteria 783
789 Ga0495624_0546880 3300046690 Bacteria 691
790 Ga0495670_0009935 3300046691 Bacteria 4677
791 Ga0495670_0013340 3300046691 Bacteria 4042
792 Ga0495670_0020514 3300046691 Bacteria 3259
793 Ga0495670_0022264 3300046691 Bacteria 3128
794 Ga0495670_0026585 3300046691 Bacteria 2865
795 Ga0495670_0055784 3300046691 Bacteria 1981
796 Ga0495670_0061434 3300046691 Bacteria 1889
797 Ga0495670_0085137 3300046691 Bacteria 1613
798 Ga0495670_0085252 3300046691 Bacteria 1612
799 Ga0495670_0157708 3300046691 Bacteria 1191
800 Ga0495670_0191862 3300046691 Bacteria 1080
801 Ga0495670_0322396 3300046691 Bacteria 829
802 Ga0495670_0387946 3300046691 Bacteria 754
803 Ga0495671_0000609 3300046692 Bacteria 26284
804 Ga0495671_0000614 3300046692 Bacteria 26133
805 Ga0495671_0002097 3300046692 Bacteria 12775
806 Ga0495671_0022260 3300046692 Bacteria 3322
807 Ga0495671_0041373 3300046692 Bacteria 2320
808 Ga0495671_0128878 3300046692 Bacteria 1234
809 Ga0495671_0177247 3300046692 Bacteria 1035
810 Ga0495671_0221251 3300046692 Bacteria 916
811 Ga0495671_0344078 3300046692 Bacteria 715
812 Ga0495671_0423823 3300046692 Bacteria 636
813 Ga0495649_0000644 3300046694 Bacteria 28394
814 Ga0495649_0003103 3300046694 Bacteria 11372
815 Ga0495649_0012829 3300046694 Bacteria 4859
816 Ga0495649_0025911 3300046694 Bacteria 3265
817 Ga0495649_0049376 3300046694 Bacteria 2285
818 Ga0495649_0063271 3300046694 Bacteria 1988
819 Ga0495649_0128657 3300046694 Bacteria 1337
820 Ga0495649_0269489 3300046694 Bacteria 871
821 Ga0495589_0000212 3300046794 Bacteria 49440
822 Ga0495589_0000358 3300046794 Bacteria 35427
823 Ga0495589_0001945 3300046794 Bacteria 11691
824 Ga0495589_0015330 3300046794 Bacteria 3946
825 Ga0495589_0028349 3300046794 Bacteria 2826
826 Ga0495589_0036559 3300046794 Bacteria 2461
827 Ga0495589_0046986 3300046794 Bacteria 2140
828 Ga0495589_0059055 3300046794 Bacteria 1886
829 Ga0495589_0215071 3300046794 Bacteria 904
830 Ga0495589_0458202 3300046794 Bacteria 583
831 Ga0495600_0031789 3300046809 Bacteria 3421
832 Ga0495600_0508627 3300046809 Bacteria 739
833 Ga0495660_0000301 3300046810 Bacteria 44739
834 Ga0495660_0000789 3300046810 Bacteria 23709
835 Ga0495660_0002992 3300046810 Bacteria 10547
836 Ga0495660_0013874 3300046810 Bacteria 4670
837 Ga0495660_0044397 3300046810 Bacteria 2445
838 Ga0495660_0049491 3300046810 Bacteria 2294
839 Ga0495660_0054119 3300046810 Bacteria 2175
840 Ga0495660_0071376 3300046810 Bacteria 1841
841 Ga0495581_0001466 3300047315 Bacteria 13108
842 Ga0495581_0016670 3300047315 Bacteria 4271
843 Ga0495581_0024866 3300047315 Bacteria 3469
844 Ga0495581_0085580 3300047315 Bacteria 1827
845 Ga0495604_0004528 3300047317 Bacteria 11009
846 Ga0495604_0009345 3300047317 Bacteria 7760
847 Ga0495604_0013433 3300047317 Bacteria 6523
848 Ga0495604_0060323 3300047317 Bacteria 2905
849 Ga0495604_0070037 3300047317 Bacteria 2657
850 Ga0495636_0002971 3300047318 Bacteria 6555
851 Ga0495636_0006765 3300047318 Bacteria 4507
852 Ga0495636_0006779 3300047318 Bacteria 4503
853 Ga0495636_0145312 3300047318 Bacteria 1061
854 Ga0495636_0163558 3300047318 Bacteria 1003
855 Ga0495674_0012252 3300047319 Bacteria 8080
856 Ga0495674_0092025 3300047319 Bacteria 2590
857 Ga0495674_0645660 3300047319 Bacteria 835
858 Ga0495672_0000078 3300047320 Bacteria 164474
859 Ga0495672_0000107 3300047320 Bacteria 132267
860 Ga0495672_0000431 3300047320 Bacteria 50205
861 Ga0495672_0001709 3300047320 Bacteria 21262
862 Ga0495672_0001925 3300047320 Bacteria 19641
863 Ga0495672_0002234 3300047320 Bacteria 18011
864 Ga0495672_0002438 3300047320 Bacteria 17117
865 Ga0495672_0007705 3300047320 Bacteria 8061
866 Ga0495672_0051279 3300047320 Bacteria 2431
867 Ga0495672_0063440 3300047320 Bacteria 2120
868 Ga0495672_0256789 3300047320 Bacteria 845
869 Ga0495672_0421865 3300047320 Bacteria 606
870 Ga0495676_0000069 3300047321 Bacteria 78689
871 Ga0495676_0037898 3300047321 Bacteria 4008
872 Ga0495676_0072388 3300047321 Bacteria 2647
873 Ga0495676_0242128 3300047321 Bacteria 1234
874 Ga0495680_0014259 3300047322 Bacteria 6892
875 Ga0495680_0110675 3300047322 Bacteria 2035
876 Ga0495680_0195764 3300047322 Bacteria 1452
877 Ga0495680_0929057 3300047322 Bacteria 560
878 Ga0495683_0000221 3300047323 Bacteria 53874
879 Ga0495683_0000559 3300047323 Bacteria 28050
880 Ga0495683_0001444 3300047323 Bacteria 15592
881 Ga0495683_0003435 3300047323 Bacteria 9243
882 Ga0495683_0026958 3300047323 Bacteria 2939
883 Ga0495683_0031928 3300047323 Bacteria 2683
884 Ga0495683_0034280 3300047323 Bacteria 2581
885 Ga0495683_0048107 3300047323 Bacteria 2138
886 Ga0495683_0103049 3300047323 Bacteria 1370
887 Ga0495683_0200183 3300047323 Bacteria 901
888 Ga0495687_000221 3300047443 Bacteria 80968
889 Ga0495687_000562 3300047443 Bacteria 43714
890 Ga0495687_000714 3300047443 Bacteria 36793
891 Ga0495687_000828 3300047443 Bacteria 33075
892 Ga0495687_000917 3300047443 Bacteria 30658
893 Ga0495687_002375 3300047443 Bacteria 15204
894 Ga0495687_004864 3300047443 Bacteria 8822
895 Ga0495687_005631 3300047443 Bacteria 7913
896 Ga0495675_0045253 3300047444 Bacteria 2802
897 Ga0495675_0054928 3300047444 Bacteria 2526
898 Ga0495675_0290282 3300047444 Bacteria 973
899 Ga0495677_0000060 3300047445 Bacteria 61831
900 Ga0495677_0000616 3300047445 Bacteria 14512
901 Ga0495677_0002470 3300047445 Bacteria 7260
902 Ga0495677_0004463 3300047445 Bacteria 5371
903 Ga0495677_0006273 3300047445 Bacteria 4491
904 Ga0495677_0015946 3300047445 Bacteria 2727
905 Ga0495677_0016528 3300047445 Bacteria 2678
906 Ga0495677_0020808 3300047445 Bacteria 2377
