F490879
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1152 | 457 | 2304 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300050489|nmdc:mga03683_79443_c1|nmdc:mga03683_79443_c1_198_1232 |
| Length | 344 |
| Sequence | MVDGMTLYSKIIGTGSYLPERRVTNQDLTDQLAAKGIETSDEWIVSRSGISARHFAEPGEKSSDLAVKAAKRALDMAGLQPNDIDLIVLASSTPDFFGSFPSTACIVQQKLGITNNGAAVDVQAVCSGFVYAMSTADAFIRAGMNKNVLVIGSEVFSRILDFNDRTTCVLFGDGAGAVVMTASQEPGILATALHADGRHSGILCMPDSFGGAVAGEAYLYMDGPAVFKLAVSVLEKVAHEALEKANMAQGQIDWLIPHQANIRIMNSTAKKLGLPLEKMVVTVDQHGNTSAASIPLALDAAVRDGRIQKGQNILMEGVGGGFTWGAVLARLTDDLLARQDLAKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 85 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 89 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 151 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 152 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 153 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 161 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 168 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 169 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 170 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 171 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 172 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 173 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 174 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 182 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 188 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 316 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 323 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 326 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 327 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 329 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 340 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 341 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 342 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 343 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 344 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 345 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 346 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 347 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 348 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 349 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 350 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 351 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 352 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 353 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 354 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 355 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 356 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 357 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 358 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 359 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 360 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 361 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 362 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 363 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 364 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 365 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 366 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 367 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 368 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 369 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 370 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 371 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 372 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 373 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 374 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 375 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 376 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 377 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 378 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 379 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 380 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 381 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 382 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 383 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 384 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 385 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 386 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 387 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 388 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 389 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 390 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 391 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 392 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 393 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 394 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 395 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 396 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 397 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 398 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 399 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 400 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 401 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 402 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 403 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 404 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 405 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 406 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 407 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 408 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 409 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 410 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 411 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 412 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 413 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 414 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 415 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 416 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 417 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 418 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 419 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 420 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 421 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 422 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 423 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 424 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 425 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 426 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 427 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 428 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 429 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 430 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 431 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 432 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 433 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 434 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 435 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 436 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 437 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 438 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 439 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 440 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 441 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 442 | 2941479691 | |||
| 443 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 444 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 445 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 446 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 447 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 448 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 449 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 450 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 451 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 452 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 453 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 454 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 455 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 456 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 457 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.67 |
| Metatranscriptomes | 2 |
| Isolates | 10.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.32 |
| Nodule | 0.87 |
| Rhizoplane | 3.39 |
| Rhizosphere | 67.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga03683_79443_c1 | 3300050489 | Bacteria | 1414 |
| 2 | JGI24741J21665_1000010 | 3300001915 | Bacteria | 44368 |
| 3 | JGI24740J21852_10000462 | 3300001979 | Bacteria | 17404 |
| 4 | JGI24740J21852_10000722 | 3300001979 | Bacteria | 14380 |
| 5 | JGI24739J22299_10010730 | 3300001989 | Bacteria | 3396 |
| 6 | JGI24737J22298_10013210 | 3300001990 | Bacteria | 2689 |
| 7 | JGI24735J21928_10000381 | 3300002067 | Bacteria | 15526 |
| 8 | JGI25155J39150_1000877 | 3300002704 | Bacteria | 4282 |
| 9 | JGI25155J39150_1000881 | 3300002704 | Bacteria | 4257 |
| 10 | JGI25156J39149_1004399 | 3300002705 | Bacteria | 4299 |
| 11 | JGI25156J39149_1004435 | 3300002705 | Bacteria | 4274 |
| 12 | JGI25156J39149_1007106 | 3300002705 | Bacteria | 2977 |
| 13 | JGI25162J39368_1000036 | 3300002737 | Bacteria | 180433 |
| 14 | JGI25162J39368_1007683 | 3300002737 | Bacteria | 1641 |
| 15 | JGI25154J39366_1000446 | 3300002738 | Bacteria | 21840 |
| 16 | JGI25154J39366_1001320 | 3300002738 | Bacteria | 9177 |
| 17 | JGI25154J39366_1002733 | 3300002738 | Bacteria | 4282 |
| 18 | JGI25154J39366_1002751 | 3300002738 | Bacteria | 4257 |
| 19 | JGI25157J39369_1001025 | 3300002741 | Bacteria | 12915 |
| 20 | JGI25157J39369_1001457 | 3300002741 | Bacteria | 8838 |
| 21 | JGI25152J39213_1003851 | 3300002773 | Bacteria | 4950 |
| 22 | JGI25150J39212_1006615 | 3300002774 | Bacteria | 2379 |
| 23 | JGI25159J45721_1005005 | 3300002987 | Bacteria | 4240 |
| 24 | JGI25151J46595_10000203 | 3300003187 | Bacteria | 73276 |
| 25 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 26 | JGI25153J46596_10008450 | 3300003215 | Bacteria | 4921 |
| 27 | JGI25161J50226_1003372 | 3300003374 | Bacteria | 3682 |
| 28 | Ga0007410J51695_1012750 | 3300003574 | Bacteria | 9424 |
| 29 | Ga0007409J51694_1006362 | 3300003575 | Bacteria | 11752 |
| 30 | Ga0007409J51694_1011802 | 3300003575 | Bacteria | 2110 |
| 31 | Ga0007416J51690_1012585 | 3300003577 | Bacteria | 9861 |
| 32 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 33 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 34 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 35 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 36 | Ga0055539_1000034 | 3300003752 | Bacteria | 223400 |
| 37 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 38 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 39 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 40 | Ga0055532_1000016 | 3300003758 | Bacteria | 327509 |
| 41 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 42 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 43 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 44 | Ga0055525_1000538 | 3300003759 | Bacteria | 18074 |
| 45 | Ga0055527_1002743 | 3300003760 | Bacteria | 2853 |
| 46 | Ga0055527_1002777 | 3300003760 | Bacteria | 2817 |
| 47 | Ga0055535_1000318 | 3300003761 | Bacteria | 48605 |
| 48 | Ga0055542_1004140 | 3300003762 | Bacteria | 3648 |
| 49 | Ga0055542_1004240 | 3300003762 | Bacteria | 3552 |
| 50 | Ga0055529_1000028 | 3300003763 | Bacteria | 287650 |
| 51 | Ga0055529_1000403 | 3300003763 | Bacteria | 45873 |
| 52 | Ga0055529_1004078 | 3300003763 | Bacteria | 2280 |
| 53 | Ga0055526_1000018 | 3300003771 | Bacteria | 198838 |
| 54 | Ga0055526_1000029 | 3300003771 | Bacteria | 148855 |
| 55 | Ga0055526_1003756 | 3300003771 | Bacteria | 9475 |
| 56 | Ga0055526_1003777 | 3300003771 | Bacteria | 9442 |
| 57 | Ga0055526_1005592 | 3300003771 | Bacteria | 7164 |
| 58 | Ga0055526_1016080 | 3300003771 | Bacteria | 2956 |
| 59 | Ga0055537_1000202 | 3300003773 | Bacteria | 44565 |
| 60 | Ga0055537_1007170 | 3300003773 | Bacteria | 2726 |
| 61 | Ga0055524_1000234 | 3300003775 | Bacteria | 58774 |
| 62 | Ga0055524_1008881 | 3300003775 | Bacteria | 4137 |
| 63 | Ga0055524_1022702 | 3300003775 | Bacteria | 2042 |
| 64 | Ga0055534_1000311 | 3300003784 | Bacteria | 32607 |
| 65 | Ga0055534_1002771 | 3300003784 | Bacteria | 5873 |
| 66 | Ga0055528_1000062 | 3300003790 | Bacteria | 85624 |
| 67 | Ga0055528_1002474 | 3300003790 | Bacteria | 9876 |
| 68 | Ga0055528_1007004 | 3300003790 | Bacteria | 5042 |
| 69 | Ga0055530_10008671 | 3300003791 | Bacteria | 4027 |
| 70 | Ga0055530_10011528 | 3300003791 | Bacteria | 3166 |
| 71 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 72 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 73 | Ga0055541_1000217 | 3300003841 | Bacteria | 23975 |
| 74 | Ga0058692_1016389 | 3300003856 | Bacteria | 1647 |
| 75 | Ga0055543_1004578 | 3300004625 | Bacteria | 3720 |
| 76 | Ga0065165_1000055 | 3300005262 | Bacteria | 187003 |
| 77 | Ga0065165_1008669 | 3300005262 | Bacteria | 4708 |
| 78 | Ga0065165_1011383 | 3300005262 | Bacteria | 3720 |
| 79 | Ga0065165_1024690 | 3300005262 | Bacteria | 2014 |
| 80 | Ga0065714_10112336 | 3300005288 | Bacteria | 1457 |
| 81 | Ga0065715_10110556 | 3300005293 | Bacteria | 2615 |
| 82 | Ga0070658_10086993 | 3300005327 | Bacteria | 2571 |
| 83 | Ga0070670_100014071 | 3300005331 | Bacteria | 6864 |
| 84 | Ga0070682_100119523 | 3300005337 | Bacteria | 1767 |
| 85 | Ga0070660_100000010 | 3300005339 | Bacteria | 136324 |
| 86 | Ga0070660_100003942 | 3300005339 | Bacteria | 10256 |
| 87 | Ga0070660_100041122 | 3300005339 | Bacteria | 3522 |
| 88 | Ga0070660_100078821 | 3300005339 | Bacteria | 2583 |
| 89 | Ga0070660_100146878 | 3300005339 | Bacteria | 1894 |
| 90 | Ga0070661_100000013 | 3300005344 | Bacteria | 163010 |
| 91 | Ga0070661_100003622 | 3300005344 | Bacteria | 10632 |
| 92 | Ga0070659_100000167 | 3300005366 | Bacteria | 50757 |
| 93 | Ga0070659_100000834 | 3300005366 | Bacteria | 22483 |
| 94 | Ga0070659_100004951 | 3300005366 | Bacteria | 9532 |
| 95 | Ga0070659_100053692 | 3300005366 | Bacteria | 3172 |
