F490879

General Info

Members Datasets Scaffolds Average Seq Length
1152 457 2304 325

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_79443_c1|nmdc:mga03683_79443_c1_198_1232
Length 344
Sequence MVDGMTLYSKIIGTGSYLPERRVTNQDLTDQLAAKGIETSDEWIVSRSGISARHFAEPGEKSSDLAVKAAKRALDMAGLQPNDIDLIVLASSTPDFFGSFPSTACIVQQKLGITNNGAAVDVQAVCSGFVYAMSTADAFIRAGMNKNVLVIGSEVFSRILDFNDRTTCVLFGDGAGAVVMTASQEPGILATALHADGRHSGILCMPDSFGGAVAGEAYLYMDGPAVFKLAVSVLEKVAHEALEKANMAQGQIDWLIPHQANIRIMNSTAKKLGLPLEKMVVTVDQHGNTSAASIPLALDAAVRDGRIQKGQNILMEGVGGGFTWGAVLARLTDDLLARQDLAKF

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
90 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
146 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
152 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
153 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
173 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
174 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
263 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
266 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
267 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
303 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
315 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
316 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
323 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
324 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
325 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
326 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
327 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
328 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
329 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
340 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
341 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
342 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
343 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
344 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
345 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
346 2519103095 Burkholderia sp. KJ006 Isolate Nodule
347 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
348 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
349 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
350 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
351 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
352 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
353 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
354 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
355 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
356 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
357 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
358 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
359 2643221556 Massilia sp. Root1485 Isolate Unclassified
360 2643221569 Achromobacter sp. Root565 Isolate Unclassified
361 2643221594 Achromobacter sp. Root170 Isolate Unclassified
362 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
363 2643221621 Achromobacter sp. Root83 Isolate Unclassified
364 2643221638 Duganella sp. Root336D2 Isolate Unclassified
365 2643221645 Massilia sp. Root351 Isolate Unclassified
366 2643221664 Massilia sp. Root418 Isolate Unclassified
367 2643221684 Massilia sp. Root133 Isolate Unclassified
368 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
369 2738541280 Massilia sp. GV090 Isolate Unclassified
370 2738541297 Duganella sp. GV083 Isolate Unclassified
371 2738541300 Massilia sp. GV016 Isolate Unclassified
372 2738541357 Duganella sp. GV053 Isolate Unclassified
373 2738543003 Duganella sp. GV066 Isolate Unclassified
374 2738543018 Massilia sp. GV045 Isolate Unclassified
375 2738543026 Duganella sp. GV089 Isolate Unclassified
376 2738543029 Duganella sp. GV039 Isolate Unclassified
377 2738543030 Massilia sp. GV097 Isolate Unclassified
378 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
379 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
380 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
381 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
382 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
383 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
384 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
385 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
386 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
387 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
388 2818991436 Collimonas arenae 515 Isolate Unclassified
389 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
390 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
391 2818991452 Burkholderia cepacia 561 Isolate Unclassified
392 2821131069 Duganella sp. 1224 Isolate Unclassified
393 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
394 2842711865 Duganella sp. R-73148 Isolate Unclassified
395 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
396 2855730933 Achromobacter sp. HZ28 Isolate Nodule
397 2855767633 Achromobacter sp. HZ34 Isolate Nodule
398 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
399 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
400 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
401 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
402 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
403 2857553236 Duganella sp. R-74557 Isolate Unclassified
404 2857558681 Duganella sp. R-74565 Isolate Unclassified
405 2857564685 Duganella sp. R-74599 Isolate Unclassified
406 2858950400 Achromobacter sp. K91 Isolate Unclassified
407 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
408 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
409 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
410 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
411 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
412 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
413 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
414 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
415 2885266251 Ralstonia sp. SET104 Isolate Nodule
416 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
417 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
418 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
419 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
420 2904424332 Duganella sp. 1411 Isolate Rhizosphere
421 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
422 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
423 2904564687 Burkholderia sp. 571 Isolate Unclassified
424 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
425 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
426 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
427 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
428 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
429 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
430 2919476304 Duganella sp. 3397 Isolate Unclassified
431 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
432 2928037797 Variovorax sp. 1126 Isolate Unclassified
433 2928044640 Variovorax sp. 1128 Isolate Unclassified
434 2928058823 Ralstonia sp. 1138 Isolate Unclassified
435 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
436 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
437 2928163908 Burkholderia sp. 567 Isolate Unclassified
438 2928170801 Burkholderia sp. 572 Isolate Unclassified
439 2928536128 Burkholderia sola 565 Isolate Unclassified
440 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
441 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
442 2941479691
443 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
444 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
445 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
446 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
447 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
448 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
449 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
450 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
451 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
452 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
453 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
454 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
455 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
456 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
457 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.67
Metatranscriptomes 2
Isolates 10.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.32
Nodule 0.87
Rhizoplane 3.39
Rhizosphere 67.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_79443_c1 3300050489 Bacteria 1414
2 JGI24741J21665_1000010 3300001915 Bacteria 44368
3 JGI24740J21852_10000462 3300001979 Bacteria 17404
4 JGI24740J21852_10000722 3300001979 Bacteria 14380
5 JGI24739J22299_10010730 3300001989 Bacteria 3396
6 JGI24737J22298_10013210 3300001990 Bacteria 2689
7 JGI24735J21928_10000381 3300002067 Bacteria 15526
8 JGI25155J39150_1000877 3300002704 Bacteria 4282
9 JGI25155J39150_1000881 3300002704 Bacteria 4257
10 JGI25156J39149_1004399 3300002705 Bacteria 4299
11 JGI25156J39149_1004435 3300002705 Bacteria 4274
12 JGI25156J39149_1007106 3300002705 Bacteria 2977
13 JGI25162J39368_1000036 3300002737 Bacteria 180433
14 JGI25162J39368_1007683 3300002737 Bacteria 1641
15 JGI25154J39366_1000446 3300002738 Bacteria 21840
16 JGI25154J39366_1001320 3300002738 Bacteria 9177
17 JGI25154J39366_1002733 3300002738 Bacteria 4282
18 JGI25154J39366_1002751 3300002738 Bacteria 4257
19 JGI25157J39369_1001025 3300002741 Bacteria 12915
20 JGI25157J39369_1001457 3300002741 Bacteria 8838
21 JGI25152J39213_1003851 3300002773 Bacteria 4950
22 JGI25150J39212_1006615 3300002774 Bacteria 2379
23 JGI25159J45721_1005005 3300002987 Bacteria 4240
24 JGI25151J46595_10000203 3300003187 Bacteria 73276
25 JGI25165J46597_1000022 3300003214 Bacteria 357959
26 JGI25153J46596_10008450 3300003215 Bacteria 4921
27 JGI25161J50226_1003372 3300003374 Bacteria 3682
28 Ga0007410J51695_1012750 3300003574 Bacteria 9424
29 Ga0007409J51694_1006362 3300003575 Bacteria 11752
30 Ga0007409J51694_1011802 3300003575 Bacteria 2110
31 Ga0007416J51690_1012585 3300003577 Bacteria 9861
32 Ga0055538_1000002 3300003751 Bacteria 999437
33 Ga0055538_1000011 3300003751 Bacteria 357959
34 Ga0055539_1000002 3300003752 Bacteria 999437
35 Ga0055539_1000016 3300003752 Bacteria 358248
36 Ga0055539_1000034 3300003752 Bacteria 223400
37 Ga0055533_1000004 3300003756 Bacteria 999437
38 Ga0055533_1000019 3300003756 Bacteria 357959
39 Ga0055532_1000002 3300003758 Bacteria 576000
40 Ga0055532_1000016 3300003758 Bacteria 327509
41 Ga0055525_1000001 3300003759 Bacteria 1016948
42 Ga0055525_1000002 3300003759 Bacteria 999437
43 Ga0055525_1000042 3300003759 Bacteria 279804
44 Ga0055525_1000538 3300003759 Bacteria 18074
45 Ga0055527_1002743 3300003760 Bacteria 2853
46 Ga0055527_1002777 3300003760 Bacteria 2817
47 Ga0055535_1000318 3300003761 Bacteria 48605
48 Ga0055542_1004140 3300003762 Bacteria 3648
49 Ga0055542_1004240 3300003762 Bacteria 3552
50 Ga0055529_1000028 3300003763 Bacteria 287650
51 Ga0055529_1000403 3300003763 Bacteria 45873
52 Ga0055529_1004078 3300003763 Bacteria 2280
53 Ga0055526_1000018 3300003771 Bacteria 198838
54 Ga0055526_1000029 3300003771 Bacteria 148855
55 Ga0055526_1003756 3300003771 Bacteria 9475
56 Ga0055526_1003777 3300003771 Bacteria 9442
57 Ga0055526_1005592 3300003771 Bacteria 7164
58 Ga0055526_1016080 3300003771 Bacteria 2956
59 Ga0055537_1000202 3300003773 Bacteria 44565
60 Ga0055537_1007170 3300003773 Bacteria 2726
61 Ga0055524_1000234 3300003775 Bacteria 58774
62 Ga0055524_1008881 3300003775 Bacteria 4137
63 Ga0055524_1022702 3300003775 Bacteria 2042
64 Ga0055534_1000311 3300003784 Bacteria 32607
65 Ga0055534_1002771 3300003784 Bacteria 5873
66 Ga0055528_1000062 3300003790 Bacteria 85624
67 Ga0055528_1002474 3300003790 Bacteria 9876
68 Ga0055528_1007004 3300003790 Bacteria 5042
69 Ga0055530_10008671 3300003791 Bacteria 4027
70 Ga0055530_10011528 3300003791 Bacteria 3166
71 Ga0055541_1000002 3300003841 Bacteria 896405
72 Ga0055541_1000017 3300003841 Bacteria 286811
73 Ga0055541_1000217 3300003841 Bacteria 23975
74 Ga0058692_1016389 3300003856 Bacteria 1647
75 Ga0055543_1004578 3300004625 Bacteria 3720
76 Ga0065165_1000055 3300005262 Bacteria 187003
77 Ga0065165_1008669 3300005262 Bacteria 4708
78 Ga0065165_1011383 3300005262 Bacteria 3720
79 Ga0065165_1024690 3300005262 Bacteria 2014
80 Ga0065714_10112336 3300005288 Bacteria 1457
81 Ga0065715_10110556 3300005293 Bacteria 2615
82 Ga0070658_10086993 3300005327 Bacteria 2571
83 Ga0070670_100014071 3300005331 Bacteria 6864
84 Ga0070682_100119523 3300005337 Bacteria 1767