907 Ga0495677_0021284 3300047445 Bacteria 2350
908 Ga0495677_0047727 3300047445 Bacteria 1572
909 Ga0495677_0058985 3300047445 Bacteria 1420
910 Ga0495677_0065026 3300047445 Bacteria 1355
911 Ga0495677_0067204 3300047445 Bacteria 1333
912 Ga0495677_0118745 3300047445 Bacteria 1007
913 Ga0495677_0438822 3300047445 Bacteria 517
914 Ga0495679_003216 3300047446 Bacteria 7935
915 Ga0495679_022299 3300047446 Bacteria 2169
916 Ga0495679_042477 3300047446 Bacteria 1402
917 Ga0495679_050040 3300047446 Bacteria 1258
918 Ga0495685_000340 3300047447 Bacteria 14999
919 Ga0495685_000345 3300047447 Bacteria 14907
920 Ga0495685_002067 3300047447 Bacteria 6236
921 Ga0495685_004743 3300047447 Bacteria 4410
922 Ga0495685_007976 3300047447 Bacteria 3507
923 Ga0495685_084209 3300047447 Bacteria 1057
924 Ga0495673_0000074 3300047469 Bacteria 210788
925 Ga0495673_0000194 3300047469 Bacteria 96014
926 Ga0495673_0017975 3300047469 Bacteria 3576
927 Ga0495673_0018985 3300047469 Bacteria 3453
928 Ga0495681_0000330 3300047470 Bacteria 37408
929 Ga0495681_0002881 3300047470 Bacteria 12160
930 Ga0495681_0013049 3300047470 Bacteria 4848
931 Ga0495681_0014169 3300047470 Bacteria 4586
932 Ga0495681_0023519 3300047470 Bacteria 3271
933 Ga0495681_0025337 3300047470 Bacteria 3103
934 Ga0495681_0028763 3300047470 Bacteria 2854
935 Ga0495681_0049171 3300047470 Bacteria 1994
936 Ga0495681_0076980 3300047470 Bacteria 1498
937 Ga0495681_0105747 3300047470 Bacteria 1224
938 Ga0495681_0140960 3300047470 Bacteria 1018
939 Ga0495681_0319686 3300047470 Bacteria 596
940 Ga0495686_0000387 3300047472 Bacteria 70185
941 Ga0495686_0001928 3300047472 Bacteria 20665
942 Ga0495686_0004503 3300047472 Bacteria 11437
943 Ga0495686_0065291 3300047472 Bacteria 2250
944 Ga0495686_0248413 3300047472 Bacteria 1000
945 Ga0495593_0003624 3300047673 Bacteria 9220
946 Ga0495593_0007992 3300047673 Bacteria 6158
947 Ga0495593_0012915 3300047673 Bacteria 4770
948 Ga0495593_0107776 3300047673 Bacteria 1424
949 Ga0495593_0127022 3300047673 Bacteria 1296
950 Ga0495602_0001744 3300048088 Bacteria 21687
951 Ga0495602_0025892 3300048088 Bacteria 5669
952 Ga0495602_0029800 3300048088 Bacteria 5188
953 Ga0495602_0173033 3300048088 Bacteria 1674
954 Ga0495602_0394976 3300048088 Bacteria 987
955 Ga0495614_0004592 3300048089 Bacteria 6216
956 Ga0495614_0005888 3300048089 Bacteria 5525
957 Ga0495614_0126677 3300048089 Bacteria 1128
958 Ga0495614_0174154 3300048089 Bacteria 966
959 Ga0495615_0018444 3300048090 Bacteria 1536
960 Ga0495615_0027387 3300048090 Bacteria 1337
961 Ga0495626_0000058 3300048091 Bacteria 147007
962 Ga0495626_0000196 3300048091 Bacteria 73575
963 Ga0495626_0001643 3300048091 Bacteria 17320
964 Ga0495626_0004639 3300048091 Bacteria 8354
965 Ga0495626_0006899 3300048091 Bacteria 6398
966 Ga0495626_0009308 3300048091 Bacteria 5312
967 Ga0495626_0012406 3300048091 Bacteria 4468
968 Ga0495626_0014002 3300048091 Bacteria 4151
969 Ga0495626_0023626 3300048091 Bacteria 3024
970 Ga0495626_0073015 3300048091 Bacteria 1537
971 Ga0495626_0073750 3300048091 Bacteria 1528
972 Ga0495626_0077093 3300048091 Bacteria 1486
973 Ga0495626_0085609 3300048091 Bacteria 1393
974 Ga0495626_0113586 3300048091 Bacteria 1170
975 Ga0495626_0129526 3300048091 Bacteria 1078
976 Ga0495626_0195981 3300048091 Bacteria 830
977 Ga0495626_0256812 3300048091 Bacteria 699
978 Ga0496100_0050289 3300048903 Bacteria 2700
979 Ga0496100_0201263 3300048903 Bacteria 1451
980 Ga0496100_0476725 3300048903 Bacteria 959
981 Ga0496100_1443835 3300048903 Bacteria 543
982 Ga0496101_0042334 3300048904 Bacteria 3251
983 Ga0496101_0419980 3300048904 Bacteria 1054
984 Ga0496102_0000097 3300048905 Bacteria 124414
985 Ga0496102_0000420 3300048905 Bacteria 48887
986 Ga0496102_0132791 3300048905 Bacteria 2331
987 Ga0496102_0134253 3300048905 Bacteria 2318
988 Ga0496102_0144595 3300048905 Bacteria 2231
989 Ga0496102_0147683 3300048905 Bacteria 2207
990 Ga0496102_0171826 3300048905 Bacteria 2040
991 Ga0496102_0685750 3300048905 Bacteria 948
992 Ga0496103_0002958 3300048906 Bacteria 10527
993 Ga0496103_0007291 3300048906 Bacteria 6590
994 Ga0496103_0021322 3300048906 Bacteria 3897
995 Ga0496103_0068974 3300048906 Bacteria 2210
996 Ga0496103_0077756 3300048906 Bacteria 2083
997 Ga0496104_0107089 3300048907 Bacteria 2679
998 Ga0496104_0820537 3300048907 Bacteria 836
999 Ga0496104_0974122 3300048907 Bacteria 752
1000 Ga0496105_0049437 3300048908 Bacteria 3472
1001 Ga0496106_0033410 3300048909 Bacteria 3838
1002 Ga0496106_0136225 3300048909 Bacteria 1929
1003 Ga0496107_0114013 3300048910 Bacteria 1988
1004 Ga0496107_0428015 3300048910 Bacteria 984
1005 Ga0496108_0064336 3300048911 Bacteria 3090
1006 Ga0496108_0393521 3300048911 Bacteria 1210
1007 Ga0496109_0129843 3300048912 Bacteria 2351
1008 Ga0496109_0490723 3300048912 Bacteria 1159
1009 Ga0496110_0004041 3300048913 Bacteria 11322
1010 Ga0496110_0018254 3300048913 Bacteria 5880
1011 Ga0496110_0028850 3300048913 Bacteria 4769
1012 Ga0496110_0454063 3300048913 Bacteria 1168
1013 Ga0496111_0051200 3300048914 Bacteria 2981
1014 Ga0496111_0509074 3300048914 Bacteria 886
1015 Ga0496113_0015989 3300048916 Bacteria 5175
1016 Ga0496113_1256873 3300048916 Bacteria 577
1017 Ga0496114_0409890 3300048917 Bacteria 1200
1018 Ga0496115_0006572 3300048918 Bacteria 8521
1019 Ga0496115_0208747 3300048918 Bacteria 1613
1020 Ga0496115_0627578 3300048918 Bacteria 852
1021 Ga0496115_0680601 3300048918 Bacteria 810
1022 Ga0496115_0701547 3300048918 Bacteria 795
1023 Ga0496115_0813234 3300048918 Bacteria 726
1024 Ga0496115_1096931 3300048918 Bacteria 603
1025 Ga0496116_0003789 3300048919 Bacteria 14777