| 96 | Ga0070659_100070043 | 3300005366 | Bacteria | 2785 |
| 97 | Ga0070667_100049400 | 3300005367 | Bacteria | 3543 |
| 98 | Ga0070714_100008646 | 3300005435 | Bacteria | 7962 |
| 99 | Ga0070663_100000006 | 3300005455 | Bacteria | 208068 |
| 100 | Ga0070663_100000789 | 3300005455 | Bacteria | 17198 |
| 101 | Ga0070663_100063775 | 3300005455 | Bacteria | 2662 |
| 102 | Ga0070662_100149373 | 3300005457 | Bacteria | 1817 |
| 103 | Ga0068855_100000065 | 3300005563 | Bacteria | 129307 |
| 104 | Ga0068855_100269568 | 3300005563 | Bacteria | 1893 |
| 105 | Ga0068855_100317253 | 3300005563 | Bacteria | 1724 |
| 106 | Ga0070664_100000002 | 3300005564 | Bacteria | 458815 |
| 107 | Ga0070664_100003335 | 3300005564 | Bacteria | 12976 |
| 108 | Ga0070664_100065531 | 3300005564 | Bacteria | 3099 |
| 109 | Ga0068857_100051097 | 3300005577 | Bacteria | 3666 |
| 110 | Ga0068857_100140667 | 3300005577 | Bacteria | 2181 |
| 111 | Ga0068854_100000004 | 3300005578 | Bacteria | 216381 |
| 112 | Ga0068856_100000294 | 3300005614 | Bacteria | 54780 |
| 113 | Ga0068856_100169372 | 3300005614 | Bacteria | 2196 |
| 114 | Ga0068852_100017069 | 3300005616 | Bacteria | 5685 |
| 115 | Ga0068852_100129856 | 3300005616 | Bacteria | 2319 |
| 116 | Ga0075363_100002122 | 3300006048 | Bacteria | 7961 |
| 117 | Ga0075364_10001271 | 3300006051 | Bacteria | 13570 |
| 118 | Ga0075364_10004880 | 3300006051 | Bacteria | 7770 |
| 119 | Ga0075366_10150087 | 3300006195 | Bacteria | 1411 |
| 120 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 121 | Ga0105251_10001123 | 3300009011 | Bacteria | 23287 |
| 122 | Ga0105244_10002843 | 3300009036 | Bacteria | 12850 |
| 123 | Ga0105244_10004589 | 3300009036 | Bacteria | 9455 |
| 124 | Ga0105244_10049320 | 3300009036 | Bacteria | 2152 |
| 125 | Ga0105244_10092329 | 3300009036 | Bacteria | 1488 |
| 126 | Ga0105240_10000297 | 3300009093 | Bacteria | 96825 |
| 127 | Ga0105240_10014780 | 3300009093 | Bacteria | 10641 |
| 128 | Ga0105240_10038598 | 3300009093 | Bacteria | 6124 |
| 129 | Ga0105240_10194424 | 3300009093 | Bacteria | 2383 |
| 130 | Ga0105240_10201688 | 3300009093 | Bacteria | 2331 |
| 131 | Ga0105245_10189972 | 3300009098 | Bacteria | 1967 |
| 132 | Ga0105243_10316365 | 3300009148 | Bacteria | 1421 |
| 133 | Ga0105241_10064594 | 3300009174 | Bacteria | 2826 |
| 134 | Ga0105242_10045340 | 3300009176 | Bacteria | 3563 |
| 135 | Ga0105248_10045070 | 3300009177 | Bacteria | 4945 |
| 136 | Ga0105237_10067786 | 3300009545 | Bacteria | 3562 |
| 137 | Ga0105237_10081975 | 3300009545 | Bacteria | 3217 |
| 138 | Ga0105237_10105569 | 3300009545 | Bacteria | 2808 |
| 139 | Ga0105237_10179067 | 3300009545 | Bacteria | 2120 |
| 140 | Ga0105238_10001896 | 3300009551 | Bacteria | 20982 |
| 141 | Ga0105238_10094199 | 3300009551 | Bacteria | 2982 |
| 142 | Ga0105239_10005044 | 3300010375 | Bacteria | 15592 |
| 143 | Ga0105239_10246327 | 3300010375 | Bacteria | 2007 |
| 144 | Ga0157373_10020184 | 3300013100 | Bacteria | 4847 |
| 145 | Ga0157371_10000123 | 3300013102 | Bacteria | 118119 |
| 146 | Ga0157370_10000013 | 3300013104 | Bacteria | 198861 |
| 147 | Ga0157374_10211981 | 3300013296 | Bacteria | 1899 |
| 148 | Ga0163162_10002139 | 3300013306 | Bacteria | 18531 |
| 149 | Ga0163162_10033754 | 3300013306 | Bacteria | 5086 |
| 150 | Ga0157372_10001159 | 3300013307 | Bacteria | 28511 |
| 151 | Ga0182008_10007666 | 3300014497 | Bacteria | 5948 |
| 152 | Ga0182008_10027927 | 3300014497 | Bacteria | 2855 |
| 153 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 154 | Ga0182006_1000017 | 3300015261 | Bacteria | 299454 |
| 155 | Ga0182006_1010763 | 3300015261 | Bacteria | 4051 |
| 156 | Ga0182006_1015580 | 3300015261 | Bacteria | 3257 |
| 157 | Ga0182007_10000069 | 3300015262 | Bacteria | 82172 |
| 158 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 159 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 160 | Ga0182005_1000307 | 3300015265 | Bacteria | 29530 |
| 161 | Ga0206355_1326248 | 3300020076 | Bacteria | 4647 |
| 162 | Ga0206351_10167421 | 3300020077 | Bacteria | 22180 |
| 163 | Ga0206350_10139122 | 3300020080 | Bacteria | 2407 |
| 164 | Ga0154015_1099906 | 3300020610 | Bacteria | 39484 |
| 165 | Ga0213872_10000263 | 3300021361 | Bacteria | 45483 |
| 166 | Ga0213872_10000773 | 3300021361 | Bacteria | 23449 |
| 167 | Ga0213872_10012586 | 3300021361 | Bacteria | 3979 |
| 168 | Ga0213872_10013693 | 3300021361 | Bacteria | 3796 |
| 169 | Ga0209435_100070 | 3300025206 | Bacteria | 63829 |
| 170 | Ga0209435_100716 | 3300025206 | Bacteria | 5582 |
| 171 | Ga0209760_101302 | 3300025207 | Bacteria | 2712 |
| 172 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 173 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 174 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 175 | Ga0209784_100293 | 3300025224 | Bacteria | 27186 |
| 176 | Ga0209784_100803 | 3300025224 | Bacteria | 7383 |
| 177 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 178 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 179 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 180 | Ga0209566_100370 | 3300025225 | Bacteria | 37519 |
| 181 | Ga0209566_100896 | 3300025225 | Bacteria | 14309 |
| 182 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 183 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 184 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 185 | Ga0209674_100122 | 3300025226 | Bacteria | 131720 |
| 186 | Ga0209674_101948 | 3300025226 | Bacteria | 4832 |
| 187 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 188 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 189 | Ga0209672_100213 | 3300025228 | Bacteria | 45410 |
| 190 | Ga0209672_109800 | 3300025228 | Bacteria | 1329 |
| 191 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 192 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 193 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 194 | Ga0209147_101674 | 3300025229 | Bacteria | 7277 |
| 195 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 196 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 197 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 198 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 199 | Ga0209563_104817 | 3300025230 | Bacteria | 2527 |
| 200 | Ga0207427_100255 | 3300025231 | Bacteria | 41856 |
| 201 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 202 | Ga0209437_100080 | 3300025233 | Bacteria | 275402 |
| 203 | Ga0209437_103076 | 3300025233 | Bacteria | 3077 |
| 204 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 205 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 206 | Ga0209258_100179 | 3300025242 | Bacteria | 137687 |
| 207 | Ga0209258_100253 | 3300025242 | Bacteria | 96309 |
| 208 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 209 | Ga0207425_1001467 | 3300025245 | Bacteria | 9823 |
| 210 | Ga0207425_1001639 | 3300025245 | Bacteria | 9024 |
| 211 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 212 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 213 | Ga0209646_1000174 | 3300025246 | Bacteria | 84479 |
| 214 | Ga0209646_1000872 | 3300025246 | Bacteria | 10050 |
| 215 | Ga0209026_1000150 | 3300025250 | Bacteria | 111025 |
| 216 | Ga0209026_1002115 | 3300025250 | Bacteria | 7781 |
| 217 | Ga0209026_1003950 | 3300025250 | Bacteria | 4633 |
| 218 | Ga0209026_1007183 | 3300025250 | Bacteria | 2561 |
| 219 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 220 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 221 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 222 | Ga0209677_103820 | 3300025253 | Bacteria | 4658 |
| 223 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 224 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 225 | Ga0209148_1000992 | 3300025254 | Bacteria | 18267 |
| 226 | Ga0209148_1004472 | 3300025254 | Bacteria | 3439 |
| 227 | Ga0209759_1000359 | 3300025256 | Bacteria | 58766 |
| 228 | Ga0209759_1000408 | 3300025256 | Bacteria | 52948 |
| 229 | Ga0209759_1001771 | 3300025256 | Bacteria | 11009 |
| 230 | Ga0209759_1002181 | 3300025256 | Bacteria | 8969 |
| 231 | Ga0209759_1007195 | 3300025256 | Bacteria | 3618 |
| 232 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 233 | Ga0209129_1005030 | 3300025258 | Bacteria | 4863 |
| 234 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 235 | Ga0209565_1000167 | 3300025263 | Bacteria | 85246 |
| 236 | Ga0209565_1000902 | 3300025263 | Bacteria | 16045 |
| 237 | Ga0209565_1001159 | 3300025263 | Bacteria | 12725 |
| 238 | Ga0209565_1007277 | 3300025263 | Bacteria | 3000 |
| 239 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 240 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 241 | Ga0209455_1000213 | 3300025272 | Bacteria | 82040 |
| 242 | Ga0209455_1002641 | 3300025272 | Bacteria | 6780 |
| 243 | Ga0209455_1004072 | 3300025272 | Bacteria | 4925 |
| 244 | Ga0209673_1000051 | 3300025273 | Bacteria | 282161 |
| 245 | Ga0209673_1000201 | 3300025273 | Bacteria | 120059 |
| 246 | Ga0209673_1012575 | 3300025273 | Bacteria | 3401 |
| 247 | Ga0209130_1000091 | 3300025284 | Bacteria | 149502 |
| 248 | Ga0209130_1000507 | 3300025284 | Bacteria | 39512 |
| 249 | Ga0209130_1003078 | 3300025284 | Bacteria | 7462 |
| 250 | Ga0209130_1006616 | 3300025284 | Bacteria | 3733 |
| 251 | Ga0209675_1000027 | 3300025291 | Bacteria | 282175 |
| 252 | Ga0209675_1000769 | 3300025291 | Bacteria | 21492 |
| 253 | Ga0209675_1005996 | 3300025291 | Bacteria | 4973 |
| 254 | Ga0209675_1009461 | 3300025291 | Bacteria | 3443 |
| 255 | Ga0209676_1004133 | 3300025292 | Bacteria | 8268 |
| 256 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 257 | Ga0209025_1016263 | 3300025294 | Bacteria | 4408 |
| 258 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 259 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 260 | Ga0209564_1000897 | 3300025295 | Bacteria | 39116 |
| 261 | Ga0209564_1001707 | 3300025295 | Bacteria | 20758 |
| 262 | Ga0209564_1002800 | 3300025295 | Bacteria | 12995 |
| 263 | Ga0209564_1003112 | 3300025295 | Bacteria | 11717 |
| 264 | Ga0209564_1047387 | 3300025295 | Bacteria | 1083 |
| 265 | Ga0209758_1000073 | 3300025297 | Bacteria | 276262 |
| 266 | Ga0209758_1002044 | 3300025297 | Bacteria | 21637 |
| 267 | Ga0209050_1000046 | 3300025298 | Bacteria | 386466 |
| 268 | Ga0209050_1003824 | 3300025298 | Bacteria | 10743 |
| 269 | Ga0209050_1012901 | 3300025298 | Bacteria | 3780 |
| 270 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 271 | Ga0209256_1000265 | 3300025299 | Bacteria | 92716 |
| 272 | Ga0209256_1002001 | 3300025299 | Bacteria | 18236 |
| 273 | Ga0209256_1010975 | 3300025299 | Bacteria | 3700 |
| 274 | Ga0207426_1001239 | 3300025302 | Bacteria | 22460 |
| 275 | Ga0207426_1003279 | 3300025302 | Bacteria | 9024 |
| 276 | Ga0209257_1000068 | 3300025304 | Bacteria | 341291 |
| 277 | Ga0207655_1008662 | 3300025728 | Bacteria | 6421 |
| 278 | Ga0207655_1011578 | 3300025728 | Bacteria | 5238 |
| 279 | Ga0207655_1050604 | 3300025728 | Bacteria | 1687 |
| 280 | Ga0207713_1003181 | 3300025735 | Bacteria | 11351 |
| 281 | Ga0207680_10231953 | 3300025903 | Bacteria | 1269 |
| 282 | Ga0207647_10000835 | 3300025904 | Bacteria | 23959 |
| 283 | Ga0207647_10018639 | 3300025904 | Bacteria | 4688 |
| 284 | Ga0207705_10023618 | 3300025909 | Bacteria | 4386 |
| 285 | Ga0207705_10112848 | 3300025909 | Bacteria | 2010 |
| 286 | Ga0207695_10000475 | 3300025913 | Bacteria | 86957 |
| 287 | Ga0207695_10006070 | 3300025913 | Bacteria | 15766 |
| 288 | Ga0207695_10011620 | 3300025913 | Bacteria | 10649 |
| 289 | Ga0207695_10032578 | 3300025913 | Bacteria | 5700 |
| 290 | Ga0207695_10036204 | 3300025913 | Bacteria | 5338 |
| 291 | Ga0207671_10020134 | 3300025914 | Bacteria | 5086 |
| 292 | Ga0207671_10052029 | 3300025914 | Bacteria | 3034 |
| 293 | Ga0207660_10094123 | 3300025917 | Bacteria | 2227 |
| 294 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 295 | Ga0207657_10012572 | 3300025919 | Bacteria | 8345 |
| 296 | Ga0207657_10037258 | 3300025919 | Bacteria | 4344 |
| 297 | Ga0207657_10137885 | 3300025919 | Bacteria | 1995 |
| 298 | Ga0207657_10330431 | 3300025919 | Bacteria | 1204 |
| 299 | Ga0207649_10000019 | 3300025920 | Bacteria | 212682 |
| 300 | Ga0207649_10035200 | 3300025920 | Bacteria | 3008 |
| 301 | Ga0207694_10004571 | 3300025924 | Bacteria | 10785 |
| 302 | Ga0207694_10010183 | 3300025924 | Bacteria | 7086 |
| 303 | Ga0207694_10022298 | 3300025924 | Bacteria | 4802 |
| 304 | Ga0207650_10011517 | 3300025925 | Bacteria | 6090 |
| 305 | Ga0207659_10256285 | 3300025926 | Bacteria | 1421 |
| 306 | Ga0207664_10123199 | 3300025929 | Bacteria | 2173 |
| 307 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 308 | Ga0207690_10004157 | 3300025932 | Bacteria | 8555 |
| 309 | Ga0207690_10021999 | 3300025932 | Bacteria | 3961 |
| 310 | Ga0207690_10127237 | 3300025932 | Bacteria | 1859 |
| 311 | Ga0207690_10133276 | 3300025932 | Bacteria | 1821 |
| 312 | Ga0207686_10049440 | 3300025934 | Bacteria | 2610 |
| 313 | Ga0207711_10024668 | 3300025941 | Bacteria | 5042 |
| 314 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 315 | Ga0207679_10004443 | 3300025945 | Bacteria | 8736 |
| 316 | Ga0207667_10000025 | 3300025949 | Bacteria | 350159 |
| 317 | Ga0207667_10023086 | 3300025949 | Bacteria | 6854 |
| 318 | Ga0207667_10046894 | 3300025949 | Bacteria | 4575 |
| 319 | Ga0207667_10134582 | 3300025949 | Bacteria | 2545 |
| 320 | Ga0207667_10138896 | 3300025949 | Bacteria | 2502 |
| 321 | Ga0207640_10000240 | 3300025981 | Bacteria | 37127 |
| 322 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 323 | Ga0207678_10000167 | 3300026067 | Bacteria | 55724 |
| 324 | Ga0207678_10038870 | 3300026067 | Bacteria | 4131 |
| 325 | Ga0207678_10253587 | 3300026067 | Bacteria | 1507 |
| 326 | Ga0207702_10000009 | 3300026078 | Bacteria | 305906 |
| 327 | Ga0207702_10136452 | 3300026078 | Bacteria | 2214 |
| 328 | Ga0207674_10064218 | 3300026116 | Bacteria | 3703 |
| 329 | Ga0207674_10281349 | 3300026116 | Bacteria | 1611 |
| 330 | Ga0207698_10020074 | 3300026142 | Bacteria | 4591 |
| 331 | Ga0207698_10111359 | 3300026142 | Bacteria | 2295 |
| 332 | Ga0209281_1006345 | 3300027111 | Bacteria | 3102 |
| 333 | Ga0209371_1000297 | 3300027312 | Bacteria | 55845 |
| 334 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 335 | Ga0268264_10162696 | 3300028381 | Bacteria | 2012 |
| 336 | Ga0268256_1000261 | 3300030500 | Bacteria | 55844 |
| 337 | Ga0307511_10000040 | 3300030521 | Bacteria | 102640 |
| 338 | Ga0316177_1009921 | 3300030731 | Bacteria | 1753 |
