F490882

General Info

Members Datasets Scaffolds Average Seq Length
1152 555 2304 297

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2921643360|2921645893
Length 350
Sequence TADVADVMSAPRASNAAQIDLARRKFRMIVRRFRECGSIRDTRLEYAKDTEMNTETILPIRGSVPAIVTPMHDDGSLDLPAFRKLLDWHVEQGSNGLVVVGTSGESATLTVDEHILMVKTAVEHAAGRIPVIAGAGANSTAEAVELSELSKQVGADATLQVVPYYNKPTQEGMYRHFRTIAESVDLPMILYNVPGRTVTDMSNETILRLAGIPGIIGVKDATGNIERGVHLIKHAPVDFGIYSGDDATAITLMLLGGHGNISVTANIAPNAMSALCRAALEGDAITARRHHLRLLSLHKHLFCEANPMPVKWALQALGRIEGGIRLPLTPLDERYHDVVRSALREAELLA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
144 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
149 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
159 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
160 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
163 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
231 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
239 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
240 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
241 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
242 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
243 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
244 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
245 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
246 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
247 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
263 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
264 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
265 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
266 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
269 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
272 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
273 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
274 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
275 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
277 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
287 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
288 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
289 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
290 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
291 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
292 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
293 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
294 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
295 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
296 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
297 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
298 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
299 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
300 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
301 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
302 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
308 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
309 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
310 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
311 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
316 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
317 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
318 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
319 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
320 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
324 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
325 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
332 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
333 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
334 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
335 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
336 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
337 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
347 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
348 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
351 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
358 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
359 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
360 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
365 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
366 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
367 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
368 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
369 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
375 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
388 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
392 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
393 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
394 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
395 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
396 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
397 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
398 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
399 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
400 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
401 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
402 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
403 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
404 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
405 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
406 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
414 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
415 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
416 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
422 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
423 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
424 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
425 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
426 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
427 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
428 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
429 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
430 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
431 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
432 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
433 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
434 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
435 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
436 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
437 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
438 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
439 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
440 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
441 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
442 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
443 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
444 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
445 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
446 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
447 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
462 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
463 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
464 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
465 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
466 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
467 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
468 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
469 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
470 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
471 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
472 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
473 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
474 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
475 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
476 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
477 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
478 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
479 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
480 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
481 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
482 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
483 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
484 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
485 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
486 2643221585 Pelomonas sp. Root662 Isolate Unclassified
487 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
488 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
489 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
490 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
491 2643221656 Pelomonas sp. Root405 Isolate Unclassified
492 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
493 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
494 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
495 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
496 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
497 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
498 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
499 2738541337 Pelomonas sp. BT06 Isolate Unclassified
500 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
501 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
502 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
503 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
504 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
505 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
506 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
507 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
508 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
509 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