1026 Ga0496116_0012419 3300048919 Bacteria 6960
1027 Ga0496117_0000056 3300048920 Bacteria 271417
1028 Ga0496117_0190466 3300048920 Bacteria 1169
1029 Ga0496118_0000047 3300048921 Bacteria 271417
1030 Ga0496121_0015850 3300048924 Bacteria 7836
1031 Ga0496121_0031019 3300048924 Bacteria 4896
1032 Ga0496121_0075013 3300048924 Bacteria 2703
1033 Ga0496121_0093062 3300048924 Bacteria 2348
1034 Ga0496121_0110221 3300048924 Bacteria 2101
1035 Ga0496121_0121260 3300048924 Bacteria 1974
1036 Ga0496121_0269046 3300048924 Bacteria 1172
1037 Ga0496122_0002132 3300048925 Bacteria 29082
1038 Ga0496122_0003733 3300048925 Bacteria 19656
1039 Ga0496122_0003878 3300048925 Bacteria 19185
1040 Ga0496122_0025683 3300048925 Bacteria 5106
1041 Ga0496122_0068413 3300048925 Bacteria 2549
1042 Ga0496122_0348081 3300048925 Bacteria 775
1043 Ga0496123_0000912 3300048926 Bacteria 46427
1044 Ga0496123_0003558 3300048926 Bacteria 17279
1045 Ga0496123_0026054 3300048926 Bacteria 4392
1046 Ga0496123_0041317 3300048926 Bacteria 3199
1047 Ga0496123_0056764 3300048926 Bacteria 2555
1048 Ga0496124_0007788 3300048927 Bacteria 11313
1049 Ga0496124_0019066 3300048927 Bacteria 6401
1050 Ga0496124_0029459 3300048927 Bacteria 4890
1051 Ga0496124_0122850 3300048927 Bacteria 2072
1052 Ga0496124_0138806 3300048927 Bacteria 1921
1053 Ga0496124_0394913 3300048927 Bacteria 962
1054 Ga0496124_0497765 3300048927 Bacteria 818
1055 Ga0496124_0710954 3300048927 Bacteria 635
1056 Ga0496125_0000368 3300048928 Bacteria 84924
1057 Ga0496125_0008339 3300048928 Bacteria 10871
1058 Ga0496125_0046906 3300048928 Bacteria 3619
1059 Ga0496125_0117526 3300048928 Bacteria 1906
1060 Ga0496126_0025776 3300048929 Bacteria 5649
1061 Ga0496126_0480852 3300048929 Bacteria 995
1062 Ga0501304_023692 3300049160 Bacteria 622
1063 Ga0495678_000013 3300049459 Bacteria 316375
1064 Ga0495678_000146 3300049459 Bacteria 85995
1065 Ga0495678_001534 3300049459 Bacteria 17833
1066 Ga0495678_003140 3300049459 Bacteria 10447
1067 Ga0495678_003408 3300049459 Bacteria 9870
1068 Ga0495678_007836 3300049459 Bacteria 5488
1069 Ga0495678_014197 3300049459 Bacteria 3711
1070 Ga0495678_021447 3300049459 Bacteria 2844
1071 Ga0495678_033575 3300049459 Bacteria 2117
1072 Ga0495682_0001326 3300049460 Bacteria 13739
1073 Ga0495682_0008409 3300049460 Bacteria 4063
1074 Ga0495682_0019648 3300049460 Bacteria 2539
1075 Ga0495682_0046075 3300049460 Bacteria 1592
1076 Ga0495682_0123234 3300049460 Bacteria 928
1077 Ga0501315_045540 3300049531 Bacteria 676
1078 Ga0501034_0234557 3300049571 Bacteria 1783
1079 Ga0501036_0227975 3300049572 Bacteria 1564
1080 Ga0501038_0253661 3300049574 Bacteria 1393
1081 Ga0501039_0495175 3300049575 Bacteria 960
1082 Ga0501222_012880 3300049662 Bacteria 1102
1083 Ga0501227_002984 3300049665 Bacteria 3697
1084 Ga0501238_018809 3300049671 Bacteria 968
1085 Ga0501249_038439 3300049679 Bacteria 1081
1086 Ga0501252_054961 3300049682 Bacteria 610
1087 Ga0501279_003909 3300049775 Bacteria 1949
1088 Ga0501279_012128 3300049775 Bacteria 1171
1089 Ga0501035_0007367 3300049822 Bacteria 10283
1090 Ga0501044_0230230 3300049823 Bacteria 1801
1091 Ga0501044_0314085 3300049823 Bacteria 1493
1092 nmdc:mga0k408_414306_c1 3300050493 Bacteria 801
1093 Ga0495601_0005679 3300053077 Bacteria 7273
1094 Ga0500572_172435 3300053111 Bacteria 708
1095 Ga0500594_0122602 3300053118 Bacteria 817
1096 Ga0500595_005622 3300053119 Bacteria 5450
1097 Ga0500618_000115 3300053125 Bacteria 65284
1098 Ga0500573_0148389 3300053140 Bacteria 1286
1099 Ga0500574_005403 3300053141 Bacteria 2485
1100 Ga0500586_022095 3300053145 Bacteria 2015
1101 Ga0500619_001637 3300053154 Bacteria 4031
1102 Ga0466962_0132893 3300061719 Bacteria 1203
1103 Ga0466962_0442978 3300061719 Bacteria 653
1104 2511250511 2511231003 Bacteria 5606035
1105 2521560585 2521172590 Bacteria 5047645
1106 2550692243 2548876994 Bacteria 4904866
1107 2553005705 2551306416 Bacteria 6152985
1108 2601671895 2600255292 Bacteria 6300551
1109 2643797137 2643221556 Bacteria 7251154
1110 2644028079 2643221603 Bacteria 6147767
1111 2644250788 2643221645 Bacteria 7207331
1112 2644358311 2643221664 Bacteria 7272945
1113 2644469759 2643221684 Bacteria 7145183
1114 2738739247 2738541280 Bacteria 6630198
1115 2738846971 2738541300 Bacteria 6675882
1116 2739276029 2738543018 Bacteria 6718814
1117 2739345073 2738543030 Bacteria 6719714
1118 2765571837 2765235838 Bacteria 5445269
1119 2808982158 2808606386 Bacteria 4471946
1120 2809130042 2808606415 Bacteria 4576710
1121 2809147442 2808606418 Bacteria 6724496
1122 2809148903 2808606419 Bacteria 4576925
1123 2819542237 2818991436 Bacteria 5376622
1124 2819595603 2818991445 Bacteria 4955017
1125 2819617278 2818991449 Bacteria 5518009
1126 2821136132 2821131069 Bacteria 6108407
1127 2839098442 2839094727 Bacteria 5534556
1128 2842717847 2842711865 Bacteria 7155354
1129 2852619038 2852618963 Bacteria 4577824
1130 2857552257 2857547612 Bacteria 6179999
1131 2857556656 2857553236 Bacteria 6166726
1132 2857563513 2857558681 Bacteria 6617694
1133 2857569503 2857564685 Bacteria 6290584
1134 2884816193 2884811622 Bacteria 5552861
1135 2884839364 2884836552 Bacteria 5219991
1136 2884856826 2884852848 Bacteria 5221161
1137 2885082342 2885080285 Bacteria 6355622
1138 2896158172 2896154374 Bacteria 5221518
1139 2904429663 2904424332 Bacteria 7633521
1140 2904442917 2904439833 Bacteria 5931679
1141 2904534883 2904530477 Bacteria 5876334
1142 2904588774 2904584206 Bacteria 6028872
1143 2904594152 2904589729 Bacteria 6113573
1144 2904605010 2904601388 Bacteria 5884906
1145 2919048584 2919046199 Bacteria 5567169