| 339 | Ga0316180_1185675 | 3300030736 | Bacteria | 2546 |
| 340 | Ga0316181_1278006 | 3300030744 | Bacteria | 2506 |
| 341 | Ga0265327_10027938 | 3300031251 | Bacteria | 3239 |
| 342 | Ga0265327_10090341 | 3300031251 | Bacteria | 1495 |
| 343 | Ga0307408_100001210 | 3300031548 | Bacteria | 19453 |
| 344 | Ga0307408_100021297 | 3300031548 | Bacteria | 4386 |
| 345 | Ga0307408_100029234 | 3300031548 | Bacteria | 3815 |
| 346 | Ga0307408_100043636 | 3300031548 | Bacteria | 3191 |
| 347 | Ga0307518_10028306 | 3300031838 | Bacteria | 4044 |
| 348 | Ga0307412_10000845 | 3300031911 | Bacteria | 17634 |
| 349 | Ga0307416_100020341 | 3300032002 | Bacteria | 4733 |
| 350 | Ga0307414_10012598 | 3300032004 | Bacteria | 5007 |
| 351 | Ga0316583_10009599 | 3300032133 | Bacteria | 3486 |
| 352 | Ga0307507_10043456 | 3300033179 | Bacteria | 4459 |
| 353 | Ga0395899_0000904 | 3300037312 | Bacteria | 27911 |
| 354 | Ga0395899_0002101 | 3300037312 | Bacteria | 16364 |
| 355 | Ga0395899_0036149 | 3300037312 | Bacteria | 3706 |
| 356 | Ga0395899_0049427 | 3300037312 | Bacteria | 3126 |
| 357 | Ga0395899_0058593 | 3300037312 | Bacteria | 2840 |
| 358 | Ga0395899_0076323 | 3300037312 | Bacteria | 2446 |
| 359 | Ga0395899_0181802 | 3300037312 | Bacteria | 1476 |
| 360 | Ga0395900_0000874 | 3300037418 | Bacteria | 39520 |
| 361 | Ga0395900_0007034 | 3300037418 | Bacteria | 11651 |
| 362 | Ga0395900_0009723 | 3300037418 | Bacteria | 9850 |
| 363 | Ga0395900_0018346 | 3300037418 | Bacteria | 7137 |
| 364 | Ga0395900_0023633 | 3300037418 | Bacteria | 6287 |
| 365 | Ga0395900_0036284 | 3300037418 | Bacteria | 5082 |
| 366 | Ga0395900_0050571 | 3300037418 | Bacteria | 4280 |
| 367 | Ga0395900_0062747 | 3300037418 | Bacteria | 3819 |
| 368 | Ga0395900_0102978 | 3300037418 | Bacteria | 2932 |
| 369 | Ga0395900_0163739 | 3300037418 | Bacteria | 2267 |
| 370 | Ga0395900_0517839 | 3300037418 | Bacteria | 1141 |
| 371 | Ga0395898_0039391 | 3300037466 | Bacteria | 4677 |
| 372 | Ga0395898_0154334 | 3300037466 | Bacteria | 2196 |
| 373 | Ga0395898_0157087 | 3300037466 | Bacteria | 2175 |
| 374 | Ga0395898_0423988 | 3300037466 | Bacteria | 1268 |
| 375 | Ga0395905_0008840 | 3300037471 | Bacteria | 9899 |
| 376 | Ga0395905_0009571 | 3300037471 | Bacteria | 9461 |
| 377 | Ga0395905_0048604 | 3300037471 | Bacteria | 3975 |
| 378 | Ga0395905_0070895 | 3300037471 | Bacteria | 3266 |
| 379 | Ga0395905_0075118 | 3300037471 | Bacteria | 3167 |
| 380 | Ga0395905_0088384 | 3300037471 | Bacteria | 2905 |
| 381 | Ga0395905_0263229 | 3300037471 | Bacteria | 1610 |
| 382 | Ga0395905_0285714 | 3300037471 | Bacteria | 1536 |
| 383 | Ga0395905_0341128 | 3300037471 | Bacteria | 1389 |
| 384 | Ga0395901_0000054 | 3300038443 | Bacteria | 160505 |
| 385 | Ga0395901_0003565 | 3300038443 | Bacteria | 15697 |
| 386 | Ga0395901_0010496 | 3300038443 | Bacteria | 9382 |
| 387 | Ga0395901_0127852 | 3300038443 | Bacteria | 2671 |
| 388 | Ga0395901_0273659 | 3300038443 | Bacteria | 1756 |
| 389 | Ga0395901_0425782 | 3300038443 | Bacteria | 1360 |
| 390 | Ga0395901_0438385 | 3300038443 | Bacteria | 1337 |
| 391 | Ga0395901_0452847 | 3300038443 | Bacteria | 1312 |
| 392 | Ga0395901_0480409 | 3300038443 | Bacteria | 1267 |
| 393 | Ga0436361_0080172 | 3300039447 | Bacteria | 39325 |
| 394 | Ga0436361_0116364 | 3300039447 | Bacteria | 2684 |
| 395 | Ga0436361_0134513 | 3300039447 | Bacteria | 2777 |
| 396 | Ga0436361_0261530 | 3300039447 | Bacteria | 8331 |
| 397 | Ga0436361_0324341 | 3300039447 | Bacteria | 73428 |
| 398 | Ga0436361_0525957 | 3300039447 | Bacteria | 2561 |
| 399 | Ga0436361_0944997 | 3300039447 | Bacteria | 6398 |
| 400 | Ga0436361_0987205 | 3300039447 | Bacteria | 3310 |
| 401 | Ga0439448_0003707 | 3300042005 | Bacteria | 4256 |
| 402 | Ga0439448_0020781 | 3300042005 | Bacteria | 2034 |
| 403 | Ga0439458_0001531 | 3300042157 | Bacteria | 5778 |
| 404 | Ga0451577_0004811 | 3300042876 | Bacteria | 14099 |
| 405 | Ga0451577_0006944 | 3300042876 | Bacteria | 11187 |
| 406 | Ga0451577_0026714 | 3300042876 | Bacteria | 5229 |
| 407 | Ga0451577_0101044 | 3300042876 | Bacteria | 2576 |
| 408 | Ga0451577_0175942 | 3300042876 | Bacteria | 1929 |
| 409 | Ga0466972_0000005 | 3300044658 | Bacteria | 289640 |
| 410 | Ga0466972_0002881 | 3300044658 | Bacteria | 8512 |
| 411 | Ga0466972_0004661 | 3300044658 | Bacteria | 6865 |
| 412 | Ga0466972_0076949 | 3300044658 | Bacteria | 1589 |
| 413 | Ga0466977_0003512 | 3300044666 | Bacteria | 7626 |
| 414 | Ga0466978_0027607 | 3300044671 | Bacteria | 3428 |
| 415 | Ga0466982_0020479 | 3300044672 | Bacteria | 3760 |
| 416 | Ga0466965_0005740 | 3300044683 | Bacteria | 5601 |
| 417 | Ga0466965_0014133 | 3300044683 | Bacteria | 3776 |
| 418 | Ga0466965_0016454 | 3300044683 | Bacteria | 3520 |
| 419 | Ga0466965_0016917 | 3300044683 | Bacteria | 3478 |
| 420 | Ga0466965_0084426 | 3300044683 | Bacteria | 1608 |
| 421 | Ga0466966_0005305 | 3300044684 | Bacteria | 8476 |
| 422 | Ga0466966_0033545 | 3300044684 | Bacteria | 3324 |
| 423 | Ga0466966_0062889 | 3300044684 | Bacteria | 2339 |
| 424 | Ga0466966_0080211 | 3300044684 | Bacteria | 2033 |
| 425 | Ga0466966_0090457 | 3300044684 | Bacteria | 1900 |
| 426 | Ga0466961_0001007 | 3300044693 | Bacteria | 17404 |
| 427 | Ga0466963_0134754 | 3300044694 | Bacteria | 1708 |
| 428 | Ga0466964_0001227 | 3300044706 | Bacteria | 8693 |
| 429 | Ga0466964_0001931 | 3300044706 | Bacteria | 7257 |
| 430 | Ga0466964_0007716 | 3300044706 | Bacteria | 4027 |
| 431 | Ga0466964_0036081 | 3300044706 | Bacteria | 1980 |
| 432 | Ga0453684_0000847 | 3300044712 | Bacteria | 103142 |
| 433 | Ga0453684_0031930 | 3300044712 | Bacteria | 7384 |
| 434 | Ga0466971_0010136 | 3300044719 | Bacteria | 4115 |
| 435 | Ga0466968_0001801 | 3300044735 | Bacteria | 7739 |
| 436 | Ga0466968_0003428 | 3300044735 | Bacteria | 5865 |
| 437 | Ga0466968_0131265 | 3300044735 | Bacteria | 1140 |
| 438 | Ga0466970_0014132 | 3300044765 | Bacteria | 4094 |
| 439 | Ga0466957_0013888 | 3300044842 | Bacteria | 4681 |
| 440 | Ga0466957_0044973 | 3300044842 | Bacteria | 2676 |
| 441 | Ga0466957_0177057 | 3300044842 | Bacteria | 1391 |
| 442 | Ga0466959_0007553 | 3300045049 | Bacteria | 7640 |
| 443 | Ga0466959_0165242 | 3300045049 | Bacteria | 1554 |
| 444 | Ga0451576_0001131 | 3300045051 | Bacteria | 48320 |
| 445 | Ga0451576_0017241 | 3300045051 | Bacteria | 7944 |
| 446 | Ga0451576_0055941 | 3300045051 | Bacteria | 4127 |
| 447 | Ga0451576_0197558 | 3300045051 | Bacteria | 2101 |
| 448 | Ga0451576_0269744 | 3300045051 | Bacteria | 1779 |
| 449 | Ga0451576_0602437 | 3300045051 | Bacteria | 1155 |
| 450 | Ga0466967_0010385 | 3300045976 | Bacteria | 6982 |
| 451 | Ga0466967_0071893 | 3300045976 | Bacteria | 3098 |
| 452 | Ga0466967_0288288 | 3300045976 | Bacteria | 1576 |
| 453 | Ga0466967_0529560 | 3300045976 | Bacteria | 1158 |
| 454 | Ga0495617_000041 | 3300046452 | Bacteria | 124027 |
| 455 | Ga0495617_000057 | 3300046452 | Bacteria | 100673 |
| 456 | Ga0495617_000843 | 3300046452 | Bacteria | 14581 |
| 457 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 458 | Ga0495627_001817 | 3300046453 | Bacteria | 11358 |
| 459 | Ga0495627_006174 | 3300046453 | Bacteria | 4721 |
| 460 | Ga0495627_020867 | 3300046453 | Bacteria | 2178 |
| 461 | Ga0495592_0047346 | 3300046454 | Bacteria | 3202 |
| 462 | Ga0495603_0078255 | 3300046455 | Bacteria | 1939 |
| 463 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 464 | Ga0495590_0000018 | 3300046457 | Bacteria | 216375 |
| 465 | Ga0495590_0002149 | 3300046457 | Bacteria | 8279 |
| 466 | Ga0495590_0008695 | 3300046457 | Bacteria | 3866 |
| 467 | Ga0495590_0010437 | 3300046457 | Bacteria | 3493 |
| 468 | Ga0495591_012498 | 3300046458 | Bacteria | 3159 |
| 469 | Ga0495629_0000293 | 3300046459 | Bacteria | 43087 |
| 470 | Ga0495638_0000086 | 3300046460 | Bacteria | 152781 |
| 471 | Ga0495638_0223603 | 3300046460 | Bacteria | 1051 |
| 472 | Ga0495651_0028201 | 3300046462 | Bacteria | 4375 |
| 473 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 474 | Ga0495653_0001619 | 3300046463 | Bacteria | 17685 |
| 475 | Ga0495653_0028643 | 3300046463 | Bacteria | 4452 |
| 476 | Ga0495650_0000108 | 3300046471 | Bacteria | 200369 |
| 477 | Ga0495650_0000118 | 3300046471 | Bacteria | 187358 |
| 478 | Ga0495650_0000140 | 3300046471 | Bacteria | 169317 |
| 479 | Ga0495650_0000156 | 3300046471 | Bacteria | 155338 |
| 480 | Ga0495650_0000837 | 3300046471 | Bacteria | 37114 |
| 481 | Ga0495650_0007249 | 3300046471 | Bacteria | 6716 |
| 482 | Ga0495650_0017152 | 3300046471 | Bacteria | 3639 |
| 483 | Ga0495580_0156385 | 3300046472 | Bacteria | 1578 |
| 484 | Ga0495582_0006054 | 3300046473 | Bacteria | 6740 |
| 485 | Ga0495582_0015498 | 3300046473 | Bacteria | 4187 |
| 486 | Ga0495605_0000168 | 3300046474 | Bacteria | 82889 |
| 487 | Ga0495605_0000416 | 3300046474 | Bacteria | 38811 |
| 488 | Ga0495605_0000438 | 3300046474 | Bacteria | 37563 |
| 489 | Ga0495605_0003370 | 3300046474 | Bacteria | 9538 |
| 490 | Ga0495605_0019964 | 3300046474 | Bacteria | 3567 |
| 491 | Ga0495605_0027851 | 3300046474 | Bacteria | 2923 |
| 492 | Ga0495605_0035069 | 3300046474 | Bacteria | 2537 |
| 493 | Ga0495605_0071002 | 3300046474 | Bacteria | 1645 |
| 494 | Ga0495605_0090233 | 3300046474 | Bacteria | 1421 |
| 495 | Ga0495605_0142817 | 3300046474 | Bacteria | 1073 |
| 496 | Ga0495639_0033664 | 3300046475 | Bacteria | 2289 |
| 497 | Ga0495584_0000281 | 3300046491 | Bacteria | 35857 |
| 498 | Ga0495584_0002307 | 3300046491 | Bacteria | 10888 |
| 499 | Ga0495584_0012122 | 3300046491 | Bacteria | 4406 |
| 500 | Ga0495584_0013652 | 3300046491 | Bacteria | 4143 |
| 501 | Ga0495584_0023179 | 3300046491 | Bacteria | 3147 |
| 502 | Ga0495584_0033622 | 3300046491 | Bacteria | 2594 |
| 503 | Ga0495584_0043266 | 3300046491 | Bacteria | 2273 |
| 504 | Ga0495585_0002371 | 3300046492 | Bacteria | 13522 |
| 505 | Ga0495585_0005187 | 3300046492 | Bacteria | 8261 |
| 506 | Ga0495585_0007454 | 3300046492 | Bacteria | 6694 |
| 507 | Ga0495585_0008412 | 3300046492 | Bacteria | 6254 |
| 508 | Ga0495585_0014980 | 3300046492 | Bacteria | 4508 |
| 509 | Ga0495585_0020761 | 3300046492 | Bacteria | 3775 |
| 510 | Ga0495585_0038339 | 3300046492 | Bacteria | 2697 |
| 511 | Ga0495585_0100247 | 3300046492 | Bacteria | 1549 |
| 512 | Ga0495585_0104505 | 3300046492 | Bacteria | 1511 |
| 513 | Ga0495594_0024057 | 3300046499 | Bacteria | 3268 |
| 514 | Ga0495596_0001435 | 3300046500 | Bacteria | 13653 |
| 515 | Ga0495596_0011978 | 3300046500 | Bacteria | 3722 |
| 516 | Ga0495596_0012711 | 3300046500 | Bacteria | 3594 |
| 517 | Ga0495596_0018777 | 3300046500 | Bacteria | 2848 |
| 518 | Ga0495596_0020910 | 3300046500 | Bacteria | 2675 |
| 519 | Ga0495596_0020949 | 3300046500 | Bacteria | 2672 |
| 520 | Ga0495596_0023665 | 3300046500 | Bacteria | 2491 |
| 521 | Ga0495596_0025542 | 3300046500 | Bacteria | 2387 |
| 522 | Ga0495596_0026299 | 3300046500 | Bacteria | 2346 |
| 523 | Ga0495596_0067256 | 3300046500 | Bacteria | 1392 |
| 524 | Ga0495607_0002962 | 3300046501 | Bacteria | 13341 |
| 525 | Ga0495607_0003330 | 3300046501 | Bacteria | 12335 |
| 526 | Ga0495607_0004150 | 3300046501 | Bacteria | 10781 |
| 527 | Ga0495607_0006983 | 3300046501 | Bacteria | 7863 |
| 528 | Ga0495607_0019846 | 3300046501 | Bacteria | 4261 |
| 529 | Ga0495607_0020575 | 3300046501 | Bacteria | 4167 |
| 530 | Ga0495607_0025658 | 3300046501 | Bacteria | 3663 |
| 531 | Ga0495607_0028934 | 3300046501 | Bacteria | 3413 |
| 532 | Ga0495607_0031999 | 3300046501 | Bacteria | 3216 |
| 533 | Ga0495607_0032131 | 3300046501 | Bacteria | 3206 |
| 534 | Ga0495607_0038276 | 3300046501 | Bacteria | 2874 |
| 535 | Ga0495607_0046570 | 3300046501 | Bacteria | 2545 |
| 536 | Ga0495607_0049132 | 3300046501 | Bacteria | 2461 |
| 537 | Ga0495607_0076351 | 3300046501 | Bacteria | 1853 |
| 538 | Ga0495607_0092268 | 3300046501 | Bacteria | 1638 |
| 539 | Ga0495583_0000177 | 3300046506 | Bacteria | 108704 |
| 540 | Ga0495583_0000221 | 3300046506 | Bacteria | 96143 |
| 541 | Ga0495583_0001635 | 3300046506 | Bacteria | 21854 |
| 542 | Ga0495583_0003816 | 3300046506 | Bacteria | 11182 |
| 543 | Ga0495583_0004868 | 3300046506 | Bacteria | 9379 |
| 544 | Ga0495583_0014101 | 3300046506 | Bacteria | 4422 |
| 545 | Ga0495583_0020486 | 3300046506 | Bacteria | 3425 |
| 546 | Ga0495583_0032488 | 3300046506 | Bacteria | 2519 |
| 547 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 548 | Ga0495606_0000011 | 3300046507 | Bacteria | 296816 |
| 549 | Ga0495606_0000679 | 3300046507 | Bacteria | 53237 |
| 550 | Ga0495606_0000864 | 3300046507 | Bacteria | 45347 |
| 551 | Ga0495606_0006986 | 3300046507 | Bacteria | 10256 |
| 552 | Ga0495606_0007758 | 3300046507 | Bacteria | 9503 |
| 553 | Ga0495606_0022736 | 3300046507 | Bacteria | 4557 |
| 554 | Ga0495606_0027811 | 3300046507 | Bacteria | 4001 |
| 555 | Ga0495606_0027851 | 3300046507 | Bacteria | 3997 |
| 556 | Ga0495606_0045995 | 3300046507 | Bacteria | 2887 |
| 557 | Ga0495606_0063561 | 3300046507 | Bacteria | 2352 |
| 558 | Ga0495606_0112714 | 3300046507 | Bacteria | 1638 |
| 559 | Ga0495608_0006170 | 3300046511 | Bacteria | 8513 |
| 560 | Ga0495608_0041553 | 3300046511 | Bacteria | 3076 |
| 561 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 562 | Ga0495610_0002329 | 3300046512 | Bacteria | 16055 |
| 563 | Ga0495610_0003829 | 3300046512 | Bacteria | 11463 |
| 564 | Ga0495610_0075135 | 3300046512 | Bacteria | 1565 |
| 565 | Ga0495610_0078369 | 3300046512 | Bacteria | 1523 |
| 566 | Ga0495616_0000662 | 3300046513 | Bacteria | 25597 |
| 567 | Ga0495616_0002684 | 3300046513 | Bacteria | 11663 |
| 568 | Ga0495616_0013824 | 3300046513 | Bacteria | 4538 |
| 569 | Ga0495616_0018343 | 3300046513 | Bacteria | 3842 |
| 570 | Ga0495616_0026851 | 3300046513 | Bacteria | 3058 |
| 571 | Ga0495616_0033272 | 3300046513 | Bacteria | 2687 |
| 572 | Ga0495616_0039587 | 3300046513 | Bacteria | 2413 |
| 573 | Ga0495616_0052848 | 3300046513 | Bacteria | 2021 |
| 574 | Ga0495616_0058167 | 3300046513 | Bacteria | 1904 |
| 575 | Ga0495618_0071916 | 3300046514 | Bacteria | 2200 |
| 576 | Ga0495628_0004565 | 3300046516 | Bacteria | 12256 |
| 577 | Ga0495628_0007604 | 3300046516 | Bacteria | 9365 |
| 578 | Ga0495628_0011133 | 3300046516 | Bacteria | 7615 |
| 579 | Ga0495630_0084205 | 3300046517 | Bacteria | 2401 |
| 580 | Ga0495631_0000632 | 3300046518 | Bacteria | 23007 |
| 581 | Ga0495631_0001483 | 3300046518 | Bacteria | 14222 |
| 582 | Ga0495631_0016053 | 3300046518 | Bacteria | 3577 |
| 583 | Ga0495631_0018103 | 3300046518 | Bacteria | 3320 |