85 Ga0070660_100000010 3300005339 Bacteria 136324
86 Ga0070660_100003942 3300005339 Bacteria 10256
87 Ga0070660_100041122 3300005339 Bacteria 3522
88 Ga0070660_100078821 3300005339 Bacteria 2583
89 Ga0070660_100146878 3300005339 Bacteria 1894
90 Ga0070661_100000013 3300005344 Bacteria 163010
91 Ga0070661_100003622 3300005344 Bacteria 10632
92 Ga0070659_100000167 3300005366 Bacteria 50757
93 Ga0070659_100000834 3300005366 Bacteria 22483
94 Ga0070659_100004951 3300005366 Bacteria 9532
95 Ga0070659_100053692 3300005366 Bacteria 3172
96 Ga0070659_100070043 3300005366 Bacteria 2785
97 Ga0070667_100049400 3300005367 Bacteria 3543
98 Ga0070714_100008646 3300005435 Bacteria 7962
99 Ga0070663_100000006 3300005455 Bacteria 208068
100 Ga0070663_100000789 3300005455 Bacteria 17198
101 Ga0070663_100063775 3300005455 Bacteria 2662
102 Ga0070662_100149373 3300005457 Bacteria 1817
103 Ga0068855_100000065 3300005563 Bacteria 129307
104 Ga0068855_100269568 3300005563 Bacteria 1893
105 Ga0068855_100317253 3300005563 Bacteria 1724
106 Ga0070664_100000002 3300005564 Bacteria 458815
107 Ga0070664_100003335 3300005564 Bacteria 12976
108 Ga0070664_100065531 3300005564 Bacteria 3099
109 Ga0068857_100051097 3300005577 Bacteria 3666
110 Ga0068857_100140667 3300005577 Bacteria 2181
111 Ga0068854_100000004 3300005578 Bacteria 216381
112 Ga0068856_100000294 3300005614 Bacteria 54780
113 Ga0068856_100169372 3300005614 Bacteria 2196
114 Ga0068852_100017069 3300005616 Bacteria 5685
115 Ga0068852_100129856 3300005616 Bacteria 2319
116 Ga0075363_100002122 3300006048 Bacteria 7961
117 Ga0075364_10001271 3300006051 Bacteria 13570
118 Ga0075364_10004880 3300006051 Bacteria 7770
119 Ga0075366_10150087 3300006195 Bacteria 1411
120 Ga0099826_10000002 3300006948 Bacteria 1125830
121 Ga0105251_10001123 3300009011 Bacteria 23287
122 Ga0105244_10002843 3300009036 Bacteria 12850
123 Ga0105244_10004589 3300009036 Bacteria 9455
124 Ga0105244_10049320 3300009036 Bacteria 2152
125 Ga0105244_10092329 3300009036 Bacteria 1488
126 Ga0105240_10000297 3300009093 Bacteria 96825
127 Ga0105240_10014780 3300009093 Bacteria 10641
128 Ga0105240_10038598 3300009093 Bacteria 6124
129 Ga0105240_10194424 3300009093 Bacteria 2383
130 Ga0105240_10201688 3300009093 Bacteria 2331
131 Ga0105245_10189972 3300009098 Bacteria 1967
132 Ga0105243_10316365 3300009148 Bacteria 1421
133 Ga0105241_10064594 3300009174 Bacteria 2826
134 Ga0105242_10045340 3300009176 Bacteria 3563
135 Ga0105248_10045070 3300009177 Bacteria 4945
136 Ga0105237_10067786 3300009545 Bacteria 3562
137 Ga0105237_10081975 3300009545 Bacteria 3217
138 Ga0105237_10105569 3300009545 Bacteria 2808
139 Ga0105237_10179067 3300009545 Bacteria 2120
140 Ga0105238_10001896 3300009551 Bacteria 20982
141 Ga0105238_10094199 3300009551 Bacteria 2982
142 Ga0105239_10005044 3300010375 Bacteria 15592
143 Ga0105239_10246327 3300010375 Bacteria 2007
144 Ga0157373_10020184 3300013100 Bacteria 4847
145 Ga0157371_10000123 3300013102 Bacteria 118119
146 Ga0157370_10000013 3300013104 Bacteria 198861
147 Ga0157374_10211981 3300013296 Bacteria 1899
148 Ga0163162_10002139 3300013306 Bacteria 18531
149 Ga0163162_10033754 3300013306 Bacteria 5086
150 Ga0157372_10001159 3300013307 Bacteria 28511
151 Ga0182008_10007666 3300014497 Bacteria 5948
152 Ga0182008_10027927 3300014497 Bacteria 2855
153 Ga0182006_1000002 3300015261 Bacteria 887990
154 Ga0182006_1000017 3300015261 Bacteria 299454
155 Ga0182006_1010763 3300015261 Bacteria 4051
156 Ga0182006_1015580 3300015261 Bacteria 3257
157 Ga0182007_10000069 3300015262 Bacteria 82172
158 Ga0182005_1000002 3300015265 Bacteria 908499
159 Ga0182005_1000007 3300015265 Bacteria 490994
160 Ga0182005_1000307 3300015265 Bacteria 29530
161 Ga0206355_1326248 3300020076 Bacteria 4647
162 Ga0206351_10167421 3300020077 Bacteria 22180
163 Ga0206350_10139122 3300020080 Bacteria 2407
164 Ga0154015_1099906 3300020610 Bacteria 39484
165 Ga0213872_10000263 3300021361 Bacteria 45483
166 Ga0213872_10000773 3300021361 Bacteria 23449
167 Ga0213872_10012586 3300021361 Bacteria 3979
168 Ga0213872_10013693 3300021361 Bacteria 3796
169 Ga0209435_100070 3300025206 Bacteria 63829
170 Ga0209435_100716 3300025206 Bacteria 5582
171 Ga0209760_101302 3300025207 Bacteria 2712
172 Ga0209784_100002 3300025224 Bacteria 1753105
173 Ga0209784_100003 3300025224 Bacteria 1379451
174 Ga0209784_100019 3300025224 Bacteria 453558
175 Ga0209784_100293 3300025224 Bacteria 27186
176 Ga0209784_100803 3300025224 Bacteria 7383
177 Ga0209566_100002 3300025225 Bacteria 2614868
178 Ga0209566_100003 3300025225 Bacteria 1753105
179 Ga0209566_100017 3300025225 Bacteria 453558
180 Ga0209566_100370 3300025225 Bacteria 37519
181 Ga0209566_100896 3300025225 Bacteria 14309
182 Ga0209674_100004 3300025226 Bacteria 1753105
183 Ga0209674_100008 3300025226 Bacteria 1076909
184 Ga0209674_100031 3300025226 Bacteria 453558
185 Ga0209674_100122 3300025226 Bacteria 131720
186 Ga0209674_101948 3300025226 Bacteria 4832
187 Ga0209672_100019 3300025228 Bacteria 432215
188 Ga0209672_100051 3300025228 Bacteria 234414
189 Ga0209672_100213 3300025228 Bacteria 45410
190 Ga0209672_109800 3300025228 Bacteria 1329
191 Ga0209147_100002 3300025229 Bacteria 2158988
192 Ga0209147_100023 3300025229 Bacteria 437803
193 Ga0209147_100026 3300025229 Bacteria 421622
194 Ga0209147_101674 3300025229 Bacteria 7277
195 Ga0209563_100004 3300025230 Bacteria 1814108
196 Ga0209563_100006 3300025230 Bacteria 1753105
197 Ga0209563_100007 3300025230 Bacteria 1579402
198 Ga0209563_100035 3300025230 Bacteria 453558
199 Ga0209563_104817 3300025230 Bacteria 2527
200 Ga0207427_100255 3300025231 Bacteria 41856
201 Ga0209437_100038 3300025233 Bacteria 453558
202 Ga0209437_100080 3300025233 Bacteria 275402
203 Ga0209437_103076 3300025233 Bacteria 3077
204 Ga0209258_100002 3300025242 Bacteria 2158988
205 Ga0209258_100031 3300025242 Bacteria 463572
206 Ga0209258_100179 3300025242 Bacteria 137687
207 Ga0209258_100253 3300025242 Bacteria 96309
208 Ga0207425_1000001 3300025245 Bacteria 2525432
209 Ga0207425_1001467 3300025245 Bacteria 9823
210 Ga0207425_1001639 3300025245 Bacteria 9024
211 Ga0209646_1000022 3300025246 Bacteria 446621
212 Ga0209646_1000033 3300025246 Bacteria 369507
213 Ga0209646_1000174 3300025246 Bacteria 84479
214 Ga0209646_1000872 3300025246 Bacteria 10050
215 Ga0209026_1000150 3300025250 Bacteria 111025
216 Ga0209026_1002115 3300025250 Bacteria 7781
217 Ga0209026_1003950 3300025250 Bacteria 4633
218 Ga0209026_1007183 3300025250 Bacteria 2561
219 Ga0209677_100003 3300025253 Bacteria 1753105
220 Ga0209677_100009 3300025253 Bacteria 749530
221 Ga0209677_100020 3300025253 Bacteria 453558
222 Ga0209677_103820 3300025253 Bacteria 4658
223 Ga0209148_1000021 3300025254 Bacteria 714645
224 Ga0209148_1000027 3300025254 Bacteria 616374
225 Ga0209148_1000992 3300025254 Bacteria 18267
226 Ga0209148_1004472 3300025254 Bacteria 3439
227 Ga0209759_1000359 3300025256 Bacteria 58766
228 Ga0209759_1000408 3300025256 Bacteria 52948
229 Ga0209759_1001771 3300025256 Bacteria 11009
230 Ga0209759_1002181 3300025256 Bacteria 8969
231 Ga0209759_1007195 3300025256 Bacteria 3618
232 Ga0209129_1000001 3300025258 Bacteria 1452436
233 Ga0209129_1005030 3300025258 Bacteria 4863
234 Ga0209233_1000049 3300025261 Bacteria 453558
235 Ga0209565_1000167 3300025263 Bacteria 85246
236 Ga0209565_1000902 3300025263 Bacteria 16045
237 Ga0209565_1001159 3300025263 Bacteria 12725
238 Ga0209565_1007277 3300025263 Bacteria 3000
239 Ga0209455_1000021 3300025272 Bacteria 699993
240 Ga0209455_1000037 3300025272 Bacteria 464097
241 Ga0209455_1000213 3300025272 Bacteria 82040
242 Ga0209455_1002641 3300025272 Bacteria 6780
243 Ga0209455_1004072 3300025272 Bacteria 4925
244 Ga0209673_1000051 3300025273 Bacteria 282161
245 Ga0209673_1000201 3300025273 Bacteria 120059
246 Ga0209673_1012575 3300025273 Bacteria 3401
247 Ga0209130_1000091 3300025284 Bacteria 149502
248 Ga0209130_1000507 3300025284 Bacteria 39512
249 Ga0209130_1003078 3300025284 Bacteria 7462
250 Ga0209130_1006616 3300025284 Bacteria 3733
251 Ga0209675_1000027 3300025291 Bacteria 282175
252 Ga0209675_1000769 3300025291 Bacteria 21492
253 Ga0209675_1005996 3300025291 Bacteria 4973
254 Ga0209675_1009461 3300025291 Bacteria 3443
255 Ga0209676_1004133 3300025292 Bacteria 8268
256 Ga0209025_1000003 3300025294 Bacteria 1366495
257 Ga0209025_1016263 3300025294 Bacteria 4408
258 Ga0209564_1000009 3300025295 Bacteria 950196
259 Ga0209564_1000068 3300025295 Bacteria 311171
260 Ga0209564_1000897 3300025295 Bacteria 39116
261 Ga0209564_1001707 3300025295 Bacteria 20758
262 Ga0209564_1002800 3300025295 Bacteria 12995
263 Ga0209564_1003112 3300025295 Bacteria 11717
264 Ga0209564_1047387 3300025295 Bacteria 1083
265 Ga0209758_1000073 3300025297 Bacteria 276262
266 Ga0209758_1002044 3300025297 Bacteria 21637
267 Ga0209050_1000046 3300025298 Bacteria 386466
268 Ga0209050_1003824 3300025298 Bacteria 10743
269 Ga0209050_1012901 3300025298 Bacteria 3780
270 Ga0209256_1000044 3300025299 Bacteria 337264
271 Ga0209256_1000265 3300025299 Bacteria 92716
272 Ga0209256_1002001 3300025299 Bacteria 18236
273 Ga0209256_1010975 3300025299 Bacteria 3700
274 Ga0207426_1001239 3300025302 Bacteria 22460
275 Ga0207426_1003279 3300025302 Bacteria 9024
276 Ga0209257_1000068 3300025304 Bacteria 341291
277 Ga0207655_1008662 3300025728 Bacteria 6421
278 Ga0207655_1011578 3300025728 Bacteria 5238
279 Ga0207655_1050604 3300025728 Bacteria 1687
280 Ga0207713_1003181 3300025735 Bacteria 11351
281 Ga0207680_10231953 3300025903 Bacteria 1269
282 Ga0207647_10000835 3300025904 Bacteria 23959
283 Ga0207647_10018639 3300025904 Bacteria 4688
284 Ga0207705_10023618 3300025909 Bacteria 4386
285 Ga0207705_10112848 3300025909 Bacteria 2010
286 Ga0207695_10000475 3300025913 Bacteria 86957
287 Ga0207695_10006070 3300025913 Bacteria 15766
288 Ga0207695_10011620 3300025913 Bacteria 10649
289 Ga0207695_10032578 3300025913 Bacteria 5700
290 Ga0207695_10036204 3300025913 Bacteria 5338
291 Ga0207671_10020134 3300025914 Bacteria 5086
292 Ga0207671_10052029 3300025914 Bacteria 3034
293 Ga0207660_10094123 3300025917 Bacteria 2227
294 Ga0207657_10000001 3300025919 Bacteria 458536
295 Ga0207657_10012572 3300025919 Bacteria 8345
296 Ga0207657_10037258 3300025919 Bacteria 4344
297 Ga0207657_10137885 3300025919 Bacteria 1995
298 Ga0207657_10330431 3300025919 Bacteria 1204
299 Ga0207649_10000019 3300025920 Bacteria 212682
300 Ga0207649_10035200 3300025920 Bacteria 3008
301 Ga0207694_10004571 3300025924 Bacteria 10785
302 Ga0207694_10010183 3300025924 Bacteria 7086
303 Ga0207694_10022298 3300025924 Bacteria 4802
304 Ga0207650_10011517 3300025925 Bacteria 6090
305 Ga0207659_10256285 3300025926 Bacteria 1421
306 Ga0207664_10123199 3300025929 Bacteria 2173
307 Ga0207690_10000006 3300025932 Bacteria 433880
308 Ga0207690_10004157 3300025932 Bacteria 8555
309 Ga0207690_10021999 3300025932 Bacteria 3961
310 Ga0207690_10127237 3300025932 Bacteria 1859
311 Ga0207690_10133276 3300025932 Bacteria 1821
312 Ga0207686_10049440 3300025934 Bacteria 2610
313 Ga0207711_10024668 3300025941 Bacteria 5042
314 Ga0207679_10000001 3300025945 Bacteria 777444
315 Ga0207679_10004443 3300025945 Bacteria 8736
316 Ga0207667_10000025 3300025949 Bacteria 350159
317 Ga0207667_10023086 3300025949 Bacteria 6854
318 Ga0207667_10046894 3300025949 Bacteria 4575
319 Ga0207667_10134582 3300025949 Bacteria 2545
320 Ga0207667_10138896 3300025949 Bacteria 2502
321 Ga0207640_10000240 3300025981 Bacteria 37127
322 Ga0207678_10000001 3300026067 Bacteria 433184
323 Ga0207678_10000167 3300026067 Bacteria 55724
324 Ga0207678_10038870 3300026067 Bacteria 4131
325 Ga0207678_10253587 3300026067 Bacteria 1507
326 Ga0207702_10000009 3300026078 Bacteria 305906
327 Ga0207702_10136452 3300026078 Bacteria 2214
328 Ga0207674_10064218 3300026116 Bacteria 3703
329 Ga0207674_10281349 3300026116 Bacteria 1611
330 Ga0207698_10020074 3300026142 Bacteria 4591
331 Ga0207698_10111359 3300026142 Bacteria 2295
332 Ga0209281_1006345 3300027111 Bacteria 3102
333 Ga0209371_1000297 3300027312 Bacteria 55845
334 Ga0209282_1000001 3300027666 Bacteria 2450367
335 Ga0268264_10162696 3300028381 Bacteria 2012
336 Ga0268256_1000261 3300030500 Bacteria 55844
337 Ga0307511_10000040 3300030521 Bacteria 102640
338 Ga0316177_1009921 3300030731 Bacteria 1753
339 Ga0316180_1185675 3300030736 Bacteria 2546
340 Ga0316181_1278006 3300030744 Bacteria 2506
341 Ga0265327_10027938 3300031251 Bacteria 3239
342 Ga0265327_10090341 3300031251 Bacteria 1495
343 Ga0307408_100001210 3300031548 Bacteria 19453
344 Ga0307408_100021297 3300031548 Bacteria 4386
345 Ga0307408_100029234 3300031548 Bacteria 3815
346 Ga0307408_100043636 3300031548 Bacteria 3191
347 Ga0307518_10028306 3300031838 Bacteria 4044