1146 2919083244 2919079590 Bacteria 5946433
1147 2919480592 2919476304 Bacteria 5888696
1148 2923514388 2923510766 Bacteria 5926163
1149 2928133104 2928130867 Bacteria 5467269
1150 2932415085 2932410948 Bacteria 6312192
1151 2932421267 2932416698 Bacteria 6315112
1152 8047676576 8047673197 Bacteria 7395230
1153 Ga0373937_0992070
1154 JGI25155J39150_1000140
1155 JGI25155J39150_1000167
1156 JGI25156J39149_1002433
1157 JGI25156J39149_1025861
1158 JGI25162J39368_1000023
1159 JGI25154J39366_1000372
1160 JGI25154J39366_1000748
1161 JGI25157J39369_1000294
1162 JGI25157J39369_1000325
1163 JGI25163J39215_1002428
1164 JGI25152J39213_1000994
1165 JGI25150J39212_1000752
1166 JGI25150J39212_1013251
1167 JGI25159J45721_1009822
1168 JGI25165J46597_1000030
1169 JGI25153J46596_10004853
1170 JGI25153J46596_10018261
1171 rootL2_10105411
1172 rootH1_10039759
1173 rootH1_10115661
1174 JGI25161J50226_1012496
1175 Ga0055538_1000017
1176 Ga0055538_1000024
1177 Ga0055539_1000022
1178 Ga0055539_1000031
1179 Ga0055533_1000030
1180 Ga0055533_1000041
1181 Ga0055532_1000074
1182 Ga0055525_1000034
1183 Ga0055525_1000049
1184 Ga0055525_1000179
1185 Ga0055535_1005537
1186 Ga0055529_1000027
1187 Ga0055526_1001365
1188 Ga0055526_1001772
1189 Ga0055537_1000172
1190 Ga0055524_1000022
1191 Ga0055524_1001210
1192 Ga0055524_1002507
1193 Ga0055534_1000169
1194 Ga0055528_1000482
1195 Ga0055528_1000486
1196 Ga0055541_1000015
1197 Ga0055541_1000022
1198 Ga0065165_1000882
1199 Ga0065165_1004612
1200 Ga0065165_1041648
1201 Ga0065165_1046410
1202 Ga0065165_1062279
1203 Ga0065165_1070869
1204 Ga0065715_10200078
1205 Ga0070658_10348972
1206 Ga0070658_10974423
1207 Ga0070676_10584703
1208 Ga0070670_100005639
1209 Ga0070666_10913056
1210 Ga0070680_100274743
1211 Ga0070682_100027341
1212 Ga0070660_100018318
1213 Ga0070660_100028962
1214 Ga0070660_100079477
1215 Ga0070661_100008198
1216 Ga0070659_100001280
1217 Ga0070659_100233173
1218 Ga0070659_100672983
1219 Ga0070663_100457055
1220 Ga0068853_100383036
1221 Ga0068855_100004477
1222 Ga0068855_100005723
1223 Ga0068855_100062139
1224 Ga0068855_100116543
1225 Ga0070664_100065165
1226 Ga0070664_100078854
1227 Ga0070664_100198424
1228 Ga0068857_100045181
1229 Ga0068857_101331131
1230 Ga0068854_100024293
1231 Ga0068856_100385673
1232 Ga0068856_100461677
1233 Ga0068856_100949085
1234 Ga0068852_100058152
1235 Ga0068852_100303035
1236 Ga0068852_101203897
1237 Ga0068851_10148005
1238 Ga0070717_10125503
1239 Ga0070712_100021282
1240 Ga0075366_10254317
1241 Ga0099823_1126674
1242 Ga0079104_1008805
1243 Ga0099826_10000006
1244 Ga0105244_10002568
1245 Ga0105244_10021821
1246 Ga0105244_10050256
1247 Ga0105240_10000718
1248 Ga0105240_10002320
1249 Ga0105241_10024076
1250 Ga0105237_10004756
1251 Ga0105237_10037524
1252 Ga0105237_10104871
1253 Ga0105238_10000107
1254 Ga0105238_10234605
1255 Ga0105238_10241190
1256 Ga0105239_10000289
1257 Ga0105239_11963486
1258 Ga0105246_10059845
1259 Ga0105246_10230040
1260 Ga0157373_10087839
1261 Ga0157371_10000153
1262 Ga0157369_10765435
1263 Ga0182008_10001831
1264 Ga0182008_10017379
1265 Ga0182008_10018149
1266 Ga0182006_1000030
1267 Ga0182006_1000138
1268 Ga0182006_1018305
1269 Ga0182006_1029740
1270 Ga0182006_1064314
1271 Ga0182007_10000037
1272 Ga0182007_10001653
1273 Ga0182007_10006560
1274 Ga0182007_10019533
1275 Ga0182007_10070104
1276 Ga0182007_10091026
1277 Ga0182005_1000021
1278 Ga0182005_1000046
1279 Ga0182005_1000207
1280 Ga0163161_10004787
1281 Ga0163161_10476551
1282 Ga0213872_10000403
1283 Ga0213872_10016939
1284 Ga0213872_10061308
1285 Ga0213872_10292951
1286 Ga0209435_100055
1287 Ga0209435_100248
1288 Ga0209760_102502
1289 Ga0209784_100018
1290 Ga0209784_100034
1291 Ga0209566_100016
1292 Ga0209566_100038
1293 Ga0209674_100030
1294 Ga0209674_100056
1295 Ga0209147_100097
1296 Ga0209563_100034
1297 Ga0209563_100057
1298 Ga0209563_100143
1299 Ga0207427_100929
1300 Ga0209437_100071
1301 Ga0209437_100234
1302 Ga0209437_103273
1303 Ga0209437_112155
1304 Ga0209258_100192
1305 Ga0207425_1000013
1306 Ga0207425_1000675
1307 Ga0209646_1000103
1308 Ga0209646_1000120
1309 Ga0209646_1000346
1310 Ga0209026_1000134
1311 Ga0209026_1003217
1312 Ga0209677_100019
1313 Ga0209677_100035
1314 Ga0209148_1000229
1315 Ga0209148_1029102
1316 Ga0209759_1000091
1317 Ga0209759_1000857
1318 Ga0209129_1000152
1319 Ga0209233_1000094
1320 Ga0209565_1000159
1321 Ga0209565_1002041
1322 Ga0209565_1012655
1323 Ga0209455_1000033
1324 Ga0209455_1019307
1325 Ga0209673_1000006
1326 Ga0209130_1000521
1327 Ga0209675_1000005
1328 Ga0209025_1027918
1329 Ga0209564_1000028
1330 Ga0209564_1000154
1331 Ga0209564_1000774
1332 Ga0209758_1000031
1333 Ga0209758_1000354
1334 Ga0209256_1000035
1335 Ga0209256_1000274
1336 Ga0209256_1000414
1337 Ga0207655_1003180
1338 Ga0207655_1006901
1339 Ga0207655_1032122
1340 Ga0207655_1043720
1341 Ga0207713_1125677
1342 Ga0207705_10000950
1343 Ga0207654_10007071
1344 Ga0207695_10001004
1345 Ga0207695_10009358
1346 Ga0207695_10011110
1347 Ga0207671_10001366
1348 Ga0207671_10079791
1349 Ga0207693_10037313
1350 Ga0207657_10003467
1351 Ga0207657_10025565
1352 Ga0207657_10110326
1353 Ga0207649_10035025
1354 Ga0207694_10000130
1355 Ga0207694_10144929
1356 Ga0207694_10307499
1357 Ga0207694_10357442
1358 Ga0207650_10002315
1359 Ga0207687_10464897
1360 Ga0207690_10021179
1361 Ga0207706_10184350
1362 Ga0207679_10018193
1363 Ga0207679_10037047
1364 Ga0207679_10050816
1365 Ga0207679_10204249
1366 Ga0207667_10000110
1367 Ga0207667_10008069
1368 Ga0207667_10046934
1369 Ga0207667_10076894
1370 Ga0207667_10907143
1371 Ga0207651_10257997
1372 Ga0207640_10004306