510 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
511 2818991450 Burkholderia sp. 604 Isolate Unclassified
512 2818991452 Burkholderia cepacia 561 Isolate Unclassified
513 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
514 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
515 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
516 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
517 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
518 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
519 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
520 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
521 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
522 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
523 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
524 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
525 2904564687 Burkholderia sp. 571 Isolate Unclassified
526 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
527 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
528 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
529 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
530 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
531 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
532 2928163908 Burkholderia sp. 567 Isolate Unclassified
533 2928170801 Burkholderia sp. 572 Isolate Unclassified
534 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
535 2928536128 Burkholderia sola 565 Isolate Unclassified
536 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
537 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
538 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
539 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
540 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
541 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
542 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
543 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
544 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
545 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
546 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
547 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
548 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
549 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
550 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
551 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
552 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
553 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
554 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
555 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.76
Metatranscriptomes 2.26
Isolates 7.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.02
Nodule 1.82
Rhizoplane 3.56
Rhizosphere 72.14
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2039426 2162886007 Bacteria 1042
2 JGI24741J21665_1000144 3300001915 Bacteria 19905
3 JGI24740J21852_10000627 3300001979 Bacteria 15195
4 JGI24740J21852_10000861 3300001979 Bacteria 13400
5 JGI24740J21852_10012655 3300001979 Bacteria 3174
6 JGI24739J22299_10022435 3300001989 Bacteria 2239
7 JGI24735J21928_10002167 3300002067 Bacteria 6892
8 JGI24735J21928_10002787 3300002067 Bacteria 6034
9 JGI24735J21928_10051380 3300002067 Bacteria 1190
10 JGI25156J39149_1000345 3300002705 Bacteria 30203
11 JGI25156J39149_1001710 3300002705 Bacteria 8829
12 JGI25156J39149_1006717 3300002705 Bacteria 3105
13 JGI25156J39149_1007238 3300002705 Bacteria 2940
14 JGI25156J39149_1012668 3300002705 Bacteria 1839
15 JGI25154J39366_1000622 3300002738 Bacteria 16863
16 JGI25157J39369_1000140 3300002741 Bacteria 61184
17 JGI25160J50197_1000215 3300003354 Bacteria 46728
18 Ga0055538_1001968 3300003751 Bacteria 3355
19 Ga0055539_1000034 3300003752 Bacteria 223400
20 Ga0055539_1000530 3300003752 Bacteria 11618
21 Ga0055539_1002368 3300003752 Bacteria 2930
22 Ga0055533_1000011 3300003756 Bacteria 467893
23 Ga0055533_1003245 3300003756 Bacteria 3343
24 Ga0055533_1003722 3300003756 Bacteria 2968
25 Ga0055533_1005086 3300003756 Bacteria 2204
26 Ga0055532_1000001 3300003758 Bacteria 1119836
27 Ga0055532_1000002 3300003758 Bacteria 576000
28 Ga0055532_1000836 3300003758 Bacteria 10436
29 Ga0055525_1000533 3300003759 Bacteria 18220
30 Ga0055527_1000002 3300003760 Bacteria 830488
31 Ga0055527_1000674 3300003760 Bacteria 10218
32 Ga0055527_1000729 3300003760 Bacteria 9342
33 Ga0055527_1001710 3300003760 Bacteria 4283
34 Ga0055535_1000001 3300003761 Bacteria 1119836
35 Ga0055535_1000107 3300003761 Bacteria 89840
36 Ga0055535_1001579 3300003761 Bacteria 10989
37 Ga0055535_1001580 3300003761 Bacteria 10976
38 Ga0055542_1000001 3300003762 Bacteria 1119836
39 Ga0055542_1001541 3300003762 Bacteria 11021
40 Ga0055542_1002294 3300003762 Bacteria 6606
41 Ga0055542_1003814 3300003762 Bacteria 3908
42 Ga0055529_1000001 3300003763 Bacteria 826680
43 Ga0055529_1000028 3300003763 Bacteria 287650
44 Ga0055529_1000111 3300003763 Bacteria 118734
45 Ga0055529_1001017 3300003763 Bacteria 13462
46 Ga0055528_1003021 3300003790 Bacteria 8680
47 Ga0055530_10002750 3300003791 Bacteria 10882
48 Ga0055540_1000086 3300003792 Bacteria 102576
49 Ga0055531_10004962 3300003794 Bacteria 7902
50 Ga0055531_10025706 3300003794 Bacteria 2128
51 Ga0055541_1000537 3300003841 Bacteria 10407
52 Ga0055541_1002865 3300003841 Bacteria 3338
53 Ga0055541_1011465 3300003841 Bacteria 1300
54 Ga0058692_1019004 3300003856 Bacteria 1473
55 Ga0065165_1000716 3300005262 Bacteria 46755
56 Ga0065712_10116128 3300005290 Bacteria 1741
57 Ga0065715_10031146 3300005293 Bacteria 1860
58 Ga0070658_10021383 3300005327 Bacteria 5186
59 Ga0070658_10031801 3300005327 Bacteria 4239
60 Ga0070658_10068996 3300005327 Bacteria 2891
61 Ga0070676_10002922 3300005328 Bacteria 8826
62 Ga0070676_10011527 3300005328 Bacteria 4807
63 Ga0070676_10030530 3300005328 Bacteria 3074
64 Ga0070690_100017599 3300005330 Bacteria 4302
65 Ga0070690_100027157 3300005330 Bacteria 3537
66 Ga0070690_100262014 3300005330 Bacteria 1227
67 Ga0070670_100003531 3300005331 Bacteria 13001
68 Ga0070670_100006355 3300005331 Bacteria 10000
69 Ga0068869_100000806 3300005334 Bacteria 17893
70 Ga0068869_100015988 3300005334 Bacteria 5051
71 Ga0068869_100096045 3300005334 Bacteria 2237
72 Ga0070666_10010690 3300005335 Bacteria 5746
73 Ga0070666_10030635 3300005335 Bacteria 3545
74 Ga0070666_10178450 3300005335 Bacteria 1489
75 Ga0070680_100000656 3300005336 Bacteria 23985
76 Ga0070680_100087622 3300005336 Bacteria 2575
77 Ga0070682_100002698 3300005337 Bacteria 9824
78 Ga0070682_100012869 3300005337 Bacteria 4802
79 Ga0070682_100046991 3300005337 Bacteria 2681
80 Ga0068868_100001558 3300005338 Bacteria 15670
81 Ga0068868_100003706 3300005338 Bacteria 10675
82 Ga0068868_100015109 3300005338 Bacteria 5703
83 Ga0068868_100136781 3300005338 Bacteria 2009
84 Ga0068868_100196211 3300005338 Bacteria 1681
85 Ga0070660_100000038 3300005339 Bacteria 77397
86 Ga0070660_100027390 3300005339 Bacteria 4252
87 Ga0070660_100139664 3300005339 Bacteria 1943
88 Ga0070660_100202775 3300005339 Bacteria 1609
89 Ga0070660_100202878 3300005339 Bacteria 1609
90 Ga0070689_100000287 3300005340 Bacteria 29278
91 Ga0070691_10000629 3300005341 Bacteria 13578
92 Ga0070691_10133581 3300005341 Bacteria 1259
93 Ga0070687_100000294 3300005343 Bacteria 16865
94 Ga0070661_100000063 3300005344 Bacteria 85407
95 Ga0070661_100000925 3300005344 Bacteria 21020
96 Ga0070661_100155457 3300005344 Bacteria 1730
97 Ga0070692_10000189 3300005345 Bacteria 16292
98 Ga0070668_100073813 3300005347 Bacteria 2660
99 Ga0070669_100096419 3300005353 Unclassified 2225
100 Ga0070675_100000705 3300005354 Bacteria 23206
101 Ga0070675_100022116 3300005354 Bacteria 5080
102 Ga0070675_100031170 3300005354 Bacteria 4309
103 Ga0070671_100010760 3300005355 Bacteria 7342
104 Ga0070671_100041517 3300005355 Bacteria 3824
105 Ga0070671_100044520 3300005355 Bacteria 3688
106 Ga0070671_100075490 3300005355 Bacteria 2816
107 Ga0070671_100123452 3300005355 Bacteria 2180
108 Ga0070674_100001477 3300005356 Bacteria 12539
109 Ga0070674_100139402 3300005356 Bacteria 1818
110 Ga0070674_100265816 3300005356 Bacteria 1354
111 Ga0070673_100000461 3300005364 Bacteria 21571
112 Ga0070673_100003618 3300005364 Bacteria 9672
113 Ga0070673_100005502 3300005364 Bacteria 8114
114 Ga0070688_100082891 3300005365 Bacteria 2080
115 Ga0070659_100000050 3300005366 Bacteria 97735
116 Ga0070659_100000856 3300005366 Bacteria 22237
117 Ga0070659_100050374 3300005366 Bacteria 3274
118 Ga0070659_100066724 3300005366 Bacteria 2852
119 Ga0070659_100279568 3300005366 Bacteria 1388
120 Ga0070667_100508219 3300005367 Bacteria 1105
121 Ga0070703_10020538 3300005406 Bacteria 1922
122 Ga0070701_10000231 3300005438 Bacteria 17724
123 Ga0070705_100007282 3300005440 Bacteria 5444
124 Ga0070700_100001183 3300005441 Bacteria 12914
125 Ga0070700_100046892 3300005441 Bacteria 2672
126 Ga0070694_100000090 3300005444 Bacteria 43268
127 Ga0070708_100257895 3300005445 Bacteria 1639
128 Ga0070708_100287057 3300005445 Bacteria 1549
129 Ga0070663_100000006 3300005455 Bacteria 208068
130 Ga0070663_100000241 3300005455 Bacteria 27729
131 Ga0070663_100000949 3300005455 Bacteria 15767
132 Ga0070663_100078433 3300005455 Bacteria 2421
133 Ga0070678_100001562 3300005456 Bacteria 12256
134 Ga0070678_100005008 3300005456 Bacteria 7593
135 Ga0070662_100009580 3300005457 Bacteria 6337
136 Ga0068867_100000077 3300005459 Bacteria 59836
137 Ga0068867_100000193 3300005459 Bacteria 40228
138 Ga0068867_100000595 3300005459 Bacteria 23912
139 Ga0068867_100001297 3300005459 Bacteria 17261
140 Ga0068867_100009829 3300005459 Bacteria 6741
141 Ga0068867_100155782 3300005459 Bacteria 1798
142 Ga0070685_10028099 3300005466 Bacteria 3115
143 Ga0070707_100314425 3300005468 Bacteria 1522
144 Ga0070679_100061340 3300005530 Bacteria 3748
145 Ga0070679_100371634 3300005530 Bacteria 1377
146 Ga0070684_100135255 3300005535 Bacteria 2226
147 Ga0070684_100137344 3300005535 Bacteria 2209
148 Ga0070697_100044817 3300005536 Bacteria 3583
149 Ga0068853_100122982 3300005539 Bacteria 2317