348 Ga0307412_10000845 3300031911 Bacteria 17634
349 Ga0307416_100020341 3300032002 Bacteria 4733
350 Ga0307414_10012598 3300032004 Bacteria 5007
351 Ga0316583_10009599 3300032133 Bacteria 3486
352 Ga0307507_10043456 3300033179 Bacteria 4459
353 Ga0395899_0000904 3300037312 Bacteria 27911
354 Ga0395899_0002101 3300037312 Bacteria 16364
355 Ga0395899_0036149 3300037312 Bacteria 3706
356 Ga0395899_0049427 3300037312 Bacteria 3126
357 Ga0395899_0058593 3300037312 Bacteria 2840
358 Ga0395899_0076323 3300037312 Bacteria 2446
359 Ga0395899_0181802 3300037312 Bacteria 1476
360 Ga0395900_0000874 3300037418 Bacteria 39520
361 Ga0395900_0007034 3300037418 Bacteria 11651
362 Ga0395900_0009723 3300037418 Bacteria 9850
363 Ga0395900_0018346 3300037418 Bacteria 7137
364 Ga0395900_0023633 3300037418 Bacteria 6287
365 Ga0395900_0036284 3300037418 Bacteria 5082
366 Ga0395900_0050571 3300037418 Bacteria 4280
367 Ga0395900_0062747 3300037418 Bacteria 3819
368 Ga0395900_0102978 3300037418 Bacteria 2932
369 Ga0395900_0163739 3300037418 Bacteria 2267
370 Ga0395900_0517839 3300037418 Bacteria 1141
371 Ga0395898_0039391 3300037466 Bacteria 4677
372 Ga0395898_0154334 3300037466 Bacteria 2196
373 Ga0395898_0157087 3300037466 Bacteria 2175
374 Ga0395898_0423988 3300037466 Bacteria 1268
375 Ga0395905_0008840 3300037471 Bacteria 9899
376 Ga0395905_0009571 3300037471 Bacteria 9461
377 Ga0395905_0048604 3300037471 Bacteria 3975
378 Ga0395905_0070895 3300037471 Bacteria 3266
379 Ga0395905_0075118 3300037471 Bacteria 3167
380 Ga0395905_0088384 3300037471 Bacteria 2905
381 Ga0395905_0263229 3300037471 Bacteria 1610
382 Ga0395905_0285714 3300037471 Bacteria 1536
383 Ga0395905_0341128 3300037471 Bacteria 1389
384 Ga0395901_0000054 3300038443 Bacteria 160505
385 Ga0395901_0003565 3300038443 Bacteria 15697
386 Ga0395901_0010496 3300038443 Bacteria 9382
387 Ga0395901_0127852 3300038443 Bacteria 2671
388 Ga0395901_0273659 3300038443 Bacteria 1756
389 Ga0395901_0425782 3300038443 Bacteria 1360
390 Ga0395901_0438385 3300038443 Bacteria 1337
391 Ga0395901_0452847 3300038443 Bacteria 1312
392 Ga0395901_0480409 3300038443 Bacteria 1267
393 Ga0436361_0080172 3300039447 Bacteria 39325
394 Ga0436361_0116364 3300039447 Bacteria 2684
395 Ga0436361_0134513 3300039447 Bacteria 2777
396 Ga0436361_0261530 3300039447 Bacteria 8331
397 Ga0436361_0324341 3300039447 Bacteria 73428
398 Ga0436361_0525957 3300039447 Bacteria 2561
399 Ga0436361_0944997 3300039447 Bacteria 6398
400 Ga0436361_0987205 3300039447 Bacteria 3310
401 Ga0439448_0003707 3300042005 Bacteria 4256
402 Ga0439448_0020781 3300042005 Bacteria 2034
403 Ga0439458_0001531 3300042157 Bacteria 5778
404 Ga0451577_0004811 3300042876 Bacteria 14099
405 Ga0451577_0006944 3300042876 Bacteria 11187
406 Ga0451577_0026714 3300042876 Bacteria 5229
407 Ga0451577_0101044 3300042876 Bacteria 2576
408 Ga0451577_0175942 3300042876 Bacteria 1929
409 Ga0466972_0000005 3300044658 Bacteria 289640
410 Ga0466972_0002881 3300044658 Bacteria 8512
411 Ga0466972_0004661 3300044658 Bacteria 6865
412 Ga0466972_0076949 3300044658 Bacteria 1589
413 Ga0466977_0003512 3300044666 Bacteria 7626
414 Ga0466978_0027607 3300044671 Bacteria 3428
415 Ga0466982_0020479 3300044672 Bacteria 3760
416 Ga0466965_0005740 3300044683 Bacteria 5601
417 Ga0466965_0014133 3300044683 Bacteria 3776
418 Ga0466965_0016454 3300044683 Bacteria 3520
419 Ga0466965_0016917 3300044683 Bacteria 3478
420 Ga0466965_0084426 3300044683 Bacteria 1608
421 Ga0466966_0005305 3300044684 Bacteria 8476
422 Ga0466966_0033545 3300044684 Bacteria 3324
423 Ga0466966_0062889 3300044684 Bacteria 2339
424 Ga0466966_0080211 3300044684 Bacteria 2033
425 Ga0466966_0090457 3300044684 Bacteria 1900
426 Ga0466961_0001007 3300044693 Bacteria 17404
427 Ga0466963_0134754 3300044694 Bacteria 1708
428 Ga0466964_0001227 3300044706 Bacteria 8693
429 Ga0466964_0001931 3300044706 Bacteria 7257
430 Ga0466964_0007716 3300044706 Bacteria 4027
431 Ga0466964_0036081 3300044706 Bacteria 1980
432 Ga0453684_0000847 3300044712 Bacteria 103142
433 Ga0453684_0031930 3300044712 Bacteria 7384
434 Ga0466971_0010136 3300044719 Bacteria 4115
435 Ga0466968_0001801 3300044735 Bacteria 7739
436 Ga0466968_0003428 3300044735 Bacteria 5865
437 Ga0466968_0131265 3300044735 Bacteria 1140
438 Ga0466970_0014132 3300044765 Bacteria 4094
439 Ga0466957_0013888 3300044842 Bacteria 4681
440 Ga0466957_0044973 3300044842 Bacteria 2676
441 Ga0466957_0177057 3300044842 Bacteria 1391
442 Ga0466959_0007553 3300045049 Bacteria 7640
443 Ga0466959_0165242 3300045049 Bacteria 1554
444 Ga0451576_0001131 3300045051 Bacteria 48320
445 Ga0451576_0017241 3300045051 Bacteria 7944
446 Ga0451576_0055941 3300045051 Bacteria 4127
447 Ga0451576_0197558 3300045051 Bacteria 2101
448 Ga0451576_0269744 3300045051 Bacteria 1779
449 Ga0451576_0602437 3300045051 Bacteria 1155
450 Ga0466967_0010385 3300045976 Bacteria 6982
451 Ga0466967_0071893 3300045976 Bacteria 3098
452 Ga0466967_0288288 3300045976 Bacteria 1576
453 Ga0466967_0529560 3300045976 Bacteria 1158
454 Ga0495617_000041 3300046452 Bacteria 124027
455 Ga0495617_000057 3300046452 Bacteria 100673
456 Ga0495617_000843 3300046452 Bacteria 14581
457 Ga0495627_000007 3300046453 Bacteria 575915
458 Ga0495627_001817 3300046453 Bacteria 11358
459 Ga0495627_006174 3300046453 Bacteria 4721
460 Ga0495627_020867 3300046453 Bacteria 2178
461 Ga0495592_0047346 3300046454 Bacteria 3202
462 Ga0495603_0078255 3300046455 Bacteria 1939
463 Ga0495590_0000001 3300046457 Bacteria 762984
464 Ga0495590_0000018 3300046457 Bacteria 216375
465 Ga0495590_0002149 3300046457 Bacteria 8279
466 Ga0495590_0008695 3300046457 Bacteria 3866
467 Ga0495590_0010437 3300046457 Bacteria 3493
468 Ga0495591_012498 3300046458 Bacteria 3159
469 Ga0495629_0000293 3300046459 Bacteria 43087
470 Ga0495638_0000086 3300046460 Bacteria 152781
471 Ga0495638_0223603 3300046460 Bacteria 1051
472 Ga0495651_0028201 3300046462 Bacteria 4375
473 Ga0495653_0000002 3300046463 Bacteria 507262
474 Ga0495653_0001619 3300046463 Bacteria 17685
475 Ga0495653_0028643 3300046463 Bacteria 4452
476 Ga0495650_0000108 3300046471 Bacteria 200369
477 Ga0495650_0000118 3300046471 Bacteria 187358
478 Ga0495650_0000140 3300046471 Bacteria 169317
479 Ga0495650_0000156 3300046471 Bacteria 155338
480 Ga0495650_0000837 3300046471 Bacteria 37114
481 Ga0495650_0007249 3300046471 Bacteria 6716
482 Ga0495650_0017152 3300046471 Bacteria 3639
483 Ga0495580_0156385 3300046472 Bacteria 1578
484 Ga0495582_0006054 3300046473 Bacteria 6740
485 Ga0495582_0015498 3300046473 Bacteria 4187
486 Ga0495605_0000168 3300046474 Bacteria 82889
487 Ga0495605_0000416 3300046474 Bacteria 38811
488 Ga0495605_0000438 3300046474 Bacteria 37563
489 Ga0495605_0003370 3300046474 Bacteria 9538
490 Ga0495605_0019964 3300046474 Bacteria 3567
491 Ga0495605_0027851 3300046474 Bacteria 2923
492 Ga0495605_0035069 3300046474 Bacteria 2537
493 Ga0495605_0071002 3300046474 Bacteria 1645
494 Ga0495605_0090233 3300046474 Bacteria 1421
495 Ga0495605_0142817 3300046474 Bacteria 1073
496 Ga0495639_0033664 3300046475 Bacteria 2289
497 Ga0495584_0000281 3300046491 Bacteria 35857
498 Ga0495584_0002307 3300046491 Bacteria 10888
499 Ga0495584_0012122 3300046491 Bacteria 4406
500 Ga0495584_0013652 3300046491 Bacteria 4143
501 Ga0495584_0023179 3300046491 Bacteria 3147
502 Ga0495584_0033622 3300046491 Bacteria 2594
503 Ga0495584_0043266 3300046491 Bacteria 2273
504 Ga0495585_0002371 3300046492 Bacteria 13522
505 Ga0495585_0005187 3300046492 Bacteria 8261
506 Ga0495585_0007454 3300046492 Bacteria 6694
507 Ga0495585_0008412 3300046492 Bacteria 6254
508 Ga0495585_0014980 3300046492 Bacteria 4508
509 Ga0495585_0020761 3300046492 Bacteria 3775
510 Ga0495585_0038339 3300046492 Bacteria 2697
511 Ga0495585_0100247 3300046492 Bacteria 1549
512 Ga0495585_0104505 3300046492 Bacteria 1511
513 Ga0495594_0024057 3300046499 Bacteria 3268
514 Ga0495596_0001435 3300046500 Bacteria 13653
515 Ga0495596_0011978 3300046500 Bacteria 3722
516 Ga0495596_0012711 3300046500 Bacteria 3594
517 Ga0495596_0018777 3300046500 Bacteria 2848
518 Ga0495596_0020910 3300046500 Bacteria 2675
519 Ga0495596_0020949 3300046500 Bacteria 2672
520 Ga0495596_0023665 3300046500 Bacteria 2491
521 Ga0495596_0025542 3300046500 Bacteria 2387
522 Ga0495596_0026299 3300046500 Bacteria 2346
523 Ga0495596_0067256 3300046500 Bacteria 1392
524 Ga0495607_0002962 3300046501 Bacteria 13341
525 Ga0495607_0003330 3300046501 Bacteria 12335
526 Ga0495607_0004150 3300046501 Bacteria 10781
527 Ga0495607_0006983 3300046501 Bacteria 7863
528 Ga0495607_0019846 3300046501 Bacteria 4261
529 Ga0495607_0020575 3300046501 Bacteria 4167
530 Ga0495607_0025658 3300046501 Bacteria 3663
531 Ga0495607_0028934 3300046501 Bacteria 3413
532 Ga0495607_0031999 3300046501 Bacteria 3216
533 Ga0495607_0032131 3300046501 Bacteria 3206
534 Ga0495607_0038276 3300046501 Bacteria 2874
535 Ga0495607_0046570 3300046501 Bacteria 2545
536 Ga0495607_0049132 3300046501 Bacteria 2461
537 Ga0495607_0076351 3300046501 Bacteria 1853
538 Ga0495607_0092268 3300046501 Bacteria 1638
539 Ga0495583_0000177 3300046506 Bacteria 108704
540 Ga0495583_0000221 3300046506 Bacteria 96143
541 Ga0495583_0001635 3300046506 Bacteria 21854
542 Ga0495583_0003816 3300046506 Bacteria 11182
543 Ga0495583_0004868 3300046506 Bacteria 9379
544 Ga0495583_0014101 3300046506 Bacteria 4422
545 Ga0495583_0020486 3300046506 Bacteria 3425
546 Ga0495583_0032488 3300046506 Bacteria 2519
547 Ga0495606_0000001 3300046507 Bacteria 592123
548 Ga0495606_0000011 3300046507 Bacteria 296816
549 Ga0495606_0000679 3300046507 Bacteria 53237
550 Ga0495606_0000864 3300046507 Bacteria 45347
551 Ga0495606_0006986 3300046507 Bacteria 10256
552 Ga0495606_0007758 3300046507 Bacteria 9503
553 Ga0495606_0022736 3300046507 Bacteria 4557
554 Ga0495606_0027811 3300046507 Bacteria 4001
555 Ga0495606_0027851 3300046507 Bacteria 3997
556 Ga0495606_0045995 3300046507 Bacteria 2887
557 Ga0495606_0063561 3300046507 Bacteria 2352
558 Ga0495606_0112714 3300046507 Bacteria 1638
559 Ga0495608_0006170 3300046511 Bacteria 8513
560 Ga0495608_0041553 3300046511 Bacteria 3076
561 Ga0495610_0000003 3300046512 Bacteria 1203910
562 Ga0495610_0002329 3300046512 Bacteria 16055
563 Ga0495610_0003829 3300046512 Bacteria 11463
564 Ga0495610_0075135 3300046512 Bacteria 1565
565 Ga0495610_0078369 3300046512 Bacteria 1523
566 Ga0495616_0000662 3300046513 Bacteria 25597
567 Ga0495616_0002684 3300046513 Bacteria 11663
568 Ga0495616_0013824 3300046513 Bacteria 4538
569 Ga0495616_0018343 3300046513 Bacteria 3842
570 Ga0495616_0026851 3300046513 Bacteria 3058
571 Ga0495616_0033272 3300046513 Bacteria 2687
572 Ga0495616_0039587 3300046513 Bacteria 2413
573 Ga0495616_0052848 3300046513 Bacteria 2021
574 Ga0495616_0058167 3300046513 Bacteria 1904
575 Ga0495618_0071916 3300046514 Bacteria 2200
576 Ga0495628_0004565 3300046516 Bacteria 12256
577 Ga0495628_0007604 3300046516 Bacteria 9365
578 Ga0495628_0011133 3300046516 Bacteria 7615
579 Ga0495630_0084205 3300046517 Bacteria 2401
580 Ga0495631_0000632 3300046518 Bacteria 23007
581 Ga0495631_0001483 3300046518 Bacteria 14222
582 Ga0495631_0016053 3300046518 Bacteria 3577
583 Ga0495631_0018103 3300046518 Bacteria 3320
584 Ga0495631_0018121 3300046518 Bacteria 3318
585 Ga0495631_0032908 3300046518 Bacteria 2333
586 Ga0495631_0070560 3300046518 Bacteria 1510
587 Ga0495632_0000214 3300046519 Bacteria 58439
588 Ga0495632_0003852 3300046519 Bacteria 10434
589 Ga0495632_0011405 3300046519 Bacteria 5187
590 Ga0495632_0014316 3300046519 Bacteria 4490
591 Ga0495632_0015456 3300046519 Bacteria 4278
592 Ga0495632_0027244 3300046519 Bacteria 2995
593 Ga0495637_0000612 3300046520 Bacteria 25396
594 Ga0495637_0001689 3300046520 Bacteria 12743
595 Ga0495637_0021637 3300046520 Bacteria 2946
596 Ga0495643_0000123 3300046522 Bacteria 124936
597 Ga0495643_0004483 3300046522 Bacteria 9748
598 Ga0495643_0009598 3300046522 Bacteria 6002
599 Ga0495643_0015947 3300046522 Bacteria 4425
600 Ga0495643_0019252 3300046522 Bacteria 3952
601 Ga0495643_0021003 3300046522 Bacteria 3753
602 Ga0495643_0043697 3300046522 Bacteria 2437
603 Ga0495643_0046264 3300046522 Bacteria 2359
604 Ga0495644_0001496 3300046523 Bacteria 9525
605 Ga0495644_0006676 3300046523 Bacteria 4470
606 Ga0495644_0007533 3300046523 Bacteria 4196
607 Ga0495644_0009890 3300046523 Bacteria 3672
608 Ga0495644_0039613 3300046523 Bacteria 1776
609 Ga0495648_0000001 3300046524 Bacteria 696872
610 Ga0495648_0002540 3300046524 Bacteria 16736
611 Ga0495648_0002834 3300046524 Bacteria 15603
612 Ga0495648_0004137 3300046524 Bacteria 12482
613 Ga0495648_0010857 3300046524 Bacteria 6912
614 Ga0495648_0018998 3300046524 Bacteria 4847
615 Ga0495648_0019039 3300046524 Bacteria 4841
616 Ga0495648_0033894 3300046524 Bacteria 3330