1373 Ga0207640_10149379
1374 Ga0207639_10686613
1375 Ga0207678_10144850
1376 Ga0207702_10179549
1377 Ga0207702_10331012
1378 Ga0207674_10654529
1379 Ga0207683_10261884
1380 Ga0207698_10006700
1381 Ga0207698_10254551
1382 Ga0209281_1005409
1383 Ga0209282_1000003
1384 Ga0307515_10294022
1385 Ga0316177_1167103
1386 Ga0316178_1105865
1387 Ga0316180_1103778
1388 Ga0316181_1213610
1389 Ga0307408_100000129
1390 Ga0265314_10352591
1391 Ga0307405_10609832
1392 Ga0307414_10298102
1393 Ga0395899_0000085
1394 Ga0395899_0004514
1395 Ga0395899_0007052
1396 Ga0395899_0010060
1397 Ga0395899_0011675
1398 Ga0395899_0134464
1399 Ga0395900_0001335
1400 Ga0395900_0003249
1401 Ga0395900_0014771
1402 Ga0395900_0022682
1403 Ga0395900_0061072
1404 Ga0395900_0114650
1405 Ga0395900_0119224
1406 Ga0395900_0191356
1407 Ga0395900_0214740
1408 Ga0395900_0307545
1409 Ga0395900_0453785
1410 Ga0395898_0057144
1411 Ga0395898_0277812
1412 Ga0395898_0391224
1413 Ga0395898_0810600
1414 Ga0395898_1001335
1415 Ga0395905_0001092
1416 Ga0395905_0017352
1417 Ga0395905_0315836
1418 Ga0395905_0398289
1419 Ga0395905_0722211
1420 Ga0395905_0850321
1421 Ga0395901_0000227
1422 Ga0395901_0000802
1423 Ga0395901_0012410
1424 Ga0395901_0155196
1425 Ga0395901_0175195
1426 Ga0395901_0358287
1427 Ga0395901_0381932
1428 Ga0395901_0528235
1429 Ga0395901_0928229
1430 Ga0395901_1010201
1431 Ga0436361_0632131
1432 Ga0436361_0768404
1433 Ga0436361_0851270
1434 Ga0436361_0939283
1435 Ga0439461_0065964
1436 Ga0451853_3903632
1437 Ga0439449_0030747
1438 Ga0450911_026543
1439 Ga0450904_001673
1440 Ga0466972_0000269
1441 Ga0466972_0001677
1442 Ga0466972_0003487
1443 Ga0466972_0049442
1444 Ga0466965_0010946
1445 Ga0466965_0012191
1446 Ga0466965_0013044
1447 Ga0466966_0002043
1448 Ga0466966_0175461
1449 Ga0466966_0238467
1450 Ga0466966_0729305
1451 Ga0466961_0076365
1452 Ga0466961_0260079
1453 Ga0466964_0000857
1454 Ga0466964_0045734
1455 Ga0466968_0015183
1456 Ga0466968_0019136
1457 Ga0466957_0000040
1458 Ga0466957_0044592
1459 Ga0466957_0064109
1460 Ga0466957_0363041
1461 Ga0466960_0555270
1462 Ga0466959_0019683
1463 Ga0466959_0203265
1464 Ga0466959_0297627
1465 Ga0466958_0050128
1466 Ga0466967_0015803
1467 Ga0466967_0159673
1468 Ga0495617_000046
1469 Ga0495617_001784
1470 Ga0495617_003526
1471 Ga0495617_029413
1472 Ga0495627_000006
1473 Ga0495627_001231
1474 Ga0495627_030329
1475 Ga0495627_041752
1476 Ga0495592_0007848
1477 Ga0495603_0015177
1478 Ga0495603_0038699
1479 Ga0495590_0000022
1480 Ga0495590_0000134
1481 Ga0495590_0000881
1482 Ga0495590_0019594
1483 Ga0495590_0023892
1484 Ga0495590_0036774
1485 Ga0495590_0057200
1486 Ga0495591_002085
1487 Ga0495629_0017454
1488 Ga0495629_0054672
1489 Ga0495629_0300915
1490 Ga0495629_0483226
1491 Ga0495638_0000099
1492 Ga0495638_0011848
1493 Ga0495638_0014511
1494 Ga0495638_0030851
1495 Ga0495638_0081329
1496 Ga0495638_0090340
1497 Ga0495638_0133951
1498 Ga0495638_0246244
1499 Ga0495651_0008564
1500 Ga0495651_0082486
1501 Ga0495653_0000102
1502 Ga0495653_0002192
1503 Ga0495653_0006028
1504 Ga0495653_0027015
1505 Ga0495653_0086375
1506 Ga0495653_0269847
1507 Ga0495653_0428136
1508 Ga0495650_0000248
1509 Ga0495650_0000297
1510 Ga0495650_0000356
1511 Ga0495650_0001404
1512 Ga0495650_0001655
1513 Ga0495650_0002354
1514 Ga0495650_0102520
1515 Ga0495580_0311600
1516 Ga0495580_0749259
1517 Ga0495582_0001046
1518 Ga0495582_0008353
1519 Ga0495582_0066525
1520 Ga0495605_0000041
1521 Ga0495605_0000284
1522 Ga0495605_0000614
1523 Ga0495605_0001332
1524 Ga0495605_0010904
1525 Ga0495605_0028409
1526 Ga0495605_0031730
1527 Ga0495605_0040483
1528 Ga0495605_0070154
1529 Ga0495605_0075370
1530 Ga0495605_0102670
1531 Ga0495605_0140134
1532 Ga0495605_0290276
1533 Ga0495639_0023100
1534 Ga0495584_0000013
1535 Ga0495584_0000550
1536 Ga0495584_0000972
1537 Ga0495584_0002502
1538 Ga0495584_0002582
1539 Ga0495584_0005273
1540 Ga0495584_0006292
1541 Ga0495584_0012174
1542 Ga0495584_0013174
1543 Ga0495584_0029083
1544 Ga0495584_0043842
1545 Ga0495584_0047551
1546 Ga0495584_0051293
1547 Ga0495584_0057245
1548 Ga0495584_0060960
1549 Ga0495584_0067904
1550 Ga0495584_0071291
1551 Ga0495584_0247397
1552 Ga0495584_0276406
1553 Ga0495584_0321837
1554 Ga0495584_0333284
1555 Ga0495584_0401622
1556 Ga0495585_0000150
1557 Ga0495585_0001052
1558 Ga0495585_0001416
1559 Ga0495585_0002993
1560 Ga0495585_0007714
1561 Ga0495585_0007869
1562 Ga0495585_0008104
1563 Ga0495585_0019082
1564 Ga0495585_0037639
1565 Ga0495585_0044444
1566 Ga0495585_0054812
1567 Ga0495585_0099319
1568 Ga0495585_0115280
1569 Ga0495585_0152892
1570 Ga0495585_0159253
1571 Ga0495585_0263363
1572 Ga0495585_0378113
1573 Ga0495594_0001996
1574 Ga0495594_0003575
1575 Ga0495594_0014485
1576 Ga0495594_0020297
1577 Ga0495594_0039661
1578 Ga0495594_0073199
1579 Ga0495596_0001797
1580 Ga0495596_0001970
1581 Ga0495596_0003353
1582 Ga0495596_0005506
1583 Ga0495596_0005656
1584 Ga0495596_0012488
1585 Ga0495596_0021655
1586 Ga0495596_0027006
1587 Ga0495596_0229092
1588 Ga0495607_0001687
1589 Ga0495607_0001951
1590 Ga0495607_0003768
1591 Ga0495607_0012121
1592 Ga0495607_0012539
1593 Ga0495607_0021678
1594 Ga0495607_0026290
1595 Ga0495607_0035582
1596 Ga0495607_0043495
1597 Ga0495607_0047731
1598 Ga0495607_0049899
1599 Ga0495607_0100280
1600 Ga0495607_0169549
1601 Ga0495607_0173833
1602 Ga0495607_0233644
1603 Ga0495583_0000063
1604 Ga0495583_0000161
1605 Ga0495583_0000220
1606 Ga0495583_0000573
1607 Ga0495583_0000839
1608 Ga0495583_0003352
1609 Ga0495583_0004154
1610 Ga0495583_0012805
1611 Ga0495583_0019410
1612 Ga0495583_0021539
1613 Ga0495583_0023952
1614 Ga0495583_0026149