150 Ga0070672_100001799 3300005543 Bacteria 13420
151 Ga0070672_100007542 3300005543 Bacteria 7391
152 Ga0070672_100095286 3300005543 Bacteria 2407
153 Ga0070686_100000815 3300005544 Bacteria 18064
154 Ga0070686_100169621 3300005544 Bacteria 1543
155 Ga0070695_100000079 3300005545 Bacteria 39939
156 Ga0070696_100000170 3300005546 Bacteria 37218
157 Ga0070693_100000321 3300005547 Bacteria 22045
158 Ga0070693_100282992 3300005547 Bacteria 1111
159 Ga0070665_100027188 3300005548 Bacteria 5762
160 Ga0070704_100000445 3300005549 Bacteria 19437
161 Ga0068855_100004969 3300005563 Bacteria 16223
162 Ga0068855_100013802 3300005563 Bacteria 9739
163 Ga0068855_100091418 3300005563 Bacteria 3510
164 Ga0070664_100000002 3300005564 Bacteria 458815
165 Ga0070664_100000939 3300005564 Bacteria 22774
166 Ga0070664_100040529 3300005564 Bacteria 3926
167 Ga0070664_100075421 3300005564 Bacteria 2896
168 Ga0070664_100372771 3300005564 Bacteria 1301
169 Ga0068857_100004824 3300005577 Bacteria 11424
170 Ga0068857_100011502 3300005577 Bacteria 7700
171 Ga0068857_100015530 3300005577 Bacteria 6652
172 Ga0068857_100244433 3300005577 Bacteria 1644
173 Ga0068854_100000093 3300005578 Bacteria 63395
174 Ga0068854_100008409 3300005578 Bacteria 6633
175 Ga0068854_100028789 3300005578 Bacteria 3841
176 Ga0068856_100000028 3300005614 Bacteria 131498
177 Ga0068856_100001841 3300005614 Bacteria 22179
178 Ga0068856_100005486 3300005614 Bacteria 12496
179 Ga0068856_100199385 3300005614 Bacteria 2016
180 Ga0070702_100000068 3300005615 Bacteria 29170
181 Ga0070702_100104809 3300005615 Bacteria 1741
182 Ga0068852_100010615 3300005616 Bacteria 6892
183 Ga0068852_100044334 3300005616 Bacteria 3776
184 Ga0068852_100111772 3300005616 Bacteria 2485
185 Ga0068852_100195807 3300005616 Bacteria 1910
186 Ga0068852_100235983 3300005616 Bacteria 1746
187 Ga0068859_100002721 3300005617 Bacteria 17925
188 Ga0068859_100627625 3300005617 Bacteria 1167
189 Ga0068864_100124104 3300005618 Bacteria 2312
190 Ga0068866_10000631 3300005718 Bacteria 15998
191 Ga0068861_100000070 3300005719 Bacteria 49394
192 Ga0068861_100005003 3300005719 Bacteria 8933
193 Ga0068851_10044639 3300005834 Bacteria 2238
194 Ga0068870_10027764 3300005840 Bacteria 2835
195 Ga0068870_10057850 3300005840 Bacteria 2074
196 Ga0068870_10068189 3300005840 Bacteria 1932
197 Ga0068863_100106860 3300005841 Bacteria 2663
198 Ga0068863_100229751 3300005841 Unclassified 1789
199 Ga0068858_100151179 3300005842 Unclassified 2183
200 Ga0068860_100002032 3300005843 Bacteria 21330
201 Ga0068860_100002262 3300005843 Bacteria 20241
202 Ga0068860_100100083 3300005843 Bacteria 2765
203 Ga0068862_100000975 3300005844 Bacteria 27450
204 Ga0068862_100017347 3300005844 Bacteria 5994
205 Ga0068862_100047947 3300005844 Bacteria 3646
206 Ga0081538_10082418 3300005981 Bacteria 1705
207 Ga0075369_10014963 3300006186 Bacteria 3106
208 Ga0075366_10004344 3300006195 Bacteria 7598
209 Ga0075366_10016872 3300006195 Bacteria 4197
210 Ga0075366_10146588 3300006195 Bacteria 1428
211 Ga0097621_100000468 3300006237 Bacteria 28316
212 Ga0097621_100005461 3300006237 Bacteria 8948
213 Ga0075370_10004840 3300006353 Bacteria 6602
214 Ga0075370_10196104 3300006353 Bacteria 1191
215 Ga0068871_100000188 3300006358 Bacteria 42040
216 Ga0068871_100127957 3300006358 Bacteria 2151
217 Ga0075428_100000109 3300006844 Bacteria 69948
218 Ga0075433_10001494 3300006852 Bacteria 17286
219 Ga0075434_100000349 3300006871 Bacteria 33394
220 Ga0075429_100001875 3300006880 Bacteria 17419
221 Ga0075429_100159723 3300006880 Bacteria 1974
222 Ga0075429_100208126 3300006880 Bacteria 1714
223 Ga0068865_100000774 3300006881 Bacteria 17943
224 Ga0068865_100327377 3300006881 Bacteria 1234
225 Ga0075436_100000075 3300006914 Bacteria 59554
226 Ga0097620_100002721 3300006931 Bacteria 17925
227 Ga0097620_100627646 3300006931 Bacteria 1167
228 Ga0079104_1000100 3300006946 Bacteria 126924
229 Ga0075435_100000116 3300007076 Bacteria 44259
230 Ga0105251_10014567 3300009011 Bacteria 4338
231 Ga0105251_10024466 3300009011 Bacteria 3101
232 Ga0105250_10024917 3300009092 Bacteria 2410
233 Ga0105240_10001133 3300009093 Bacteria 46680
234 Ga0105240_10012059 3300009093 Bacteria 11976
235 Ga0105240_10068505 3300009093 Bacteria 4394
236 Ga0105240_10068991 3300009093 Bacteria 4377
237 Ga0105240_10094404 3300009093 Bacteria 3649
238 Ga0105240_10146689 3300009093 Bacteria 2815
239 Ga0105240_10410498 3300009093 Bacteria 1523
240 Ga0111539_10000444 3300009094 Bacteria 52248
241 Ga0111539_10006398 3300009094 Bacteria 15194
242 Ga0111539_10057135 3300009094 Bacteria 4635
243 Ga0111539_10445217 3300009094 Bacteria 1508
244 Ga0105245_10001758 3300009098 Bacteria 19754
245 Ga0105245_10430032 3300009098 Bacteria 1325
246 Ga0114129_10018282 3300009147 Bacteria 9983
247 Ga0105243_10004393 3300009148 Bacteria 11153
248 Ga0105243_10010169 3300009148 Bacteria 7154
249 Ga0105243_10035296 3300009148 Bacteria 3876
250 Ga0105241_10145061 3300009174 Bacteria 1936
251 Ga0105242_10000161 3300009176 Bacteria 50082
252 Ga0105248_10014983 3300009177 Bacteria 8535
253 Ga0105248_10226578 3300009177 Bacteria 2104
254 Ga0105248_10314554 3300009177 Bacteria 1764
255 Ga0105248_10430174 3300009177 Bacteria 1487
256 Ga0105237_10022667 3300009545 Bacteria 6441
257 Ga0105238_10008987 3300009551 Bacteria 10001
258 Ga0105238_10432165 3300009551 Bacteria 1312
259 Ga0105238_10519790 3300009551 Bacteria 1193
260 Ga0105238_10655904 3300009551 Bacteria 1060
261 Ga0105249_10003947 3300009553 Bacteria 12806
262 Ga0105249_10006488 3300009553 Bacteria 10176
263 Ga0105239_10004444 3300010375 Bacteria 16761
264 Ga0105239_10039318 3300010375 Bacteria 5183
265 Ga0105239_10067176 3300010375 Bacteria 3938
266 Ga0105246_10141931 3300011119 Bacteria 1807
267 Ga0157373_10014860 3300013100 Bacteria 5702
268 Ga0157371_10012934 3300013102 Bacteria 6355
269 Ga0157371_10032474 3300013102 Bacteria 3756
270 Ga0157370_10000013 3300013104 Bacteria 198861
271 Ga0157370_10000764 3300013104 Bacteria 40254
272 Ga0157370_10006887 3300013104 Bacteria 12440
273 Ga0157370_10066875 3300013104 Bacteria 3397
274 Ga0157369_10000726 3300013105 Bacteria 42440
275 Ga0157369_10001607 3300013105 Bacteria 27644
276 Ga0157369_10006810 3300013105 Bacteria 13180
277 Ga0157369_10034666 3300013105 Bacteria 5537
278 Ga0157369_10061086 3300013105 Bacteria 4063
279 Ga0157369_10161938 3300013105 Bacteria 2362
280 Ga0157369_10258550 3300013105 Bacteria 1816
281 Ga0157374_10000032 3300013296 Bacteria 202485
282 Ga0157374_10017084 3300013296 Bacteria 6387
283 Ga0157374_10111839 3300013296 Unclassified 2628
284 Ga0157378_10001289 3300013297 Bacteria 22567
285 Ga0157378_10001854 3300013297 Bacteria 18981
286 Ga0157378_10012803 3300013297 Bacteria 7343
287 Ga0157378_10073646 3300013297 Bacteria 3071
288 Ga0163162_10008349 3300013306 Bacteria 10096
289 Ga0163162_10020229 3300013306 Bacteria 6536
290 Ga0163162_10037313 3300013306 Bacteria 4849
291 Ga0163162_10298003 3300013306 Bacteria 1744
292 Ga0157372_10003169 3300013307 Bacteria 17739
293 Ga0157375_10002284 3300013308 Bacteria 16578
294 Ga0157375_10040469 3300013308 Bacteria 4493
295 Ga0157375_10114845 3300013308 Bacteria 2795
296 Ga0157380_10018117 3300014326 Bacteria 5223
297 Ga0157380_10345773 3300014326 Bacteria 1389
298 Ga0182008_10123857 3300014497 Bacteria 1286
299 Ga0157377_10000094 3300014745 Bacteria 64283
300 Ga0157377_10050107 3300014745 Bacteria 2350
301 Ga0157379_10134736 3300014968 Bacteria 2225
302 Ga0157379_10311795 3300014968 Bacteria 1435
303 Ga0157376_10000457 3300014969 Bacteria 26365
304 Ga0157376_10105541 3300014969 Bacteria 2471
305 Ga0157376_10190837 3300014969 Bacteria 1879
306 Ga0182006_1000486 3300015261 Bacteria 31112
307 Ga0182007_10000339 3300015262 Bacteria 29721
308 Ga0182007_10002603 3300015262 Bacteria 8886
309 Ga0182007_10029330 3300015262 Bacteria 1884
310 Ga0183361_10006 3300016635 Bacteria 368532
311 Ga0163161_10327949 3300017792 Bacteria 1212
312 Ga0197907_10786487 3300020069 Bacteria 2350
313 Ga0206356_11063903 3300020070 Bacteria 1274
314 Ga0206356_11271715 3300020070 Bacteria 2395
315 Ga0206349_1746600 3300020075 Bacteria 1070
316 Ga0206355_1314553 3300020076 Bacteria 2697
317 Ga0206351_10276860 3300020077 Bacteria 13540
318 Ga0206350_10136400 3300020080 Bacteria 2710
319 Ga0206353_10640594 3300020082 Bacteria 3136
320 Ga0154015_1572807 3300020610 Bacteria 29913
321 Ga0213872_10000992 3300021361 Bacteria 19860
322 Ga0224712_10000016 3300022467 Bacteria 25742
323 Ga0209784_100003 3300025224 Bacteria 1379451
324 Ga0209784_100793 3300025224 Bacteria 7485
325 Ga0209566_100002 3300025225 Bacteria 2614868
326 Ga0209566_100534 3300025225 Bacteria 25886
327 Ga0209566_101105 3300025225 Bacteria 10413
328 Ga0209566_101161 3300025225 Bacteria 9641
329 Ga0209674_100003 3300025226 Bacteria 2196646
330 Ga0209674_100005 3300025226 Bacteria 1708125
331 Ga0209674_100008 3300025226 Bacteria 1076909
332 Ga0209674_100179 3300025226 Bacteria 77366
333 Ga0209674_100334 3300025226 Bacteria 28536
334 Ga0209674_103262 3300025226 Bacteria 3054
335 Ga0209674_103950 3300025226 Bacteria 2555
336 Ga0209672_100001 3300025228 Bacteria 2828210
337 Ga0209672_100014 3300025228 Bacteria 546252
338 Ga0209672_100023 3300025228 Bacteria 371758
339 Ga0209672_100052 3300025228 Bacteria 231179
340 Ga0209672_100191 3300025228 Bacteria 49747
341 Ga0209147_100001 3300025229 Bacteria 2384371
342 Ga0209147_100002 3300025229 Bacteria 2158988
343 Ga0209147_100127 3300025229 Bacteria 123986
344 Ga0209147_100171 3300025229 Bacteria 86726
345 Ga0209147_102551 3300025229 Bacteria 4387
346 Ga0209563_100004 3300025230 Bacteria 1814108
347 Ga0209563_100010 3300025230 Bacteria 1337457
348 Ga0209563_100968 3300025230 Bacteria 8416
349 Ga0209563_107376 3300025230 Bacteria 1810
350 Ga0207427_100403 3300025231 Bacteria 25278
351 Ga0207427_102749 3300025231 Bacteria 4342
352 Ga0209258_100001 3300025242 Bacteria 2384269
353 Ga0209258_100002 3300025242 Bacteria 2158988
354 Ga0209258_100134 3300025242 Bacteria 174683
355 Ga0209258_100183 3300025242 Bacteria 136466
356 Ga0209258_100267 3300025242 Bacteria 89896