| 584 | Ga0495631_0018121 | 3300046518 | Bacteria | 3318 |
| 585 | Ga0495631_0032908 | 3300046518 | Bacteria | 2333 |
| 586 | Ga0495631_0070560 | 3300046518 | Bacteria | 1510 |
| 587 | Ga0495632_0000214 | 3300046519 | Bacteria | 58439 |
| 588 | Ga0495632_0003852 | 3300046519 | Bacteria | 10434 |
| 589 | Ga0495632_0011405 | 3300046519 | Bacteria | 5187 |
| 590 | Ga0495632_0014316 | 3300046519 | Bacteria | 4490 |
| 591 | Ga0495632_0015456 | 3300046519 | Bacteria | 4278 |
| 592 | Ga0495632_0027244 | 3300046519 | Bacteria | 2995 |
| 593 | Ga0495637_0000612 | 3300046520 | Bacteria | 25396 |
| 594 | Ga0495637_0001689 | 3300046520 | Bacteria | 12743 |
| 595 | Ga0495637_0021637 | 3300046520 | Bacteria | 2946 |
| 596 | Ga0495643_0000123 | 3300046522 | Bacteria | 124936 |
| 597 | Ga0495643_0004483 | 3300046522 | Bacteria | 9748 |
| 598 | Ga0495643_0009598 | 3300046522 | Bacteria | 6002 |
| 599 | Ga0495643_0015947 | 3300046522 | Bacteria | 4425 |
| 600 | Ga0495643_0019252 | 3300046522 | Bacteria | 3952 |
| 601 | Ga0495643_0021003 | 3300046522 | Bacteria | 3753 |
| 602 | Ga0495643_0043697 | 3300046522 | Bacteria | 2437 |
| 603 | Ga0495643_0046264 | 3300046522 | Bacteria | 2359 |
| 604 | Ga0495644_0001496 | 3300046523 | Bacteria | 9525 |
| 605 | Ga0495644_0006676 | 3300046523 | Bacteria | 4470 |
| 606 | Ga0495644_0007533 | 3300046523 | Bacteria | 4196 |
| 607 | Ga0495644_0009890 | 3300046523 | Bacteria | 3672 |
| 608 | Ga0495644_0039613 | 3300046523 | Bacteria | 1776 |
| 609 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 610 | Ga0495648_0002540 | 3300046524 | Bacteria | 16736 |
| 611 | Ga0495648_0002834 | 3300046524 | Bacteria | 15603 |
| 612 | Ga0495648_0004137 | 3300046524 | Bacteria | 12482 |
| 613 | Ga0495648_0010857 | 3300046524 | Bacteria | 6912 |
| 614 | Ga0495648_0018998 | 3300046524 | Bacteria | 4847 |
| 615 | Ga0495648_0019039 | 3300046524 | Bacteria | 4841 |
| 616 | Ga0495648_0033894 | 3300046524 | Bacteria | 3330 |
| 617 | Ga0495648_0044272 | 3300046524 | Bacteria | 2780 |
| 618 | Ga0495648_0058698 | 3300046524 | Bacteria | 2299 |
| 619 | Ga0495648_0103908 | 3300046524 | Bacteria | 1561 |
| 620 | Ga0495648_0124694 | 3300046524 | Bacteria | 1378 |
| 621 | Ga0495663_0004849 | 3300046525 | Bacteria | 3759 |
| 622 | Ga0495642_0000741 | 3300046528 | Bacteria | 16179 |
| 623 | Ga0495642_0001464 | 3300046528 | Bacteria | 10572 |
| 624 | Ga0495642_0007631 | 3300046528 | Bacteria | 4147 |
| 625 | Ga0495642_0013970 | 3300046528 | Bacteria | 3110 |
| 626 | Ga0495642_0015415 | 3300046528 | Bacteria | 2971 |
| 627 | Ga0495642_0023321 | 3300046528 | Bacteria | 2442 |
| 628 | Ga0495652_0012068 | 3300046529 | Bacteria | 7808 |
| 629 | Ga0495652_0040085 | 3300046529 | Bacteria | 4048 |
| 630 | Ga0495652_0113750 | 3300046529 | Bacteria | 2172 |
| 631 | Ga0495654_0000038 | 3300046530 | Bacteria | 185693 |
| 632 | Ga0495654_0070510 | 3300046530 | Bacteria | 1657 |
| 633 | Ga0495654_0097181 | 3300046530 | Bacteria | 1360 |
| 634 | Ga0495654_0131186 | 3300046530 | Bacteria | 1125 |
| 635 | Ga0495665_0019053 | 3300046531 | Bacteria | 3688 |
| 636 | Ga0495665_0026571 | 3300046531 | Bacteria | 3109 |
| 637 | Ga0495640_0208183 | 3300046533 | Bacteria | 1237 |
| 638 | Ga0495586_0032100 | 3300046535 | Bacteria | 2815 |
| 639 | Ga0495586_0123732 | 3300046535 | Bacteria | 1445 |
| 640 | Ga0495587_0235306 | 3300046536 | Bacteria | 1031 |
| 641 | Ga0495609_0000009 | 3300046538 | Bacteria | 354860 |
| 642 | Ga0495609_0000479 | 3300046538 | Bacteria | 32080 |
| 643 | Ga0495609_0002949 | 3300046538 | Bacteria | 10058 |
| 644 | Ga0495609_0003102 | 3300046538 | Bacteria | 9742 |
| 645 | Ga0495609_0006657 | 3300046538 | Bacteria | 5864 |
| 646 | Ga0495609_0018010 | 3300046538 | Bacteria | 3276 |
| 647 | Ga0495609_0020796 | 3300046538 | Bacteria | 3029 |
| 648 | Ga0495609_0029171 | 3300046538 | Bacteria | 2513 |
| 649 | Ga0495609_0116195 | 3300046538 | Bacteria | 1152 |
| 650 | Ga0495597_0000110 | 3300046542 | Bacteria | 72678 |
| 651 | Ga0495597_0002311 | 3300046542 | Bacteria | 12366 |
| 652 | Ga0495597_0003097 | 3300046542 | Bacteria | 10004 |
| 653 | Ga0495597_0004138 | 3300046542 | Bacteria | 8064 |
| 654 | Ga0495597_0007611 | 3300046542 | Bacteria | 5483 |
| 655 | Ga0495597_0010421 | 3300046542 | Bacteria | 4546 |
| 656 | Ga0495597_0014117 | 3300046542 | Bacteria | 3808 |
| 657 | Ga0495597_0018479 | 3300046542 | Bacteria | 3272 |
| 658 | Ga0495597_0026802 | 3300046542 | Bacteria | 2646 |
| 659 | Ga0495645_0014686 | 3300046543 | Bacteria | 5560 |
| 660 | Ga0495645_0027376 | 3300046543 | Bacteria | 4142 |
| 661 | Ga0495622_0000028 | 3300046557 | Bacteria | 133197 |
| 662 | Ga0495622_0003561 | 3300046557 | Bacteria | 7318 |
| 663 | Ga0495622_0038097 | 3300046557 | Bacteria | 2238 |
| 664 | Ga0495633_0000272 | 3300046558 | Bacteria | 60512 |
| 665 | Ga0495633_0002858 | 3300046558 | Bacteria | 11858 |
| 666 | Ga0495633_0003780 | 3300046558 | Bacteria | 9929 |
| 667 | Ga0495633_0004683 | 3300046558 | Bacteria | 8607 |
| 668 | Ga0495633_0006086 | 3300046558 | Bacteria | 7228 |
| 669 | Ga0495633_0011002 | 3300046558 | Bacteria | 4911 |
| 670 | Ga0495633_0015072 | 3300046558 | Bacteria | 4018 |
| 671 | Ga0495633_0026986 | 3300046558 | Bacteria | 2811 |
| 672 | Ga0495633_0034003 | 3300046558 | Bacteria | 2453 |
| 673 | Ga0495633_0115253 | 3300046558 | Bacteria | 1245 |
| 674 | Ga0495656_0003881 | 3300046615 | Bacteria | 5084 |
| 675 | Ga0495656_0053355 | 3300046615 | Bacteria | 1737 |
| 676 | Ga0495668_0000093 | 3300046616 | Bacteria | 142565 |
| 677 | Ga0495668_0000095 | 3300046616 | Bacteria | 141321 |
| 678 | Ga0495668_0000151 | 3300046616 | Bacteria | 105466 |
| 679 | Ga0495668_0001575 | 3300046616 | Bacteria | 21547 |
| 680 | Ga0495668_0003639 | 3300046616 | Bacteria | 11407 |
| 681 | Ga0495668_0015431 | 3300046616 | Bacteria | 4461 |
| 682 | Ga0495668_0016287 | 3300046616 | Bacteria | 4320 |
| 683 | Ga0495668_0025820 | 3300046616 | Bacteria | 3336 |
| 684 | Ga0495668_0030438 | 3300046616 | Bacteria | 3047 |
| 685 | Ga0495668_0030940 | 3300046616 | Bacteria | 3017 |
| 686 | Ga0495668_0091938 | 3300046616 | Bacteria | 1662 |
| 687 | Ga0495668_0129139 | 3300046616 | Bacteria | 1383 |
| 688 | Ga0495634_0048273 | 3300046642 | Bacteria | 2866 |
| 689 | Ga0495634_0199937 | 3300046642 | Bacteria | 1242 |
| 690 | Ga0495611_0000499 | 3300046648 | Bacteria | 23354 |
| 691 | Ga0495611_0002457 | 3300046648 | Bacteria | 8460 |
| 692 | Ga0495611_0011597 | 3300046648 | Bacteria | 3738 |
| 693 | Ga0495611_0023585 | 3300046648 | Bacteria | 2671 |
| 694 | Ga0495611_0026413 | 3300046648 | Bacteria | 2533 |
| 695 | Ga0495611_0085172 | 3300046648 | Bacteria | 1457 |
| 696 | Ga0495625_0001679 | 3300046660 | Bacteria | 25832 |
| 697 | Ga0495625_0004300 | 3300046660 | Bacteria | 13548 |
| 698 | Ga0495625_0007018 | 3300046660 | Bacteria | 9917 |
| 699 | Ga0495625_0010387 | 3300046660 | Bacteria | 7709 |
| 700 | Ga0495625_0017150 | 3300046660 | Bacteria | 5673 |
| 701 | Ga0495625_0026781 | 3300046660 | Bacteria | 4349 |
| 702 | Ga0495625_0050235 | 3300046660 | Bacteria | 2993 |
| 703 | Ga0495625_0057067 | 3300046660 | Bacteria | 2778 |
| 704 | Ga0495625_0066343 | 3300046660 | Bacteria | 2542 |
| 705 | Ga0495625_0068572 | 3300046660 | Bacteria | 2493 |
| 706 | Ga0495635_0002454 | 3300046663 | Bacteria | 12659 |
| 707 | Ga0495635_0057076 | 3300046663 | Bacteria | 2687 |
| 708 | Ga0495659_0000284 | 3300046664 | Bacteria | 20570 |
| 709 | Ga0495659_0004469 | 3300046664 | Bacteria | 4405 |
| 710 | Ga0495659_0007199 | 3300046664 | Bacteria | 3523 |
| 711 | Ga0495659_0034594 | 3300046664 | Bacteria | 1777 |
| 712 | Ga0495661_0001929 | 3300046665 | Bacteria | 16505 |
| 713 | Ga0495661_0007429 | 3300046665 | Bacteria | 7642 |
| 714 | Ga0495661_0008112 | 3300046665 | Bacteria | 7280 |
| 715 | Ga0495661_0012238 | 3300046665 | Bacteria | 5795 |
| 716 | Ga0495661_0013191 | 3300046665 | Bacteria | 5556 |
| 717 | Ga0495661_0014739 | 3300046665 | Bacteria | 5233 |
| 718 | Ga0495661_0017969 | 3300046665 | Bacteria | 4660 |
| 719 | Ga0495661_0027110 | 3300046665 | Bacteria | 3680 |
| 720 | Ga0495661_0035807 | 3300046665 | Bacteria | 3112 |
| 721 | Ga0495661_0042600 | 3300046665 | Bacteria | 2797 |
| 722 | Ga0495661_0049481 | 3300046665 | Bacteria | 2548 |
| 723 | Ga0495661_0058954 | 3300046665 | Bacteria | 2286 |
| 724 | Ga0495661_0076618 | 3300046665 | Bacteria | 1939 |
| 725 | Ga0495661_0079739 | 3300046665 | Bacteria | 1891 |
| 726 | Ga0495661_0094786 | 3300046665 | Bacteria | 1691 |
| 727 | Ga0495588_0000077 | 3300046674 | Bacteria | 215338 |
| 728 | Ga0495588_0010399 | 3300046674 | Bacteria | 4328 |
| 729 | Ga0495588_0011557 | 3300046674 | Bacteria | 4146 |
| 730 | Ga0495588_0031167 | 3300046674 | Bacteria | 2682 |
| 731 | Ga0495588_0032950 | 3300046674 | Bacteria | 2614 |
| 732 | Ga0495588_0050863 | 3300046674 | Bacteria | 2132 |
| 733 | Ga0495657_0073728 | 3300046675 | Bacteria | 2222 |
| 734 | Ga0495599_0004944 | 3300046678 | Bacteria | 7925 |
| 735 | Ga0495623_0011364 | 3300046679 | Bacteria | 5760 |
| 736 | Ga0495623_0012790 | 3300046679 | Bacteria | 5434 |
| 737 | Ga0495623_0043008 | 3300046679 | Bacteria | 2875 |
| 738 | Ga0495646_0012052 | 3300046680 | Bacteria | 5499 |
| 739 | Ga0495669_0000116 | 3300046684 | Bacteria | 51756 |
| 740 | Ga0495669_0006988 | 3300046684 | Bacteria | 4726 |
| 741 | Ga0495669_0007431 | 3300046684 | Bacteria | 4595 |
| 742 | Ga0495669_0008000 | 3300046684 | Bacteria | 4437 |
| 743 | Ga0495669_0011905 | 3300046684 | Bacteria | 3699 |
| 744 | Ga0495669_0023781 | 3300046684 | Bacteria | 2669 |
| 745 | Ga0495669_0056974 | 3300046684 | Bacteria | 1762 |
| 746 | Ga0495624_0034960 | 3300046690 | Bacteria | 3247 |
| 747 | Ga0495670_0003774 | 3300046691 | Bacteria | 7444 |
| 748 | Ga0495670_0005019 | 3300046691 | Bacteria | 6507 |
| 749 | Ga0495670_0050660 | 3300046691 | Bacteria | 2078 |
| 750 | Ga0495670_0053626 | 3300046691 | Bacteria | 2019 |
| 751 | Ga0495670_0056910 | 3300046691 | Bacteria | 1962 |
| 752 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 753 | Ga0495671_0000108 | 3300046692 | Bacteria | 74169 |
| 754 | Ga0495671_0002689 | 3300046692 | Bacteria | 11143 |
| 755 | Ga0495671_0034330 | 3300046692 | Bacteria | 2579 |
| 756 | Ga0495671_0140335 | 3300046692 | Bacteria | 1177 |
| 757 | Ga0495649_0003311 | 3300046694 | Bacteria | 10948 |
| 758 | Ga0495649_0011717 | 3300046694 | Bacteria | 5131 |
| 759 | Ga0495649_0017148 | 3300046694 | Bacteria | 4091 |
| 760 | Ga0495649_0077418 | 3300046694 | Bacteria | 1780 |
| 761 | Ga0495649_0091022 | 3300046694 | Bacteria | 1626 |
| 762 | Ga0495589_0001060 | 3300046794 | Bacteria | 16526 |
| 763 | Ga0495589_0003670 | 3300046794 | Bacteria | 8295 |
| 764 | Ga0495589_0007613 | 3300046794 | Bacteria | 5673 |
| 765 | Ga0495589_0013208 | 3300046794 | Bacteria | 4261 |
| 766 | Ga0495589_0017044 | 3300046794 | Bacteria | 3730 |
| 767 | Ga0495589_0019655 | 3300046794 | Bacteria | 3458 |
| 768 | Ga0495589_0038105 | 3300046794 | Bacteria | 2407 |
| 769 | Ga0495589_0060621 | 3300046794 | Bacteria | 1858 |
| 770 | Ga0495589_0072619 | 3300046794 | Bacteria | 1680 |
| 771 | Ga0495589_0100291 | 3300046794 | Bacteria | 1401 |
| 772 | Ga0495600_0001876 | 3300046809 | Bacteria | 11795 |
| 773 | Ga0495660_0000178 | 3300046810 | Bacteria | 68956 |
| 774 | Ga0495660_0000705 | 3300046810 | Bacteria | 25643 |
| 775 | Ga0495660_0003426 | 3300046810 | Bacteria | 9818 |
| 776 | Ga0495660_0005173 | 3300046810 | Bacteria | 7833 |
| 777 | Ga0495660_0014659 | 3300046810 | Bacteria | 4533 |
| 778 | Ga0495660_0020825 | 3300046810 | Bacteria | 3759 |
| 779 | Ga0495604_0027131 | 3300047317 | Bacteria | 4556 |
| 780 | Ga0495604_0177628 | 3300047317 | Bacteria | 1491 |
| 781 | Ga0495636_0003600 | 3300047318 | Bacteria | 6007 |
| 782 | Ga0495636_0020049 | 3300047318 | Bacteria | 2692 |
| 783 | Ga0495636_0033912 | 3300047318 | Bacteria | 2099 |
| 784 | Ga0495636_0079592 | 3300047318 | Bacteria | 1409 |
| 785 | Ga0495674_0019748 | 3300047319 | Bacteria | 6249 |
| 786 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 787 | Ga0495672_0000181 | 3300047320 | Bacteria | 91278 |
| 788 | Ga0495672_0000366 | 3300047320 | Bacteria | 57469 |
| 789 | Ga0495672_0000381 | 3300047320 | Bacteria | 54971 |
| 790 | Ga0495672_0001623 | 3300047320 | Bacteria | 21897 |
| 791 | Ga0495672_0009440 | 3300047320 | Bacteria | 7068 |
| 792 | Ga0495672_0010123 | 3300047320 | Bacteria | 6744 |
| 793 | Ga0495672_0072440 | 3300047320 | Bacteria | 1946 |
| 794 | Ga0495676_0000121 | 3300047321 | Bacteria | 59949 |
| 795 | Ga0495676_0115733 | 3300047321 | Bacteria | 1960 |
| 796 | Ga0495680_0043864 | 3300047322 | Bacteria | 3538 |
| 797 | Ga0495680_0132495 | 3300047322 | Bacteria | 1830 |
| 798 | Ga0495683_0001151 | 3300047323 | Bacteria | 18144 |
| 799 | Ga0495683_0011839 | 3300047323 | Bacteria | 4586 |
| 800 | Ga0495683_0012145 | 3300047323 | Bacteria | 4526 |
| 801 | Ga0495683_0020827 | 3300047323 | Bacteria | 3380 |
| 802 | Ga0495683_0036976 | 3300047323 | Bacteria | 2477 |
| 803 | Ga0495683_0053793 | 3300047323 | Bacteria | 2007 |
| 804 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 805 | Ga0495687_000017 | 3300047443 | Bacteria | 350429 |
| 806 | Ga0495687_000024 | 3300047443 | Bacteria | 316676 |
| 807 | Ga0495687_000458 | 3300047443 | Bacteria | 49855 |
| 808 | Ga0495687_006587 | 3300047443 | Bacteria | 7071 |
| 809 | Ga0495687_013931 | 3300047443 | Bacteria | 4166 |
| 810 | Ga0495687_014022 | 3300047443 | Bacteria | 4147 |
| 811 | Ga0495687_029982 | 3300047443 | Bacteria | 2510 |
| 812 | Ga0495675_0016790 | 3300047444 | Bacteria | 4629 |
| 813 | Ga0495675_0086847 | 3300047444 | Bacteria | 1966 |
| 814 | Ga0495675_0097755 | 3300047444 | Bacteria | 1839 |
| 815 | Ga0495675_0163034 | 3300047444 | Bacteria | 1372 |
| 816 | Ga0495677_0000117 | 3300047445 | Bacteria | 38586 |
| 817 | Ga0495677_0001384 | 3300047445 | Bacteria | 9699 |
| 818 | Ga0495677_0002355 | 3300047445 | Bacteria | 7419 |
| 819 | Ga0495677_0003340 | 3300047445 | Bacteria | 6242 |
| 820 | Ga0495677_0005223 | 3300047445 | Bacteria | 4938 |
| 821 | Ga0495677_0008846 | 3300047445 | Bacteria | 3729 |
| 822 | Ga0495677_0010361 | 3300047445 | Bacteria | 3425 |
| 823 | Ga0495677_0016878 | 3300047445 | Bacteria | 2647 |
| 824 | Ga0495677_0029010 | 3300047445 | Bacteria | 2011 |
| 825 | Ga0495679_013040 | 3300047446 | Bacteria | 3136 |
| 826 | Ga0495679_015572 | 3300047446 | Bacteria | 2777 |
| 827 | Ga0495685_000012 | 3300047447 | Bacteria | 80496 |
| 828 | Ga0495685_004997 | 3300047447 | Bacteria | 4313 |