617 Ga0495648_0044272 3300046524 Bacteria 2780
618 Ga0495648_0058698 3300046524 Bacteria 2299
619 Ga0495648_0103908 3300046524 Bacteria 1561
620 Ga0495648_0124694 3300046524 Bacteria 1378
621 Ga0495663_0004849 3300046525 Bacteria 3759
622 Ga0495642_0000741 3300046528 Bacteria 16179
623 Ga0495642_0001464 3300046528 Bacteria 10572
624 Ga0495642_0007631 3300046528 Bacteria 4147
625 Ga0495642_0013970 3300046528 Bacteria 3110
626 Ga0495642_0015415 3300046528 Bacteria 2971
627 Ga0495642_0023321 3300046528 Bacteria 2442
628 Ga0495652_0012068 3300046529 Bacteria 7808
629 Ga0495652_0040085 3300046529 Bacteria 4048
630 Ga0495652_0113750 3300046529 Bacteria 2172
631 Ga0495654_0000038 3300046530 Bacteria 185693
632 Ga0495654_0070510 3300046530 Bacteria 1657
633 Ga0495654_0097181 3300046530 Bacteria 1360
634 Ga0495654_0131186 3300046530 Bacteria 1125
635 Ga0495665_0019053 3300046531 Bacteria 3688
636 Ga0495665_0026571 3300046531 Bacteria 3109
637 Ga0495640_0208183 3300046533 Bacteria 1237
638 Ga0495586_0032100 3300046535 Bacteria 2815
639 Ga0495586_0123732 3300046535 Bacteria 1445
640 Ga0495587_0235306 3300046536 Bacteria 1031
641 Ga0495609_0000009 3300046538 Bacteria 354860
642 Ga0495609_0000479 3300046538 Bacteria 32080
643 Ga0495609_0002949 3300046538 Bacteria 10058
644 Ga0495609_0003102 3300046538 Bacteria 9742
645 Ga0495609_0006657 3300046538 Bacteria 5864
646 Ga0495609_0018010 3300046538 Bacteria 3276
647 Ga0495609_0020796 3300046538 Bacteria 3029
648 Ga0495609_0029171 3300046538 Bacteria 2513
649 Ga0495609_0116195 3300046538 Bacteria 1152
650 Ga0495597_0000110 3300046542 Bacteria 72678
651 Ga0495597_0002311 3300046542 Bacteria 12366
652 Ga0495597_0003097 3300046542 Bacteria 10004
653 Ga0495597_0004138 3300046542 Bacteria 8064
654 Ga0495597_0007611 3300046542 Bacteria 5483
655 Ga0495597_0010421 3300046542 Bacteria 4546
656 Ga0495597_0014117 3300046542 Bacteria 3808
657 Ga0495597_0018479 3300046542 Bacteria 3272
658 Ga0495597_0026802 3300046542 Bacteria 2646
659 Ga0495645_0014686 3300046543 Bacteria 5560
660 Ga0495645_0027376 3300046543 Bacteria 4142
661 Ga0495622_0000028 3300046557 Bacteria 133197
662 Ga0495622_0003561 3300046557 Bacteria 7318
663 Ga0495622_0038097 3300046557 Bacteria 2238
664 Ga0495633_0000272 3300046558 Bacteria 60512
665 Ga0495633_0002858 3300046558 Bacteria 11858
666 Ga0495633_0003780 3300046558 Bacteria 9929
667 Ga0495633_0004683 3300046558 Bacteria 8607
668 Ga0495633_0006086 3300046558 Bacteria 7228
669 Ga0495633_0011002 3300046558 Bacteria 4911
670 Ga0495633_0015072 3300046558 Bacteria 4018
671 Ga0495633_0026986 3300046558 Bacteria 2811
672 Ga0495633_0034003 3300046558 Bacteria 2453
673 Ga0495633_0115253 3300046558 Bacteria 1245
674 Ga0495656_0003881 3300046615 Bacteria 5084
675 Ga0495656_0053355 3300046615 Bacteria 1737
676 Ga0495668_0000093 3300046616 Bacteria 142565
677 Ga0495668_0000095 3300046616 Bacteria 141321
678 Ga0495668_0000151 3300046616 Bacteria 105466
679 Ga0495668_0001575 3300046616 Bacteria 21547
680 Ga0495668_0003639 3300046616 Bacteria 11407
681 Ga0495668_0015431 3300046616 Bacteria 4461
682 Ga0495668_0016287 3300046616 Bacteria 4320
683 Ga0495668_0025820 3300046616 Bacteria 3336
684 Ga0495668_0030438 3300046616 Bacteria 3047
685 Ga0495668_0030940 3300046616 Bacteria 3017
686 Ga0495668_0091938 3300046616 Bacteria 1662
687 Ga0495668_0129139 3300046616 Bacteria 1383
688 Ga0495634_0048273 3300046642 Bacteria 2866
689 Ga0495634_0199937 3300046642 Bacteria 1242
690 Ga0495611_0000499 3300046648 Bacteria 23354
691 Ga0495611_0002457 3300046648 Bacteria 8460
692 Ga0495611_0011597 3300046648 Bacteria 3738
693 Ga0495611_0023585 3300046648 Bacteria 2671
694 Ga0495611_0026413 3300046648 Bacteria 2533
695 Ga0495611_0085172 3300046648 Bacteria 1457
696 Ga0495625_0001679 3300046660 Bacteria 25832
697 Ga0495625_0004300 3300046660 Bacteria 13548
698 Ga0495625_0007018 3300046660 Bacteria 9917
699 Ga0495625_0010387 3300046660 Bacteria 7709
700 Ga0495625_0017150 3300046660 Bacteria 5673
701 Ga0495625_0026781 3300046660 Bacteria 4349
702 Ga0495625_0050235 3300046660 Bacteria 2993
703 Ga0495625_0057067 3300046660 Bacteria 2778
704 Ga0495625_0066343 3300046660 Bacteria 2542
705 Ga0495625_0068572 3300046660 Bacteria 2493
706 Ga0495635_0002454 3300046663 Bacteria 12659
707 Ga0495635_0057076 3300046663 Bacteria 2687
708 Ga0495659_0000284 3300046664 Bacteria 20570
709 Ga0495659_0004469 3300046664 Bacteria 4405
710 Ga0495659_0007199 3300046664 Bacteria 3523
711 Ga0495659_0034594 3300046664 Bacteria 1777
712 Ga0495661_0001929 3300046665 Bacteria 16505
713 Ga0495661_0007429 3300046665 Bacteria 7642
714 Ga0495661_0008112 3300046665 Bacteria 7280
715 Ga0495661_0012238 3300046665 Bacteria 5795
716 Ga0495661_0013191 3300046665 Bacteria 5556
717 Ga0495661_0014739 3300046665 Bacteria 5233
718 Ga0495661_0017969 3300046665 Bacteria 4660
719 Ga0495661_0027110 3300046665 Bacteria 3680
720 Ga0495661_0035807 3300046665 Bacteria 3112
721 Ga0495661_0042600 3300046665 Bacteria 2797
722 Ga0495661_0049481 3300046665 Bacteria 2548
723 Ga0495661_0058954 3300046665 Bacteria 2286
724 Ga0495661_0076618 3300046665 Bacteria 1939
725 Ga0495661_0079739 3300046665 Bacteria 1891
726 Ga0495661_0094786 3300046665 Bacteria 1691
727 Ga0495588_0000077 3300046674 Bacteria 215338
728 Ga0495588_0010399 3300046674 Bacteria 4328
729 Ga0495588_0011557 3300046674 Bacteria 4146
730 Ga0495588_0031167 3300046674 Bacteria 2682
731 Ga0495588_0032950 3300046674 Bacteria 2614
732 Ga0495588_0050863 3300046674 Bacteria 2132
733 Ga0495657_0073728 3300046675 Bacteria 2222
734 Ga0495599_0004944 3300046678 Bacteria 7925
735 Ga0495623_0011364 3300046679 Bacteria 5760
736 Ga0495623_0012790 3300046679 Bacteria 5434
737 Ga0495623_0043008 3300046679 Bacteria 2875
738 Ga0495646_0012052 3300046680 Bacteria 5499
739 Ga0495669_0000116 3300046684 Bacteria 51756
740 Ga0495669_0006988 3300046684 Bacteria 4726
741 Ga0495669_0007431 3300046684 Bacteria 4595
742 Ga0495669_0008000 3300046684 Bacteria 4437
743 Ga0495669_0011905 3300046684 Bacteria 3699
744 Ga0495669_0023781 3300046684 Bacteria 2669
745 Ga0495669_0056974 3300046684 Bacteria 1762
746 Ga0495624_0034960 3300046690 Bacteria 3247
747 Ga0495670_0003774 3300046691 Bacteria 7444
748 Ga0495670_0005019 3300046691 Bacteria 6507
749 Ga0495670_0050660 3300046691 Bacteria 2078
750 Ga0495670_0053626 3300046691 Bacteria 2019
751 Ga0495670_0056910 3300046691 Bacteria 1962
752 Ga0495671_0000001 3300046692 Bacteria 1169494
753 Ga0495671_0000108 3300046692 Bacteria 74169
754 Ga0495671_0002689 3300046692 Bacteria 11143
755 Ga0495671_0034330 3300046692 Bacteria 2579
756 Ga0495671_0140335 3300046692 Bacteria 1177
757 Ga0495649_0003311 3300046694 Bacteria 10948
758 Ga0495649_0011717 3300046694 Bacteria 5131
759 Ga0495649_0017148 3300046694 Bacteria 4091
760 Ga0495649_0077418 3300046694 Bacteria 1780
761 Ga0495649_0091022 3300046694 Bacteria 1626
762 Ga0495589_0001060 3300046794 Bacteria 16526
763 Ga0495589_0003670 3300046794 Bacteria 8295
764 Ga0495589_0007613 3300046794 Bacteria 5673
765 Ga0495589_0013208 3300046794 Bacteria 4261
766 Ga0495589_0017044 3300046794 Bacteria 3730
767 Ga0495589_0019655 3300046794 Bacteria 3458
768 Ga0495589_0038105 3300046794 Bacteria 2407
769 Ga0495589_0060621 3300046794 Bacteria 1858
770 Ga0495589_0072619 3300046794 Bacteria 1680
771 Ga0495589_0100291 3300046794 Bacteria 1401
772 Ga0495600_0001876 3300046809 Bacteria 11795
773 Ga0495660_0000178 3300046810 Bacteria 68956
774 Ga0495660_0000705 3300046810 Bacteria 25643
775 Ga0495660_0003426 3300046810 Bacteria 9818
776 Ga0495660_0005173 3300046810 Bacteria 7833
777 Ga0495660_0014659 3300046810 Bacteria 4533
778 Ga0495660_0020825 3300046810 Bacteria 3759
779 Ga0495604_0027131 3300047317 Bacteria 4556
780 Ga0495604_0177628 3300047317 Bacteria 1491
781 Ga0495636_0003600 3300047318 Bacteria 6007
782 Ga0495636_0020049 3300047318 Bacteria 2692
783 Ga0495636_0033912 3300047318 Bacteria 2099
784 Ga0495636_0079592 3300047318 Bacteria 1409
785 Ga0495674_0019748 3300047319 Bacteria 6249
786 Ga0495672_0000033 3300047320 Bacteria 291992
787 Ga0495672_0000181 3300047320 Bacteria 91278
788 Ga0495672_0000366 3300047320 Bacteria 57469
789 Ga0495672_0000381 3300047320 Bacteria 54971
790 Ga0495672_0001623 3300047320 Bacteria 21897
791 Ga0495672_0009440 3300047320 Bacteria 7068
792 Ga0495672_0010123 3300047320 Bacteria 6744
793 Ga0495672_0072440 3300047320 Bacteria 1946
794 Ga0495676_0000121 3300047321 Bacteria 59949
795 Ga0495676_0115733 3300047321 Bacteria 1960
796 Ga0495680_0043864 3300047322 Bacteria 3538
797 Ga0495680_0132495 3300047322 Bacteria 1830
798 Ga0495683_0001151 3300047323 Bacteria 18144
799 Ga0495683_0011839 3300047323 Bacteria 4586
800 Ga0495683_0012145 3300047323 Bacteria 4526
801 Ga0495683_0020827 3300047323 Bacteria 3380
802 Ga0495683_0036976 3300047323 Bacteria 2477
803 Ga0495683_0053793 3300047323 Bacteria 2007
804 Ga0495687_000002 3300047443 Bacteria 1085770
805 Ga0495687_000017 3300047443 Bacteria 350429
806 Ga0495687_000024 3300047443 Bacteria 316676
807 Ga0495687_000458 3300047443 Bacteria 49855
808 Ga0495687_006587 3300047443 Bacteria 7071
809 Ga0495687_013931 3300047443 Bacteria 4166
810 Ga0495687_014022 3300047443 Bacteria 4147
811 Ga0495687_029982 3300047443 Bacteria 2510
812 Ga0495675_0016790 3300047444 Bacteria 4629
813 Ga0495675_0086847 3300047444 Bacteria 1966
814 Ga0495675_0097755 3300047444 Bacteria 1839
815 Ga0495675_0163034 3300047444 Bacteria 1372
816 Ga0495677_0000117 3300047445 Bacteria 38586
817 Ga0495677_0001384 3300047445 Bacteria 9699
818 Ga0495677_0002355 3300047445 Bacteria 7419
819 Ga0495677_0003340 3300047445 Bacteria 6242
820 Ga0495677_0005223 3300047445 Bacteria 4938
821 Ga0495677_0008846 3300047445 Bacteria 3729
822 Ga0495677_0010361 3300047445 Bacteria 3425
823 Ga0495677_0016878 3300047445 Bacteria 2647
824 Ga0495677_0029010 3300047445 Bacteria 2011
825 Ga0495679_013040 3300047446 Bacteria 3136
826 Ga0495679_015572 3300047446 Bacteria 2777
827 Ga0495685_000012 3300047447 Bacteria 80496
828 Ga0495685_004997 3300047447 Bacteria 4313
829 Ga0495685_009848 3300047447 Bacteria 3198
830 Ga0495685_011775 3300047447 Bacteria 2957
831 Ga0495685_026424 3300047447 Bacteria 1997
832 Ga0495673_0000003 3300047469 Bacteria 1491337
833 Ga0495673_0000016 3300047469 Bacteria 580643
834 Ga0495673_0000188 3300047469 Bacteria 99425
835 Ga0495673_0023555 3300047469 Bacteria 2992
836 Ga0495673_0050101 3300047469 Bacteria 1835
837 Ga0495681_0000994 3300047470 Bacteria 21702
838 Ga0495681_0004664 3300047470 Bacteria 9291
839 Ga0495681_0012084 3300047470 Bacteria 5090
840 Ga0495681_0014560 3300047470 Bacteria 4497
841 Ga0495681_0023578 3300047470 Bacteria 3265
842 Ga0495681_0031523 3300047470 Bacteria 2681
843 Ga0495681_0031695 3300047470 Bacteria 2671
844 Ga0495681_0054057 3300047470 Bacteria 1878
845 Ga0495681_0057162 3300047470 Bacteria 1812
846 Ga0495686_0000032 3300047472 Bacteria 345132
847 Ga0495686_0000380 3300047472 Bacteria 71038
848 Ga0495686_0000591 3300047472 Bacteria 50934
849 Ga0495686_0001614 3300047472 Bacteria 23675
850 Ga0495686_0002052 3300047472 Bacteria 19845
851 Ga0495686_0013728 3300047472 Bacteria 5612
852 Ga0495686_0092149 3300047472 Bacteria 1838
853 Ga0495602_0077771 3300048088 Bacteria 2805
854 Ga0495602_0291844 3300048088 Bacteria 1197
855 Ga0495614_0004132 3300048089 Bacteria 6536
856 Ga0495615_0003367 3300048090 Bacteria 2671
857 Ga0495615_0015588 3300048090 Bacteria 1626
858 Ga0495626_0000004 3300048091 Bacteria 356599
859 Ga0495626_0000016 3300048091 Bacteria 232214
860 Ga0495626_0000693 3300048091 Bacteria 32187
861 Ga0495626_0004909 3300048091 Bacteria 8035
862 Ga0495626_0016810 3300048091 Bacteria 3708
863 Ga0495626_0029793 3300048091 Bacteria 2637
864 Ga0495626_0030305 3300048091 Bacteria 2609
865 Ga0495626_0035415 3300048091 Bacteria 2382
866 Ga0495626_0038734 3300048091 Bacteria 2258
867 Ga0495626_0054614 3300048091 Bacteria 1833
868 Ga0496100_0001564 3300048903 Bacteria 11251
869 Ga0496100_0035012 3300048903 Bacteria 3156
870 Ga0496100_0085040 3300048903 Bacteria 2146
871 Ga0496100_0103952 3300048903 Bacteria 1962
872 Ga0496100_0140327 3300048903 Bacteria 1712
873 Ga0496101_0004610 3300048904 Bacteria 8706
874 Ga0496102_0000340 3300048905 Bacteria 57233
875 Ga0496102_0000477 3300048905 Bacteria 44404
876 Ga0496102_0008702 3300048905 Bacteria 8712
877 Ga0496102_0033722 3300048905 Bacteria 4603
878 Ga0496102_0068030 3300048905 Bacteria 3267
879 Ga0496102_0180819 3300048905 Bacteria 1987
880 Ga0496103_0009410 3300048906 Bacteria 5789
881 Ga0496103_0088948 3300048906 Bacteria 1947
882 Ga0496103_0209725 3300048906 Bacteria 1253
883 Ga0496104_0128977 3300048907 Bacteria 2429
884 Ga0496105_0157903 3300048908 Bacteria 1862
885 Ga0496106_0085445 3300048909 Bacteria 2429