357 Ga0209646_1000022 3300025246 Bacteria 446621
358 Ga0209646_1000142 3300025246 Bacteria 106607
359 Ga0209026_1000027 3300025250 Bacteria 351282
360 Ga0209026_1003742 3300025250 Bacteria 4828
361 Ga0209677_100009 3300025253 Bacteria 749530
362 Ga0209677_100083 3300025253 Bacteria 117063
363 Ga0209677_101097 3300025253 Bacteria 12715
364 Ga0209677_102324 3300025253 Bacteria 7309
365 Ga0209148_1000003 3300025254 Bacteria 2384288
366 Ga0209148_1000021 3300025254 Bacteria 714645
367 Ga0209148_1000035 3300025254 Bacteria 548413
368 Ga0209148_1000759 3300025254 Bacteria 24653
369 Ga0209759_1000152 3300025256 Bacteria 119866
370 Ga0209759_1000223 3300025256 Bacteria 85074
371 Ga0209759_1000632 3300025256 Bacteria 33347
372 Ga0209759_1001047 3300025256 Bacteria 18429
373 Ga0209759_1001331 3300025256 Bacteria 14498
374 Ga0209759_1003570 3300025256 Bacteria 6152
375 Ga0209759_1005317 3300025256 Bacteria 4543
376 Ga0209759_1005697 3300025256 Bacteria 4300
377 Ga0209759_1006126 3300025256 Bacteria 4092
378 Ga0209759_1006134 3300025256 Bacteria 4090
379 Ga0209233_1000016 3300025261 Bacteria 907830
380 Ga0209565_1020529 3300025263 Bacteria 1392
381 Ga0209455_1000001 3300025272 Bacteria 2384278
382 Ga0209455_1000021 3300025272 Bacteria 699993
383 Ga0209455_1000072 3300025272 Bacteria 293074
384 Ga0209455_1000158 3300025272 Bacteria 118973
385 Ga0209455_1001083 3300025272 Bacteria 13412
386 Ga0209673_1000140 3300025273 Bacteria 157575
387 Ga0209130_1007182 3300025284 Bacteria 3487
388 Ga0209675_1019043 3300025291 Bacteria 1902
389 Ga0209564_1019659 3300025295 Bacteria 2514
390 Ga0209564_1027380 3300025295 Bacteria 1853
391 Ga0209050_1001494 3300025298 Bacteria 24797
392 Ga0209050_1010817 3300025298 Bacteria 4432
393 Ga0209256_1000071 3300025299 Bacteria 242618
394 Ga0207426_1000245 3300025302 Bacteria 120041
395 Ga0209051_1000210 3300025303 Bacteria 102629
396 Ga0209051_1023851 3300025303 Bacteria 2533
397 Ga0209257_1000017 3300025304 Bacteria 866287
398 Ga0209257_1000179 3300025304 Bacteria 158484
399 Ga0209257_1000314 3300025304 Bacteria 102629
400 Ga0207697_10005251 3300025315 Bacteria 6039
401 Ga0207656_10031678 3300025321 Bacteria 2193
402 Ga0207696_1052071 3300025711 Bacteria 1168
403 Ga0207713_1000202 3300025735 Bacteria 81787
404 Ga0207713_1003263 3300025735 Bacteria 11174
405 Ga0207653_10006510 3300025885 Bacteria 3645
406 Ga0207682_10005848 3300025893 Bacteria 4986
407 Ga0207682_10008342 3300025893 Bacteria 4098
408 Ga0207642_10000249 3300025899 Bacteria 16057
409 Ga0207680_10003802 3300025903 Bacteria 7112
410 Ga0207680_10039180 3300025903 Bacteria 2748
411 Ga0207647_10001142 3300025904 Bacteria 20402
412 Ga0207647_10003351 3300025904 Bacteria 12017
413 Ga0207647_10037588 3300025904 Bacteria 3068
414 Ga0207647_10079403 3300025904 Bacteria 1970
415 Ga0207647_10089176 3300025904 Bacteria 1841
416 Ga0207699_10037202 3300025906 Bacteria 2780
417 Ga0207645_10001701 3300025907 Bacteria 17857
418 Ga0207645_10009891 3300025907 Bacteria 6572
419 Ga0207645_10056494 3300025907 Bacteria 2506
420 Ga0207645_10084194 3300025907 Bacteria 2041
421 Ga0207643_10018310 3300025908 Bacteria 3836
422 Ga0207705_10000844 3300025909 Bacteria 25085
423 Ga0207705_10004402 3300025909 Bacteria 10642
424 Ga0207705_10086851 3300025909 Bacteria 2286
425 Ga0207654_10028204 3300025911 Bacteria 3059
426 Ga0207707_10067875 3300025912 Bacteria 3106
427 Ga0207707_10071830 3300025912 Bacteria 3016
428 Ga0207695_10009153 3300025913 Bacteria 12290
429 Ga0207695_10009853 3300025913 Bacteria 11742
430 Ga0207695_10018069 3300025913 Bacteria 8162
431 Ga0207695_10021832 3300025913 Bacteria 7290
432 Ga0207695_10030671 3300025913 Bacteria 5916
433 Ga0207695_10045161 3300025913 Bacteria 4679
434 Ga0207671_10081233 3300025914 Bacteria 2431
435 Ga0207660_10003897 3300025917 Bacteria 9726
436 Ga0207662_10000064 3300025918 Bacteria 46399
437 Ga0207662_10015905 3300025918 Bacteria 4239
438 Ga0207657_10000122 3300025919 Bacteria 77380
439 Ga0207657_10000330 3300025919 Bacteria 50190
440 Ga0207649_10000118 3300025920 Bacteria 67180
441 Ga0207649_10001141 3300025920 Bacteria 16077
442 Ga0207649_10111638 3300025920 Bacteria 1827
443 Ga0207649_10169034 3300025920 Bacteria 1521
444 Ga0207694_10027215 3300025924 Bacteria 4353
445 Ga0207694_10058075 3300025924 Bacteria 3009
446 Ga0207694_10085713 3300025924 Bacteria 2480
447 Ga0207694_10582120 3300025924 Bacteria 941
448 Ga0207650_10004854 3300025925 Bacteria 9184
449 Ga0207650_10020670 3300025925 Unclassified 4645
450 Ga0207650_10053761 3300025925 Bacteria 2986
451 Ga0207659_10009905 3300025926 Bacteria 5963
452 Ga0207659_10030120 3300025926 Bacteria 3704
453 Ga0207659_10031148 3300025926 Bacteria 3649
454 Ga0207687_10000267 3300025927 Bacteria 35541
455 Ga0207644_10001988 3300025931 Bacteria 13223
456 Ga0207644_10322018 3300025931 Bacteria 1250
457 Ga0207644_10349413 3300025931 Bacteria 1200
458 Ga0207690_10000047 3300025932 Bacteria 116333
459 Ga0207690_10000806 3300025932 Bacteria 20112
460 Ga0207690_10007376 3300025932 Bacteria 6527
461 Ga0207706_10002276 3300025933 Bacteria 18747
462 Ga0207706_10047673 3300025933 Bacteria 3790
463 Ga0207706_10364553 3300025933 Bacteria 1255
464 Ga0207706_10618290 3300025933 Bacteria 929
465 Ga0207686_10067842 3300025934 Bacteria 2283
466 Ga0207709_10000473 3300025935 Bacteria 36885
467 Ga0207709_10105700 3300025935 Bacteria 1871
468 Ga0207670_10019210 3300025936 Bacteria 4169
469 Ga0207670_10028136 3300025936 Bacteria 3564
470 Ga0207669_10005866 3300025937 Bacteria 5555
471 Ga0207669_10011044 3300025937 Bacteria 4376
472 Ga0207704_10000581 3300025938 Bacteria 16249
473 Ga0207704_10001884 3300025938 Bacteria 9386
474 Ga0207691_10000019 3300025940 Bacteria 133680
475 Ga0207691_10000361 3300025940 Bacteria 45833
476 Ga0207691_10012729 3300025940 Bacteria 8059
477 Ga0207691_10054976 3300025940 Bacteria 3630
478 Ga0207711_10086148 3300025941 Bacteria 2754
479 Ga0207711_10595550 3300025941 Bacteria 1031
480 Ga0207689_10000200 3300025942 Bacteria 52703
481 Ga0207689_10015822 3300025942 Bacteria 6388
482 Ga0207689_10031815 3300025942 Bacteria 4388
483 Ga0207689_10077819 3300025942 Bacteria 2726
484 Ga0207661_10028885 3300025944 Bacteria 4252
485 Ga0207679_10000001 3300025945 Bacteria 777444
486 Ga0207679_10000201 3300025945 Bacteria 48099
487 Ga0207679_10029874 3300025945 Bacteria 3799
488 Ga0207667_10001243 3300025949 Bacteria 31943
489 Ga0207667_10002763 3300025949 Bacteria 21703
490 Ga0207667_10016789 3300025949 Bacteria 8258
491 Ga0207667_10121488 3300025949 Bacteria 2691
492 Ga0207667_10212020 3300025949 Bacteria 1985
493 Ga0207651_10004395 3300025960 Bacteria 7096
494 Ga0207651_10031449 3300025960 Bacteria 3393
495 Ga0207712_10001270 3300025961 Bacteria 17369
496 Ga0207640_10000113 3300025981 Bacteria 60850
497 Ga0207640_10005815 3300025981 Bacteria 6724
498 Ga0207640_10006490 3300025981 Bacteria 6423
499 Ga0207640_10013476 3300025981 Bacteria 4688
500 Ga0207658_10196452 3300025986 Bacteria 1681
501 Ga0207677_10004351 3300026023 Bacteria 7588
502 Ga0207677_10044660 3300026023 Bacteria 2954
503 Ga0207677_10218490 3300026023 Bacteria 1527
504 Ga0207677_10373665 3300026023 Bacteria 1201
505 Ga0207703_10009109 3300026035 Bacteria 7816
506 Ga0207703_10056358 3300026035 Bacteria 3201
507 Ga0207703_10188688 3300026035 Bacteria 1824
508 Ga0207703_10473741 3300026035 Bacteria 1172
509 Ga0207639_10106451 3300026041 Bacteria 2276
510 Ga0207678_10000001 3300026067 Bacteria 433184
511 Ga0207678_10000251 3300026067 Bacteria 48485
512 Ga0207678_10000522 3300026067 Bacteria 34895
513 Ga0207678_10047296 3300026067 Bacteria 3721
514 Ga0207708_10001866 3300026075 Bacteria 15534
515 Ga0207708_10005405 3300026075 Bacteria 9412
516 Ga0207708_10160036 3300026075 Bacteria 1777
517 Ga0207702_10000009 3300026078 Bacteria 305906
518 Ga0207702_10001685 3300026078 Bacteria 21816
519 Ga0207702_10059569 3300026078 Bacteria 3252
520 Ga0207702_10076411 3300026078 Bacteria 2895
521 Ga0207702_10156003 3300026078 Bacteria 2081
522 Ga0207641_10311435 3300026088 Bacteria 1490
523 Ga0207648_10000193 3300026089 Bacteria 64119
524 Ga0207648_10000309 3300026089 Bacteria 53487
525 Ga0207648_10001698 3300026089 Bacteria 24073
526 Ga0207648_10004374 3300026089 Bacteria 14528
527 Ga0207648_10005619 3300026089 Bacteria 12603
528 Ga0207648_10109552 3300026089 Bacteria 2424
529 Ga0207674_10013210 3300026116 Bacteria 9183
530 Ga0207674_10028128 3300026116 Bacteria 5937
531 Ga0207675_100000089 3300026118 Bacteria 71258
532 Ga0207675_100112223 3300026118 Bacteria 2573
533 Ga0207675_100257609 3300026118 Bacteria 1690
534 Ga0207683_10000443 3300026121 Bacteria 38316
535 Ga0207683_10032306 3300026121 Bacteria 4547
536 Ga0207698_10002643 3300026142 Bacteria 10651
537 Ga0207698_10089109 3300026142 Bacteria 2518
538 Ga0207698_10273872 3300026142 Bacteria 1557
539 Ga0207698_10387682 3300026142 Bacteria 1331
540 Ga0209281_1000084 3300027111 Bacteria 254215
541 Ga0209371_1000079 3300027312 Bacteria 187621
542 Ga0209371_1006443 3300027312 Bacteria 4345
543 Ga0209969_1011643 3300027360 Bacteria 1265
544 Ga0209999_1006617 3300027543 Bacteria 2082
545 Ga0207428_10001059 3300027907 Bacteria 30205
546 Ga0207428_10002692 3300027907 Bacteria 17705
547 Ga0207428_10031335 3300027907 Bacteria 4388
548 Ga0207428_10094310 3300027907 Bacteria 2320
549 Ga0268266_10150619 3300028379 Unclassified 2096
550 Ga0268266_10543925 3300028379 Bacteria 1112
551 Ga0268265_10002816 3300028380 Bacteria 12795
552 Ga0268265_10010412 3300028380 Bacteria 6281
553 Ga0268265_10073719 3300028380 Bacteria 2667
554 Ga0268265_10198809 3300028380 Bacteria 1737
555 Ga0268264_10001651 3300028381 Bacteria 20603
556 Ga0268264_10005991 3300028381 Bacteria 10291
557 Ga0268264_10060358 3300028381 Bacteria 3178
558 Ga0268264_10469492 3300028381 Bacteria 1222
559 Ga0265336_10000008 3300028666 Bacteria 336082
560 Ga0307517_10000671 3300028786 Bacteria 58755
561 Ga0307517_10153306 3300028786 Bacteria 1573
562 Ga0307517_10155498 3300028786 Bacteria 1553
563 Ga0307515_10001283 3300028794 Bacteria 57022
564 Ga0307515_10036077 3300028794 Bacteria 8015