| 829 | Ga0495685_009848 | 3300047447 | Bacteria | 3198 |
| 830 | Ga0495685_011775 | 3300047447 | Bacteria | 2957 |
| 831 | Ga0495685_026424 | 3300047447 | Bacteria | 1997 |
| 832 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 833 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 834 | Ga0495673_0000188 | 3300047469 | Bacteria | 99425 |
| 835 | Ga0495673_0023555 | 3300047469 | Bacteria | 2992 |
| 836 | Ga0495673_0050101 | 3300047469 | Bacteria | 1835 |
| 837 | Ga0495681_0000994 | 3300047470 | Bacteria | 21702 |
| 838 | Ga0495681_0004664 | 3300047470 | Bacteria | 9291 |
| 839 | Ga0495681_0012084 | 3300047470 | Bacteria | 5090 |
| 840 | Ga0495681_0014560 | 3300047470 | Bacteria | 4497 |
| 841 | Ga0495681_0023578 | 3300047470 | Bacteria | 3265 |
| 842 | Ga0495681_0031523 | 3300047470 | Bacteria | 2681 |
| 843 | Ga0495681_0031695 | 3300047470 | Bacteria | 2671 |
| 844 | Ga0495681_0054057 | 3300047470 | Bacteria | 1878 |
| 845 | Ga0495681_0057162 | 3300047470 | Bacteria | 1812 |
| 846 | Ga0495686_0000032 | 3300047472 | Bacteria | 345132 |
| 847 | Ga0495686_0000380 | 3300047472 | Bacteria | 71038 |
| 848 | Ga0495686_0000591 | 3300047472 | Bacteria | 50934 |
| 849 | Ga0495686_0001614 | 3300047472 | Bacteria | 23675 |
| 850 | Ga0495686_0002052 | 3300047472 | Bacteria | 19845 |
| 851 | Ga0495686_0013728 | 3300047472 | Bacteria | 5612 |
| 852 | Ga0495686_0092149 | 3300047472 | Bacteria | 1838 |
| 853 | Ga0495602_0077771 | 3300048088 | Bacteria | 2805 |
| 854 | Ga0495602_0291844 | 3300048088 | Bacteria | 1197 |
| 855 | Ga0495614_0004132 | 3300048089 | Bacteria | 6536 |
| 856 | Ga0495615_0003367 | 3300048090 | Bacteria | 2671 |
| 857 | Ga0495615_0015588 | 3300048090 | Bacteria | 1626 |
| 858 | Ga0495626_0000004 | 3300048091 | Bacteria | 356599 |
| 859 | Ga0495626_0000016 | 3300048091 | Bacteria | 232214 |
| 860 | Ga0495626_0000693 | 3300048091 | Bacteria | 32187 |
| 861 | Ga0495626_0004909 | 3300048091 | Bacteria | 8035 |
| 862 | Ga0495626_0016810 | 3300048091 | Bacteria | 3708 |
| 863 | Ga0495626_0029793 | 3300048091 | Bacteria | 2637 |
| 864 | Ga0495626_0030305 | 3300048091 | Bacteria | 2609 |
| 865 | Ga0495626_0035415 | 3300048091 | Bacteria | 2382 |
| 866 | Ga0495626_0038734 | 3300048091 | Bacteria | 2258 |
| 867 | Ga0495626_0054614 | 3300048091 | Bacteria | 1833 |
| 868 | Ga0496100_0001564 | 3300048903 | Bacteria | 11251 |
| 869 | Ga0496100_0035012 | 3300048903 | Bacteria | 3156 |
| 870 | Ga0496100_0085040 | 3300048903 | Bacteria | 2146 |
| 871 | Ga0496100_0103952 | 3300048903 | Bacteria | 1962 |
| 872 | Ga0496100_0140327 | 3300048903 | Bacteria | 1712 |
| 873 | Ga0496101_0004610 | 3300048904 | Bacteria | 8706 |
| 874 | Ga0496102_0000340 | 3300048905 | Bacteria | 57233 |
| 875 | Ga0496102_0000477 | 3300048905 | Bacteria | 44404 |
| 876 | Ga0496102_0008702 | 3300048905 | Bacteria | 8712 |
| 877 | Ga0496102_0033722 | 3300048905 | Bacteria | 4603 |
| 878 | Ga0496102_0068030 | 3300048905 | Bacteria | 3267 |
| 879 | Ga0496102_0180819 | 3300048905 | Bacteria | 1987 |
| 880 | Ga0496103_0009410 | 3300048906 | Bacteria | 5789 |
| 881 | Ga0496103_0088948 | 3300048906 | Bacteria | 1947 |
| 882 | Ga0496103_0209725 | 3300048906 | Bacteria | 1253 |
| 883 | Ga0496104_0128977 | 3300048907 | Bacteria | 2429 |
| 884 | Ga0496105_0157903 | 3300048908 | Bacteria | 1862 |
| 885 | Ga0496106_0085445 | 3300048909 | Bacteria | 2429 |
| 886 | Ga0496107_0034773 | 3300048910 | Bacteria | 3611 |
| 887 | Ga0496107_0138725 | 3300048910 | Bacteria | 1797 |
| 888 | Ga0496108_0034687 | 3300048911 | Bacteria | 4191 |
| 889 | Ga0496109_0005210 | 3300048912 | Bacteria | 10861 |
| 890 | Ga0496109_0022441 | 3300048912 | Bacteria | 5590 |
| 891 | Ga0496109_0122656 | 3300048912 | Bacteria | 2421 |
| 892 | Ga0496110_0003516 | 3300048913 | Bacteria | 12023 |
| 893 | Ga0496110_0004929 | 3300048913 | Bacteria | 10425 |
| 894 | Ga0496110_0005432 | 3300048913 | Bacteria | 9995 |
| 895 | Ga0496110_0387250 | 3300048913 | Bacteria | 1274 |
| 896 | Ga0496111_0021552 | 3300048914 | Bacteria | 4502 |
| 897 | Ga0496112_0016052 | 3300048915 | Bacteria | 7003 |
| 898 | Ga0496113_0023519 | 3300048916 | Bacteria | 4369 |
| 899 | Ga0496113_0036051 | 3300048916 | Bacteria | 3622 |
| 900 | Ga0496116_0007137 | 3300048919 | Bacteria | 9993 |
| 901 | Ga0496116_0032514 | 3300048919 | Bacteria | 3717 |
| 902 | Ga0496116_0037251 | 3300048919 | Bacteria | 3394 |
| 903 | Ga0496116_0052261 | 3300048919 | Bacteria | 2708 |
| 904 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 905 | Ga0496117_0024619 | 3300048920 | Bacteria | 4754 |
| 906 | Ga0496117_0078292 | 3300048920 | Bacteria | 2183 |
| 907 | Ga0496117_0105751 | 3300048920 | Bacteria | 1768 |
| 908 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 909 | Ga0496118_0017381 | 3300048921 | Bacteria | 6548 |
| 910 | Ga0496118_0037074 | 3300048921 | Bacteria | 3930 |
| 911 | Ga0496118_0094970 | 3300048921 | Bacteria | 2037 |
| 912 | Ga0496118_0103492 | 3300048921 | Bacteria | 1915 |
| 913 | Ga0496119_0008234 | 3300048922 | Bacteria | 9214 |
| 914 | Ga0496119_0120723 | 3300048922 | Bacteria | 1441 |
| 915 | Ga0496120_0006959 | 3300048923 | Bacteria | 8524 |
| 916 | Ga0496121_0000306 | 3300048924 | Bacteria | 102245 |
| 917 | Ga0496121_0004537 | 3300048924 | Bacteria | 18576 |
| 918 | Ga0496121_0023095 | 3300048924 | Bacteria | 6004 |
| 919 | Ga0496121_0032659 | 3300048924 | Bacteria | 4727 |
| 920 | Ga0496121_0043305 | 3300048924 | Bacteria | 3900 |
| 921 | Ga0496121_0046034 | 3300048924 | Bacteria | 3739 |
| 922 | Ga0496121_0048456 | 3300048924 | Bacteria | 3614 |
| 923 | Ga0496121_0150077 | 3300048924 | Bacteria | 1716 |
| 924 | Ga0496122_0000455 | 3300048925 | Bacteria | 85041 |
| 925 | Ga0496122_0000644 | 3300048925 | Bacteria | 70937 |
| 926 | Ga0496122_0004387 | 3300048925 | Bacteria | 17565 |
| 927 | Ga0496122_0009237 | 3300048925 | Bacteria | 10432 |
| 928 | Ga0496122_0009551 | 3300048925 | Bacteria | 10188 |
| 929 | Ga0496122_0034717 | 3300048925 | Bacteria | 4120 |
| 930 | Ga0496122_0077420 | 3300048925 | Bacteria | 2335 |
| 931 | Ga0496122_0157694 | 3300048925 | Bacteria | 1389 |
| 932 | Ga0496122_0177464 | 3300048925 | Bacteria | 1275 |
| 933 | Ga0496123_0000197 | 3300048926 | Bacteria | 122784 |
| 934 | Ga0496123_0000203 | 3300048926 | Bacteria | 121361 |
| 935 | Ga0496123_0003912 | 3300048926 | Bacteria | 16190 |
| 936 | Ga0496123_0013893 | 3300048926 | Bacteria | 6710 |
| 937 | Ga0496123_0017730 | 3300048926 | Bacteria | 5710 |
| 938 | Ga0496123_0026217 | 3300048926 | Bacteria | 4373 |
| 939 | Ga0496123_0042315 | 3300048926 | Bacteria | 3145 |
| 940 | Ga0496123_0164006 | 3300048926 | Bacteria | 1181 |
| 941 | Ga0496124_0000046 | 3300048927 | Bacteria | 287043 |
| 942 | Ga0496124_0009308 | 3300048927 | Bacteria | 10124 |
| 943 | Ga0496124_0035599 | 3300048927 | Bacteria | 4354 |
| 944 | Ga0496124_0051693 | 3300048927 | Bacteria | 3494 |
| 945 | Ga0496124_0056406 | 3300048927 | Bacteria | 3313 |
| 946 | Ga0496124_0124435 | 3300048927 | Bacteria | 2056 |
| 947 | Ga0496124_0151412 | 3300048927 | Bacteria | 1819 |
| 948 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 949 | Ga0496125_0000983 | 3300048928 | Bacteria | 44536 |
| 950 | Ga0496125_0001069 | 3300048928 | Bacteria | 42296 |
| 951 | Ga0496125_0018029 | 3300048928 | Bacteria | 6710 |
| 952 | Ga0496125_0022845 | 3300048928 | Bacteria | 5795 |
| 953 | Ga0496125_0027105 | 3300048928 | Bacteria | 5201 |
| 954 | Ga0496125_0035345 | 3300048928 | Bacteria | 4385 |
| 955 | Ga0496125_0077000 | 3300048928 | Bacteria | 2573 |
| 956 | Ga0496126_0000034 | 3300048929 | Bacteria | 362440 |
| 957 | Ga0496126_0006564 | 3300048929 | Bacteria | 12959 |
| 958 | Ga0496126_0038550 | 3300048929 | Bacteria | 4445 |
| 959 | Ga0496126_0055812 | 3300048929 | Bacteria | 3572 |
| 960 | Ga0496126_0263737 | 3300048929 | Bacteria | 1432 |
| 961 | Ga0501308_000102 | 3300049128 | Bacteria | 3985 |
| 962 | Ga0501310_000345 | 3300049130 | Bacteria | 4223 |
| 963 | Ga0501310_003722 | 3300049130 | Bacteria | 1501 |
| 964 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 965 | Ga0495678_000275 | 3300049459 | Bacteria | 56673 |
| 966 | Ga0495678_000746 | 3300049459 | Bacteria | 29508 |
| 967 | Ga0495678_001983 | 3300049459 | Bacteria | 14748 |
| 968 | Ga0495678_002319 | 3300049459 | Bacteria | 13113 |
| 969 | Ga0495678_003043 | 3300049459 | Bacteria | 10657 |
| 970 | Ga0495678_004447 | 3300049459 | Bacteria | 8101 |
| 971 | Ga0495678_004779 | 3300049459 | Bacteria | 7715 |
| 972 | Ga0495678_014319 | 3300049459 | Bacteria | 3691 |
| 973 | Ga0495678_024380 | 3300049459 | Bacteria | 2612 |
| 974 | Ga0495682_0002099 | 3300049460 | Bacteria | 9711 |
| 975 | Ga0495682_0010088 | 3300049460 | Bacteria | 3667 |
| 976 | Ga0495682_0019757 | 3300049460 | Bacteria | 2531 |
| 977 | Ga0495682_0027473 | 3300049460 | Bacteria | 2110 |
| 978 | Ga0501031_0003738 | 3300049568 | Bacteria | 9794 |
| 979 | Ga0501032_0018637 | 3300049569 | Bacteria | 4859 |
| 980 | Ga0501033_0003665 | 3300049570 | Bacteria | 12525 |
| 981 | Ga0501033_0034503 | 3300049570 | Bacteria | 3794 |
| 982 | Ga0501033_0061751 | 3300049570 | Bacteria | 2761 |
| 983 | Ga0501033_0112304 | 3300049570 | Bacteria | 1982 |
| 984 | Ga0501034_0032914 | 3300049571 | Bacteria | 5264 |
| 985 | Ga0501034_0140107 | 3300049571 | Bacteria | 2398 |
| 986 | Ga0501037_0016812 | 3300049573 | Bacteria | 5382 |
| 987 | Ga0501037_0042579 | 3300049573 | Bacteria | 3336 |
| 988 | Ga0501037_0141383 | 3300049573 | Bacteria | 1722 |
| 989 | Ga0501038_0012706 | 3300049574 | Bacteria | 7694 |
| 990 | Ga0501038_0252694 | 3300049574 | Bacteria | 1396 |
| 991 | Ga0501039_0051432 | 3300049575 | Bacteria | 3188 |
| 992 | Ga0501039_0243526 | 3300049575 | Bacteria | 1414 |
| 993 | Ga0501043_0011390 | 3300049579 | Bacteria | 6961 |
| 994 | Ga0501043_0023603 | 3300049579 | Bacteria | 4824 |
| 995 | Ga0501046_0006547 | 3300049580 | Bacteria | 10300 |
| 996 | Ga0501046_0094005 | 3300049580 | Bacteria | 2304 |
| 997 | Ga0501047_0005230 | 3300049581 | Bacteria | 12182 |
| 998 | Ga0501047_0017738 | 3300049581 | Bacteria | 6819 |
| 999 | Ga0501227_003069 | 3300049665 | Bacteria | 3637 |
| 1000 | Ga0501249_004078 | 3300049679 | Bacteria | 2955 |
| 1001 | Ga0501269_000561 | 3300049766 | Bacteria | 7021 |
| 1002 | Ga0501035_0002186 | 3300049822 | Bacteria | 19407 |
| 1003 | Ga0501035_0003294 | 3300049822 | Bacteria | 15480 |
| 1004 | Ga0501035_0004380 | 3300049822 | Bacteria | 13405 |
| 1005 | Ga0501035_0015998 | 3300049822 | Bacteria | 6922 |
| 1006 | Ga0501044_0001185 | 3300049823 | Bacteria | 30889 |
| 1007 | Ga0501044_0002640 | 3300049823 | Bacteria | 20395 |
| 1008 | Ga0501044_0028040 | 3300049823 | Bacteria | 5942 |
| 1009 | Ga0501044_0087887 | 3300049823 | Bacteria | 3138 |
| 1010 | nmdc:mga00v17_3752_c2 | 3300050491 | Bacteria | 5018 |
| 1011 | nmdc:mga07m45_140377_c1 | 3300050496 | Bacteria | 1399 |
| 1012 | Ga0495601_0003048 | 3300053077 | Bacteria | 9551 |
| 1013 | Ga0500594_0011549 | 3300053118 | Bacteria | 2063 |
| 1014 | Ga0500595_004677 | 3300053119 | Bacteria | 6085 |
| 1015 | Ga0500618_000089 | 3300053125 | Bacteria | 74800 |
| 1016 | Ga0500618_000670 | 3300053125 | Bacteria | 20129 |
| 1017 | Ga0500618_000710 | 3300053125 | Bacteria | 19287 |
| 1018 | Ga0500586_001257 | 3300053145 | Bacteria | 5315 |
| 1019 | Ga0500600_0007675 | 3300053149 | Bacteria | 6495 |
| 1020 | Ga0500619_000505 | 3300053154 | Bacteria | 6771 |
| 1021 | Ga0500637_0104059 | 3300053178 | Bacteria | 1646 |
| 1022 | Ga0587077_002659 | 3300059493 | Bacteria | 2150 |
| 1023 | Ga0587080_003961 | 3300059503 | Bacteria | 1888 |
| 1024 | Ga0587088_003034 | 3300059508 | Bacteria | 1986 |
| 1025 | Ga0587090_008830 | 3300059510 | Bacteria | 1362 |
| 1026 | Ga0587101_007126 | 3300059623 | Bacteria | 1310 |
| 1027 | Ga0587067_000055 | 3300059640 | Bacteria | 6355 |
| 1028 | Ga0587068_004141 | 3300059641 | Bacteria | 1902 |
| 1029 | Ga0587068_004557 | 3300059641 | Bacteria | 1840 |
| 1030 | Ga0587072_000318 | 3300059643 | Bacteria | 4543 |
| 1031 | Ga0587076_010792 | 3300059645 | Bacteria | 1328 |
| 1032 | Ga0587079_002440 | 3300059647 | Bacteria | 2273 |
| 1033 | Ga0587079_009610 | 3300059647 | Bacteria | 1510 |
| 1034 | 2501073321 | 2501025501 | Bacteria | 7768574 |
| 1035 | 2501408423 | 2501025504 | Bacteria | 8008976 |
| 1036 | 2511096158 | 2510917014 | Bacteria | 8296963 |
| 1037 | 2511103119 | 2510917015 | Bacteria | 7950052 |
| 1038 | 2511250641 | 2511231003 | Bacteria | 5606035 |
| 1039 | 2511384949 | 2511231026 | Bacteria | 5225445 |
| 1040 | 2516022417 | 2515154189 | Bacteria | 9629850 |
| 1041 | 2519458258 | 2519103095 | Bacteria | 6629912 |
| 1042 | 2521557887 | 2521172590 | Bacteria | 5047645 |
| 1043 | 2550693926 | 2548876994 | Bacteria | 4904866 |
| 1044 | 2553003010 | 2551306416 | Bacteria | 6152985 |
| 1045 | 2585294690 | 2582581311 | Bacteria | 6763856 |
| 1046 | 2597028853 | 2596583598 | Bacteria | 5251611 |
| 1047 | 2599445541 | 2599185178 | Bacteria | 5365746 |
| 1048 | 2599738118 | 2599185239 | Bacteria | 8686614 |
| 1049 | 2599742510 | 2599185240 | Bacteria | 7968121 |
| 1050 | 2599903229 | 2599185292 | Bacteria | 6290804 |
| 1051 | 2600204628 | 2599185355 | Bacteria | 7968906 |
| 1052 | 2601667671 | 2600255292 | Bacteria | 6300551 |
| 1053 | 2643786925 | 2643221554 | Bacteria | 6603920 |
| 1054 | 2643802365 | 2643221556 | Bacteria | 7251154 |
| 1055 | 2643862279 | 2643221569 | Bacteria | 6064337 |
| 1056 | 2643980695 | 2643221594 | Bacteria | 5811388 |
| 1057 | 2644030669 | 2643221603 | Bacteria | 6147767 |
| 1058 | 2644122119 | 2643221621 | Bacteria | 6212786 |
| 1059 | 2644215986 | 2643221638 | Bacteria | 6579467 |
| 1060 | 2644254476 | 2643221645 | Bacteria | 7207331 |
| 1061 | 2644357859 | 2643221664 | Bacteria | 7272945 |
| 1062 | 2644475878 | 2643221684 | Bacteria | 7145183 |
| 1063 | 2676741614 | 2675903129 | Bacteria | 7964495 |
| 1064 | 2738741283 | 2738541280 | Bacteria | 6630198 |
| 1065 | 2738829176 | 2738541297 | Bacteria | 6549566 |
| 1066 | 2738845752 | 2738541300 | Bacteria | 6675882 |
| 1067 | 2739152972 | 2738541357 | Bacteria | 6549408 |
| 1068 | 2739194892 | 2738543003 | Bacteria | 6549560 |
| 1069 | 2739277560 | 2738543018 | Bacteria | 6718814 |
| 1070 | 2739321368 | 2738543026 | Bacteria | 6549408 |
| 1071 | 2739340076 | 2738543029 | Bacteria | 6549249 |
| 1072 | 2739346517 | 2738543030 | Bacteria | 6719714 |
| 1073 | 2739612191 | 2739367655 | Bacteria | 4051151 |
| 1074 | 2765569008 | 2765235838 | Bacteria | 5445269 |
| 1075 | 2808984484 | 2808606386 | Bacteria | 4471946 |