886 Ga0496107_0034773 3300048910 Bacteria 3611
887 Ga0496107_0138725 3300048910 Bacteria 1797
888 Ga0496108_0034687 3300048911 Bacteria 4191
889 Ga0496109_0005210 3300048912 Bacteria 10861
890 Ga0496109_0022441 3300048912 Bacteria 5590
891 Ga0496109_0122656 3300048912 Bacteria 2421
892 Ga0496110_0003516 3300048913 Bacteria 12023
893 Ga0496110_0004929 3300048913 Bacteria 10425
894 Ga0496110_0005432 3300048913 Bacteria 9995
895 Ga0496110_0387250 3300048913 Bacteria 1274
896 Ga0496111_0021552 3300048914 Bacteria 4502
897 Ga0496112_0016052 3300048915 Bacteria 7003
898 Ga0496113_0023519 3300048916 Bacteria 4369
899 Ga0496113_0036051 3300048916 Bacteria 3622
900 Ga0496116_0007137 3300048919 Bacteria 9993
901 Ga0496116_0032514 3300048919 Bacteria 3717
902 Ga0496116_0037251 3300048919 Bacteria 3394
903 Ga0496116_0052261 3300048919 Bacteria 2708
904 Ga0496117_0000001 3300048920 Bacteria 2526244
905 Ga0496117_0024619 3300048920 Bacteria 4754
906 Ga0496117_0078292 3300048920 Bacteria 2183
907 Ga0496117_0105751 3300048920 Bacteria 1768
908 Ga0496118_0000002 3300048921 Bacteria 1690764
909 Ga0496118_0017381 3300048921 Bacteria 6548
910 Ga0496118_0037074 3300048921 Bacteria 3930
911 Ga0496118_0094970 3300048921 Bacteria 2037
912 Ga0496118_0103492 3300048921 Bacteria 1915
913 Ga0496119_0008234 3300048922 Bacteria 9214
914 Ga0496119_0120723 3300048922 Bacteria 1441
915 Ga0496120_0006959 3300048923 Bacteria 8524
916 Ga0496121_0000306 3300048924 Bacteria 102245
917 Ga0496121_0004537 3300048924 Bacteria 18576
918 Ga0496121_0023095 3300048924 Bacteria 6004
919 Ga0496121_0032659 3300048924 Bacteria 4727
920 Ga0496121_0043305 3300048924 Bacteria 3900
921 Ga0496121_0046034 3300048924 Bacteria 3739
922 Ga0496121_0048456 3300048924 Bacteria 3614
923 Ga0496121_0150077 3300048924 Bacteria 1716
924 Ga0496122_0000455 3300048925 Bacteria 85041
925 Ga0496122_0000644 3300048925 Bacteria 70937
926 Ga0496122_0004387 3300048925 Bacteria 17565
927 Ga0496122_0009237 3300048925 Bacteria 10432
928 Ga0496122_0009551 3300048925 Bacteria 10188
929 Ga0496122_0034717 3300048925 Bacteria 4120
930 Ga0496122_0077420 3300048925 Bacteria 2335
931 Ga0496122_0157694 3300048925 Bacteria 1389
932 Ga0496122_0177464 3300048925 Bacteria 1275
933 Ga0496123_0000197 3300048926 Bacteria 122784
934 Ga0496123_0000203 3300048926 Bacteria 121361
935 Ga0496123_0003912 3300048926 Bacteria 16190
936 Ga0496123_0013893 3300048926 Bacteria 6710
937 Ga0496123_0017730 3300048926 Bacteria 5710
938 Ga0496123_0026217 3300048926 Bacteria 4373
939 Ga0496123_0042315 3300048926 Bacteria 3145
940 Ga0496123_0164006 3300048926 Bacteria 1181
941 Ga0496124_0000046 3300048927 Bacteria 287043
942 Ga0496124_0009308 3300048927 Bacteria 10124
943 Ga0496124_0035599 3300048927 Bacteria 4354
944 Ga0496124_0051693 3300048927 Bacteria 3494
945 Ga0496124_0056406 3300048927 Bacteria 3313
946 Ga0496124_0124435 3300048927 Bacteria 2056
947 Ga0496124_0151412 3300048927 Bacteria 1819
948 Ga0496125_0000011 3300048928 Bacteria 655895
949 Ga0496125_0000983 3300048928 Bacteria 44536
950 Ga0496125_0001069 3300048928 Bacteria 42296
951 Ga0496125_0018029 3300048928 Bacteria 6710
952 Ga0496125_0022845 3300048928 Bacteria 5795
953 Ga0496125_0027105 3300048928 Bacteria 5201
954 Ga0496125_0035345 3300048928 Bacteria 4385
955 Ga0496125_0077000 3300048928 Bacteria 2573
956 Ga0496126_0000034 3300048929 Bacteria 362440
957 Ga0496126_0006564 3300048929 Bacteria 12959
958 Ga0496126_0038550 3300048929 Bacteria 4445
959 Ga0496126_0055812 3300048929 Bacteria 3572
960 Ga0496126_0263737 3300048929 Bacteria 1432
961 Ga0501308_000102 3300049128 Bacteria 3985
962 Ga0501310_000345 3300049130 Bacteria 4223
963 Ga0501310_003722 3300049130 Bacteria 1501
964 Ga0495678_000004 3300049459 Bacteria 532920
965 Ga0495678_000275 3300049459 Bacteria 56673
966 Ga0495678_000746 3300049459 Bacteria 29508
967 Ga0495678_001983 3300049459 Bacteria 14748
968 Ga0495678_002319 3300049459 Bacteria 13113
969 Ga0495678_003043 3300049459 Bacteria 10657
970 Ga0495678_004447 3300049459 Bacteria 8101
971 Ga0495678_004779 3300049459 Bacteria 7715
972 Ga0495678_014319 3300049459 Bacteria 3691
973 Ga0495678_024380 3300049459 Bacteria 2612
974 Ga0495682_0002099 3300049460 Bacteria 9711
975 Ga0495682_0010088 3300049460 Bacteria 3667
976 Ga0495682_0019757 3300049460 Bacteria 2531
977 Ga0495682_0027473 3300049460 Bacteria 2110
978 Ga0501031_0003738 3300049568 Bacteria 9794
979 Ga0501032_0018637 3300049569 Bacteria 4859
980 Ga0501033_0003665 3300049570 Bacteria 12525
981 Ga0501033_0034503 3300049570 Bacteria 3794
982 Ga0501033_0061751 3300049570 Bacteria 2761
983 Ga0501033_0112304 3300049570 Bacteria 1982
984 Ga0501034_0032914 3300049571 Bacteria 5264
985 Ga0501034_0140107 3300049571 Bacteria 2398
986 Ga0501037_0016812 3300049573 Bacteria 5382
987 Ga0501037_0042579 3300049573 Bacteria 3336
988 Ga0501037_0141383 3300049573 Bacteria 1722
989 Ga0501038_0012706 3300049574 Bacteria 7694
990 Ga0501038_0252694 3300049574 Bacteria 1396
991 Ga0501039_0051432 3300049575 Bacteria 3188
992 Ga0501039_0243526 3300049575 Bacteria 1414
993 Ga0501043_0011390 3300049579 Bacteria 6961
994 Ga0501043_0023603 3300049579 Bacteria 4824
995 Ga0501046_0006547 3300049580 Bacteria 10300
996 Ga0501046_0094005 3300049580 Bacteria 2304
997 Ga0501047_0005230 3300049581 Bacteria 12182
998 Ga0501047_0017738 3300049581 Bacteria 6819
999 Ga0501227_003069 3300049665 Bacteria 3637
1000 Ga0501249_004078 3300049679 Bacteria 2955
1001 Ga0501269_000561 3300049766 Bacteria 7021
1002 Ga0501035_0002186 3300049822 Bacteria 19407
1003 Ga0501035_0003294 3300049822 Bacteria 15480
1004 Ga0501035_0004380 3300049822 Bacteria 13405
1005 Ga0501035_0015998 3300049822 Bacteria 6922
1006 Ga0501044_0001185 3300049823 Bacteria 30889
1007 Ga0501044_0002640 3300049823 Bacteria 20395
1008 Ga0501044_0028040 3300049823 Bacteria 5942
1009 Ga0501044_0087887 3300049823 Bacteria 3138
1010 nmdc:mga00v17_3752_c2 3300050491 Bacteria 5018
1011 nmdc:mga07m45_140377_c1 3300050496 Bacteria 1399
1012 Ga0495601_0003048 3300053077 Bacteria 9551
1013 Ga0500594_0011549 3300053118 Bacteria 2063
1014 Ga0500595_004677 3300053119 Bacteria 6085
1015 Ga0500618_000089 3300053125 Bacteria 74800
1016 Ga0500618_000670 3300053125 Bacteria 20129
1017 Ga0500618_000710 3300053125 Bacteria 19287
1018 Ga0500586_001257 3300053145 Bacteria 5315
1019 Ga0500600_0007675 3300053149 Bacteria 6495
1020 Ga0500619_000505 3300053154 Bacteria 6771
1021 Ga0500637_0104059 3300053178 Bacteria 1646
1022 Ga0587077_002659 3300059493 Bacteria 2150
1023 Ga0587080_003961 3300059503 Bacteria 1888
1024 Ga0587088_003034 3300059508 Bacteria 1986
1025 Ga0587090_008830 3300059510 Bacteria 1362
1026 Ga0587101_007126 3300059623 Bacteria 1310
1027 Ga0587067_000055 3300059640 Bacteria 6355
1028 Ga0587068_004141 3300059641 Bacteria 1902
1029 Ga0587068_004557 3300059641 Bacteria 1840
1030 Ga0587072_000318 3300059643 Bacteria 4543
1031 Ga0587076_010792 3300059645 Bacteria 1328
1032 Ga0587079_002440 3300059647 Bacteria 2273
1033 Ga0587079_009610 3300059647 Bacteria 1510
1034 2501073321 2501025501 Bacteria 7768574
1035 2501408423 2501025504 Bacteria 8008976
1036 2511096158 2510917014 Bacteria 8296963
1037 2511103119 2510917015 Bacteria 7950052
1038 2511250641 2511231003 Bacteria 5606035
1039 2511384949 2511231026 Bacteria 5225445
1040 2516022417 2515154189 Bacteria 9629850
1041 2519458258 2519103095 Bacteria 6629912
1042 2521557887 2521172590 Bacteria 5047645
1043 2550693926 2548876994 Bacteria 4904866
1044 2553003010 2551306416 Bacteria 6152985
1045 2585294690 2582581311 Bacteria 6763856
1046 2597028853 2596583598 Bacteria 5251611
1047 2599445541 2599185178 Bacteria 5365746
1048 2599738118 2599185239 Bacteria 8686614
1049 2599742510 2599185240 Bacteria 7968121
1050 2599903229 2599185292 Bacteria 6290804
1051 2600204628 2599185355 Bacteria 7968906
1052 2601667671 2600255292 Bacteria 6300551
1053 2643786925 2643221554 Bacteria 6603920
1054 2643802365 2643221556 Bacteria 7251154
1055 2643862279 2643221569 Bacteria 6064337
1056 2643980695 2643221594 Bacteria 5811388
1057 2644030669 2643221603 Bacteria 6147767
1058 2644122119 2643221621 Bacteria 6212786
1059 2644215986 2643221638 Bacteria 6579467
1060 2644254476 2643221645 Bacteria 7207331
1061 2644357859 2643221664 Bacteria 7272945
1062 2644475878 2643221684 Bacteria 7145183
1063 2676741614 2675903129 Bacteria 7964495
1064 2738741283 2738541280 Bacteria 6630198
1065 2738829176 2738541297 Bacteria 6549566
1066 2738845752 2738541300 Bacteria 6675882
1067 2739152972 2738541357 Bacteria 6549408
1068 2739194892 2738543003 Bacteria 6549560
1069 2739277560 2738543018 Bacteria 6718814
1070 2739321368 2738543026 Bacteria 6549408
1071 2739340076 2738543029 Bacteria 6549249
1072 2739346517 2738543030 Bacteria 6719714
1073 2739612191 2739367655 Bacteria 4051151
1074 2765569008 2765235838 Bacteria 5445269
1075 2808984484 2808606386 Bacteria 4471946
1076 2809031988 2808606395 Bacteria 6020352
1077 2809131211 2808606415 Bacteria 4576710
1078 2809145417 2808606418 Bacteria 6724496
1079 2809150454 2808606419 Bacteria 4576925
1080 2817260408 2816332253 Bacteria 6764532
1081 2817278096 2816332256 Bacteria 6891714
1082 2817455663 2816332286 Bacteria 6853759
1083 2819542544 2818991436 Bacteria 5376622
1084 2819591176 2818991445 Bacteria 4955017
1085 2819614972 2818991449 Bacteria 5518009
1086 2819632934 2818991452 Bacteria 8442785
1087 2821131624 2821131069 Bacteria 6108407
1088 2839096107 2839094727 Bacteria 5534556
1089 2842717742 2842711865 Bacteria 7155354
1090 2852621970 2852618963 Bacteria 4577824
1091 2855734598 2855730933 Bacteria 7047938
1092 2855770188 2855767633 Bacteria 7049357
1093 2856292749 2856287931 Bacteria 7223934
1094 2857360983 2857357740 Bacteria 9937880
1095 2857538471 2857537821 Bacteria 5248181
1096 2857546625 2857542790 Bacteria 5326616
1097 2857550302 2857547612 Bacteria 6179999
1098 2857554478 2857553236 Bacteria 6166726
1099 2857559443 2857558681 Bacteria 6617694
1100 2857564715 2857564685 Bacteria 6290584
1101 2858955739 2858950400 Bacteria 6783797
1102 2863421945 2863421361 Bacteria 7300805
1103 2870072113 2870068957 Bacteria 8925310
1104 2881414409 2881412998 Bacteria 6492157
1105 2881930290 2881927736 Bacteria 3993927
1106 2884812294 2884811622 Bacteria 5552861
1107 2884836901 2884836552 Bacteria 5219991
1108 2884853192 2884852848 Bacteria 5221161
1109 2885085394 2885080285 Bacteria 6355622
1110 2885266799 2885266251 Bacteria 4796748
1111 2887377889 2887375801 Bacteria 5334027
1112 2895516613 2895511927 Bacteria 6802080
1113 2896155690 2896154374 Bacteria 5221518
1114 2900578666 2900577576 Bacteria 5438534
1115 2904425973 2904424332 Bacteria 7633521
1116 2904441346 2904439833 Bacteria 5931679
1117 2904531714 2904530477 Bacteria 5876334
1118 2904566110 2904564687 Bacteria 7609577
1119 2904573154 2904571731 Bacteria 7608790
1120 2904588061 2904584206 Bacteria 6028872
1121 2904589779 2904589729 Bacteria 6113573
1122 2904602835 2904601388 Bacteria 5884906
1123 2919046350 2919046199 Bacteria 5567169
1124 2919079661 2919079590 Bacteria 5946433
1125 2919478418 2919476304 Bacteria 5888696
1126 2923511120 2923510766 Bacteria 5926163
1127 2928041924 2928037797 Bacteria 7273642
1128 2928049488 2928044640 Bacteria 7271509
1129 2928062875 2928058823 Bacteria 5520022
1130 2928131056 2928130867 Bacteria 5467269
1131 2928159474 2928157003 Bacteria 7522202
1132 2928164466 2928163908 Bacteria 7561269
1133 2928177550 2928170801 Bacteria 8785406
1134 2928538324 2928536128 Bacteria 7657547
1135 2932411276 2932410948 Bacteria 6312192
1136 2932419157 2932416698 Bacteria 6315112
1137 2941481929
1138 2981993908 2981990288 Bacteria 7590678
1139 642417212 641736154 Bacteria 7689995
1140 8002395009 8002392321 Bacteria 4159911
1141 8018850379 8018845410 Bacteria 8933938
1142 8020808839 8020807995 Bacteria 6801506
1143 8020939405 8020938398 Bacteria 7472757
1144 8020947192 8020945358 Bacteria 8467355
1145 8020954371 8020953355 Bacteria 7439080
1146 8021122841 8021120328 Bacteria 8782274
1147 8039102778 8039098773 Bacteria 6602928
1148 8040169288 8040167225 Bacteria 6542727
1149 8040175007 8040173305 Bacteria 6827067
1150 8047673772 8047673197 Bacteria 7395230
1151 8048749766 8048746797 Bacteria 3557226
1152 8055227947 8055225921 Bacteria 3341787
1153 nmdc:mga03683_79443_c1
1154 JGI24741J21665_1000010
1155 JGI24740J21852_10000462
1156 JGI24740J21852_10000722
1157 JGI24739J22299_10010730
1158 JGI24737J22298_10013210
1159 JGI24735J21928_10000381
1160 JGI25155J39150_1000877
1161 JGI25155J39150_1000881
1162 JGI25156J39149_1004399
1163 JGI25156J39149_1004435
1164 JGI25156J39149_1007106
1165 JGI25162J39368_1000036
1166 JGI25162J39368_1007683
1167 JGI25154J39366_1000446
1168 JGI25154J39366_1001320
1169 JGI25154J39366_1002733
1170 JGI25154J39366_1002751