565 Ga0307515_10070801 3300028794 Bacteria 4739
566 Ga0307515_10086283 3300028794 Bacteria 4003
567 Ga0307515_10088603 3300028794 Bacteria 3909
568 Ga0307515_10137364 3300028794 Bacteria 2647
569 Ga0307515_10143815 3300028794 Bacteria 2540
570 Ga0307515_10262153 3300028794 Bacteria 1463
571 Ga0265324_10001714 3300029957 Bacteria 12059
572 Ga0268256_1000429 3300030500 Bacteria 37689
573 Ga0268256_1006028 3300030500 Bacteria 4610
574 Ga0307511_10000623 3300030521 Bacteria 37906
575 Ga0307512_10058658 3300030522 Bacteria 2996
576 Ga0307512_10099361 3300030522 Bacteria 1981
577 Ga0265331_10001526 3300031250 Bacteria 17054
578 Ga0265327_10000144 3300031251 Bacteria 156779
579 Ga0265327_10001301 3300031251 Bacteria 32649
580 Ga0307513_10000004 3300031456 Bacteria 558931
581 Ga0307513_10027729 3300031456 Bacteria 6494
582 Ga0307513_10039345 3300031456 Bacteria 5242
583 Ga0307513_10134285 3300031456 Bacteria 2413
584 Ga0307509_10000041 3300031507 Bacteria 182302
585 Ga0307509_10041365 3300031507 Bacteria 5001
586 Ga0307509_10047402 3300031507 Bacteria 4623
587 Ga0307509_10087870 3300031507 Bacteria 3192
588 Ga0307509_10088275 3300031507 Bacteria 3183
589 Ga0307509_10122263 3300031507 Bacteria 2578
590 Ga0307408_100061382 3300031548 Bacteria 2744
591 Ga0307508_10065449 3300031616 Bacteria 3202
592 Ga0307508_10392976 3300031616 Bacteria 978
593 Ga0307514_10000795 3300031649 Bacteria 52015
594 Ga0307514_10001506 3300031649 Bacteria 27927
595 Ga0307514_10064361 3300031649 Bacteria 2781
596 Ga0307514_10102061 3300031649 Bacteria 2057
597 Ga0307516_10003211 3300031730 Bacteria 21220
598 Ga0307516_10016177 3300031730 Bacteria 7815
599 Ga0307405_10108420 3300031731 Bacteria 1876
600 Ga0307405_10209366 3300031731 Bacteria 1422
601 Ga0307413_10001960 3300031824 Bacteria 8171
602 Ga0307410_10021641 3300031852 Bacteria 3958
603 Ga0307412_10000008 3300031911 Bacteria 461034
604 Ga0307412_10030512 3300031911 Bacteria 3395
605 Ga0307409_100133281 3300031995 Unclassified 2127
606 Ga0307416_100012234 3300032002 Bacteria 5769
607 Ga0307416_100211655 3300032002 Bacteria 1850
608 Ga0307416_100308841 3300032002 Bacteria 1577
609 Ga0307416_100318279 3300032002 Bacteria 1556
610 Ga0307414_10275228 3300032004 Bacteria 1412
611 Ga0307411_10000263 3300032005 Bacteria 17179
612 Ga0307411_10002529 3300032005 Bacteria 8143
613 Ga0307411_10248541 3300032005 Bacteria 1397
614 Ga0307415_100004459 3300032126 Bacteria 7265
615 Ga0307507_10231909 3300033179 Bacteria 1222
616 Ga0307507_10296179 3300033179 Bacteria 996
617 Ga0373926_0008602 3300035083 Bacteria 3397
618 Ga0373940_0010689 3300035088 Bacteria 2165
619 Ga0373949_0004709 3300035090 Bacteria 3100
620 Ga0373951_0041973 3300035091 Bacteria 1105
621 Ga0373932_0021211 3300035112 Bacteria 1713
622 Ga0373939_0000017 3300035114 Bacteria 61924
623 Ga0373945_0013270 3300035116 Bacteria 2747
624 Ga0373960_0021202 3300035121 Bacteria 1726
625 Ga0373946_0040508 3300035171 Bacteria 1906
626 Ga0373942_0010184 3300035207 Bacteria 2208
627 Ga0373961_0018880 3300035241 Bacteria 1805
628 Ga0373961_0042724 3300035241 Bacteria 1315
629 Ga0373962_0004175 3300035242 Bacteria 3481
630 Ga0373924_0038989 3300035410 Bacteria 1940
631 Ga0373931_0002168 3300035691 Bacteria 8651
632 Ga0373931_0004530 3300035691 Bacteria 6357
633 Ga0373931_0011317 3300035691 Bacteria 4308
634 Ga0373931_0159233 3300035691 Bacteria 1322
635 Ga0373931_0161563 3300035691 Bacteria 1314
636 Ga0373931_0165154 3300035691 Bacteria 1300
637 Ga0373935_0011919 3300035692 Bacteria 5223
638 Ga0373927_0019101 3300035695 Bacteria 4495
639 Ga0373927_0183269 3300035695 Bacteria 1374
640 Ga0373937_0078854 3300036401 Bacteria 3044
641 Ga0373925_0333433 3300037068 Bacteria 1229
642 Ga0373925_0337481 3300037068 Bacteria 1222
643 Ga0395899_0000007 3300037312 Bacteria 629129
644 Ga0395899_0020035 3300037312 Bacteria 5074
645 Ga0395899_0090394 3300037312 Bacteria 2220
646 Ga0395899_0137060 3300037312 Bacteria 1744
647 Ga0395900_0000066 3300037418 Bacteria 194825
648 Ga0395900_0001782 3300037418 Bacteria 24684
649 Ga0395900_0026541 3300037418 Bacteria 5930
650 Ga0395900_0132162 3300037418 Bacteria 2557
651 Ga0395900_0301275 3300037418 Bacteria 1589
652 Ga0395898_0000225 3300037466 Bacteria 144962
653 Ga0395898_0000921 3300037466 Bacteria 47076
654 Ga0395898_0055484 3300037466 Bacteria 3864
655 Ga0395898_0079984 3300037466 Bacteria 3152
656 Ga0395898_0337574 3300037466 Bacteria 1437
657 Ga0395905_0000050 3300037471 Bacteria 223801
658 Ga0395905_0000733 3300037471 Bacteria 43190
659 Ga0395901_0000067 3300038443 Bacteria 144966
660 Ga0395901_0000133 3300038443 Bacteria 96281
661 Ga0395901_0003229 3300038443 Bacteria 16396
662 Ga0395901_0029424 3300038443 Bacteria 5656
663 Ga0395901_0357875 3300038443 Bacteria 1505
664 Ga0436361_0494111 3300039447 Bacteria 1522
665 Ga0436361_0677882 3300039447 Bacteria 228834
666 Ga0436361_0939131 3300039447 Bacteria 2575
667 Ga0436361_1040196 3300039447 Bacteria 6011
668 Ga0439448_0000283 3300042005 Bacteria 11120
669 Ga0450890_002028 3300042127 Bacteria 2851
670 Ga0450891_008112 3300042129 Bacteria 963
671 Ga0450892_001891 3300042130 Bacteria 1878
672 Ga0450889_000080 3300042144 Bacteria 8812
673 Ga0439459_0021734 3300042438 Bacteria 1235
674 Ga0450918_000362 3300042531 Bacteria 9979
675 Ga0450893_0000522 3300042532 Bacteria 5453
676 Ga0451577_0003800 3300042876 Bacteria 16436
677 Ga0451577_0003831 3300042876 Bacteria 16362
678 Ga0451577_0006873 3300042876 Bacteria 11257
679 Ga0451577_0334375 3300042876 Bacteria 1374
680 Ga0466986_0182397 3300044650 Bacteria 1393
681 Ga0466969_0001463 3300044656 Bacteria 12684
682 Ga0466969_0007667 3300044656 Bacteria 5736
683 Ga0466969_0008720 3300044656 Bacteria 5376
684 Ga0466969_0037623 3300044656 Bacteria 2440
685 Ga0466969_0090505 3300044656 Bacteria 1450
686 Ga0466972_0007876 3300044658 Bacteria 5342
687 Ga0466973_0074960 3300044659 Bacteria 2990
688 Ga0466978_0103880 3300044671 Bacteria 1765
689 Ga0466982_0097121 3300044672 Bacteria 1825
690 Ga0453683_0028341 3300044673 Bacteria 3547
691 Ga0466965_0001438 3300044683 Bacteria 9606
692 Ga0466965_0002260 3300044683 Bacteria 8114
693 Ga0466966_0000194 3300044684 Bacteria 40727
694 Ga0466966_0001860 3300044684 Bacteria 13696
695 Ga0466966_0002364 3300044684 Bacteria 12324
696 Ga0466966_0007860 3300044684 Bacteria 7057
697 Ga0466966_0028107 3300044684 Bacteria 3664
698 Ga0466966_0130621 3300044684 Bacteria 1538
699 Ga0466961_0000151 3300044693 Bacteria 46966
700 Ga0466961_0000628 3300044693 Bacteria 22128
701 Ga0466961_0006856 3300044693 Bacteria 7245
702 Ga0466961_0016198 3300044693 Bacteria 4786
703 Ga0466961_0041951 3300044693 Bacteria 2933
704 Ga0466961_0048450 3300044693 Bacteria 2715
705 Ga0466963_0001052 3300044694 Bacteria 14352
706 Ga0466963_0085188 3300044694 Bacteria 2145
707 Ga0466963_0085486 3300044694 Bacteria 2142
708 Ga0466964_0036610 3300044706 Bacteria 1968
709 Ga0453684_0000149 3300044712 Bacteria 307732
710 Ga0466971_0000194 3300044719 Bacteria 23436
711 Ga0466971_0007086 3300044719 Bacteria 4880
712 Ga0466971_0009721 3300044719 Bacteria 4198
713 Ga0466971_0036026 3300044719 Bacteria 2219
714 Ga0466968_0013237 3300044735 Bacteria 3242
715 Ga0466968_0015862 3300044735 Bacteria 2992
716 Ga0466970_0005638 3300044765 Bacteria 6217
717 Ga0466970_0034783 3300044765 Bacteria 2668
718 Ga0466970_0073542 3300044765 Bacteria 1839
719 Ga0466957_0000847 3300044842 Bacteria 15672
720 Ga0466957_0001803 3300044842 Bacteria 11284
721 Ga0466957_0008467 3300044842 Bacteria 5851
722 Ga0466960_0170237 3300044901 Bacteria 1175
723 Ga0466959_0002631 3300045049 Bacteria 11519
724 Ga0466959_0006950 3300045049 Bacteria 7905
725 Ga0466959_0010672 3300045049 Bacteria 6576
726 Ga0466959_0023909 3300045049 Bacteria 4523
727 Ga0466959_0036866 3300045049 Bacteria 3613
728 Ga0466959_0222807 3300045049 Bacteria 1307
729 Ga0451576_0000114 3300045051 Bacteria 208462
730 Ga0451576_0000656 3300045051 Bacteria 71486
731 Ga0451576_0002721 3300045051 Bacteria 25669
732 Ga0451576_0014283 3300045051 Bacteria 8844
733 Ga0451576_0056505 3300045051 Bacteria 4104
734 Ga0451576_0063244 3300045051 Bacteria 3857
735 Ga0451576_0067604 3300045051 Bacteria 3720
736 Ga0451576_0186597 3300045051 Bacteria 2165
737 Ga0466958_0000925 3300045836 Bacteria 13218
738 Ga0466958_0003153 3300045836 Bacteria 8483
739 Ga0466967_0018609 3300045976 Bacteria 5558
740 Ga0466967_0529138 3300045976 Bacteria 1159
741 Ga0495592_0000028 3300046454 Bacteria 132590
742 Ga0495592_0005491 3300046454 Bacteria 9370
743 Ga0495592_0103595 3300046454 Bacteria 2024
744 Ga0495592_0246043 3300046454 Bacteria 1184
745 Ga0495603_0001931 3300046455 Bacteria 12223
746 Ga0495603_0003257 3300046455 Bacteria 9670
747 Ga0495603_0005093 3300046455 Bacteria 7850
748 Ga0495603_0017440 3300046455 Bacteria 4344
749 Ga0495590_0057246 3300046457 Bacteria 1362
750 Ga0495629_0001146 3300046459 Bacteria 20942
751 Ga0495629_0001890 3300046459 Bacteria 16312
752 Ga0495629_0002163 3300046459 Bacteria 15183
753 Ga0495629_0091798 3300046459 Bacteria 2119
754 Ga0495638_0015120 3300046460 Bacteria 5191
755 Ga0495638_0017957 3300046460 Bacteria 4708
756 Ga0495651_0012126 3300046462 Bacteria 6633
757 Ga0495651_0097279 3300046462 Bacteria 2198
758 Ga0495651_0147642 3300046462 Bacteria 1698
759 Ga0495653_0022460 3300046463 Bacteria 5106
760 Ga0495653_0048684 3300046463 Bacteria 3271
761 Ga0495653_0086002 3300046463 Bacteria 2311
762 Ga0495653_0209685 3300046463 Bacteria 1316
763 Ga0495650_0011299 3300046471 Bacteria 4904
764 Ga0495650_0013298 3300046471 Bacteria 4362
765 Ga0495650_0014003 3300046471 Bacteria 4204
766 Ga0495580_0000517 3300046472 Bacteria 32486
767 Ga0495580_0016734 3300046472 Bacteria 5503
768 Ga0495580_0017140 3300046472 Bacteria 5423
769 Ga0495580_0017698 3300046472 Bacteria 5320
770 Ga0495580_0106584 3300046472 Bacteria 1946
771 Ga0495580_0235969 3300046472 Bacteria 1254
772 Ga0495582_0077436 3300046473 Bacteria 1844
773 Ga0495582_0116145 3300046473 Bacteria 1505
774 Ga0495605_0003018 3300046474 Bacteria 10158
775 Ga0495605_0021788 3300046474 Bacteria 3390