| 1076 | 2809031988 | 2808606395 | Bacteria | 6020352 |
| 1077 | 2809131211 | 2808606415 | Bacteria | 4576710 |
| 1078 | 2809145417 | 2808606418 | Bacteria | 6724496 |
| 1079 | 2809150454 | 2808606419 | Bacteria | 4576925 |
| 1080 | 2817260408 | 2816332253 | Bacteria | 6764532 |
| 1081 | 2817278096 | 2816332256 | Bacteria | 6891714 |
| 1082 | 2817455663 | 2816332286 | Bacteria | 6853759 |
| 1083 | 2819542544 | 2818991436 | Bacteria | 5376622 |
| 1084 | 2819591176 | 2818991445 | Bacteria | 4955017 |
| 1085 | 2819614972 | 2818991449 | Bacteria | 5518009 |
| 1086 | 2819632934 | 2818991452 | Bacteria | 8442785 |
| 1087 | 2821131624 | 2821131069 | Bacteria | 6108407 |
| 1088 | 2839096107 | 2839094727 | Bacteria | 5534556 |
| 1089 | 2842717742 | 2842711865 | Bacteria | 7155354 |
| 1090 | 2852621970 | 2852618963 | Bacteria | 4577824 |
| 1091 | 2855734598 | 2855730933 | Bacteria | 7047938 |
| 1092 | 2855770188 | 2855767633 | Bacteria | 7049357 |
| 1093 | 2856292749 | 2856287931 | Bacteria | 7223934 |
| 1094 | 2857360983 | 2857357740 | Bacteria | 9937880 |
| 1095 | 2857538471 | 2857537821 | Bacteria | 5248181 |
| 1096 | 2857546625 | 2857542790 | Bacteria | 5326616 |
| 1097 | 2857550302 | 2857547612 | Bacteria | 6179999 |
| 1098 | 2857554478 | 2857553236 | Bacteria | 6166726 |
| 1099 | 2857559443 | 2857558681 | Bacteria | 6617694 |
| 1100 | 2857564715 | 2857564685 | Bacteria | 6290584 |
| 1101 | 2858955739 | 2858950400 | Bacteria | 6783797 |
| 1102 | 2863421945 | 2863421361 | Bacteria | 7300805 |
| 1103 | 2870072113 | 2870068957 | Bacteria | 8925310 |
| 1104 | 2881414409 | 2881412998 | Bacteria | 6492157 |
| 1105 | 2881930290 | 2881927736 | Bacteria | 3993927 |
| 1106 | 2884812294 | 2884811622 | Bacteria | 5552861 |
| 1107 | 2884836901 | 2884836552 | Bacteria | 5219991 |
| 1108 | 2884853192 | 2884852848 | Bacteria | 5221161 |
| 1109 | 2885085394 | 2885080285 | Bacteria | 6355622 |
| 1110 | 2885266799 | 2885266251 | Bacteria | 4796748 |
| 1111 | 2887377889 | 2887375801 | Bacteria | 5334027 |
| 1112 | 2895516613 | 2895511927 | Bacteria | 6802080 |
| 1113 | 2896155690 | 2896154374 | Bacteria | 5221518 |
| 1114 | 2900578666 | 2900577576 | Bacteria | 5438534 |
| 1115 | 2904425973 | 2904424332 | Bacteria | 7633521 |
| 1116 | 2904441346 | 2904439833 | Bacteria | 5931679 |
| 1117 | 2904531714 | 2904530477 | Bacteria | 5876334 |
| 1118 | 2904566110 | 2904564687 | Bacteria | 7609577 |
| 1119 | 2904573154 | 2904571731 | Bacteria | 7608790 |
| 1120 | 2904588061 | 2904584206 | Bacteria | 6028872 |
| 1121 | 2904589779 | 2904589729 | Bacteria | 6113573 |
| 1122 | 2904602835 | 2904601388 | Bacteria | 5884906 |
| 1123 | 2919046350 | 2919046199 | Bacteria | 5567169 |
| 1124 | 2919079661 | 2919079590 | Bacteria | 5946433 |
| 1125 | 2919478418 | 2919476304 | Bacteria | 5888696 |
| 1126 | 2923511120 | 2923510766 | Bacteria | 5926163 |
| 1127 | 2928041924 | 2928037797 | Bacteria | 7273642 |
| 1128 | 2928049488 | 2928044640 | Bacteria | 7271509 |
| 1129 | 2928062875 | 2928058823 | Bacteria | 5520022 |
| 1130 | 2928131056 | 2928130867 | Bacteria | 5467269 |
| 1131 | 2928159474 | 2928157003 | Bacteria | 7522202 |
| 1132 | 2928164466 | 2928163908 | Bacteria | 7561269 |
| 1133 | 2928177550 | 2928170801 | Bacteria | 8785406 |
| 1134 | 2928538324 | 2928536128 | Bacteria | 7657547 |
| 1135 | 2932411276 | 2932410948 | Bacteria | 6312192 |
| 1136 | 2932419157 | 2932416698 | Bacteria | 6315112 |
| 1137 | 2941481929 | |||
| 1138 | 2981993908 | 2981990288 | Bacteria | 7590678 |
| 1139 | 642417212 | 641736154 | Bacteria | 7689995 |
| 1140 | 8002395009 | 8002392321 | Bacteria | 4159911 |
| 1141 | 8018850379 | 8018845410 | Bacteria | 8933938 |
| 1142 | 8020808839 | 8020807995 | Bacteria | 6801506 |
| 1143 | 8020939405 | 8020938398 | Bacteria | 7472757 |
| 1144 | 8020947192 | 8020945358 | Bacteria | 8467355 |
| 1145 | 8020954371 | 8020953355 | Bacteria | 7439080 |
| 1146 | 8021122841 | 8021120328 | Bacteria | 8782274 |
| 1147 | 8039102778 | 8039098773 | Bacteria | 6602928 |
| 1148 | 8040169288 | 8040167225 | Bacteria | 6542727 |
| 1149 | 8040175007 | 8040173305 | Bacteria | 6827067 |
| 1150 | 8047673772 | 8047673197 | Bacteria | 7395230 |
| 1151 | 8048749766 | 8048746797 | Bacteria | 3557226 |
| 1152 | 8055227947 | 8055225921 | Bacteria | 3341787 |
| 1153 | nmdc:mga03683_79443_c1 | |||
| 1154 | JGI24741J21665_1000010 | |||
| 1155 | JGI24740J21852_10000462 | |||
| 1156 | JGI24740J21852_10000722 | |||
| 1157 | JGI24739J22299_10010730 | |||
| 1158 | JGI24737J22298_10013210 | |||
| 1159 | JGI24735J21928_10000381 | |||
| 1160 | JGI25155J39150_1000877 | |||
| 1161 | JGI25155J39150_1000881 | |||
| 1162 | JGI25156J39149_1004399 | |||
| 1163 | JGI25156J39149_1004435 | |||
| 1164 | JGI25156J39149_1007106 | |||
| 1165 | JGI25162J39368_1000036 | |||
| 1166 | JGI25162J39368_1007683 | |||
| 1167 | JGI25154J39366_1000446 | |||
| 1168 | JGI25154J39366_1001320 | |||
| 1169 | JGI25154J39366_1002733 | |||
| 1170 | JGI25154J39366_1002751 | |||
| 1171 | JGI25157J39369_1001025 | |||
| 1172 | JGI25157J39369_1001457 | |||
| 1173 | JGI25152J39213_1003851 | |||
| 1174 | JGI25150J39212_1006615 | |||
| 1175 | JGI25159J45721_1005005 | |||
| 1176 | JGI25151J46595_10000203 | |||
| 1177 | JGI25165J46597_1000022 | |||
| 1178 | JGI25153J46596_10008450 | |||
| 1179 | JGI25161J50226_1003372 | |||
| 1180 | Ga0007410J51695_1012750 | |||
| 1181 | Ga0007409J51694_1006362 | |||
| 1182 | Ga0007409J51694_1011802 | |||
| 1183 | Ga0007416J51690_1012585 | |||
| 1184 | Ga0055538_1000002 | |||
| 1185 | Ga0055538_1000011 | |||
| 1186 | Ga0055539_1000002 | |||
| 1187 | Ga0055539_1000016 | |||
| 1188 | Ga0055539_1000034 | |||
| 1189 | Ga0055533_1000004 | |||
| 1190 | Ga0055533_1000019 | |||
| 1191 | Ga0055532_1000002 | |||
| 1192 | Ga0055532_1000016 | |||
| 1193 | Ga0055525_1000001 | |||
| 1194 | Ga0055525_1000002 | |||
| 1195 | Ga0055525_1000042 | |||
| 1196 | Ga0055525_1000538 | |||
| 1197 | Ga0055527_1002743 | |||
| 1198 | Ga0055527_1002777 | |||
| 1199 | Ga0055535_1000318 | |||
| 1200 | Ga0055542_1004140 | |||
| 1201 | Ga0055542_1004240 | |||
| 1202 | Ga0055529_1000028 | |||
| 1203 | Ga0055529_1000403 | |||
| 1204 | Ga0055529_1004078 | |||
| 1205 | Ga0055526_1000018 | |||
| 1206 | Ga0055526_1000029 | |||
| 1207 | Ga0055526_1003756 | |||
| 1208 | Ga0055526_1003777 | |||
| 1209 | Ga0055526_1005592 | |||
| 1210 | Ga0055526_1016080 | |||
| 1211 | Ga0055537_1000202 | |||
| 1212 | Ga0055537_1007170 | |||
| 1213 | Ga0055524_1000234 | |||
| 1214 | Ga0055524_1008881 | |||
| 1215 | Ga0055524_1022702 | |||
| 1216 | Ga0055534_1000311 | |||
| 1217 | Ga0055534_1002771 | |||
| 1218 | Ga0055528_1000062 | |||
| 1219 | Ga0055528_1002474 | |||
| 1220 | Ga0055528_1007004 | |||
| 1221 | Ga0055530_10008671 | |||
| 1222 | Ga0055530_10011528 | |||
| 1223 | Ga0055541_1000002 | |||
| 1224 | Ga0055541_1000017 | |||
| 1225 | Ga0055541_1000217 | |||
| 1226 | Ga0058692_1016389 | |||
| 1227 | Ga0055543_1004578 | |||
| 1228 | Ga0065165_1000055 | |||
| 1229 | Ga0065165_1008669 | |||
| 1230 | Ga0065165_1011383 | |||
| 1231 | Ga0065165_1024690 | |||
| 1232 | Ga0065714_10112336 | |||
| 1233 | Ga0065715_10110556 | |||
| 1234 | Ga0070658_10086993 | |||
| 1235 | Ga0070670_100014071 | |||
| 1236 | Ga0070682_100119523 | |||
| 1237 | Ga0070660_100000010 | |||
| 1238 | Ga0070660_100003942 | |||
| 1239 | Ga0070660_100041122 | |||
| 1240 | Ga0070660_100078821 | |||
| 1241 | Ga0070660_100146878 | |||
| 1242 | Ga0070661_100000013 | |||
| 1243 | Ga0070661_100003622 | |||
| 1244 | Ga0070659_100000167 | |||
| 1245 | Ga0070659_100000834 | |||
| 1246 | Ga0070659_100004951 | |||
| 1247 | Ga0070659_100053692 | |||
| 1248 | Ga0070659_100070043 | |||
| 1249 | Ga0070667_100049400 | |||
| 1250 | Ga0070714_100008646 | |||
| 1251 | Ga0070663_100000006 | |||
| 1252 | Ga0070663_100000789 | |||
| 1253 | Ga0070663_100063775 | |||
| 1254 | Ga0070662_100149373 | |||
| 1255 | Ga0068855_100000065 | |||
| 1256 | Ga0068855_100269568 | |||
| 1257 | Ga0068855_100317253 | |||
| 1258 | Ga0070664_100000002 | |||
| 1259 | Ga0070664_100003335 | |||
| 1260 | Ga0070664_100065531 | |||
| 1261 | Ga0068857_100051097 | |||
| 1262 | Ga0068857_100140667 | |||
| 1263 | Ga0068854_100000004 | |||
| 1264 | Ga0068856_100000294 | |||
| 1265 | Ga0068856_100169372 | |||
| 1266 | Ga0068852_100017069 | |||
| 1267 | Ga0068852_100129856 | |||
| 1268 | Ga0075363_100002122 | |||
| 1269 | Ga0075364_10001271 | |||
| 1270 | Ga0075364_10004880 | |||
| 1271 | Ga0075366_10150087 | |||
| 1272 | Ga0099826_10000002 | |||
| 1273 | Ga0105251_10001123 | |||
| 1274 | Ga0105244_10002843 | |||
| 1275 | Ga0105244_10004589 | |||
| 1276 | Ga0105244_10049320 | |||
| 1277 | Ga0105244_10092329 | |||
| 1278 | Ga0105240_10000297 | |||
| 1279 | Ga0105240_10014780 | |||
| 1280 | Ga0105240_10038598 | |||
| 1281 | Ga0105240_10194424 | |||
| 1282 | Ga0105240_10201688 | |||
| 1283 | Ga0105245_10189972 | |||
| 1284 | Ga0105243_10316365 | |||
| 1285 | Ga0105241_10064594 | |||
| 1286 | Ga0105242_10045340 | |||
| 1287 | Ga0105248_10045070 | |||
| 1288 | Ga0105237_10067786 | |||
| 1289 | Ga0105237_10081975 | |||
| 1290 | Ga0105237_10105569 | |||
| 1291 | Ga0105237_10179067 | |||
| 1292 | Ga0105238_10001896 | |||
| 1293 | Ga0105238_10094199 | |||
| 1294 | Ga0105239_10005044 | |||
| 1295 | Ga0105239_10246327 | |||
| 1296 | Ga0157373_10020184 | |||
| 1297 | Ga0157371_10000123 | |||
| 1298 | Ga0157370_10000013 | |||
| 1299 | Ga0157374_10211981 | |||
| 1300 | Ga0163162_10002139 | |||
| 1301 | Ga0163162_10033754 | |||
| 1302 | Ga0157372_10001159 | |||
| 1303 | Ga0182008_10007666 | |||
| 1304 | Ga0182008_10027927 | |||
| 1305 | Ga0182006_1000002 | |||
| 1306 | Ga0182006_1000017 | |||
| 1307 | Ga0182006_1010763 | |||
| 1308 | Ga0182006_1015580 | |||
| 1309 | Ga0182007_10000069 | |||
| 1310 | Ga0182005_1000002 | |||
| 1311 | Ga0182005_1000007 | |||
| 1312 | Ga0182005_1000307 | |||
| 1313 | Ga0206355_1326248 | |||
| 1314 | Ga0206351_10167421 | |||
| 1315 | Ga0206350_10139122 | |||
| 1316 | Ga0154015_1099906 | |||
| 1317 | Ga0213872_10000263 | |||
| 1318 | Ga0213872_10000773 | |||
| 1319 | Ga0213872_10012586 | |||
| 1320 | Ga0213872_10013693 | |||
| 1321 | Ga0209435_100070 | |||
| 1322 | Ga0209435_100716 | |||
| 1323 | Ga0209760_101302 | |||
| 1324 | Ga0209784_100002 | |||
| 1325 | Ga0209784_100003 | |||
| 1326 | Ga0209784_100019 | |||
| 1327 | Ga0209784_100293 | |||
| 1328 | Ga0209784_100803 | |||
| 1329 | Ga0209566_100002 | |||
| 1330 | Ga0209566_100003 | |||
| 1331 | Ga0209566_100017 | |||
| 1332 | Ga0209566_100370 | |||
| 1333 | Ga0209566_100896 | |||
| 1334 | Ga0209674_100004 | |||
| 1335 | Ga0209674_100008 | |||
| 1336 | Ga0209674_100031 | |||
| 1337 | Ga0209674_100122 | |||
| 1338 | Ga0209674_101948 | |||
| 1339 | Ga0209672_100019 | |||
| 1340 | Ga0209672_100051 | |||
| 1341 | Ga0209672_100213 | |||
| 1342 | Ga0209672_109800 | |||
| 1343 | Ga0209147_100002 | |||
| 1344 | Ga0209147_100023 | |||
| 1345 | Ga0209147_100026 | |||
| 1346 | Ga0209147_101674 | |||
| 1347 | Ga0209563_100004 | |||
| 1348 | Ga0209563_100006 | |||
| 1349 | Ga0209563_100007 | |||
| 1350 | Ga0209563_100035 | |||
| 1351 | Ga0209563_104817 | |||
| 1352 | Ga0207427_100255 | |||
| 1353 | Ga0209437_100038 | |||
| 1354 | Ga0209437_100080 | |||
| 1355 | Ga0209437_103076 | |||
| 1356 | Ga0209258_100002 | |||
| 1357 | Ga0209258_100031 | |||
| 1358 | Ga0209258_100179 | |||
| 1359 | Ga0209258_100253 | |||
| 1360 | Ga0207425_1000001 | |||
| 1361 | Ga0207425_1001467 | |||
| 1362 | Ga0207425_1001639 | |||
| 1363 | Ga0209646_1000022 | |||
| 1364 | Ga0209646_1000033 | |||
| 1365 | Ga0209646_1000174 | |||
| 1366 | Ga0209646_1000872 | |||
| 1367 | Ga0209026_1000150 | |||
| 1368 | Ga0209026_1002115 | |||
| 1369 | Ga0209026_1003950 | |||
| 1370 | Ga0209026_1007183 | |||
| 1371 | Ga0209677_100003 | |||
| 1372 | Ga0209677_100009 | |||
| 1373 | Ga0209677_100020 | |||
| 1374 | Ga0209677_103820 | |||
| 1375 | Ga0209148_1000021 | |||
| 1376 | Ga0209148_1000027 | |||
| 1377 | Ga0209148_1000992 | |||
| 1378 | Ga0209148_1004472 | |||
| 1379 | Ga0209759_1000359 | |||
| 1380 | Ga0209759_1000408 | |||
| 1381 | Ga0209759_1001771 | |||
| 1382 | Ga0209759_1002181 | |||
| 1383 | Ga0209759_1007195 | |||
| 1384 | Ga0209129_1000001 | |||
| 1385 | Ga0209129_1005030 | |||
| 1386 | Ga0209233_1000049 | |||
| 1387 | Ga0209565_1000167 | |||
| 1388 | Ga0209565_1000902 | |||
| 1389 | Ga0209565_1001159 | |||
| 1390 | Ga0209565_1007277 | |||
| 1391 | Ga0209455_1000021 | |||
| 1392 | Ga0209455_1000037 | |||
| 1393 | Ga0209455_1000213 | |||
| 1394 | Ga0209455_1002641 | |||
| 1395 | Ga0209455_1004072 | |||
| 1396 | Ga0209673_1000051 | |||
| 1397 | Ga0209673_1000201 | |||
| 1398 | Ga0209673_1012575 | |||
| 1399 | Ga0209130_1000091 | |||
| 1400 | Ga0209130_1000507 | |||
| 1401 | Ga0209130_1003078 | |||
| 1402 | Ga0209130_1006616 | |||
| 1403 | Ga0209675_1000027 | |||
| 1404 | Ga0209675_1000769 | |||
| 1405 | Ga0209675_1005996 | |||
| 1406 | Ga0209675_1009461 | |||
| 1407 | Ga0209676_1004133 | |||
| 1408 | Ga0209025_1000003 | |||
| 1409 | Ga0209025_1016263 | |||
| 1410 | Ga0209564_1000009 | |||
| 1411 | Ga0209564_1000068 | |||
| 1412 | Ga0209564_1000897 | |||
| 1413 | Ga0209564_1001707 | |||
| 1414 | Ga0209564_1002800 | |||
| 1415 | Ga0209564_1003112 | |||
| 1416 | Ga0209564_1047387 | |||
| 1417 | Ga0209758_1000073 | |||
| 1418 | Ga0209758_1002044 | |||
| 1419 | Ga0209050_1000046 | |||
| 1420 | Ga0209050_1003824 | |||
| 1421 | Ga0209050_1012901 | |||
| 1422 | Ga0209256_1000044 | |||
| 1423 | Ga0209256_1000265 | |||
| 1424 | Ga0209256_1002001 | |||
| 1425 | Ga0209256_1010975 | |||
| 1426 | Ga0207426_1001239 | |||
| 1427 | Ga0207426_1003279 | |||
| 1428 | Ga0209257_1000068 | |||
| 1429 | Ga0207655_1008662 | |||
| 1430 | Ga0207655_1011578 | |||
| 1431 | Ga0207655_1050604 | |||
| 1432 | Ga0207713_1003181 | |||
| 1433 | Ga0207680_10231953 | |||
| 1434 | Ga0207647_10000835 | |||
| 1435 | Ga0207647_10018639 | |||
| 1436 | Ga0207705_10023618 | |||
| 1437 | Ga0207705_10112848 | |||
| 1438 | Ga0207695_10000475 | |||
| 1439 | Ga0207695_10006070 | |||
| 1440 | Ga0207695_10011620 | |||
| 1441 | Ga0207695_10032578 | |||
| 1442 | Ga0207695_10036204 | |||
| 1443 | Ga0207671_10020134 | |||
| 1444 | Ga0207671_10052029 | |||
| 1445 | Ga0207660_10094123 | |||
| 1446 | Ga0207657_10000001 | |||
| 1447 | Ga0207657_10012572 | |||
| 1448 | Ga0207657_10037258 | |||
| 1449 | Ga0207657_10137885 | |||
| 1450 | Ga0207657_10330431 | |||
| 1451 | Ga0207649_10000019 | |||
| 1452 | Ga0207649_10035200 | |||
| 1453 | Ga0207694_10004571 | |||
| 1454 | Ga0207694_10010183 | |||