1615 Ga0495583_0070711
1616 Ga0495583_0100302
1617 Ga0495583_0123073
1618 Ga0495606_0000169
1619 Ga0495606_0000187
1620 Ga0495606_0000494
1621 Ga0495606_0000609
1622 Ga0495606_0001166
1623 Ga0495606_0003491
1624 Ga0495606_0004057
1625 Ga0495606_0004324
1626 Ga0495606_0014062
1627 Ga0495606_0014578
1628 Ga0495606_0016249
1629 Ga0495606_0021080
1630 Ga0495606_0023156
1631 Ga0495606_0027832
1632 Ga0495606_0044441
1633 Ga0495606_0102083
1634 Ga0495606_0144783
1635 Ga0495606_0153038
1636 Ga0495606_0198937
1637 Ga0495608_0001695
1638 Ga0495608_0008843
1639 Ga0495610_0001163
1640 Ga0495610_0001852
1641 Ga0495610_0002889
1642 Ga0495610_0011309
1643 Ga0495610_0026885
1644 Ga0495610_0093974
1645 Ga0495616_0000644
1646 Ga0495616_0000673
1647 Ga0495616_0000838
1648 Ga0495616_0007456
1649 Ga0495616_0015301
1650 Ga0495616_0016767
1651 Ga0495616_0019935
1652 Ga0495616_0023226
1653 Ga0495616_0026850
1654 Ga0495616_0038790
1655 Ga0495616_0039683
1656 Ga0495616_0044942
1657 Ga0495616_0062104
1658 Ga0495616_0077051
1659 Ga0495616_0220707
1660 Ga0495618_0010248
1661 Ga0495618_0217225
1662 Ga0495620_0018095
1663 Ga0495628_0001477
1664 Ga0495628_0026883
1665 Ga0495630_0069306
1666 Ga0495630_0182260
1667 Ga0495631_0003439
1668 Ga0495631_0013417
1669 Ga0495631_0015319
1670 Ga0495631_0028788
1671 Ga0495631_0037142
1672 Ga0495631_0065594
1673 Ga0495631_0079566
1674 Ga0495631_0092553
1675 Ga0495632_0000280
1676 Ga0495632_0000959
1677 Ga0495632_0001908
1678 Ga0495632_0006230
1679 Ga0495632_0032737
1680 Ga0495632_0035794
1681 Ga0495632_0040099
1682 Ga0495632_0048198
1683 Ga0495637_0000029
1684 Ga0495637_0009751
1685 Ga0495637_0057171
1686 Ga0495637_0060307
1687 Ga0495637_0156117
1688 Ga0495643_0000245
1689 Ga0495643_0000517
1690 Ga0495643_0001674
1691 Ga0495643_0002014
1692 Ga0495643_0027566
1693 Ga0495643_0034203
1694 Ga0495643_0035434
1695 Ga0495643_0037582
1696 Ga0495643_0073801
1697 Ga0495643_0081629
1698 Ga0495643_0337667
1699 Ga0495644_0002273
1700 Ga0495644_0003806
1701 Ga0495644_0011649
1702 Ga0495644_0012217
1703 Ga0495644_0017846
1704 Ga0495644_0052387
1705 Ga0495644_0053352
1706 Ga0495644_0063353
1707 Ga0495644_0067614
1708 Ga0495648_0000004
1709 Ga0495648_0000047
1710 Ga0495648_0002640
1711 Ga0495648_0010391
1712 Ga0495648_0012788
1713 Ga0495648_0013386
1714 Ga0495648_0017457
1715 Ga0495648_0043398
1716 Ga0495648_0057399
1717 Ga0495648_0069338
1718 Ga0495648_0094064
1719 Ga0495648_0104921
1720 Ga0495648_0162016
1721 Ga0495648_0176469
1722 Ga0495663_0010443
1723 Ga0495663_0014291
1724 Ga0495663_0067581
1725 Ga0495663_0067646
1726 Ga0495663_0139130
1727 Ga0495666_0005439
1728 Ga0495666_0005509
1729 Ga0495666_0010419
1730 Ga0495666_0035199
1731 Ga0495666_0080157
1732 Ga0495642_0000707
1733 Ga0495642_0000925
1734 Ga0495642_0008048
1735 Ga0495642_0010762
1736 Ga0495642_0014975
1737 Ga0495642_0019680
1738 Ga0495642_0026945
1739 Ga0495642_0037955
1740 Ga0495642_0043182
1741 Ga0495642_0064902
1742 Ga0495642_0069488
1743 Ga0495642_0084868
1744 Ga0495642_0085552
1745 Ga0495642_0088305
1746 Ga0495642_0107585
1747 Ga0495642_0108713
1748 Ga0495642_0222244
1749 Ga0495652_0011499
1750 Ga0495652_0031560
1751 Ga0495652_0072781
1752 Ga0495652_0262714
1753 Ga0495654_0000025
1754 Ga0495654_0004114
1755 Ga0495654_0034180
1756 Ga0495654_0045637
1757 Ga0495654_0054823
1758 Ga0495654_0061427
1759 Ga0495654_0094153
1760 Ga0495665_0004037
1761 Ga0495665_0030778
1762 Ga0495665_0042804
1763 Ga0495665_0078944
1764 Ga0495665_0082842
1765 Ga0495640_0235064
1766 Ga0495640_0547966
1767 Ga0495586_0008401
1768 Ga0495586_0013058
1769 Ga0495586_0013968
1770 Ga0495586_0109707
1771 Ga0495587_0027319
1772 Ga0495587_0199040
1773 Ga0495598_0005700
1774 Ga0495609_0000005
1775 Ga0495609_0001551
1776 Ga0495609_0002450
1777 Ga0495609_0002738
1778 Ga0495609_0004216
1779 Ga0495609_0017751
1780 Ga0495609_0021227
1781 Ga0495609_0049904
1782 Ga0495609_0051853
1783 Ga0495609_0073300
1784 Ga0495609_0079009
1785 Ga0495609_0089366
1786 Ga0495609_0141949
1787 Ga0495621_0022367
1788 Ga0495621_0140321
1789 Ga0495597_0000563
1790 Ga0495597_0002604
1791 Ga0495597_0003147
1792 Ga0495597_0003284
1793 Ga0495597_0005953
1794 Ga0495597_0007880
1795 Ga0495597_0019916
1796 Ga0495597_0023976
1797 Ga0495597_0045024
1798 Ga0495597_0050654
1799 Ga0495597_0076977
1800 Ga0495597_0103959
1801 Ga0495597_0175037
1802 Ga0495645_0013561
1803 Ga0495645_0077035
1804 Ga0495622_0000157
1805 Ga0495622_0000500
1806 Ga0495622_0016343
1807 Ga0495622_0016775
1808 Ga0495622_0017778
1809 Ga0495622_0061564
1810 Ga0495622_0068054
1811 Ga0495622_0116639
1812 Ga0495622_0277991
1813 Ga0495633_0000467
1814 Ga0495633_0000472
1815 Ga0495633_0003329
1816 Ga0495633_0003381
1817 Ga0495633_0005433
1818 Ga0495633_0006297
1819 Ga0495633_0007489
1820 Ga0495633_0010420
1821 Ga0495633_0011181
1822 Ga0495633_0012377
1823 Ga0495633_0014107
1824 Ga0495633_0024284
1825 Ga0495633_0029432
1826 Ga0495633_0059713
1827 Ga0495633_0064498
1828 Ga0495633_0101075
1829 Ga0495633_0235731
1830 Ga0495633_0387080
1831 Ga0495656_0010881
1832 Ga0495656_0011715
1833 Ga0495656_0343044
1834 Ga0495656_0510488
1835 Ga0495668_0000210
1836 Ga0495668_0000219
1837 Ga0495668_0000333
1838 Ga0495668_0001190
1839 Ga0495668_0004052
1840 Ga0495668_0004067
1841 Ga0495668_0004388
1842 Ga0495668_0007970
1843 Ga0495668_0013030
1844 Ga0495668_0014801
1845 Ga0495668_0018764
1846 Ga0495668_0020133
1847 Ga0495668_0024867
1848 Ga0495668_0045191
1849 Ga0495668_0428710
1850 Ga0495634_0010701
1851 Ga0495634_0277526
1852 Ga0495611_0000336
1853 Ga0495611_0001499
1854 Ga0495611_0001565
1855 Ga0495611_0010689
1856 Ga0495611_0013278
1857 Ga0495611_0017678