776 Ga0495639_0004838 3300046475 Bacteria 5777
777 Ga0495664_0011488 3300046477 Bacteria 4995
778 Ga0495664_0011977 3300046477 Bacteria 4900
779 Ga0495664_0016892 3300046477 Bacteria 4166
780 Ga0495664_0112764 3300046477 Bacteria 1642
781 Ga0495584_0041969 3300046491 Bacteria 2309
782 Ga0495596_0002474 3300046500 Bacteria 9917
783 Ga0495596_0004382 3300046500 Bacteria 6895
784 Ga0495583_0000171 3300046506 Bacteria 110806
785 Ga0495583_0008171 3300046506 Bacteria 6435
786 Ga0495583_0011405 3300046506 Bacteria 5104
787 Ga0495606_0032177 3300046507 Bacteria 3637
788 Ga0495606_0034434 3300046507 Bacteria 3477
789 Ga0495606_0054271 3300046507 Bacteria 2595
790 Ga0495606_0056907 3300046507 Bacteria 2520
791 Ga0495608_0007945 3300046511 Bacteria 7455
792 Ga0495608_0013416 3300046511 Bacteria 5682
793 Ga0495610_0017008 3300046512 Bacteria 4162
794 Ga0495618_0005269 3300046514 Bacteria 7905
795 Ga0495618_0048156 3300046514 Bacteria 2690
796 Ga0495618_0116916 3300046514 Bacteria 1708
797 Ga0495628_0001007 3300046516 Bacteria 25697
798 Ga0495628_0074034 3300046516 Bacteria 2653
799 Ga0495628_0119465 3300046516 Bacteria 2023
800 Ga0495628_0181960 3300046516 Bacteria 1589
801 Ga0495630_0006191 3300046517 Bacteria 8488
802 Ga0495630_0008391 3300046517 Bacteria 7408
803 Ga0495630_0011496 3300046517 Bacteria 6410
804 Ga0495630_0024623 3300046517 Bacteria 4448
805 Ga0495630_0026345 3300046517 Bacteria 4304
806 Ga0495648_0013526 3300046524 Bacteria 6024
807 Ga0495648_0068282 3300046524 Bacteria 2074
808 Ga0495666_0006096 3300046526 Bacteria 6067
809 Ga0495666_0010997 3300046526 Bacteria 4514
810 Ga0495666_0099569 3300046526 Bacteria 1370
811 Ga0495642_0058095 3300046528 Bacteria 1601
812 Ga0495652_0004958 3300046529 Bacteria 12617
813 Ga0495652_0134520 3300046529 Bacteria 1952
814 Ga0495665_0000594 3300046531 Bacteria 18495
815 Ga0495665_0002061 3300046531 Bacteria 10873
816 Ga0495665_0006205 3300046531 Bacteria 6454
817 Ga0495640_0005888 3300046533 Bacteria 9722
818 Ga0495640_0167613 3300046533 Bacteria 1404
819 Ga0495586_0002775 3300046535 Bacteria 9467
820 Ga0495586_0003604 3300046535 Bacteria 8296
821 Ga0495586_0013386 3300046535 Bacteria 4350
822 Ga0495598_0047222 3300046537 Bacteria 1283
823 Ga0495621_0036134 3300046539 Bacteria 1713
824 Ga0495645_0006099 3300046543 Bacteria 8341
825 Ga0495645_0010780 3300046543 Bacteria 6420
826 Ga0495645_0075727 3300046543 Bacteria 2422
827 Ga0495667_0034073 3300046559 Bacteria 3405
828 Ga0495668_0050673 3300046616 Bacteria 2300
829 Ga0495634_0008364 3300046642 Bacteria 7712
830 Ga0495634_0020991 3300046642 Bacteria 4625
831 Ga0495625_0010602 3300046660 Bacteria 7604
832 Ga0495635_0016969 3300046663 Bacteria 5085
833 Ga0495661_0006659 3300046665 Bacteria 8110
834 Ga0495661_0023626 3300046665 Bacteria 3987
835 Ga0495661_0049029 3300046665 Bacteria 2563
836 Ga0495588_0031963 3300046674 Bacteria 2652
837 Ga0495599_0091342 3300046678 Bacteria 1900
838 Ga0495599_0112927 3300046678 Bacteria 1691
839 Ga0495623_0053399 3300046679 Bacteria 2551
840 Ga0495623_0083010 3300046679 Bacteria 1979
841 Ga0495646_0037223 3300046680 Bacteria 3011
842 Ga0495646_0046212 3300046680 Bacteria 2655
843 Ga0495646_0066570 3300046680 Bacteria 2130
844 Ga0495647_0002600 3300046681 Bacteria 5728
845 Ga0495669_0002739 3300046684 Bacteria 7231
846 Ga0495613_0021742 3300046689 Bacteria 4779
847 Ga0495613_0079849 3300046689 Bacteria 2378
848 Ga0495624_0001768 3300046690 Bacteria 16539
849 Ga0495624_0007203 3300046690 Bacteria 7824
850 Ga0495624_0049165 3300046690 Bacteria 2674
851 Ga0495624_0049811 3300046690 Bacteria 2655
852 Ga0495624_0107566 3300046690 Bacteria 1715
853 Ga0495624_0137103 3300046690 Bacteria 1499
854 Ga0495671_0009406 3300046692 Bacteria 5457
855 Ga0495649_0000231 3300046694 Bacteria 48903
856 Ga0495649_0009842 3300046694 Bacteria 5659
857 Ga0495649_0015210 3300046694 Bacteria 4380
858 Ga0495589_0003656 3300046794 Bacteria 8310
859 Ga0495589_0045125 3300046794 Bacteria 2190
860 Ga0495589_0129285 3300046794 Bacteria 1213
861 Ga0495600_0002037 3300046809 Bacteria 11378
862 Ga0495600_0009095 3300046809 Bacteria 6128
863 Ga0495581_0053507 3300047315 Bacteria 2331
864 Ga0495604_0055414 3300047317 Bacteria 3055
865 Ga0495604_0104560 3300047317 Bacteria 2074
866 Ga0495604_0112685 3300047317 Bacteria 1981
867 Ga0495674_0008443 3300047319 Bacteria 9814
868 Ga0495674_0016439 3300047319 Bacteria 6902
869 Ga0495674_0041342 3300047319 Bacteria 4118
870 Ga0495674_0084030 3300047319 Bacteria 2728
871 Ga0495674_0264147 3300047319 Bacteria 1413
872 Ga0495672_0001630 3300047320 Bacteria 21841
873 Ga0495672_0017913 3300047320 Bacteria 4724
874 Ga0495672_0039613 3300047320 Bacteria 2864
875 Ga0495676_0015888 3300047321 Bacteria 6690
876 Ga0495676_0048716 3300047321 Bacteria 3413
877 Ga0495676_0066658 3300047321 Bacteria 2789
878 Ga0495676_0069814 3300047321 Bacteria 2709
879 Ga0495680_0001829 3300047322 Bacteria 22466
880 Ga0495680_0012161 3300047322 Bacteria 7595
881 Ga0495680_0031678 3300047322 Bacteria 4299
882 Ga0495680_0097906 3300047322 Bacteria 2189
883 Ga0495683_0001484 3300047323 Bacteria 15301
884 Ga0495683_0012221 3300047323 Bacteria 4512
885 Ga0495683_0064935 3300047323 Bacteria 1801
886 Ga0495683_0066340 3300047323 Bacteria 1778
887 Ga0495683_0118169 3300047323 Bacteria 1260
888 Ga0495687_072515 3300047443 Bacteria 1375
889 Ga0495687_127525 3300047443 Bacteria 907
890 Ga0495675_0001062 3300047444 Bacteria 16695
891 Ga0495675_0020157 3300047444 Bacteria 4238
892 Ga0495675_0037367 3300047444 Bacteria 3093
893 Ga0495675_0098205 3300047444 Bacteria 1834
894 Ga0495679_001045 3300047446 Bacteria 16874
895 Ga0495679_001930 3300047446 Bacteria 11082
896 Ga0495679_002911 3300047446 Bacteria 8473
897 Ga0495673_0003222 3300047469 Bacteria 10893
898 Ga0495673_0010992 3300047469 Bacteria 4897
899 Ga0495684_0054243 3300047471 Bacteria 3058
900 Ga0495686_0000002 3300047472 Bacteria 1050777
901 Ga0495686_0018809 3300047472 Bacteria 4626
902 Ga0495593_0005941 3300047673 Bacteria 7193
903 Ga0495593_0018522 3300047673 Bacteria 3910
904 Ga0495593_0024611 3300047673 Bacteria 3336
905 Ga0495593_0046822 3300047673 Bacteria 2303
906 Ga0495602_0007108 3300048088 Bacteria 11748
907 Ga0495602_0021822 3300048088 Bacteria 6287
908 Ga0495602_0022728 3300048088 Bacteria 6132
909 Ga0495602_0065391 3300048088 Bacteria 3138
910 Ga0495602_0143660 3300048088 Bacteria 1885
911 Ga0495602_0215459 3300048088 Bacteria 1453
912 Ga0495614_0026820 3300048089 Bacteria 2483
913 Ga0495614_0040063 3300048089 Bacteria 2011
914 Ga0495614_0052410 3300048089 Bacteria 1748
915 Ga0496100_0021083 3300048903 Bacteria 3918
916 Ga0496100_0029489 3300048903 Bacteria 3394
917 Ga0496100_0082208 3300048903 Bacteria 2178
918 Ga0496100_0191396 3300048903 Bacteria 1485
919 Ga0496101_0043975 3300048904 Bacteria 3194
920 Ga0496101_0054630 3300048904 Bacteria 2884
921 Ga0496102_0002584 3300048905 Bacteria 15439
922 Ga0496102_0007189 3300048905 Bacteria 9506
923 Ga0496102_0059147 3300048905 Bacteria 3504
924 Ga0496102_0083729 3300048905 Bacteria 2943
925 Ga0496102_0118208 3300048905 Bacteria 2474
926 Ga0496102_0498043 3300048905 Bacteria 1140
927 Ga0496103_0001198 3300048906 Bacteria 17787
928 Ga0496103_0002973 3300048906 Bacteria 10496
929 Ga0496104_0038994 3300048907 Bacteria 4447
930 Ga0496105_0111515 3300048908 Bacteria 2257
931 Ga0496105_0318085 3300048908 Bacteria 1248
932 Ga0496106_0006310 3300048909 Bacteria 8779
933 Ga0496106_0013030 3300048909 Bacteria 6136
934 Ga0496106_0038486 3300048909 Bacteria 3580
935 Ga0496106_0228556 3300048909 Bacteria 1485
936 Ga0496107_0014068 3300048910 Bacteria 5602
937 Ga0496107_0136951 3300048910 Unclassified 1809
938 Ga0496108_0050818 3300048911 Bacteria 3472
939 Ga0496109_0018971 3300048912 Bacteria 6056
940 Ga0496109_0073211 3300048912 Bacteria 3148
941 Ga0496110_0042683 3300048913 Bacteria 3959
942 Ga0496110_0099014 3300048913 Bacteria 2614
943 Ga0496110_0198775 3300048913 Bacteria 1821
944 Ga0496110_0220994 3300048913 Bacteria 1722
945 Ga0496111_0006562 3300048914 Bacteria 7565
946 Ga0496112_0062144 3300048915 Bacteria 3683
947 Ga0496112_0069114 3300048915 Bacteria 3489
948 Ga0496112_0094559 3300048915 Bacteria 2959
949 Ga0496113_0007024 3300048916 Bacteria 7202
950 Ga0496114_0006772 3300048917 Bacteria 9027
951 Ga0496117_0000622 3300048920 Bacteria 57400
952 Ga0496117_0003463 3300048920 Bacteria 18342
953 Ga0496117_0008093 3300048920 Bacteria 10066
954 Ga0496117_0038065 3300048920 Bacteria 3573
955 Ga0496117_0059594 3300048920 Bacteria 2635
956 Ga0496117_0070573 3300048920 Bacteria 2345
957 Ga0496118_0001465 3300048921 Bacteria 35377
958 Ga0496118_0005899 3300048921 Bacteria 13715
959 Ga0496118_0011064 3300048921 Bacteria 8856
960 Ga0496118_0016918 3300048921 Bacteria 6660
961 Ga0496118_0018642 3300048921 Bacteria 6243
962 Ga0496118_0064670 3300048921 Bacteria 2682
963 Ga0496118_0147249 3300048921 Bacteria 1480
964 Ga0496121_0004846 3300048924 Bacteria 17701
965 Ga0496121_0004983 3300048924 Bacteria 17399
966 Ga0496121_0007284 3300048924 Bacteria 13388
967 Ga0496121_0013227 3300048924 Bacteria 8892
968 Ga0496121_0027216 3300048924 Bacteria 5356
969 Ga0496122_0014682 3300048925 Bacteria 7553
970 Ga0496124_0000161 3300048927 Bacteria 136651
971 Ga0496124_0235590 3300048927 Bacteria 1365
972 Ga0496125_0006543 3300048928 Bacteria 12559
973 Ga0496125_0025298 3300048928 Bacteria 5439
974 Ga0496126_0004047 3300048929 Bacteria 17838
975 Ga0496126_0005902 3300048929 Bacteria 13810
976 Ga0496126_0008623 3300048929 Bacteria 10963
977 Ga0496126_0012817 3300048929 Bacteria 8567
978 Ga0496126_0112078 3300048929 Bacteria 2375
979 Ga0496126_0221918 3300048929 Bacteria 1587
980 Ga0501032_0230422 3300049569 Bacteria 1204
981 Ga0501036_0260593 3300049572 Bacteria 1452
982 Ga0501039_0073715 3300049575 Bacteria 2652
983 Ga0501040_0017185 3300049576 Bacteria 4802
984 Ga0501041_0063122 3300049577 Bacteria 2268
985 Ga0501041_0078529 3300049577 Bacteria 2031
986 Ga0501042_0009440 3300049578 Bacteria 6501
987 Ga0501047_0003323 3300049581 Bacteria 15230
988 Ga0501067_0004424 3300049583 Bacteria 7746
989 Ga0501068_0000394 3300049584 Bacteria 22113