1171 JGI25157J39369_1001025
1172 JGI25157J39369_1001457
1173 JGI25152J39213_1003851
1174 JGI25150J39212_1006615
1175 JGI25159J45721_1005005
1176 JGI25151J46595_10000203
1177 JGI25165J46597_1000022
1178 JGI25153J46596_10008450
1179 JGI25161J50226_1003372
1180 Ga0007410J51695_1012750
1181 Ga0007409J51694_1006362
1182 Ga0007409J51694_1011802
1183 Ga0007416J51690_1012585
1184 Ga0055538_1000002
1185 Ga0055538_1000011
1186 Ga0055539_1000002
1187 Ga0055539_1000016
1188 Ga0055539_1000034
1189 Ga0055533_1000004
1190 Ga0055533_1000019
1191 Ga0055532_1000002
1192 Ga0055532_1000016
1193 Ga0055525_1000001
1194 Ga0055525_1000002
1195 Ga0055525_1000042
1196 Ga0055525_1000538
1197 Ga0055527_1002743
1198 Ga0055527_1002777
1199 Ga0055535_1000318
1200 Ga0055542_1004140
1201 Ga0055542_1004240
1202 Ga0055529_1000028
1203 Ga0055529_1000403
1204 Ga0055529_1004078
1205 Ga0055526_1000018
1206 Ga0055526_1000029
1207 Ga0055526_1003756
1208 Ga0055526_1003777
1209 Ga0055526_1005592
1210 Ga0055526_1016080
1211 Ga0055537_1000202
1212 Ga0055537_1007170
1213 Ga0055524_1000234
1214 Ga0055524_1008881
1215 Ga0055524_1022702
1216 Ga0055534_1000311
1217 Ga0055534_1002771
1218 Ga0055528_1000062
1219 Ga0055528_1002474
1220 Ga0055528_1007004
1221 Ga0055530_10008671
1222 Ga0055530_10011528
1223 Ga0055541_1000002
1224 Ga0055541_1000017
1225 Ga0055541_1000217
1226 Ga0058692_1016389
1227 Ga0055543_1004578
1228 Ga0065165_1000055
1229 Ga0065165_1008669
1230 Ga0065165_1011383
1231 Ga0065165_1024690
1232 Ga0065714_10112336
1233 Ga0065715_10110556
1234 Ga0070658_10086993
1235 Ga0070670_100014071
1236 Ga0070682_100119523
1237 Ga0070660_100000010
1238 Ga0070660_100003942
1239 Ga0070660_100041122
1240 Ga0070660_100078821
1241 Ga0070660_100146878
1242 Ga0070661_100000013
1243 Ga0070661_100003622
1244 Ga0070659_100000167
1245 Ga0070659_100000834
1246 Ga0070659_100004951
1247 Ga0070659_100053692
1248 Ga0070659_100070043
1249 Ga0070667_100049400
1250 Ga0070714_100008646
1251 Ga0070663_100000006
1252 Ga0070663_100000789
1253 Ga0070663_100063775
1254 Ga0070662_100149373
1255 Ga0068855_100000065
1256 Ga0068855_100269568
1257 Ga0068855_100317253
1258 Ga0070664_100000002
1259 Ga0070664_100003335
1260 Ga0070664_100065531
1261 Ga0068857_100051097
1262 Ga0068857_100140667
1263 Ga0068854_100000004
1264 Ga0068856_100000294
1265 Ga0068856_100169372
1266 Ga0068852_100017069
1267 Ga0068852_100129856
1268 Ga0075363_100002122
1269 Ga0075364_10001271
1270 Ga0075364_10004880
1271 Ga0075366_10150087
1272 Ga0099826_10000002
1273 Ga0105251_10001123
1274 Ga0105244_10002843
1275 Ga0105244_10004589
1276 Ga0105244_10049320
1277 Ga0105244_10092329
1278 Ga0105240_10000297
1279 Ga0105240_10014780
1280 Ga0105240_10038598
1281 Ga0105240_10194424
1282 Ga0105240_10201688
1283 Ga0105245_10189972
1284 Ga0105243_10316365
1285 Ga0105241_10064594
1286 Ga0105242_10045340
1287 Ga0105248_10045070
1288 Ga0105237_10067786
1289 Ga0105237_10081975
1290 Ga0105237_10105569
1291 Ga0105237_10179067
1292 Ga0105238_10001896
1293 Ga0105238_10094199
1294 Ga0105239_10005044
1295 Ga0105239_10246327
1296 Ga0157373_10020184
1297 Ga0157371_10000123
1298 Ga0157370_10000013
1299 Ga0157374_10211981
1300 Ga0163162_10002139
1301 Ga0163162_10033754
1302 Ga0157372_10001159
1303 Ga0182008_10007666
1304 Ga0182008_10027927
1305 Ga0182006_1000002
1306 Ga0182006_1000017
1307 Ga0182006_1010763
1308 Ga0182006_1015580
1309 Ga0182007_10000069
1310 Ga0182005_1000002
1311 Ga0182005_1000007
1312 Ga0182005_1000307
1313 Ga0206355_1326248
1314 Ga0206351_10167421
1315 Ga0206350_10139122
1316 Ga0154015_1099906
1317 Ga0213872_10000263
1318 Ga0213872_10000773
1319 Ga0213872_10012586
1320 Ga0213872_10013693
1321 Ga0209435_100070
1322 Ga0209435_100716
1323 Ga0209760_101302
1324 Ga0209784_100002
1325 Ga0209784_100003
1326 Ga0209784_100019
1327 Ga0209784_100293
1328 Ga0209784_100803
1329 Ga0209566_100002
1330 Ga0209566_100003
1331 Ga0209566_100017
1332 Ga0209566_100370
1333 Ga0209566_100896
1334 Ga0209674_100004
1335 Ga0209674_100008
1336 Ga0209674_100031
1337 Ga0209674_100122
1338 Ga0209674_101948
1339 Ga0209672_100019
1340 Ga0209672_100051
1341 Ga0209672_100213
1342 Ga0209672_109800
1343 Ga0209147_100002
1344 Ga0209147_100023
1345 Ga0209147_100026
1346 Ga0209147_101674
1347 Ga0209563_100004
1348 Ga0209563_100006
1349 Ga0209563_100007
1350 Ga0209563_100035
1351 Ga0209563_104817
1352 Ga0207427_100255
1353 Ga0209437_100038
1354 Ga0209437_100080
1355 Ga0209437_103076
1356 Ga0209258_100002
1357 Ga0209258_100031
1358 Ga0209258_100179
1359 Ga0209258_100253
1360 Ga0207425_1000001
1361 Ga0207425_1001467
1362 Ga0207425_1001639
1363 Ga0209646_1000022
1364 Ga0209646_1000033
1365 Ga0209646_1000174
1366 Ga0209646_1000872
1367 Ga0209026_1000150
1368 Ga0209026_1002115
1369 Ga0209026_1003950
1370 Ga0209026_1007183
1371 Ga0209677_100003
1372 Ga0209677_100009
1373 Ga0209677_100020
1374 Ga0209677_103820
1375 Ga0209148_1000021
1376 Ga0209148_1000027
1377 Ga0209148_1000992
1378 Ga0209148_1004472
1379 Ga0209759_1000359
1380 Ga0209759_1000408
1381 Ga0209759_1001771
1382 Ga0209759_1002181
1383 Ga0209759_1007195
1384 Ga0209129_1000001
1385 Ga0209129_1005030
1386 Ga0209233_1000049
1387 Ga0209565_1000167
1388 Ga0209565_1000902
1389 Ga0209565_1001159
1390 Ga0209565_1007277
1391 Ga0209455_1000021
1392 Ga0209455_1000037
1393 Ga0209455_1000213
1394 Ga0209455_1002641
1395 Ga0209455_1004072
1396 Ga0209673_1000051
1397 Ga0209673_1000201
1398 Ga0209673_1012575
1399 Ga0209130_1000091
1400 Ga0209130_1000507
1401 Ga0209130_1003078
1402 Ga0209130_1006616
1403 Ga0209675_1000027
1404 Ga0209675_1000769
1405 Ga0209675_1005996
1406 Ga0209675_1009461
1407 Ga0209676_1004133
1408 Ga0209025_1000003
1409 Ga0209025_1016263
1410 Ga0209564_1000009
1411 Ga0209564_1000068
1412 Ga0209564_1000897
1413 Ga0209564_1001707
1414 Ga0209564_1002800
1415 Ga0209564_1003112
1416 Ga0209564_1047387
1417 Ga0209758_1000073
1418 Ga0209758_1002044
1419 Ga0209050_1000046
1420 Ga0209050_1003824
1421 Ga0209050_1012901
1422 Ga0209256_1000044
1423 Ga0209256_1000265
1424 Ga0209256_1002001
1425 Ga0209256_1010975
1426 Ga0207426_1001239
1427 Ga0207426_1003279
1428 Ga0209257_1000068
1429 Ga0207655_1008662
1430 Ga0207655_1011578
1431 Ga0207655_1050604
1432 Ga0207713_1003181
1433 Ga0207680_10231953
1434 Ga0207647_10000835
1435 Ga0207647_10018639
1436 Ga0207705_10023618
1437 Ga0207705_10112848
1438 Ga0207695_10000475
1439 Ga0207695_10006070
1440 Ga0207695_10011620
1441 Ga0207695_10032578
1442 Ga0207695_10036204
1443 Ga0207671_10020134
1444 Ga0207671_10052029
1445 Ga0207660_10094123
1446 Ga0207657_10000001
1447 Ga0207657_10012572
1448 Ga0207657_10037258
1449 Ga0207657_10137885
1450 Ga0207657_10330431
1451 Ga0207649_10000019
1452 Ga0207649_10035200
1453 Ga0207694_10004571
1454 Ga0207694_10010183
1455 Ga0207694_10022298
1456 Ga0207650_10011517
1457 Ga0207659_10256285
1458 Ga0207664_10123199
1459 Ga0207690_10000006
1460 Ga0207690_10004157
1461 Ga0207690_10021999
1462 Ga0207690_10127237
1463 Ga0207690_10133276
1464 Ga0207686_10049440
1465 Ga0207711_10024668
1466 Ga0207679_10000001
1467 Ga0207679_10004443
1468 Ga0207667_10000025
1469 Ga0207667_10023086
1470 Ga0207667_10046894
1471 Ga0207667_10134582
1472 Ga0207667_10138896
1473 Ga0207640_10000240
1474 Ga0207678_10000001
1475 Ga0207678_10000167
1476 Ga0207678_10038870
1477 Ga0207678_10253587
1478 Ga0207702_10000009
1479 Ga0207702_10136452
1480 Ga0207674_10064218
1481 Ga0207674_10281349
1482 Ga0207698_10020074
1483 Ga0207698_10111359
1484 Ga0209281_1006345
1485 Ga0209371_1000297
1486 Ga0209282_1000001
1487 Ga0268264_10162696
1488 Ga0268256_1000261
1489 Ga0307511_10000040
1490 Ga0316177_1009921
1491 Ga0316180_1185675
1492 Ga0316181_1278006
1493 Ga0265327_10027938
1494 Ga0265327_10090341
1495 Ga0307408_100001210
1496 Ga0307408_100021297
1497 Ga0307408_100029234
1498 Ga0307408_100043636
1499 Ga0307518_10028306
1500 Ga0307412_10000845
1501 Ga0307416_100020341
1502 Ga0307414_10012598
1503 Ga0316583_10009599
1504 Ga0307507_10043456
1505 Ga0395899_0000904
1506 Ga0395899_0002101
1507 Ga0395899_0036149
1508 Ga0395899_0049427
1509 Ga0395899_0058593
1510 Ga0395899_0076323
1511 Ga0395899_0181802
1512 Ga0395900_0000874
1513 Ga0395900_0007034
1514 Ga0395900_0009723
1515 Ga0395900_0018346
1516 Ga0395900_0023633
1517 Ga0395900_0036284
1518 Ga0395900_0050571
1519 Ga0395900_0062747
1520 Ga0395900_0102978
1521 Ga0395900_0163739
1522 Ga0395900_0517839
1523 Ga0395898_0039391
1524 Ga0395898_0154334
1525 Ga0395898_0157087
1526 Ga0395898_0423988
1527 Ga0395905_0008840
1528 Ga0395905_0009571
1529 Ga0395905_0048604
1530 Ga0395905_0070895
1531 Ga0395905_0075118
1532 Ga0395905_0088384
1533 Ga0395905_0263229
1534 Ga0395905_0285714
1535 Ga0395905_0341128
1536 Ga0395901_0000054
1537 Ga0395901_0003565
1538 Ga0395901_0010496
1539 Ga0395901_0127852
1540 Ga0395901_0273659
1541 Ga0395901_0425782
1542 Ga0395901_0438385
1543 Ga0395901_0452847
1544 Ga0395901_0480409
1545 Ga0436361_0080172
1546 Ga0436361_0116364
1547 Ga0436361_0134513
1548 Ga0436361_0261530
1549 Ga0436361_0324341
1550 Ga0436361_0525957
1551 Ga0436361_0944997
1552 Ga0436361_0987205
1553 Ga0439448_0003707
1554 Ga0439448_0020781
1555 Ga0439458_0001531
1556 Ga0451577_0004811
1557 Ga0451577_0006944
1558 Ga0451577_0026714
1559 Ga0451577_0101044
1560 Ga0451577_0175942
1561 Ga0466972_0000005
1562 Ga0466972_0002881
1563 Ga0466972_0004661
1564 Ga0466972_0076949
1565 Ga0466977_0003512
1566 Ga0466978_0027607
1567 Ga0466982_0020479
1568 Ga0466965_0005740
1569 Ga0466965_0014133
1570 Ga0466965_0016454
1571 Ga0466965_0016917
1572 Ga0466965_0084426
1573 Ga0466966_0005305
1574 Ga0466966_0033545
1575 Ga0466966_0062889
1576 Ga0466966_0080211
1577 Ga0466966_0090457
1578 Ga0466961_0001007
1579 Ga0466963_0134754
1580 Ga0466964_0001227
1581 Ga0466964_0001931
1582 Ga0466964_0007716
1583 Ga0466964_0036081
1584 Ga0453684_0000847
1585 Ga0453684_0031930
1586 Ga0466971_0010136
1587 Ga0466968_0001801
1588 Ga0466968_0003428
1589 Ga0466968_0131265
1590 Ga0466970_0014132
1591 Ga0466957_0013888
1592 Ga0466957_0044973
1593 Ga0466957_0177057
1594 Ga0466959_0007553
1595 Ga0466959_0165242
1596 Ga0451576_0001131
1597 Ga0451576_0017241
1598 Ga0451576_0055941
1599 Ga0451576_0197558
1600 Ga0451576_0269744
1601 Ga0451576_0602437
1602 Ga0466967_0010385
1603 Ga0466967_0071893
1604 Ga0466967_0288288
1605 Ga0466967_0529560
1606 Ga0495617_000041
1607 Ga0495617_000057
1608 Ga0495617_000843
1609 Ga0495627_000007
1610 Ga0495627_001817
1611 Ga0495627_006174
1612 Ga0495627_020867
1613 Ga0495592_0047346
1614 Ga0495603_0078255
1615 Ga0495590_0000001
1616 Ga0495590_0000018
1617 Ga0495590_0002149
1618 Ga0495590_0008695
1619 Ga0495590_0010437
1620 Ga0495591_012498
1621 Ga0495629_0000293
1622 Ga0495638_0000086
1623 Ga0495638_0223603
1624 Ga0495651_0028201
1625 Ga0495653_0000002
1626 Ga0495653_0001619
1627 Ga0495653_0028643
1628 Ga0495650_0000108
1629 Ga0495650_0000118
1630 Ga0495650_0000140
1631 Ga0495650_0000156
1632 Ga0495650_0000837
1633 Ga0495650_0007249
1634 Ga0495650_0017152
1635 Ga0495580_0156385
1636 Ga0495582_0006054
1637 Ga0495582_0015498
1638 Ga0495605_0000168
1639 Ga0495605_0000416
1640 Ga0495605_0000438
1641 Ga0495605_0003370
1642 Ga0495605_0019964
1643 Ga0495605_0027851
1644 Ga0495605_0035069
1645 Ga0495605_0071002
1646 Ga0495605_0090233
1647 Ga0495605_0142817
1648 Ga0495639_0033664
1649 Ga0495584_0000281
1650 Ga0495584_0002307
1651 Ga0495584_0012122
1652 Ga0495584_0013652
1653 Ga0495584_0023179
1654 Ga0495584_0033622
1655 Ga0495584_0043266
1656 Ga0495585_0002371
1657 Ga0495585_0005187
1658 Ga0495585_0007454
1659 Ga0495585_0008412
1660 Ga0495585_0014980
1661 Ga0495585_0020761
1662 Ga0495585_0038339
1663 Ga0495585_0100247
1664 Ga0495585_0104505
1665 Ga0495594_0024057
1666 Ga0495596_0001435
1667 Ga0495596_0011978
1668 Ga0495596_0012711
1669 Ga0495596_0018777
1670 Ga0495596_0020910
1671 Ga0495596_0020949
1672 Ga0495596_0023665
1673 Ga0495596_0025542
1674 Ga0495596_0026299
1675 Ga0495596_0067256
1676 Ga0495607_0002962
1677 Ga0495607_0003330
1678 Ga0495607_0004150
1679 Ga0495607_0006983
1680 Ga0495607_0019846
1681 Ga0495607_0020575
1682 Ga0495607_0025658
1683 Ga0495607_0028934
1684 Ga0495607_0031999
1685 Ga0495607_0032131
1686 Ga0495607_0038276
1687 Ga0495607_0046570
1688 Ga0495607_0049132
1689 Ga0495607_0076351
1690 Ga0495607_0092268
1691 Ga0495583_0000177
1692 Ga0495583_0000221
1693 Ga0495583_0001635
1694 Ga0495583_0003816
1695 Ga0495583_0004868
1696 Ga0495583_0014101
1697 Ga0495583_0020486
1698 Ga0495583_0032488
1699 Ga0495606_0000001
1700 Ga0495606_0000011
1701 Ga0495606_0000679
1702 Ga0495606_0000864
1703 Ga0495606_0006986
1704 Ga0495606_0007758
1705 Ga0495606_0022736
1706 Ga0495606_0027811
1707 Ga0495606_0027851
1708 Ga0495606_0045995
1709 Ga0495606_0063561
1710 Ga0495606_0112714
1711 Ga0495608_0006170
1712 Ga0495608_0041553
1713 Ga0495610_0000003