| 1455 | Ga0207694_10022298 | |||
| 1456 | Ga0207650_10011517 | |||
| 1457 | Ga0207659_10256285 | |||
| 1458 | Ga0207664_10123199 | |||
| 1459 | Ga0207690_10000006 | |||
| 1460 | Ga0207690_10004157 | |||
| 1461 | Ga0207690_10021999 | |||
| 1462 | Ga0207690_10127237 | |||
| 1463 | Ga0207690_10133276 | |||
| 1464 | Ga0207686_10049440 | |||
| 1465 | Ga0207711_10024668 | |||
| 1466 | Ga0207679_10000001 | |||
| 1467 | Ga0207679_10004443 | |||
| 1468 | Ga0207667_10000025 | |||
| 1469 | Ga0207667_10023086 | |||
| 1470 | Ga0207667_10046894 | |||
| 1471 | Ga0207667_10134582 | |||
| 1472 | Ga0207667_10138896 | |||
| 1473 | Ga0207640_10000240 | |||
| 1474 | Ga0207678_10000001 | |||
| 1475 | Ga0207678_10000167 | |||
| 1476 | Ga0207678_10038870 | |||
| 1477 | Ga0207678_10253587 | |||
| 1478 | Ga0207702_10000009 | |||
| 1479 | Ga0207702_10136452 | |||
| 1480 | Ga0207674_10064218 | |||
| 1481 | Ga0207674_10281349 | |||
| 1482 | Ga0207698_10020074 | |||
| 1483 | Ga0207698_10111359 | |||
| 1484 | Ga0209281_1006345 | |||
| 1485 | Ga0209371_1000297 | |||
| 1486 | Ga0209282_1000001 | |||
| 1487 | Ga0268264_10162696 | |||
| 1488 | Ga0268256_1000261 | |||
| 1489 | Ga0307511_10000040 | |||
| 1490 | Ga0316177_1009921 | |||
| 1491 | Ga0316180_1185675 | |||
| 1492 | Ga0316181_1278006 | |||
| 1493 | Ga0265327_10027938 | |||
| 1494 | Ga0265327_10090341 | |||
| 1495 | Ga0307408_100001210 | |||
| 1496 | Ga0307408_100021297 | |||
| 1497 | Ga0307408_100029234 | |||
| 1498 | Ga0307408_100043636 | |||
| 1499 | Ga0307518_10028306 | |||
| 1500 | Ga0307412_10000845 | |||
| 1501 | Ga0307416_100020341 | |||
| 1502 | Ga0307414_10012598 | |||
| 1503 | Ga0316583_10009599 | |||
| 1504 | Ga0307507_10043456 | |||
| 1505 | Ga0395899_0000904 | |||
| 1506 | Ga0395899_0002101 | |||
| 1507 | Ga0395899_0036149 | |||
| 1508 | Ga0395899_0049427 | |||
| 1509 | Ga0395899_0058593 | |||
| 1510 | Ga0395899_0076323 | |||
| 1511 | Ga0395899_0181802 | |||
| 1512 | Ga0395900_0000874 | |||
| 1513 | Ga0395900_0007034 | |||
| 1514 | Ga0395900_0009723 | |||
| 1515 | Ga0395900_0018346 | |||
| 1516 | Ga0395900_0023633 | |||
| 1517 | Ga0395900_0036284 | |||
| 1518 | Ga0395900_0050571 | |||
| 1519 | Ga0395900_0062747 | |||
| 1520 | Ga0395900_0102978 | |||
| 1521 | Ga0395900_0163739 | |||
| 1522 | Ga0395900_0517839 | |||
| 1523 | Ga0395898_0039391 | |||
| 1524 | Ga0395898_0154334 | |||
| 1525 | Ga0395898_0157087 | |||
| 1526 | Ga0395898_0423988 | |||
| 1527 | Ga0395905_0008840 | |||
| 1528 | Ga0395905_0009571 | |||
| 1529 | Ga0395905_0048604 | |||
| 1530 | Ga0395905_0070895 | |||
| 1531 | Ga0395905_0075118 | |||
| 1532 | Ga0395905_0088384 | |||
| 1533 | Ga0395905_0263229 | |||
| 1534 | Ga0395905_0285714 | |||
| 1535 | Ga0395905_0341128 | |||
| 1536 | Ga0395901_0000054 | |||
| 1537 | Ga0395901_0003565 | |||
| 1538 | Ga0395901_0010496 | |||
| 1539 | Ga0395901_0127852 | |||
| 1540 | Ga0395901_0273659 | |||
| 1541 | Ga0395901_0425782 | |||
| 1542 | Ga0395901_0438385 | |||
| 1543 | Ga0395901_0452847 | |||
| 1544 | Ga0395901_0480409 | |||
| 1545 | Ga0436361_0080172 | |||
| 1546 | Ga0436361_0116364 | |||
| 1547 | Ga0436361_0134513 | |||
| 1548 | Ga0436361_0261530 | |||
| 1549 | Ga0436361_0324341 | |||
| 1550 | Ga0436361_0525957 | |||
| 1551 | Ga0436361_0944997 | |||
| 1552 | Ga0436361_0987205 | |||
| 1553 | Ga0439448_0003707 | |||
| 1554 | Ga0439448_0020781 | |||
| 1555 | Ga0439458_0001531 | |||
| 1556 | Ga0451577_0004811 | |||
| 1557 | Ga0451577_0006944 | |||
| 1558 | Ga0451577_0026714 | |||
| 1559 | Ga0451577_0101044 | |||
| 1560 | Ga0451577_0175942 | |||
| 1561 | Ga0466972_0000005 | |||
| 1562 | Ga0466972_0002881 | |||
| 1563 | Ga0466972_0004661 | |||
| 1564 | Ga0466972_0076949 | |||
| 1565 | Ga0466977_0003512 | |||
| 1566 | Ga0466978_0027607 | |||
| 1567 | Ga0466982_0020479 | |||
| 1568 | Ga0466965_0005740 | |||
| 1569 | Ga0466965_0014133 | |||
| 1570 | Ga0466965_0016454 | |||
| 1571 | Ga0466965_0016917 | |||
| 1572 | Ga0466965_0084426 | |||
| 1573 | Ga0466966_0005305 | |||
| 1574 | Ga0466966_0033545 | |||
| 1575 | Ga0466966_0062889 | |||
| 1576 | Ga0466966_0080211 | |||
| 1577 | Ga0466966_0090457 | |||
| 1578 | Ga0466961_0001007 | |||
| 1579 | Ga0466963_0134754 | |||
| 1580 | Ga0466964_0001227 | |||
| 1581 | Ga0466964_0001931 | |||
| 1582 | Ga0466964_0007716 | |||
| 1583 | Ga0466964_0036081 | |||
| 1584 | Ga0453684_0000847 | |||
| 1585 | Ga0453684_0031930 | |||
| 1586 | Ga0466971_0010136 | |||
| 1587 | Ga0466968_0001801 | |||
| 1588 | Ga0466968_0003428 | |||
| 1589 | Ga0466968_0131265 | |||
| 1590 | Ga0466970_0014132 | |||
| 1591 | Ga0466957_0013888 | |||
| 1592 | Ga0466957_0044973 | |||
| 1593 | Ga0466957_0177057 | |||
| 1594 | Ga0466959_0007553 | |||
| 1595 | Ga0466959_0165242 | |||
| 1596 | Ga0451576_0001131 | |||
| 1597 | Ga0451576_0017241 | |||
| 1598 | Ga0451576_0055941 | |||
| 1599 | Ga0451576_0197558 | |||
| 1600 | Ga0451576_0269744 | |||
| 1601 | Ga0451576_0602437 | |||
| 1602 | Ga0466967_0010385 | |||
| 1603 | Ga0466967_0071893 | |||
| 1604 | Ga0466967_0288288 | |||
| 1605 | Ga0466967_0529560 | |||
| 1606 | Ga0495617_000041 | |||
| 1607 | Ga0495617_000057 | |||
| 1608 | Ga0495617_000843 | |||
| 1609 | Ga0495627_000007 | |||
| 1610 | Ga0495627_001817 | |||
| 1611 | Ga0495627_006174 | |||
| 1612 | Ga0495627_020867 | |||
| 1613 | Ga0495592_0047346 | |||
| 1614 | Ga0495603_0078255 | |||
| 1615 | Ga0495590_0000001 | |||
| 1616 | Ga0495590_0000018 | |||
| 1617 | Ga0495590_0002149 | |||
| 1618 | Ga0495590_0008695 | |||
| 1619 | Ga0495590_0010437 | |||
| 1620 | Ga0495591_012498 | |||
| 1621 | Ga0495629_0000293 | |||
| 1622 | Ga0495638_0000086 | |||
| 1623 | Ga0495638_0223603 | |||
| 1624 | Ga0495651_0028201 | |||
| 1625 | Ga0495653_0000002 | |||
| 1626 | Ga0495653_0001619 | |||
| 1627 | Ga0495653_0028643 | |||
| 1628 | Ga0495650_0000108 | |||
| 1629 | Ga0495650_0000118 | |||
| 1630 | Ga0495650_0000140 | |||
| 1631 | Ga0495650_0000156 | |||
| 1632 | Ga0495650_0000837 | |||
| 1633 | Ga0495650_0007249 | |||
| 1634 | Ga0495650_0017152 | |||
| 1635 | Ga0495580_0156385 | |||
| 1636 | Ga0495582_0006054 | |||
| 1637 | Ga0495582_0015498 | |||
| 1638 | Ga0495605_0000168 | |||
| 1639 | Ga0495605_0000416 | |||
| 1640 | Ga0495605_0000438 | |||
| 1641 | Ga0495605_0003370 | |||
| 1642 | Ga0495605_0019964 | |||
| 1643 | Ga0495605_0027851 | |||
| 1644 | Ga0495605_0035069 | |||
| 1645 | Ga0495605_0071002 | |||
| 1646 | Ga0495605_0090233 | |||
| 1647 | Ga0495605_0142817 | |||
| 1648 | Ga0495639_0033664 | |||
| 1649 | Ga0495584_0000281 | |||
| 1650 | Ga0495584_0002307 | |||
| 1651 | Ga0495584_0012122 | |||
| 1652 | Ga0495584_0013652 | |||
| 1653 | Ga0495584_0023179 | |||
| 1654 | Ga0495584_0033622 | |||
| 1655 | Ga0495584_0043266 | |||
| 1656 | Ga0495585_0002371 | |||
| 1657 | Ga0495585_0005187 | |||
| 1658 | Ga0495585_0007454 | |||
| 1659 | Ga0495585_0008412 | |||
| 1660 | Ga0495585_0014980 | |||
| 1661 | Ga0495585_0020761 | |||
| 1662 | Ga0495585_0038339 | |||
| 1663 | Ga0495585_0100247 | |||
| 1664 | Ga0495585_0104505 | |||
| 1665 | Ga0495594_0024057 | |||
| 1666 | Ga0495596_0001435 | |||
| 1667 | Ga0495596_0011978 | |||
| 1668 | Ga0495596_0012711 | |||
| 1669 | Ga0495596_0018777 | |||
| 1670 | Ga0495596_0020910 | |||
| 1671 | Ga0495596_0020949 | |||
| 1672 | Ga0495596_0023665 | |||
| 1673 | Ga0495596_0025542 | |||
| 1674 | Ga0495596_0026299 | |||
| 1675 | Ga0495596_0067256 | |||
| 1676 | Ga0495607_0002962 | |||
| 1677 | Ga0495607_0003330 | |||
| 1678 | Ga0495607_0004150 | |||
| 1679 | Ga0495607_0006983 | |||
| 1680 | Ga0495607_0019846 | |||
| 1681 | Ga0495607_0020575 | |||
| 1682 | Ga0495607_0025658 | |||
| 1683 | Ga0495607_0028934 | |||
| 1684 | Ga0495607_0031999 | |||
| 1685 | Ga0495607_0032131 | |||
| 1686 | Ga0495607_0038276 | |||
| 1687 | Ga0495607_0046570 | |||
| 1688 | Ga0495607_0049132 | |||
| 1689 | Ga0495607_0076351 | |||
| 1690 | Ga0495607_0092268 | |||
| 1691 | Ga0495583_0000177 | |||
| 1692 | Ga0495583_0000221 | |||
| 1693 | Ga0495583_0001635 | |||
| 1694 | Ga0495583_0003816 | |||
| 1695 | Ga0495583_0004868 | |||
| 1696 | Ga0495583_0014101 | |||
| 1697 | Ga0495583_0020486 | |||
| 1698 | Ga0495583_0032488 | |||
| 1699 | Ga0495606_0000001 | |||
| 1700 | Ga0495606_0000011 | |||
| 1701 | Ga0495606_0000679 | |||
| 1702 | Ga0495606_0000864 | |||
| 1703 | Ga0495606_0006986 | |||
| 1704 | Ga0495606_0007758 | |||
| 1705 | Ga0495606_0022736 | |||
| 1706 | Ga0495606_0027811 | |||
| 1707 | Ga0495606_0027851 | |||
| 1708 | Ga0495606_0045995 | |||
| 1709 | Ga0495606_0063561 | |||
| 1710 | Ga0495606_0112714 | |||
| 1711 | Ga0495608_0006170 | |||
| 1712 | Ga0495608_0041553 | |||
| 1713 | Ga0495610_0000003 | |||
| 1714 | Ga0495610_0002329 | |||
| 1715 | Ga0495610_0003829 | |||
| 1716 | Ga0495610_0075135 | |||
| 1717 | Ga0495610_0078369 | |||
| 1718 | Ga0495616_0000662 | |||
| 1719 | Ga0495616_0002684 | |||
| 1720 | Ga0495616_0013824 | |||
| 1721 | Ga0495616_0018343 | |||
| 1722 | Ga0495616_0026851 | |||
| 1723 | Ga0495616_0033272 | |||
| 1724 | Ga0495616_0039587 | |||
| 1725 | Ga0495616_0052848 | |||
| 1726 | Ga0495616_0058167 | |||
| 1727 | Ga0495618_0071916 | |||
| 1728 | Ga0495628_0004565 | |||
| 1729 | Ga0495628_0007604 | |||
| 1730 | Ga0495628_0011133 | |||
| 1731 | Ga0495630_0084205 | |||
| 1732 | Ga0495631_0000632 | |||
| 1733 | Ga0495631_0001483 | |||
| 1734 | Ga0495631_0016053 | |||
| 1735 | Ga0495631_0018103 | |||
| 1736 | Ga0495631_0018121 | |||
| 1737 | Ga0495631_0032908 | |||
| 1738 | Ga0495631_0070560 | |||
| 1739 | Ga0495632_0000214 | |||
| 1740 | Ga0495632_0003852 | |||
| 1741 | Ga0495632_0011405 | |||
| 1742 | Ga0495632_0014316 | |||
| 1743 | Ga0495632_0015456 | |||
| 1744 | Ga0495632_0027244 | |||
| 1745 | Ga0495637_0000612 | |||
| 1746 | Ga0495637_0001689 | |||
| 1747 | Ga0495637_0021637 | |||
| 1748 | Ga0495643_0000123 | |||
| 1749 | Ga0495643_0004483 | |||
| 1750 | Ga0495643_0009598 | |||
| 1751 | Ga0495643_0015947 | |||
| 1752 | Ga0495643_0019252 | |||
| 1753 | Ga0495643_0021003 | |||
| 1754 | Ga0495643_0043697 | |||
| 1755 | Ga0495643_0046264 | |||
| 1756 | Ga0495644_0001496 | |||
| 1757 | Ga0495644_0006676 | |||
| 1758 | Ga0495644_0007533 | |||
| 1759 | Ga0495644_0009890 | |||
| 1760 | Ga0495644_0039613 | |||
| 1761 | Ga0495648_0000001 | |||
| 1762 | Ga0495648_0002540 | |||
| 1763 | Ga0495648_0002834 | |||
| 1764 | Ga0495648_0004137 | |||
| 1765 | Ga0495648_0010857 | |||
| 1766 | Ga0495648_0018998 | |||
| 1767 | Ga0495648_0019039 | |||
| 1768 | Ga0495648_0033894 | |||
| 1769 | Ga0495648_0044272 | |||
| 1770 | Ga0495648_0058698 | |||
| 1771 | Ga0495648_0103908 | |||
| 1772 | Ga0495648_0124694 | |||
| 1773 | Ga0495663_0004849 | |||
| 1774 | Ga0495642_0000741 | |||
| 1775 | Ga0495642_0001464 | |||
| 1776 | Ga0495642_0007631 | |||
| 1777 | Ga0495642_0013970 | |||
| 1778 | Ga0495642_0015415 | |||
| 1779 | Ga0495642_0023321 | |||
| 1780 | Ga0495652_0012068 | |||
| 1781 | Ga0495652_0040085 | |||
| 1782 | Ga0495652_0113750 | |||
| 1783 | Ga0495654_0000038 | |||
| 1784 | Ga0495654_0070510 | |||
| 1785 | Ga0495654_0097181 | |||
| 1786 | Ga0495654_0131186 | |||
| 1787 | Ga0495665_0019053 | |||
| 1788 | Ga0495665_0026571 | |||
| 1789 | Ga0495640_0208183 | |||
| 1790 | Ga0495586_0032100 | |||
| 1791 | Ga0495586_0123732 | |||
| 1792 | Ga0495587_0235306 | |||
| 1793 | Ga0495609_0000009 | |||
| 1794 | Ga0495609_0000479 | |||
| 1795 | Ga0495609_0002949 | |||
| 1796 | Ga0495609_0003102 | |||
| 1797 | Ga0495609_0006657 | |||
| 1798 | Ga0495609_0018010 | |||
| 1799 | Ga0495609_0020796 | |||
| 1800 | Ga0495609_0029171 | |||
| 1801 | Ga0495609_0116195 | |||
| 1802 | Ga0495597_0000110 | |||
| 1803 | Ga0495597_0002311 | |||
| 1804 | Ga0495597_0003097 | |||
| 1805 | Ga0495597_0004138 | |||
| 1806 | Ga0495597_0007611 | |||
| 1807 | Ga0495597_0010421 | |||
| 1808 | Ga0495597_0014117 | |||
| 1809 | Ga0495597_0018479 | |||
| 1810 | Ga0495597_0026802 | |||
| 1811 | Ga0495645_0014686 | |||
| 1812 | Ga0495645_0027376 | |||
| 1813 | Ga0495622_0000028 | |||
| 1814 | Ga0495622_0003561 | |||
| 1815 | Ga0495622_0038097 | |||
| 1816 | Ga0495633_0000272 | |||
| 1817 | Ga0495633_0002858 | |||
| 1818 | Ga0495633_0003780 | |||
| 1819 | Ga0495633_0004683 | |||
| 1820 | Ga0495633_0006086 | |||
| 1821 | Ga0495633_0011002 | |||
| 1822 | Ga0495633_0015072 | |||
| 1823 | Ga0495633_0026986 | |||
| 1824 | Ga0495633_0034003 | |||
| 1825 | Ga0495633_0115253 | |||
| 1826 | Ga0495656_0003881 | |||
| 1827 | Ga0495656_0053355 | |||
| 1828 | Ga0495668_0000093 | |||
| 1829 | Ga0495668_0000095 | |||
| 1830 | Ga0495668_0000151 | |||
| 1831 | Ga0495668_0001575 | |||
| 1832 | Ga0495668_0003639 | |||
| 1833 | Ga0495668_0015431 | |||
| 1834 | Ga0495668_0016287 | |||
| 1835 | Ga0495668_0025820 | |||
| 1836 | Ga0495668_0030438 | |||
| 1837 | Ga0495668_0030940 | |||
| 1838 | Ga0495668_0091938 | |||
| 1839 | Ga0495668_0129139 | |||
| 1840 | Ga0495634_0048273 | |||
| 1841 | Ga0495634_0199937 | |||
| 1842 | Ga0495611_0000499 | |||
| 1843 | Ga0495611_0002457 | |||
| 1844 | Ga0495611_0011597 | |||
| 1845 | Ga0495611_0023585 | |||
| 1846 | Ga0495611_0026413 | |||
| 1847 | Ga0495611_0085172 | |||
| 1848 | Ga0495625_0001679 | |||
| 1849 | Ga0495625_0004300 | |||
| 1850 | Ga0495625_0007018 | |||
| 1851 | Ga0495625_0010387 | |||
| 1852 | Ga0495625_0017150 | |||
| 1853 | Ga0495625_0026781 | |||
| 1854 | Ga0495625_0050235 | |||
| 1855 | Ga0495625_0057067 | |||
| 1856 | Ga0495625_0066343 | |||
| 1857 | Ga0495625_0068572 | |||
| 1858 | Ga0495635_0002454 | |||
| 1859 | Ga0495635_0057076 | |||
| 1860 | Ga0495659_0000284 | |||
| 1861 | Ga0495659_0004469 | |||
| 1862 | Ga0495659_0007199 | |||
| 1863 | Ga0495659_0034594 | |||
| 1864 | Ga0495661_0001929 | |||
| 1865 | Ga0495661_0007429 | |||
| 1866 | Ga0495661_0008112 | |||
| 1867 | Ga0495661_0012238 | |||
| 1868 | Ga0495661_0013191 | |||
| 1869 | Ga0495661_0014739 | |||
| 1870 | Ga0495661_0017969 | |||
| 1871 | Ga0495661_0027110 | |||
| 1872 | Ga0495661_0035807 | |||
| 1873 | Ga0495661_0042600 | |||
| 1874 | Ga0495661_0049481 | |||
| 1875 | Ga0495661_0058954 | |||
| 1876 | Ga0495661_0076618 | |||
| 1877 | Ga0495661_0079739 | |||
| 1878 | Ga0495661_0094786 | |||
| 1879 | Ga0495588_0000077 | |||
| 1880 | Ga0495588_0010399 | |||
| 1881 | Ga0495588_0011557 | |||
| 1882 | Ga0495588_0031167 | |||
| 1883 | Ga0495588_0032950 | |||
| 1884 | Ga0495588_0050863 | |||
| 1885 | Ga0495657_0073728 | |||
| 1886 | Ga0495599_0004944 | |||
| 1887 | Ga0495623_0011364 | |||
| 1888 | Ga0495623_0012790 | |||
| 1889 | Ga0495623_0043008 | |||
| 1890 | Ga0495646_0012052 | |||
| 1891 | Ga0495669_0000116 | |||
| 1892 | Ga0495669_0006988 | |||
| 1893 | Ga0495669_0007431 | |||