1858 Ga0495611_0041172
1859 Ga0495611_0068028
1860 Ga0495611_0091520
1861 Ga0495611_0117584
1862 Ga0495611_0126570
1863 Ga0495611_0161329
1864 Ga0495625_0000412
1865 Ga0495625_0000821
1866 Ga0495625_0001604
1867 Ga0495625_0002389
1868 Ga0495625_0010280
1869 Ga0495625_0015331
1870 Ga0495625_0018833
1871 Ga0495625_0026294
1872 Ga0495625_0027262
1873 Ga0495625_0037139
1874 Ga0495625_0166697
1875 Ga0495625_0253278
1876 Ga0495625_0283143
1877 Ga0495635_0005531
1878 Ga0495635_0022214
1879 Ga0495635_0393322
1880 Ga0495659_0000010
1881 Ga0495659_0012562
1882 Ga0495659_0018764
1883 Ga0495659_0028004
1884 Ga0495659_0066207
1885 Ga0495661_0000613
1886 Ga0495661_0000794
1887 Ga0495661_0002649
1888 Ga0495661_0007511
1889 Ga0495661_0011228
1890 Ga0495661_0013468
1891 Ga0495661_0014914
1892 Ga0495661_0015701
1893 Ga0495661_0021272
1894 Ga0495661_0026984
1895 Ga0495661_0037400
1896 Ga0495661_0044511
1897 Ga0495661_0093555
1898 Ga0495661_0096071
1899 Ga0495661_0117592
1900 Ga0495661_0181574
1901 Ga0495661_0189947
1902 Ga0495661_0222464
1903 Ga0495661_0252868
1904 Ga0495588_0000059
1905 Ga0495588_0014575
1906 Ga0495588_0014966
1907 Ga0495588_0020374
1908 Ga0495588_0025634
1909 Ga0495588_0037690
1910 Ga0495588_0091166
1911 Ga0495588_0114443
1912 Ga0495588_0117194
1913 Ga0495588_0124438
1914 Ga0495588_0130369
1915 Ga0495588_0158389
1916 Ga0495588_0195908
1917 Ga0495657_0015496
1918 Ga0495657_0525874
1919 Ga0495599_0058762
1920 Ga0495599_0144623
1921 Ga0495623_0007728
1922 Ga0495623_0014841
1923 Ga0495623_0015129
1924 Ga0495623_0087224
1925 Ga0495646_0001070
1926 Ga0495646_0007728
1927 Ga0495646_0170595
1928 Ga0495658_0127742
1929 Ga0495669_0000240
1930 Ga0495669_0000324
1931 Ga0495669_0007418
1932 Ga0495669_0019826
1933 Ga0495669_0028499
1934 Ga0495669_0029737
1935 Ga0495613_0039779
1936 Ga0495613_0043486
1937 Ga0495613_0048789
1938 Ga0495624_0028520
1939 Ga0495624_0162046
1940 Ga0495624_0437914
1941 Ga0495624_0546880
1942 Ga0495670_0009935
1943 Ga0495670_0013340
1944 Ga0495670_0020514
1945 Ga0495670_0022264
1946 Ga0495670_0026585
1947 Ga0495670_0055784
1948 Ga0495670_0061434
1949 Ga0495670_0085137
1950 Ga0495670_0085252
1951 Ga0495670_0157708
1952 Ga0495670_0191862
1953 Ga0495670_0322396
1954 Ga0495670_0387946
1955 Ga0495671_0000609
1956 Ga0495671_0000614
1957 Ga0495671_0002097
1958 Ga0495671_0022260
1959 Ga0495671_0041373
1960 Ga0495671_0128878
1961 Ga0495671_0177247
1962 Ga0495671_0221251
1963 Ga0495671_0344078
1964 Ga0495671_0423823
1965 Ga0495649_0000644
1966 Ga0495649_0003103
1967 Ga0495649_0012829
1968 Ga0495649_0025911
1969 Ga0495649_0049376
1970 Ga0495649_0063271
1971 Ga0495649_0128657
1972 Ga0495649_0269489
1973 Ga0495589_0000212
1974 Ga0495589_0000358
1975 Ga0495589_0001945
1976 Ga0495589_0015330
1977 Ga0495589_0028349
1978 Ga0495589_0036559
1979 Ga0495589_0046986
1980 Ga0495589_0059055
1981 Ga0495589_0215071
1982 Ga0495589_0458202
1983 Ga0495600_0031789
1984 Ga0495600_0508627
1985 Ga0495660_0000301
1986 Ga0495660_0000789
1987 Ga0495660_0002992
1988 Ga0495660_0013874
1989 Ga0495660_0044397
1990 Ga0495660_0049491
1991 Ga0495660_0054119
1992 Ga0495660_0071376
1993 Ga0495581_0001466
1994 Ga0495581_0016670
1995 Ga0495581_0024866
1996 Ga0495581_0085580
1997 Ga0495604_0004528
1998 Ga0495604_0009345
1999 Ga0495604_0013433
2000 Ga0495604_0060323
2001 Ga0495604_0070037
2002 Ga0495636_0002971
2003 Ga0495636_0006765
2004 Ga0495636_0006779
2005 Ga0495636_0145312
2006 Ga0495636_0163558
2007 Ga0495674_0012252
2008 Ga0495674_0092025
2009 Ga0495674_0645660
2010 Ga0495672_0000078
2011 Ga0495672_0000107
2012 Ga0495672_0000431
2013 Ga0495672_0001709
2014 Ga0495672_0001925
2015 Ga0495672_0002234
2016 Ga0495672_0002438
2017 Ga0495672_0007705
2018 Ga0495672_0051279
2019 Ga0495672_0063440
2020 Ga0495672_0256789
2021 Ga0495672_0421865
2022 Ga0495676_0000069
2023 Ga0495676_0037898
2024 Ga0495676_0072388
2025 Ga0495676_0242128
2026 Ga0495680_0014259
2027 Ga0495680_0110675
2028 Ga0495680_0195764
2029 Ga0495680_0929057
2030 Ga0495683_0000221
2031 Ga0495683_0000559
2032 Ga0495683_0001444
2033 Ga0495683_0003435
2034 Ga0495683_0026958
2035 Ga0495683_0031928
2036 Ga0495683_0034280
2037 Ga0495683_0048107
2038 Ga0495683_0103049
2039 Ga0495683_0200183
2040 Ga0495687_000221
2041 Ga0495687_000562
2042 Ga0495687_000714
2043 Ga0495687_000828
2044 Ga0495687_000917
2045 Ga0495687_002375
2046 Ga0495687_004864
2047 Ga0495687_005631
2048 Ga0495675_0045253
2049 Ga0495675_0054928
2050 Ga0495675_0290282
2051 Ga0495677_0000060
2052 Ga0495677_0000616
2053 Ga0495677_0002470
2054 Ga0495677_0004463
2055 Ga0495677_0006273
2056 Ga0495677_0015946
2057 Ga0495677_0016528
2058 Ga0495677_0020808
2059 Ga0495677_0021284
2060 Ga0495677_0047727
2061 Ga0495677_0058985
2062 Ga0495677_0065026
2063 Ga0495677_0067204
2064 Ga0495677_0118745
2065 Ga0495677_0438822
2066 Ga0495679_003216
2067 Ga0495679_022299
2068 Ga0495679_042477
2069 Ga0495679_050040
2070 Ga0495685_000340
2071 Ga0495685_000345
2072 Ga0495685_002067
2073 Ga0495685_004743
2074 Ga0495685_007976
2075 Ga0495685_084209
2076 Ga0495673_0000074
2077 Ga0495673_0000194
2078 Ga0495673_0017975
2079 Ga0495673_0018985
2080 Ga0495681_0000330
2081 Ga0495681_0002881
2082 Ga0495681_0013049
2083 Ga0495681_0014169
2084 Ga0495681_0023519
2085 Ga0495681_0025337
2086 Ga0495681_0028763
2087 Ga0495681_0049171
2088 Ga0495681_0076980
2089 Ga0495681_0105747
2090 Ga0495681_0140960
2091 Ga0495681_0319686
2092 Ga0495686_0000387
2093 Ga0495686_0001928
2094 Ga0495686_0004503
2095 Ga0495686_0065291
2096 Ga0495686_0248413
2097 Ga0495593_0003624
2098 Ga0495593_0007992
2099 Ga0495593_0012915
2100 Ga0495593_0107776