1714 Ga0495610_0002329
1715 Ga0495610_0003829
1716 Ga0495610_0075135
1717 Ga0495610_0078369
1718 Ga0495616_0000662
1719 Ga0495616_0002684
1720 Ga0495616_0013824
1721 Ga0495616_0018343
1722 Ga0495616_0026851
1723 Ga0495616_0033272
1724 Ga0495616_0039587
1725 Ga0495616_0052848
1726 Ga0495616_0058167
1727 Ga0495618_0071916
1728 Ga0495628_0004565
1729 Ga0495628_0007604
1730 Ga0495628_0011133
1731 Ga0495630_0084205
1732 Ga0495631_0000632
1733 Ga0495631_0001483
1734 Ga0495631_0016053
1735 Ga0495631_0018103
1736 Ga0495631_0018121
1737 Ga0495631_0032908
1738 Ga0495631_0070560
1739 Ga0495632_0000214
1740 Ga0495632_0003852
1741 Ga0495632_0011405
1742 Ga0495632_0014316
1743 Ga0495632_0015456
1744 Ga0495632_0027244
1745 Ga0495637_0000612
1746 Ga0495637_0001689
1747 Ga0495637_0021637
1748 Ga0495643_0000123
1749 Ga0495643_0004483
1750 Ga0495643_0009598
1751 Ga0495643_0015947
1752 Ga0495643_0019252
1753 Ga0495643_0021003
1754 Ga0495643_0043697
1755 Ga0495643_0046264
1756 Ga0495644_0001496
1757 Ga0495644_0006676
1758 Ga0495644_0007533
1759 Ga0495644_0009890
1760 Ga0495644_0039613
1761 Ga0495648_0000001
1762 Ga0495648_0002540
1763 Ga0495648_0002834
1764 Ga0495648_0004137
1765 Ga0495648_0010857
1766 Ga0495648_0018998
1767 Ga0495648_0019039
1768 Ga0495648_0033894
1769 Ga0495648_0044272
1770 Ga0495648_0058698
1771 Ga0495648_0103908
1772 Ga0495648_0124694
1773 Ga0495663_0004849
1774 Ga0495642_0000741
1775 Ga0495642_0001464
1776 Ga0495642_0007631
1777 Ga0495642_0013970
1778 Ga0495642_0015415
1779 Ga0495642_0023321
1780 Ga0495652_0012068
1781 Ga0495652_0040085
1782 Ga0495652_0113750
1783 Ga0495654_0000038
1784 Ga0495654_0070510
1785 Ga0495654_0097181
1786 Ga0495654_0131186
1787 Ga0495665_0019053
1788 Ga0495665_0026571
1789 Ga0495640_0208183
1790 Ga0495586_0032100
1791 Ga0495586_0123732
1792 Ga0495587_0235306
1793 Ga0495609_0000009
1794 Ga0495609_0000479
1795 Ga0495609_0002949
1796 Ga0495609_0003102
1797 Ga0495609_0006657
1798 Ga0495609_0018010
1799 Ga0495609_0020796
1800 Ga0495609_0029171
1801 Ga0495609_0116195
1802 Ga0495597_0000110
1803 Ga0495597_0002311
1804 Ga0495597_0003097
1805 Ga0495597_0004138
1806 Ga0495597_0007611
1807 Ga0495597_0010421
1808 Ga0495597_0014117
1809 Ga0495597_0018479
1810 Ga0495597_0026802
1811 Ga0495645_0014686
1812 Ga0495645_0027376
1813 Ga0495622_0000028
1814 Ga0495622_0003561
1815 Ga0495622_0038097
1816 Ga0495633_0000272
1817 Ga0495633_0002858
1818 Ga0495633_0003780
1819 Ga0495633_0004683
1820 Ga0495633_0006086
1821 Ga0495633_0011002
1822 Ga0495633_0015072
1823 Ga0495633_0026986
1824 Ga0495633_0034003
1825 Ga0495633_0115253
1826 Ga0495656_0003881
1827 Ga0495656_0053355
1828 Ga0495668_0000093
1829 Ga0495668_0000095
1830 Ga0495668_0000151
1831 Ga0495668_0001575
1832 Ga0495668_0003639
1833 Ga0495668_0015431
1834 Ga0495668_0016287
1835 Ga0495668_0025820
1836 Ga0495668_0030438
1837 Ga0495668_0030940
1838 Ga0495668_0091938
1839 Ga0495668_0129139
1840 Ga0495634_0048273
1841 Ga0495634_0199937
1842 Ga0495611_0000499
1843 Ga0495611_0002457
1844 Ga0495611_0011597
1845 Ga0495611_0023585
1846 Ga0495611_0026413
1847 Ga0495611_0085172
1848 Ga0495625_0001679
1849 Ga0495625_0004300
1850 Ga0495625_0007018
1851 Ga0495625_0010387
1852 Ga0495625_0017150
1853 Ga0495625_0026781
1854 Ga0495625_0050235
1855 Ga0495625_0057067
1856 Ga0495625_0066343
1857 Ga0495625_0068572
1858 Ga0495635_0002454
1859 Ga0495635_0057076
1860 Ga0495659_0000284
1861 Ga0495659_0004469
1862 Ga0495659_0007199
1863 Ga0495659_0034594
1864 Ga0495661_0001929
1865 Ga0495661_0007429
1866 Ga0495661_0008112
1867 Ga0495661_0012238
1868 Ga0495661_0013191
1869 Ga0495661_0014739
1870 Ga0495661_0017969
1871 Ga0495661_0027110
1872 Ga0495661_0035807
1873 Ga0495661_0042600
1874 Ga0495661_0049481
1875 Ga0495661_0058954
1876 Ga0495661_0076618
1877 Ga0495661_0079739
1878 Ga0495661_0094786
1879 Ga0495588_0000077
1880 Ga0495588_0010399
1881 Ga0495588_0011557
1882 Ga0495588_0031167
1883 Ga0495588_0032950
1884 Ga0495588_0050863
1885 Ga0495657_0073728
1886 Ga0495599_0004944
1887 Ga0495623_0011364
1888 Ga0495623_0012790
1889 Ga0495623_0043008
1890 Ga0495646_0012052
1891 Ga0495669_0000116
1892 Ga0495669_0006988
1893 Ga0495669_0007431
1894 Ga0495669_0008000
1895 Ga0495669_0011905
1896 Ga0495669_0023781
1897 Ga0495669_0056974
1898 Ga0495624_0034960
1899 Ga0495670_0003774
1900 Ga0495670_0005019
1901 Ga0495670_0050660
1902 Ga0495670_0053626
1903 Ga0495670_0056910
1904 Ga0495671_0000001
1905 Ga0495671_0000108
1906 Ga0495671_0002689
1907 Ga0495671_0034330
1908 Ga0495671_0140335
1909 Ga0495649_0003311
1910 Ga0495649_0011717
1911 Ga0495649_0017148
1912 Ga0495649_0077418
1913 Ga0495649_0091022
1914 Ga0495589_0001060
1915 Ga0495589_0003670
1916 Ga0495589_0007613
1917 Ga0495589_0013208
1918 Ga0495589_0017044
1919 Ga0495589_0019655
1920 Ga0495589_0038105
1921 Ga0495589_0060621
1922 Ga0495589_0072619
1923 Ga0495589_0100291
1924 Ga0495600_0001876
1925 Ga0495660_0000178
1926 Ga0495660_0000705
1927 Ga0495660_0003426
1928 Ga0495660_0005173
1929 Ga0495660_0014659
1930 Ga0495660_0020825
1931 Ga0495604_0027131
1932 Ga0495604_0177628
1933 Ga0495636_0003600
1934 Ga0495636_0020049
1935 Ga0495636_0033912
1936 Ga0495636_0079592
1937 Ga0495674_0019748
1938 Ga0495672_0000033
1939 Ga0495672_0000181
1940 Ga0495672_0000366
1941 Ga0495672_0000381
1942 Ga0495672_0001623
1943 Ga0495672_0009440
1944 Ga0495672_0010123
1945 Ga0495672_0072440
1946 Ga0495676_0000121
1947 Ga0495676_0115733
1948 Ga0495680_0043864
1949 Ga0495680_0132495
1950 Ga0495683_0001151
1951 Ga0495683_0011839
1952 Ga0495683_0012145
1953 Ga0495683_0020827
1954 Ga0495683_0036976
1955 Ga0495683_0053793
1956 Ga0495687_000002
1957 Ga0495687_000017
1958 Ga0495687_000024
1959 Ga0495687_000458
1960 Ga0495687_006587
1961 Ga0495687_013931
1962 Ga0495687_014022
1963 Ga0495687_029982
1964 Ga0495675_0016790
1965 Ga0495675_0086847
1966 Ga0495675_0097755
1967 Ga0495675_0163034
1968 Ga0495677_0000117
1969 Ga0495677_0001384
1970 Ga0495677_0002355
1971 Ga0495677_0003340
1972 Ga0495677_0005223
1973 Ga0495677_0008846
1974 Ga0495677_0010361
1975 Ga0495677_0016878
1976 Ga0495677_0029010
1977 Ga0495679_013040
1978 Ga0495679_015572
1979 Ga0495685_000012
1980 Ga0495685_004997
1981 Ga0495685_009848
1982 Ga0495685_011775
1983 Ga0495685_026424
1984 Ga0495673_0000003
1985 Ga0495673_0000016
1986 Ga0495673_0000188
1987 Ga0495673_0023555
1988 Ga0495673_0050101
1989 Ga0495681_0000994
1990 Ga0495681_0004664
1991 Ga0495681_0012084
1992 Ga0495681_0014560
1993 Ga0495681_0023578
1994 Ga0495681_0031523
1995 Ga0495681_0031695
1996 Ga0495681_0054057
1997 Ga0495681_0057162
1998 Ga0495686_0000032
1999 Ga0495686_0000380
2000 Ga0495686_0000591
2001 Ga0495686_0001614
2002 Ga0495686_0002052
2003 Ga0495686_0013728
2004 Ga0495686_0092149
2005 Ga0495602_0077771
2006 Ga0495602_0291844
2007 Ga0495614_0004132
2008 Ga0495615_0003367
2009 Ga0495615_0015588
2010 Ga0495626_0000004
2011 Ga0495626_0000016
2012 Ga0495626_0000693
2013 Ga0495626_0004909
2014 Ga0495626_0016810
2015 Ga0495626_0029793
2016 Ga0495626_0030305
2017 Ga0495626_0035415
2018 Ga0495626_0038734
2019 Ga0495626_0054614
2020 Ga0496100_0001564
2021 Ga0496100_0035012
2022 Ga0496100_0085040
2023 Ga0496100_0103952
2024 Ga0496100_0140327
2025 Ga0496101_0004610
2026 Ga0496102_0000340
2027 Ga0496102_0000477
2028 Ga0496102_0008702
2029 Ga0496102_0033722
2030 Ga0496102_0068030
2031 Ga0496102_0180819
2032 Ga0496103_0009410
2033 Ga0496103_0088948
2034 Ga0496103_0209725
2035 Ga0496104_0128977
2036 Ga0496105_0157903
2037 Ga0496106_0085445
2038 Ga0496107_0034773
2039 Ga0496107_0138725
2040 Ga0496108_0034687
2041 Ga0496109_0005210
2042 Ga0496109_0022441
2043 Ga0496109_0122656
2044 Ga0496110_0003516
2045 Ga0496110_0004929
2046 Ga0496110_0005432
2047 Ga0496110_0387250
2048 Ga0496111_0021552
2049 Ga0496112_0016052
2050 Ga0496113_0023519
2051 Ga0496113_0036051
2052 Ga0496116_0007137
2053 Ga0496116_0032514
2054 Ga0496116_0037251
2055 Ga0496116_0052261
2056 Ga0496117_0000001
2057 Ga0496117_0024619
2058 Ga0496117_0078292
2059 Ga0496117_0105751
2060 Ga0496118_0000002
2061 Ga0496118_0017381
2062 Ga0496118_0037074
2063 Ga0496118_0094970
2064 Ga0496118_0103492
2065 Ga0496119_0008234
2066 Ga0496119_0120723
2067 Ga0496120_0006959
2068 Ga0496121_0000306
2069 Ga0496121_0004537
2070 Ga0496121_0023095
2071 Ga0496121_0032659
2072 Ga0496121_0043305
2073 Ga0496121_0046034
2074 Ga0496121_0048456
2075 Ga0496121_0150077
2076 Ga0496122_0000455
2077 Ga0496122_0000644
2078 Ga0496122_0004387
2079 Ga0496122_0009237
2080 Ga0496122_0009551
2081 Ga0496122_0034717
2082 Ga0496122_0077420
2083 Ga0496122_0157694
2084 Ga0496122_0177464
2085 Ga0496123_0000197
2086 Ga0496123_0000203
2087 Ga0496123_0003912
2088 Ga0496123_0013893
2089 Ga0496123_0017730
2090 Ga0496123_0026217
2091 Ga0496123_0042315
2092 Ga0496123_0164006
2093 Ga0496124_0000046
2094 Ga0496124_0009308
2095 Ga0496124_0035599
2096 Ga0496124_0051693
2097 Ga0496124_0056406
2098 Ga0496124_0124435
2099 Ga0496124_0151412
2100 Ga0496125_0000011
2101 Ga0496125_0000983
2102 Ga0496125_0001069
2103 Ga0496125_0018029
2104 Ga0496125_0022845
2105 Ga0496125_0027105
2106 Ga0496125_0035345
2107 Ga0496125_0077000
2108 Ga0496126_0000034
2109 Ga0496126_0006564
2110 Ga0496126_0038550
2111 Ga0496126_0055812
2112 Ga0496126_0263737
2113 Ga0501308_000102
2114 Ga0501310_000345
2115 Ga0501310_003722
2116 Ga0495678_000004
2117 Ga0495678_000275
2118 Ga0495678_000746
2119 Ga0495678_001983
2120 Ga0495678_002319
2121 Ga0495678_003043
2122 Ga0495678_004447
2123 Ga0495678_004779
2124 Ga0495678_014319
2125 Ga0495678_024380
2126 Ga0495682_0002099
2127 Ga0495682_0010088
2128 Ga0495682_0019757
2129 Ga0495682_0027473
2130 Ga0501031_0003738
2131 Ga0501032_0018637
2132 Ga0501033_0003665
2133 Ga0501033_0034503
2134 Ga0501033_0061751
2135 Ga0501033_0112304
2136 Ga0501034_0032914
2137 Ga0501034_0140107
2138 Ga0501037_0016812
2139 Ga0501037_0042579
2140 Ga0501037_0141383
2141 Ga0501038_0012706
2142 Ga0501038_0252694
2143 Ga0501039_0051432
2144 Ga0501039_0243526
2145 Ga0501043_0011390
2146 Ga0501043_0023603
2147 Ga0501046_0006547
2148 Ga0501046_0094005
2149 Ga0501047_0005230
2150 Ga0501047_0017738
2151 Ga0501227_003069
2152 Ga0501249_004078
2153 Ga0501269_000561
2154 Ga0501035_0002186
2155 Ga0501035_0003294
2156 Ga0501035_0004380
2157 Ga0501035_0015998
2158 Ga0501044_0001185
2159 Ga0501044_0002640
2160 Ga0501044_0028040
2161 Ga0501044_0087887
2162 nmdc:mga00v17_3752_c2
2163 nmdc:mga07m45_140377_c1
2164 Ga0495601_0003048
2165 Ga0500594_0011549
2166 Ga0500595_004677
2167 Ga0500618_000089
2168 Ga0500618_000670
2169 Ga0500618_000710
2170 Ga0500586_001257
2171 Ga0500600_0007675
2172 Ga0500619_000505
2173 Ga0500637_0104059
2174 Ga0587077_002659
2175 Ga0587080_003961
2176 Ga0587088_003034
2177 Ga0587090_008830
2178 Ga0587101_007126
2179 Ga0587067_000055
2180 Ga0587068_004141
2181 Ga0587068_004557
2182 Ga0587072_000318
2183 Ga0587076_010792
2184 Ga0587079_002440
2185 Ga0587079_009610
2186 2501073321
2187 2501408423
2188 2511096158
2189 2511103119
2190 2511250641
2191 2511384949
2192 2516022417
2193 2519458258
2194 2521557887
2195 2550693926
2196 2553003010
2197 2585294690
2198 2597028853
2199 2599445541
2200 2599738118
2201 2599742510
2202 2599903229
2203 2600204628
2204 2601667671
2205 2643786925
2206 2643802365
2207 2643862279
2208 2643980695
2209 2644030669
2210 2644122119
2211 2644215986
2212 2644254476
2213 2644357859
2214 2644475878
2215 2676741614
2216 2738741283
2217 2738829176
2218 2738845752
2219 2739152972
2220 2739194892
2221 2739277560
2222 2739321368
2223 2739340076
2224 2739346517
2225 2739612191
2226 2765569008
2227 2808984484
2228 2809031988
2229 2809131211
2230 2809145417
2231 2809150454
2232 2817260408
2233 2817278096
2234 2817455663
2235 2819542544
2236 2819591176
2237 2819614972
2238 2819632934
2239 2821131624
2240 2839096107
2241 2842717742
2242 2852621970
2243 2855734598
2244 2855770188
2245 2856292749
2246 2857360983
2247 2857538471
2248 2857546625
2249 2857550302
2250 2857554478
2251 2857559443
2252 2857564715
2253 2858955739
2254 2863421945
2255 2870072113
2256 2881414409
2257 2881930290
2258 2884812294
2259 2884836901
2260 2884853192
2261 2885085394
2262 2885266799
2263 2887377889
2264 2895516613
2265 2896155690
2266 2900578666
2267 2904425973
2268 2904441346
2269 2904531714
2270 2904566110
2271 2904573154
2272 2904588061
2273 2904589779
2274 2904602835
2275 2919046350
2276 2919079661
2277 2919478418
2278 2923511120
2279 2928041924
2280 2928049488
2281 2928062875
2282 2928131056
2283 2928159474
2284 2928164466
2285 2928177550
2286 2928538324
2287 2932411276
2288 2932419157
2289 2941481929
2290 2981993908
2291 642417212
2292 8002395009
2293 8018850379
2294 8020808839
2295 8020939405
2296 8020947192
2297 8020954371
2298 8021122841
2299 8039102778
2300 8040169288
2301 8040175007
2302 8047673772
2303 8048749766
2304 8055227947