990 Ga0501069_0000211 3300049585 Bacteria 25989
991 Ga0501072_0000016 3300049588 Bacteria 165259
992 Ga0501073_0004660 3300049589 Bacteria 10301
993 Ga0501074_0003292 3300049590 Bacteria 11428
994 Ga0501074_0017094 3300049590 Bacteria 5262
995 Ga0501076_0003805 3300049592 Bacteria 10625
996 Ga0501079_0005386 3300049741 Bacteria 9528
997 Ga0501081_0003513 3300049743 Bacteria 10025
998 Ga0501081_0314529 3300049743 Bacteria 1150
999 Ga0501081_0386476 3300049743 Bacteria 1035
1000 Ga0501083_0005162 3300049744 Bacteria 9239
1001 Ga0501044_0002394 3300049823 Bacteria 21381
1002 nmdc:mga0yw44_43259_c1 3300050492 Bacteria 2688
1003 nmdc:mga0k408_1348_c1 3300050493 Bacteria 13248
1004 nmdc:mga0k408_54830_c1 3300050493 Bacteria 2311
1005 nmdc:mga0k408_59192_c2 3300050493 Bacteria 1691
1006 nmdc:mga07m45_1241_c1 3300050496 Bacteria 11565
1007 nmdc:mga07m45_176015_c1 3300050496 Bacteria 1244
1008 nmdc:mga07m45_1961_c1 3300050496 Bacteria 9521
1009 nmdc:mga05p37_72_c1 3300050507 Bacteria 88725
1010 nmdc:mga09592_7186_c1 3300050508 Bacteria 9052
1011 nmdc:mga0qj67_127854_c1 3300050509 Bacteria 2056
1012 nmdc:mga08y16_17302_c1 3300050511 Bacteria 7589
1013 nmdc:mga08y16_203259_c1 3300050511 Bacteria 2053
1014 nmdc:mga08y16_2144_c1 3300050511 Bacteria 20246
1015 nmdc:mga08y16_446_c1 3300050511 Bacteria 38236
1016 nmdc:mga08y16_79312_c1 3300050511 Bacteria 3422
1017 nmdc:mga0n895_7346_c1 3300050512 Bacteria 9452
1018 nmdc:mga0rr50_374_c1 3300050513 Bacteria 24484
1019 nmdc:mga08x19_1134_c1 3300050514 Bacteria 16616
1020 nmdc:mga0a205_1144_c1 3300050515 Bacteria 22034
1021 nmdc:mga0a205_424481_c1 3300050515 Bacteria 1191
1022 Ga0500578_0020678 3300053086 Bacteria 4231
1023 Ga0500651_0003954 3300053093 Bacteria 8220
1024 Ga0500651_0064096 3300053093 Bacteria 2292
1025 Ga0500594_0003862 3300053118 Bacteria 3299
1026 Ga0500608_052538 3300053122 Bacteria 1957
1027 Ga0500559_0000141 3300053136 Bacteria 56026
1028 Ga0500619_007960 3300053154 Bacteria 2546
1029 Ga0500622_0001173 3300053156 Bacteria 21675
1030 Ga0500636_0005519 3300053177 Bacteria 7224
1031 Ga0500636_0118835 3300053177 Bacteria 1485
1032 Ga0500645_003156 3300053730 Bacteria 6857
1033 Ga0500587_003876 3300053739 Bacteria 2072
1034 Ga0500587_004820 3300053739 Bacteria 1840
1035 Ga0501084_0000028 3300054114 Bacteria 124129
1036 Ga0590071_000905 3300059421 Bacteria 8224
1037 Ga0587084_000105 3300059477 Bacteria 4593
1038 Ga0587093_001819 3300059478 Bacteria 1880
1039 Ga0587070_019705 3300059491 Bacteria 1120
1040 Ga0587073_0006385 3300059492 Bacteria 1811
1041 Ga0587083_0000250 3300059505 Bacteria 4139
1042 Ga0587085_017200 3300059506 Bacteria 1056
1043 Ga0587088_000007 3300059508 Bacteria 8942
1044 Ga0587088_008846 3300059508 Bacteria 1435
1045 Ga0587106_014539 3300059605 Bacteria 1086
1046 Ga0587101_000297 3300059623 Bacteria 3223
1047 Ga0587128_004138 3300059630 Bacteria 1662
1048 Ga0587067_000065 3300059640 Bacteria 6009
1049 Ga0587068_000913 3300059641 Bacteria 3052
1050 Ga0587072_000021 3300059643 Bacteria 9666
1051 Ga0587072_025015 3300059643 Bacteria 1083
1052 Ga0587079_004324 3300059647 Bacteria 1924
1053 Ga0501082_0000787 3300060353 Bacteria 27894
1054 Ga0466962_0000946 3300061719 Bacteria 13149
1055 Ga0466962_0002327 3300061719 Bacteria 9004
1056 Ga0466962_0009479 3300061719 Bacteria 4669
1057 Ga0466962_0029937 3300061719 Bacteria 2606
1058 Ga0466962_0086844 3300061719 Bacteria 1498
1059 Ga0530510_0021621 3300061734 Bacteria 4577
1060 Ga0530510_0441795 3300061734 Bacteria 983
1061 2921645893 2921643360 Bacteria 11448031
1062 2501072682 2501025501 Bacteria 7768574
1063 2501080542 2501025502 Bacteria 9641094
1064 2501410565 2501025504 Bacteria 8008976
1065 2509131318 2508501125 Bacteria 7208311
1066 2510251482 2510065045 Bacteria 7761063
1067 2511086999 2510917013 Bacteria 9951648
1068 2511096968 2510917014 Bacteria 8296963
1069 2511103778 2510917015 Bacteria 7950052
1070 2512345560 2512047030 Bacteria 9031815
1071 2513552214 2513237082 Bacteria 8640282
1072 2513561000 2513237083 Bacteria 8410967
1073 2513961851 2513237151 Bacteria 6309801
1074 2514051970 2513237166 Bacteria 10373764
1075 2515680845 2515154122 Bacteria 8609520
1076 2515690672 2515154123 Bacteria 6387382
1077 2516019445 2515154189 Bacteria 9629850
1078 2563058801 2562617112 Bacteria 10918404
1079 2599736748 2599185239 Bacteria 8686614
1080 2599744820 2599185240 Bacteria 7968121
1081 2600205816 2599185355 Bacteria 7968906
1082 2600812081 2600255067 Bacteria 6795583
1083 2643936825 2643221585 Bacteria 5812563
1084 2644221656 2643221639 Bacteria 6649903
1085 2644249029 2643221644 Bacteria 6865017
1086 2644257579 2643221646 Bacteria 6433402
1087 2644304217 2643221654 Bacteria 5273570
1088 2644318726 2643221656 Bacteria 5809961
1089 2676742949 2675903129 Bacteria 7964495
1090 2713476545 2711768613 Bacteria 11048459
1091 2719640596 2718217991 Bacteria 7829542
1092 2735817510 2734482258 Unclassified 2930739
1093 2738818652 2738541296 Bacteria 7285013
1094 2738831191 2738541298 Bacteria 7286732
1095 2738872719 2738541306 Bacteria 7284992
1096 2739058565 2738541337 Bacteria 6183410
1097 2739184349 2738543002 Bacteria 7284546
1098 2739219318 2738543008 Bacteria 7282815
1099 2746088721 2744054900 Bacteria 8399525
1100 2746097338 2744054901 Bacteria 8397047
1101 2792836049 2791355137 Bacteria 9654227
1102 2808972748 2808606384 Bacteria 8474373
1103 2809007730 2808606390 Bacteria 8476311
1104 2809014730 2808606391 Bacteria 8308166
1105 2817261436 2816332253 Bacteria 6764532
1106 2817279122 2816332256 Bacteria 6891714
1107 2817456278 2816332286 Bacteria 6853759
1108 2819619999 2818991450 Bacteria 6962147
1109 2819631272 2818991452 Bacteria 8442785
1110 2842328653 2842324504 Bacteria 9364110
1111 2842352969 2842348783 Bacteria 9002918
1112 2842458686 2842454564 Bacteria 8730687
1113 2856294236 2856287931 Bacteria 7223934
1114 2857367493 2857357740 Bacteria 9937880
1115 2863427413 2863421361 Bacteria 7300805
1116 2870070881 2870068957 Bacteria 8925310
1117 2883093039 2883087390 Bacteria 9532701
1118 2885273003 2885270888 Bacteria 9831543
1119 2900634281 2900634093 Bacteria 10263517
1120 2902683701 2902682994 Bacteria 8951596
1121 2904484591 2904483920 Bacteria 7545285
1122 2904570032 2904564687 Bacteria 7609577
1123 2904576057 2904571731 Bacteria 7608790
1124 2904624183 2904615490 Bacteria 10047340
1125 2919531445 2919527303 Bacteria 7718827
1126 2928110508 2928108538 Bacteria 7360024
1127 2928140024 2928135762 Bacteria 7259641
1128 2928162906 2928157003 Bacteria 7522202
1129 2928169578 2928163908 Bacteria 7561269
1130 2928171596 2928170801 Bacteria 8785406
1131 2928505516 2928503688 Bacteria 7268108
1132 2928542596 2928536128 Bacteria 7657547
1133 2945937351 2945934425 Bacteria 7444609
1134 2981996797 2981990288 Bacteria 7590678
1135 2990705955 2990703756 Bacteria 7715990
1136 642425610 641736151 Bacteria 7477263
1137 642416305 641736154 Bacteria 7689995
1138 642593210 642555112 Bacteria 8676562
1139 642622107 642555113 Bacteria 8214658
1140 8003955570 8003955200 Bacteria 8601927
1141 8018846985 8018845410 Bacteria 8933938
1142 8020813638 8020807995 Bacteria 6801506
1143 8020944946 8020938398 Bacteria 7472757
1144 8020945523 8020945358 Bacteria 8467355
1145 8020957017 8020953355 Bacteria 7439080
1146 8021122125 8021120328 Bacteria 8782274
1147 8039102624 8039098773 Bacteria 6602928
1148 8040172784 8040167225 Bacteria 6542727
1149 8040173745 8040173305 Bacteria 6827067
1150 8055268936 8055266321 Bacteria 7999742
1151 8055302080 8055301274 Bacteria 8587385
1152 8057579237 8057575449 Bacteria 7367519
1153 SwRhRL2b_contig_2039426
1154 JGI24741J21665_1000144
1155 JGI24740J21852_10000627
1156 JGI24740J21852_10000861
1157 JGI24740J21852_10012655
1158 JGI24739J22299_10022435
1159 JGI24735J21928_10002167
1160 JGI24735J21928_10002787
1161 JGI24735J21928_10051380
1162 JGI25156J39149_1000345
1163 JGI25156J39149_1001710
1164 JGI25156J39149_1006717
1165 JGI25156J39149_1007238
1166 JGI25156J39149_1012668
1167 JGI25154J39366_1000622
1168 JGI25157J39369_1000140
1169 JGI25160J50197_1000215
1170 Ga0055538_1001968
1171 Ga0055539_1000034
1172 Ga0055539_1000530
1173 Ga0055539_1002368
1174 Ga0055533_1000011
1175 Ga0055533_1003245
1176 Ga0055533_1003722
1177 Ga0055533_1005086
1178 Ga0055532_1000001
1179 Ga0055532_1000002
1180 Ga0055532_1000836
1181 Ga0055525_1000533
1182 Ga0055527_1000002
1183 Ga0055527_1000674
1184 Ga0055527_1000729
1185 Ga0055527_1001710
1186 Ga0055535_1000001
1187 Ga0055535_1000107
1188 Ga0055535_1001579
1189 Ga0055535_1001580
1190 Ga0055542_1000001
1191 Ga0055542_1001541
1192 Ga0055542_1002294
1193 Ga0055542_1003814
1194 Ga0055529_1000001
1195 Ga0055529_1000028
1196 Ga0055529_1000111
1197 Ga0055529_1001017
1198 Ga0055528_1003021
1199 Ga0055530_10002750
1200 Ga0055540_1000086
1201 Ga0055531_10004962
1202 Ga0055531_10025706
1203 Ga0055541_1000537
1204 Ga0055541_1002865
1205 Ga0055541_1011465
1206 Ga0058692_1019004
1207 Ga0065165_1000716
1208 Ga0065712_10116128
1209 Ga0065715_10031146
1210 Ga0070658_10021383
1211 Ga0070658_10031801
1212 Ga0070658_10068996
1213 Ga0070676_10002922
1214 Ga0070676_10011527
1215 Ga0070676_10030530
1216 Ga0070690_100017599
1217 Ga0070690_100027157
1218 Ga0070690_100262014
1219 Ga0070670_100003531
1220 Ga0070670_100006355
1221 Ga0068869_100000806
1222 Ga0068869_100015988
1223 Ga0068869_100096045
1224 Ga0070666_10010690
1225 Ga0070666_10030635
1226 Ga0070666_10178450
1227 Ga0070680_100000656
1228 Ga0070680_100087622
1229 Ga0070682_100002698
1230 Ga0070682_100012869
1231 Ga0070682_100046991
1232 Ga0068868_100001558
1233 Ga0068868_100003706
1234 Ga0068868_100015109
1235 Ga0068868_100136781
1236 Ga0068868_100196211
1237 Ga0070660_100000038
1238 Ga0070660_100027390
1239 Ga0070660_100139664
1240 Ga0070660_100202775
1241 Ga0070660_100202878
1242 Ga0070689_100000287
1243 Ga0070691_10000629
1244 Ga0070691_10133581
1245 Ga0070687_100000294
1246 Ga0070661_100000063
1247 Ga0070661_100000925
1248 Ga0070661_100155457
1249 Ga0070692_10000189
1250 Ga0070668_100073813
1251 Ga0070669_100096419
1252 Ga0070675_100000705
1253 Ga0070675_100022116