2101 Ga0495593_0127022
2102 Ga0495602_0001744
2103 Ga0495602_0025892
2104 Ga0495602_0029800
2105 Ga0495602_0173033
2106 Ga0495602_0394976
2107 Ga0495614_0004592
2108 Ga0495614_0005888
2109 Ga0495614_0126677
2110 Ga0495614_0174154
2111 Ga0495615_0018444
2112 Ga0495615_0027387
2113 Ga0495626_0000058
2114 Ga0495626_0000196
2115 Ga0495626_0001643
2116 Ga0495626_0004639
2117 Ga0495626_0006899
2118 Ga0495626_0009308
2119 Ga0495626_0012406
2120 Ga0495626_0014002
2121 Ga0495626_0023626
2122 Ga0495626_0073015
2123 Ga0495626_0073750
2124 Ga0495626_0077093
2125 Ga0495626_0085609
2126 Ga0495626_0113586
2127 Ga0495626_0129526
2128 Ga0495626_0195981
2129 Ga0495626_0256812
2130 Ga0496100_0050289
2131 Ga0496100_0201263
2132 Ga0496100_0476725
2133 Ga0496100_1443835
2134 Ga0496101_0042334
2135 Ga0496101_0419980
2136 Ga0496102_0000097
2137 Ga0496102_0000420
2138 Ga0496102_0132791
2139 Ga0496102_0134253
2140 Ga0496102_0144595
2141 Ga0496102_0147683
2142 Ga0496102_0171826
2143 Ga0496102_0685750
2144 Ga0496103_0002958
2145 Ga0496103_0007291
2146 Ga0496103_0021322
2147 Ga0496103_0068974
2148 Ga0496103_0077756
2149 Ga0496104_0107089
2150 Ga0496104_0820537
2151 Ga0496104_0974122
2152 Ga0496105_0049437
2153 Ga0496106_0033410
2154 Ga0496106_0136225
2155 Ga0496107_0114013
2156 Ga0496107_0428015
2157 Ga0496108_0064336
2158 Ga0496108_0393521
2159 Ga0496109_0129843
2160 Ga0496109_0490723
2161 Ga0496110_0004041
2162 Ga0496110_0018254
2163 Ga0496110_0028850
2164 Ga0496110_0454063
2165 Ga0496111_0051200
2166 Ga0496111_0509074
2167 Ga0496113_0015989
2168 Ga0496113_1256873
2169 Ga0496114_0409890
2170 Ga0496115_0006572
2171 Ga0496115_0208747
2172 Ga0496115_0627578
2173 Ga0496115_0680601
2174 Ga0496115_0701547
2175 Ga0496115_0813234
2176 Ga0496115_1096931
2177 Ga0496116_0003789
2178 Ga0496116_0012419
2179 Ga0496117_0000056
2180 Ga0496117_0190466
2181 Ga0496118_0000047
2182 Ga0496121_0015850
2183 Ga0496121_0031019
2184 Ga0496121_0075013
2185 Ga0496121_0093062
2186 Ga0496121_0110221
2187 Ga0496121_0121260
2188 Ga0496121_0269046
2189 Ga0496122_0002132
2190 Ga0496122_0003733
2191 Ga0496122_0003878
2192 Ga0496122_0025683
2193 Ga0496122_0068413
2194 Ga0496122_0348081
2195 Ga0496123_0000912
2196 Ga0496123_0003558
2197 Ga0496123_0026054
2198 Ga0496123_0041317
2199 Ga0496123_0056764
2200 Ga0496124_0007788
2201 Ga0496124_0019066
2202 Ga0496124_0029459
2203 Ga0496124_0122850
2204 Ga0496124_0138806
2205 Ga0496124_0394913
2206 Ga0496124_0497765
2207 Ga0496124_0710954
2208 Ga0496125_0000368
2209 Ga0496125_0008339
2210 Ga0496125_0046906
2211 Ga0496125_0117526
2212 Ga0496126_0025776
2213 Ga0496126_0480852
2214 Ga0501304_023692
2215 Ga0495678_000013
2216 Ga0495678_000146
2217 Ga0495678_001534
2218 Ga0495678_003140
2219 Ga0495678_003408
2220 Ga0495678_007836
2221 Ga0495678_014197
2222 Ga0495678_021447
2223 Ga0495678_033575
2224 Ga0495682_0001326
2225 Ga0495682_0008409
2226 Ga0495682_0019648
2227 Ga0495682_0046075
2228 Ga0495682_0123234
2229 Ga0501315_045540
2230 Ga0501034_0234557
2231 Ga0501036_0227975
2232 Ga0501038_0253661
2233 Ga0501039_0495175
2234 Ga0501222_012880
2235 Ga0501227_002984
2236 Ga0501238_018809
2237 Ga0501249_038439
2238 Ga0501252_054961
2239 Ga0501279_003909
2240 Ga0501279_012128
2241 Ga0501035_0007367
2242 Ga0501044_0230230
2243 Ga0501044_0314085
2244 nmdc:mga0k408_414306_c1
2245 Ga0495601_0005679
2246 Ga0500572_172435
2247 Ga0500594_0122602
2248 Ga0500595_005622
2249 Ga0500618_000115
2250 Ga0500573_0148389
2251 Ga0500574_005403
2252 Ga0500586_022095
2253 Ga0500619_001637
2254 Ga0466962_0132893
2255 Ga0466962_0442978
2256 2511250511
2257 2521560585
2258 2550692243
2259 2553005705
2260 2601671895
2261 2643797137
2262 2644028079
2263 2644250788
2264 2644358311
2265 2644469759
2266 2738739247
2267 2738846971
2268 2739276029
2269 2739345073
2270 2765571837
2271 2808982158
2272 2809130042
2273 2809147442
2274 2809148903
2275 2819542237
2276 2819595603
2277 2819617278
2278 2821136132
2279 2839098442
2280 2842717847
2281 2852619038
2282 2857552257
2283 2857556656
2284 2857563513
2285 2857569503
2286 2884816193
2287 2884839364
2288 2884856826
2289 2885082342
2290 2896158172
2291 2904429663
2292 2904442917
2293 2904534883
2294 2904588774
2295 2904594152
2296 2904605010
2297 2919048584
2298 2919083244
2299 2919480592
2300 2923514388
2301 2928133104
2302 2932415085
2303 2932421267
2304 8047676576

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

13

162

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.6602 15 150
7nnt-assembly1.cif.gz_C cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.6049 14 156
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.5845 15 156
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.5666 15 150
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.5463 16 156
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9546 16 156 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8817 16 156 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.681 14 156 1.10.1760.20
5kc4E00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6602 15 150 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.604 14 156 1.10.1760.20
ID Description Score Start End GO Terms
AF-R5PK45-F1-model_v4 deleted 0.984 10 154
AF-A0A521Z556-F1-model_v4 Rod shape-determining protein MreD 0.9773 10 160 GO:0005886
GO:0008360
AF-A0A147GRT5-F1-model_v4 Rod shape-determining protein MreD 0.9731 9 148 GO:0005886
GO:0008360
AF-A0A6B2R0A9-F1-model_v4 Rod shape-determining protein MreD 0.9692 26 157 GO:0005886
GO:0008360
AF-A0A6F8VHK6-F1-model_v4 Rod shape-determining protein MreD 0.9672 10 156 GO:0005886
GO:0008360

Map