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

120

197

0.99

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

242

331

0.98

PF00108

Thiolase_N

Thiolase, N-terminal domain

46

168

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dfe-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from burkholderia xenovorans 0.9923 2 326
4dfe-assembly2.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from burkholderia xenovorans 0.9922 2 326
4dfe-assembly2.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from burkholderia xenovorans 0.9907 2 326
4ryb-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase iii (fabh) from neisseria meningitidis 0.9901 4 326
4dfe-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from burkholderia xenovorans 0.9892 2 326
ID Description Score Start End Superfamily
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9781 4 326 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9725 4 326 3.40.47.10
1hnkA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9723 180 326 3.40.47.10
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.972 4 326 3.40.47.10
1zowB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9704 4 179 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A5C8BIH8-F1-model_v4 deleted 0.9945 4 133
AF-A0A259CS22-F1-model_v4 3-oxoacyl-ACP synthase 0.9938 1 146 GO:0004315
GO:0006633
GO:0044550
AF-A1KRY9-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9915 3 326 GO:0004315
GO:0005737
GO:0006633
GO:0033818
AF-A0A496W691-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.989 115 326 GO:0004315
GO:0006633
GO:0033818
AF-I2NS20-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9879 2 326 GO:0004315
GO:0005737
GO:0006633
GO:0033818

Map