| 1894 | Ga0495669_0008000 | |||
| 1895 | Ga0495669_0011905 | |||
| 1896 | Ga0495669_0023781 | |||
| 1897 | Ga0495669_0056974 | |||
| 1898 | Ga0495624_0034960 | |||
| 1899 | Ga0495670_0003774 | |||
| 1900 | Ga0495670_0005019 | |||
| 1901 | Ga0495670_0050660 | |||
| 1902 | Ga0495670_0053626 | |||
| 1903 | Ga0495670_0056910 | |||
| 1904 | Ga0495671_0000001 | |||
| 1905 | Ga0495671_0000108 | |||
| 1906 | Ga0495671_0002689 | |||
| 1907 | Ga0495671_0034330 | |||
| 1908 | Ga0495671_0140335 | |||
| 1909 | Ga0495649_0003311 | |||
| 1910 | Ga0495649_0011717 | |||
| 1911 | Ga0495649_0017148 | |||
| 1912 | Ga0495649_0077418 | |||
| 1913 | Ga0495649_0091022 | |||
| 1914 | Ga0495589_0001060 | |||
| 1915 | Ga0495589_0003670 | |||
| 1916 | Ga0495589_0007613 | |||
| 1917 | Ga0495589_0013208 | |||
| 1918 | Ga0495589_0017044 | |||
| 1919 | Ga0495589_0019655 | |||
| 1920 | Ga0495589_0038105 | |||
| 1921 | Ga0495589_0060621 | |||
| 1922 | Ga0495589_0072619 | |||
| 1923 | Ga0495589_0100291 | |||
| 1924 | Ga0495600_0001876 | |||
| 1925 | Ga0495660_0000178 | |||
| 1926 | Ga0495660_0000705 | |||
| 1927 | Ga0495660_0003426 | |||
| 1928 | Ga0495660_0005173 | |||
| 1929 | Ga0495660_0014659 | |||
| 1930 | Ga0495660_0020825 | |||
| 1931 | Ga0495604_0027131 | |||
| 1932 | Ga0495604_0177628 | |||
| 1933 | Ga0495636_0003600 | |||
| 1934 | Ga0495636_0020049 | |||
| 1935 | Ga0495636_0033912 | |||
| 1936 | Ga0495636_0079592 | |||
| 1937 | Ga0495674_0019748 | |||
| 1938 | Ga0495672_0000033 | |||
| 1939 | Ga0495672_0000181 | |||
| 1940 | Ga0495672_0000366 | |||
| 1941 | Ga0495672_0000381 | |||
| 1942 | Ga0495672_0001623 | |||
| 1943 | Ga0495672_0009440 | |||
| 1944 | Ga0495672_0010123 | |||
| 1945 | Ga0495672_0072440 | |||
| 1946 | Ga0495676_0000121 | |||
| 1947 | Ga0495676_0115733 | |||
| 1948 | Ga0495680_0043864 | |||
| 1949 | Ga0495680_0132495 | |||
| 1950 | Ga0495683_0001151 | |||
| 1951 | Ga0495683_0011839 | |||
| 1952 | Ga0495683_0012145 | |||
| 1953 | Ga0495683_0020827 | |||
| 1954 | Ga0495683_0036976 | |||
| 1955 | Ga0495683_0053793 | |||
| 1956 | Ga0495687_000002 | |||
| 1957 | Ga0495687_000017 | |||
| 1958 | Ga0495687_000024 | |||
| 1959 | Ga0495687_000458 | |||
| 1960 | Ga0495687_006587 | |||
| 1961 | Ga0495687_013931 | |||
| 1962 | Ga0495687_014022 | |||
| 1963 | Ga0495687_029982 | |||
| 1964 | Ga0495675_0016790 | |||
| 1965 | Ga0495675_0086847 | |||
| 1966 | Ga0495675_0097755 | |||
| 1967 | Ga0495675_0163034 | |||
| 1968 | Ga0495677_0000117 | |||
| 1969 | Ga0495677_0001384 | |||
| 1970 | Ga0495677_0002355 | |||
| 1971 | Ga0495677_0003340 | |||
| 1972 | Ga0495677_0005223 | |||
| 1973 | Ga0495677_0008846 | |||
| 1974 | Ga0495677_0010361 | |||
| 1975 | Ga0495677_0016878 | |||
| 1976 | Ga0495677_0029010 | |||
| 1977 | Ga0495679_013040 | |||
| 1978 | Ga0495679_015572 | |||
| 1979 | Ga0495685_000012 | |||
| 1980 | Ga0495685_004997 | |||
| 1981 | Ga0495685_009848 | |||
| 1982 | Ga0495685_011775 | |||
| 1983 | Ga0495685_026424 | |||
| 1984 | Ga0495673_0000003 | |||
| 1985 | Ga0495673_0000016 | |||
| 1986 | Ga0495673_0000188 | |||
| 1987 | Ga0495673_0023555 | |||
| 1988 | Ga0495673_0050101 | |||
| 1989 | Ga0495681_0000994 | |||
| 1990 | Ga0495681_0004664 | |||
| 1991 | Ga0495681_0012084 | |||
| 1992 | Ga0495681_0014560 | |||
| 1993 | Ga0495681_0023578 | |||
| 1994 | Ga0495681_0031523 | |||
| 1995 | Ga0495681_0031695 | |||
| 1996 | Ga0495681_0054057 | |||
| 1997 | Ga0495681_0057162 | |||
| 1998 | Ga0495686_0000032 | |||
| 1999 | Ga0495686_0000380 | |||
| 2000 | Ga0495686_0000591 | |||
| 2001 | Ga0495686_0001614 | |||
| 2002 | Ga0495686_0002052 | |||
| 2003 | Ga0495686_0013728 | |||
| 2004 | Ga0495686_0092149 | |||
| 2005 | Ga0495602_0077771 | |||
| 2006 | Ga0495602_0291844 | |||
| 2007 | Ga0495614_0004132 | |||
| 2008 | Ga0495615_0003367 | |||
| 2009 | Ga0495615_0015588 | |||
| 2010 | Ga0495626_0000004 | |||
| 2011 | Ga0495626_0000016 | |||
| 2012 | Ga0495626_0000693 | |||
| 2013 | Ga0495626_0004909 | |||
| 2014 | Ga0495626_0016810 | |||
| 2015 | Ga0495626_0029793 | |||
| 2016 | Ga0495626_0030305 | |||
| 2017 | Ga0495626_0035415 | |||
| 2018 | Ga0495626_0038734 | |||
| 2019 | Ga0495626_0054614 | |||
| 2020 | Ga0496100_0001564 | |||
| 2021 | Ga0496100_0035012 | |||
| 2022 | Ga0496100_0085040 | |||
| 2023 | Ga0496100_0103952 | |||
| 2024 | Ga0496100_0140327 | |||
| 2025 | Ga0496101_0004610 | |||
| 2026 | Ga0496102_0000340 | |||
| 2027 | Ga0496102_0000477 | |||
| 2028 | Ga0496102_0008702 | |||
| 2029 | Ga0496102_0033722 | |||
| 2030 | Ga0496102_0068030 | |||
| 2031 | Ga0496102_0180819 | |||
| 2032 | Ga0496103_0009410 | |||
| 2033 | Ga0496103_0088948 | |||
| 2034 | Ga0496103_0209725 | |||
| 2035 | Ga0496104_0128977 | |||
| 2036 | Ga0496105_0157903 | |||
| 2037 | Ga0496106_0085445 | |||
| 2038 | Ga0496107_0034773 | |||
| 2039 | Ga0496107_0138725 | |||
| 2040 | Ga0496108_0034687 | |||
| 2041 | Ga0496109_0005210 | |||
| 2042 | Ga0496109_0022441 | |||
| 2043 | Ga0496109_0122656 | |||
| 2044 | Ga0496110_0003516 | |||
| 2045 | Ga0496110_0004929 | |||
| 2046 | Ga0496110_0005432 | |||
| 2047 | Ga0496110_0387250 | |||
| 2048 | Ga0496111_0021552 | |||
| 2049 | Ga0496112_0016052 | |||
| 2050 | Ga0496113_0023519 | |||
| 2051 | Ga0496113_0036051 | |||
| 2052 | Ga0496116_0007137 | |||
| 2053 | Ga0496116_0032514 | |||
| 2054 | Ga0496116_0037251 | |||
| 2055 | Ga0496116_0052261 | |||
| 2056 | Ga0496117_0000001 | |||
| 2057 | Ga0496117_0024619 | |||
| 2058 | Ga0496117_0078292 | |||
| 2059 | Ga0496117_0105751 | |||
| 2060 | Ga0496118_0000002 | |||
| 2061 | Ga0496118_0017381 | |||
| 2062 | Ga0496118_0037074 | |||
| 2063 | Ga0496118_0094970 | |||
| 2064 | Ga0496118_0103492 | |||
| 2065 | Ga0496119_0008234 | |||
| 2066 | Ga0496119_0120723 | |||
| 2067 | Ga0496120_0006959 | |||
| 2068 | Ga0496121_0000306 | |||
| 2069 | Ga0496121_0004537 | |||
| 2070 | Ga0496121_0023095 | |||
| 2071 | Ga0496121_0032659 | |||
| 2072 | Ga0496121_0043305 | |||
| 2073 | Ga0496121_0046034 | |||
| 2074 | Ga0496121_0048456 | |||
| 2075 | Ga0496121_0150077 | |||
| 2076 | Ga0496122_0000455 | |||
| 2077 | Ga0496122_0000644 | |||
| 2078 | Ga0496122_0004387 | |||
| 2079 | Ga0496122_0009237 | |||
| 2080 | Ga0496122_0009551 | |||
| 2081 | Ga0496122_0034717 | |||
| 2082 | Ga0496122_0077420 | |||
| 2083 | Ga0496122_0157694 | |||
| 2084 | Ga0496122_0177464 | |||
| 2085 | Ga0496123_0000197 | |||
| 2086 | Ga0496123_0000203 | |||
| 2087 | Ga0496123_0003912 | |||
| 2088 | Ga0496123_0013893 | |||
| 2089 | Ga0496123_0017730 | |||
| 2090 | Ga0496123_0026217 | |||
| 2091 | Ga0496123_0042315 | |||
| 2092 | Ga0496123_0164006 | |||
| 2093 | Ga0496124_0000046 | |||
| 2094 | Ga0496124_0009308 | |||
| 2095 | Ga0496124_0035599 | |||
| 2096 | Ga0496124_0051693 | |||
| 2097 | Ga0496124_0056406 | |||
| 2098 | Ga0496124_0124435 | |||
| 2099 | Ga0496124_0151412 | |||
| 2100 | Ga0496125_0000011 | |||
| 2101 | Ga0496125_0000983 | |||
| 2102 | Ga0496125_0001069 | |||
| 2103 | Ga0496125_0018029 | |||
| 2104 | Ga0496125_0022845 | |||
| 2105 | Ga0496125_0027105 | |||
| 2106 | Ga0496125_0035345 | |||
| 2107 | Ga0496125_0077000 | |||
| 2108 | Ga0496126_0000034 | |||
| 2109 | Ga0496126_0006564 | |||
| 2110 | Ga0496126_0038550 | |||
| 2111 | Ga0496126_0055812 | |||
| 2112 | Ga0496126_0263737 | |||
| 2113 | Ga0501308_000102 | |||
| 2114 | Ga0501310_000345 | |||
| 2115 | Ga0501310_003722 | |||
| 2116 | Ga0495678_000004 | |||
| 2117 | Ga0495678_000275 | |||
| 2118 | Ga0495678_000746 | |||
| 2119 | Ga0495678_001983 | |||
| 2120 | Ga0495678_002319 | |||
| 2121 | Ga0495678_003043 | |||
| 2122 | Ga0495678_004447 | |||
| 2123 | Ga0495678_004779 | |||
| 2124 | Ga0495678_014319 | |||
| 2125 | Ga0495678_024380 | |||
| 2126 | Ga0495682_0002099 | |||
| 2127 | Ga0495682_0010088 | |||
| 2128 | Ga0495682_0019757 | |||
| 2129 | Ga0495682_0027473 | |||
| 2130 | Ga0501031_0003738 | |||
| 2131 | Ga0501032_0018637 | |||
| 2132 | Ga0501033_0003665 | |||
| 2133 | Ga0501033_0034503 | |||
| 2134 | Ga0501033_0061751 | |||
| 2135 | Ga0501033_0112304 | |||
| 2136 | Ga0501034_0032914 | |||
| 2137 | Ga0501034_0140107 | |||
| 2138 | Ga0501037_0016812 | |||
| 2139 | Ga0501037_0042579 | |||
| 2140 | Ga0501037_0141383 | |||
| 2141 | Ga0501038_0012706 | |||
| 2142 | Ga0501038_0252694 | |||
| 2143 | Ga0501039_0051432 | |||
| 2144 | Ga0501039_0243526 | |||
| 2145 | Ga0501043_0011390 | |||
| 2146 | Ga0501043_0023603 | |||
| 2147 | Ga0501046_0006547 | |||
| 2148 | Ga0501046_0094005 | |||
| 2149 | Ga0501047_0005230 | |||
| 2150 | Ga0501047_0017738 | |||
| 2151 | Ga0501227_003069 | |||
| 2152 | Ga0501249_004078 | |||
| 2153 | Ga0501269_000561 | |||
| 2154 | Ga0501035_0002186 | |||
| 2155 | Ga0501035_0003294 | |||
| 2156 | Ga0501035_0004380 | |||
| 2157 | Ga0501035_0015998 | |||
| 2158 | Ga0501044_0001185 | |||
| 2159 | Ga0501044_0002640 | |||
| 2160 | Ga0501044_0028040 | |||
| 2161 | Ga0501044_0087887 | |||
| 2162 | nmdc:mga00v17_3752_c2 | |||
| 2163 | nmdc:mga07m45_140377_c1 | |||
| 2164 | Ga0495601_0003048 | |||
| 2165 | Ga0500594_0011549 | |||
| 2166 | Ga0500595_004677 | |||
| 2167 | Ga0500618_000089 | |||
| 2168 | Ga0500618_000670 | |||
| 2169 | Ga0500618_000710 | |||
| 2170 | Ga0500586_001257 | |||
| 2171 | Ga0500600_0007675 | |||
| 2172 | Ga0500619_000505 | |||
| 2173 | Ga0500637_0104059 | |||
| 2174 | Ga0587077_002659 | |||
| 2175 | Ga0587080_003961 | |||
| 2176 | Ga0587088_003034 | |||
| 2177 | Ga0587090_008830 | |||
| 2178 | Ga0587101_007126 | |||
| 2179 | Ga0587067_000055 | |||
| 2180 | Ga0587068_004141 | |||
| 2181 | Ga0587068_004557 | |||
| 2182 | Ga0587072_000318 | |||
| 2183 | Ga0587076_010792 | |||
| 2184 | Ga0587079_002440 | |||
| 2185 | Ga0587079_009610 | |||
| 2186 | 2501073321 | |||
| 2187 | 2501408423 | |||
| 2188 | 2511096158 | |||
| 2189 | 2511103119 | |||
| 2190 | 2511250641 | |||
| 2191 | 2511384949 | |||
| 2192 | 2516022417 | |||
| 2193 | 2519458258 | |||
| 2194 | 2521557887 | |||
| 2195 | 2550693926 | |||
| 2196 | 2553003010 | |||
| 2197 | 2585294690 | |||
| 2198 | 2597028853 | |||
| 2199 | 2599445541 | |||
| 2200 | 2599738118 | |||
| 2201 | 2599742510 | |||
| 2202 | 2599903229 | |||
| 2203 | 2600204628 | |||
| 2204 | 2601667671 | |||
| 2205 | 2643786925 | |||
| 2206 | 2643802365 | |||
| 2207 | 2643862279 | |||
| 2208 | 2643980695 | |||
| 2209 | 2644030669 | |||
| 2210 | 2644122119 | |||
| 2211 | 2644215986 | |||
| 2212 | 2644254476 | |||
| 2213 | 2644357859 | |||
| 2214 | 2644475878 | |||
| 2215 | 2676741614 | |||
| 2216 | 2738741283 | |||
| 2217 | 2738829176 | |||
| 2218 | 2738845752 | |||
| 2219 | 2739152972 | |||
| 2220 | 2739194892 | |||
| 2221 | 2739277560 | |||
| 2222 | 2739321368 | |||
| 2223 | 2739340076 | |||
| 2224 | 2739346517 | |||
| 2225 | 2739612191 | |||
| 2226 | 2765569008 | |||
| 2227 | 2808984484 | |||
| 2228 | 2809031988 | |||
| 2229 | 2809131211 | |||
| 2230 | 2809145417 | |||
| 2231 | 2809150454 | |||
| 2232 | 2817260408 | |||
| 2233 | 2817278096 | |||
| 2234 | 2817455663 | |||
| 2235 | 2819542544 | |||
| 2236 | 2819591176 | |||
| 2237 | 2819614972 | |||
| 2238 | 2819632934 | |||
| 2239 | 2821131624 | |||
| 2240 | 2839096107 | |||
| 2241 | 2842717742 | |||
| 2242 | 2852621970 | |||
| 2243 | 2855734598 | |||
| 2244 | 2855770188 | |||
| 2245 | 2856292749 | |||
| 2246 | 2857360983 | |||
| 2247 | 2857538471 | |||
| 2248 | 2857546625 | |||
| 2249 | 2857550302 | |||
| 2250 | 2857554478 | |||
| 2251 | 2857559443 | |||
| 2252 | 2857564715 | |||
| 2253 | 2858955739 | |||
| 2254 | 2863421945 | |||
| 2255 | 2870072113 | |||
| 2256 | 2881414409 | |||
| 2257 | 2881930290 | |||
| 2258 | 2884812294 | |||
| 2259 | 2884836901 | |||
| 2260 | 2884853192 | |||
| 2261 | 2885085394 | |||
| 2262 | 2885266799 | |||
| 2263 | 2887377889 | |||
| 2264 | 2895516613 | |||
| 2265 | 2896155690 | |||
| 2266 | 2900578666 | |||
| 2267 | 2904425973 | |||
| 2268 | 2904441346 | |||
| 2269 | 2904531714 | |||
| 2270 | 2904566110 | |||
| 2271 | 2904573154 | |||
| 2272 | 2904588061 | |||
| 2273 | 2904589779 | |||
| 2274 | 2904602835 | |||
| 2275 | 2919046350 | |||
| 2276 | 2919079661 | |||
| 2277 | 2919478418 | |||
| 2278 | 2923511120 | |||
| 2279 | 2928041924 | |||
| 2280 | 2928049488 | |||
| 2281 | 2928062875 | |||
| 2282 | 2928131056 | |||
| 2283 | 2928159474 | |||
| 2284 | 2928164466 | |||
| 2285 | 2928177550 | |||
| 2286 | 2928538324 | |||
| 2287 | 2932411276 | |||
| 2288 | 2932419157 | |||
| 2289 | 2941481929 | |||
| 2290 | 2981993908 | |||
| 2291 | 642417212 | |||
| 2292 | 8002395009 | |||
| 2293 | 8018850379 | |||
| 2294 | 8020808839 | |||
| 2295 | 8020939405 | |||
| 2296 | 8020947192 | |||
| 2297 | 8020954371 | |||
| 2298 | 8021122841 | |||
| 2299 | 8039102778 | |||
| 2300 | 8040169288 | |||
| 2301 | 8040175007 | |||
| 2302 | 8047673772 | |||
| 2303 | 8048749766 | |||
| 2304 | 8055227947 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dfe-assembly1.cif.gz_D | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from burkholderia xenovorans | 0.9923 | 2 | 326 |
| 4dfe-assembly2.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from burkholderia xenovorans | 0.9922 | 2 | 326 |
| 4dfe-assembly2.cif.gz_C | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from burkholderia xenovorans | 0.9907 | 2 | 326 |
| 4ryb-assembly1.cif.gz_B | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from neisseria meningitidis | 0.9901 | 4 | 326 |
| 4dfe-assembly1.cif.gz_D | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from burkholderia xenovorans | 0.9892 | 2 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6R0_1_317_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9781 | 4 | 326 | 3.40.47.10 |
| af_Q2FZS0_1_313_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9725 | 4 | 326 | 3.40.47.10 |
| 1hnkA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9723 | 180 | 326 | 3.40.47.10 |
| af_P0A6R0_1_317_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.972 | 4 | 326 | 3.40.47.10 |
| 1zowB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9704 | 4 | 179 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C8BIH8-F1-model_v4 | deleted | 0.9945 | 4 | 133 |
|
| AF-A0A259CS22-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9938 | 1 | 146 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A1KRY9-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9915 | 3 | 326 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 |
| AF-A0A496W691-F1-model_v4 | 3-oxoacyl-ACP synthase (EC 2.3.1.180) | 0.989 | 115 | 326 |
GO:0004315
GO:0006633 GO:0033818 |
| AF-I2NS20-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9879 | 2 | 326 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 |