1254 Ga0070675_100031170
1255 Ga0070671_100010760
1256 Ga0070671_100041517
1257 Ga0070671_100044520
1258 Ga0070671_100075490
1259 Ga0070671_100123452
1260 Ga0070674_100001477
1261 Ga0070674_100139402
1262 Ga0070674_100265816
1263 Ga0070673_100000461
1264 Ga0070673_100003618
1265 Ga0070673_100005502
1266 Ga0070688_100082891
1267 Ga0070659_100000050
1268 Ga0070659_100000856
1269 Ga0070659_100050374
1270 Ga0070659_100066724
1271 Ga0070659_100279568
1272 Ga0070667_100508219
1273 Ga0070703_10020538
1274 Ga0070701_10000231
1275 Ga0070705_100007282
1276 Ga0070700_100001183
1277 Ga0070700_100046892
1278 Ga0070694_100000090
1279 Ga0070708_100257895
1280 Ga0070708_100287057
1281 Ga0070663_100000006
1282 Ga0070663_100000241
1283 Ga0070663_100000949
1284 Ga0070663_100078433
1285 Ga0070678_100001562
1286 Ga0070678_100005008
1287 Ga0070662_100009580
1288 Ga0068867_100000077
1289 Ga0068867_100000193
1290 Ga0068867_100000595
1291 Ga0068867_100001297
1292 Ga0068867_100009829
1293 Ga0068867_100155782
1294 Ga0070685_10028099
1295 Ga0070707_100314425
1296 Ga0070679_100061340
1297 Ga0070679_100371634
1298 Ga0070684_100135255
1299 Ga0070684_100137344
1300 Ga0070697_100044817
1301 Ga0068853_100122982
1302 Ga0070672_100001799
1303 Ga0070672_100007542
1304 Ga0070672_100095286
1305 Ga0070686_100000815
1306 Ga0070686_100169621
1307 Ga0070695_100000079
1308 Ga0070696_100000170
1309 Ga0070693_100000321
1310 Ga0070693_100282992
1311 Ga0070665_100027188
1312 Ga0070704_100000445
1313 Ga0068855_100004969
1314 Ga0068855_100013802
1315 Ga0068855_100091418
1316 Ga0070664_100000002
1317 Ga0070664_100000939
1318 Ga0070664_100040529
1319 Ga0070664_100075421
1320 Ga0070664_100372771
1321 Ga0068857_100004824
1322 Ga0068857_100011502
1323 Ga0068857_100015530
1324 Ga0068857_100244433
1325 Ga0068854_100000093
1326 Ga0068854_100008409
1327 Ga0068854_100028789
1328 Ga0068856_100000028
1329 Ga0068856_100001841
1330 Ga0068856_100005486
1331 Ga0068856_100199385
1332 Ga0070702_100000068
1333 Ga0070702_100104809
1334 Ga0068852_100010615
1335 Ga0068852_100044334
1336 Ga0068852_100111772
1337 Ga0068852_100195807
1338 Ga0068852_100235983
1339 Ga0068859_100002721
1340 Ga0068859_100627625
1341 Ga0068864_100124104
1342 Ga0068866_10000631
1343 Ga0068861_100000070
1344 Ga0068861_100005003
1345 Ga0068851_10044639
1346 Ga0068870_10027764
1347 Ga0068870_10057850
1348 Ga0068870_10068189
1349 Ga0068863_100106860
1350 Ga0068863_100229751
1351 Ga0068858_100151179
1352 Ga0068860_100002032
1353 Ga0068860_100002262
1354 Ga0068860_100100083
1355 Ga0068862_100000975
1356 Ga0068862_100017347
1357 Ga0068862_100047947
1358 Ga0081538_10082418
1359 Ga0075369_10014963
1360 Ga0075366_10004344
1361 Ga0075366_10016872
1362 Ga0075366_10146588
1363 Ga0097621_100000468
1364 Ga0097621_100005461
1365 Ga0075370_10004840
1366 Ga0075370_10196104
1367 Ga0068871_100000188
1368 Ga0068871_100127957
1369 Ga0075428_100000109
1370 Ga0075433_10001494
1371 Ga0075434_100000349
1372 Ga0075429_100001875
1373 Ga0075429_100159723
1374 Ga0075429_100208126
1375 Ga0068865_100000774
1376 Ga0068865_100327377
1377 Ga0075436_100000075
1378 Ga0097620_100002721
1379 Ga0097620_100627646
1380 Ga0079104_1000100
1381 Ga0075435_100000116
1382 Ga0105251_10014567
1383 Ga0105251_10024466
1384 Ga0105250_10024917
1385 Ga0105240_10001133
1386 Ga0105240_10012059
1387 Ga0105240_10068505
1388 Ga0105240_10068991
1389 Ga0105240_10094404
1390 Ga0105240_10146689
1391 Ga0105240_10410498
1392 Ga0111539_10000444
1393 Ga0111539_10006398
1394 Ga0111539_10057135
1395 Ga0111539_10445217
1396 Ga0105245_10001758
1397 Ga0105245_10430032
1398 Ga0114129_10018282
1399 Ga0105243_10004393
1400 Ga0105243_10010169
1401 Ga0105243_10035296
1402 Ga0105241_10145061
1403 Ga0105242_10000161
1404 Ga0105248_10014983
1405 Ga0105248_10226578
1406 Ga0105248_10314554
1407 Ga0105248_10430174
1408 Ga0105237_10022667
1409 Ga0105238_10008987
1410 Ga0105238_10432165
1411 Ga0105238_10519790
1412 Ga0105238_10655904
1413 Ga0105249_10003947
1414 Ga0105249_10006488
1415 Ga0105239_10004444
1416 Ga0105239_10039318
1417 Ga0105239_10067176
1418 Ga0105246_10141931
1419 Ga0157373_10014860
1420 Ga0157371_10012934
1421 Ga0157371_10032474
1422 Ga0157370_10000013
1423 Ga0157370_10000764
1424 Ga0157370_10006887
1425 Ga0157370_10066875
1426 Ga0157369_10000726
1427 Ga0157369_10001607
1428 Ga0157369_10006810
1429 Ga0157369_10034666
1430 Ga0157369_10061086
1431 Ga0157369_10161938
1432 Ga0157369_10258550
1433 Ga0157374_10000032
1434 Ga0157374_10017084
1435 Ga0157374_10111839
1436 Ga0157378_10001289
1437 Ga0157378_10001854
1438 Ga0157378_10012803
1439 Ga0157378_10073646
1440 Ga0163162_10008349
1441 Ga0163162_10020229
1442 Ga0163162_10037313
1443 Ga0163162_10298003
1444 Ga0157372_10003169
1445 Ga0157375_10002284
1446 Ga0157375_10040469
1447 Ga0157375_10114845
1448 Ga0157380_10018117
1449 Ga0157380_10345773
1450 Ga0182008_10123857
1451 Ga0157377_10000094
1452 Ga0157377_10050107
1453 Ga0157379_10134736
1454 Ga0157379_10311795
1455 Ga0157376_10000457
1456 Ga0157376_10105541
1457 Ga0157376_10190837
1458 Ga0182006_1000486
1459 Ga0182007_10000339
1460 Ga0182007_10002603
1461 Ga0182007_10029330
1462 Ga0183361_10006
1463 Ga0163161_10327949
1464 Ga0197907_10786487
1465 Ga0206356_11063903
1466 Ga0206356_11271715
1467 Ga0206349_1746600
1468 Ga0206355_1314553
1469 Ga0206351_10276860
1470 Ga0206350_10136400
1471 Ga0206353_10640594
1472 Ga0154015_1572807
1473 Ga0213872_10000992
1474 Ga0224712_10000016
1475 Ga0209784_100003
1476 Ga0209784_100793
1477 Ga0209566_100002
1478 Ga0209566_100534
1479 Ga0209566_101105
1480 Ga0209566_101161
1481 Ga0209674_100003
1482 Ga0209674_100005
1483 Ga0209674_100008
1484 Ga0209674_100179
1485 Ga0209674_100334
1486 Ga0209674_103262
1487 Ga0209674_103950
1488 Ga0209672_100001
1489 Ga0209672_100014
1490 Ga0209672_100023
1491 Ga0209672_100052
1492 Ga0209672_100191
1493 Ga0209147_100001
1494 Ga0209147_100002
1495 Ga0209147_100127
1496 Ga0209147_100171
1497 Ga0209147_102551
1498 Ga0209563_100004
1499 Ga0209563_100010
1500 Ga0209563_100968
1501 Ga0209563_107376
1502 Ga0207427_100403
1503 Ga0207427_102749
1504 Ga0209258_100001
1505 Ga0209258_100002
1506 Ga0209258_100134
1507 Ga0209258_100183
1508 Ga0209258_100267
1509 Ga0209646_1000022
1510 Ga0209646_1000142
1511 Ga0209026_1000027
1512 Ga0209026_1003742
1513 Ga0209677_100009
1514 Ga0209677_100083
1515 Ga0209677_101097
1516 Ga0209677_102324
1517 Ga0209148_1000003
1518 Ga0209148_1000021
1519 Ga0209148_1000035
1520 Ga0209148_1000759
1521 Ga0209759_1000152
1522 Ga0209759_1000223
1523 Ga0209759_1000632
1524 Ga0209759_1001047
1525 Ga0209759_1001331
1526 Ga0209759_1003570
1527 Ga0209759_1005317
1528 Ga0209759_1005697
1529 Ga0209759_1006126
1530 Ga0209759_1006134
1531 Ga0209233_1000016
1532 Ga0209565_1020529
1533 Ga0209455_1000001
1534 Ga0209455_1000021
1535 Ga0209455_1000072
1536 Ga0209455_1000158
1537 Ga0209455_1001083
1538 Ga0209673_1000140
1539 Ga0209130_1007182
1540 Ga0209675_1019043
1541 Ga0209564_1019659
1542 Ga0209564_1027380
1543 Ga0209050_1001494
1544 Ga0209050_1010817
1545 Ga0209256_1000071
1546 Ga0207426_1000245
1547 Ga0209051_1000210
1548 Ga0209051_1023851
1549 Ga0209257_1000017
1550 Ga0209257_1000179
1551 Ga0209257_1000314
1552 Ga0207697_10005251
1553 Ga0207656_10031678
1554 Ga0207696_1052071
1555 Ga0207713_1000202
1556 Ga0207713_1003263
1557 Ga0207653_10006510
1558 Ga0207682_10005848
1559 Ga0207682_10008342
1560 Ga0207642_10000249
1561 Ga0207680_10003802
1562 Ga0207680_10039180
1563 Ga0207647_10001142
1564 Ga0207647_10003351
1565 Ga0207647_10037588
1566 Ga0207647_10079403
1567 Ga0207647_10089176
1568 Ga0207699_10037202
1569 Ga0207645_10001701
1570 Ga0207645_10009891
1571 Ga0207645_10056494
1572 Ga0207645_10084194
1573 Ga0207643_10018310
1574 Ga0207705_10000844
1575 Ga0207705_10004402
1576 Ga0207705_10086851
1577 Ga0207654_10028204
1578 Ga0207707_10067875
1579 Ga0207707_10071830
1580 Ga0207695_10009153
1581 Ga0207695_10009853
1582 Ga0207695_10018069
1583 Ga0207695_10021832
1584 Ga0207695_10030671
1585 Ga0207695_10045161
1586 Ga0207671_10081233
1587 Ga0207660_10003897
1588 Ga0207662_10000064
1589 Ga0207662_10015905
1590 Ga0207657_10000122
1591 Ga0207657_10000330
1592 Ga0207649_10000118
1593 Ga0207649_10001141
1594 Ga0207649_10111638
1595 Ga0207649_10169034
1596 Ga0207694_10027215
1597 Ga0207694_10058075
1598 Ga0207694_10085713
1599 Ga0207694_10582120
1600 Ga0207650_10004854
1601 Ga0207650_10020670
1602 Ga0207650_10053761
1603 Ga0207659_10009905
1604 Ga0207659_10030120
1605 Ga0207659_10031148
1606 Ga0207687_10000267
1607 Ga0207644_10001988
1608 Ga0207644_10322018
1609 Ga0207644_10349413
1610 Ga0207690_10000047
1611 Ga0207690_10000806
1612 Ga0207690_10007376
1613 Ga0207706_10002276
1614 Ga0207706_10047673
1615 Ga0207706_10364553
1616 Ga0207706_10618290
1617 Ga0207686_10067842
1618 Ga0207709_10000473
1619 Ga0207709_10105700
1620 Ga0207670_10019210
1621 Ga0207670_10028136
1622 Ga0207669_10005866
1623 Ga0207669_10011044
1624 Ga0207704_10000581
1625 Ga0207704_10001884
1626 Ga0207691_10000019
1627 Ga0207691_10000361
1628 Ga0207691_10012729
1629 Ga0207691_10054976
1630 Ga0207711_10086148
1631 Ga0207711_10595550
1632 Ga0207689_10000200
1633 Ga0207689_10015822
1634 Ga0207689_10031815
1635 Ga0207689_10077819
1636 Ga0207661_10028885
1637 Ga0207679_10000001
1638 Ga0207679_10000201
1639 Ga0207679_10029874
1640 Ga0207667_10001243
1641 Ga0207667_10002763
1642 Ga0207667_10016789
1643 Ga0207667_10121488
1644 Ga0207667_10212020
1645 Ga0207651_10004395
1646 Ga0207651_10031449
1647 Ga0207712_10001270
1648 Ga0207640_10000113
1649 Ga0207640_10005815
1650 Ga0207640_10006490
1651 Ga0207640_10013476
1652 Ga0207658_10196452
1653 Ga0207677_10004351
1654 Ga0207677_10044660
1655 Ga0207677_10218490
1656 Ga0207677_10373665
1657 Ga0207703_10009109
1658 Ga0207703_10056358
1659 Ga0207703_10188688
1660 Ga0207703_10473741
1661 Ga0207639_10106451
1662 Ga0207678_10000001
1663 Ga0207678_10000251
1664 Ga0207678_10000522
1665 Ga0207678_10047296
1666 Ga0207708_10001866
1667 Ga0207708_10005405
1668 Ga0207708_10160036
1669 Ga0207702_10000009
1670 Ga0207702_10001685
1671 Ga0207702_10059569
1672 Ga0207702_10076411
1673 Ga0207702_10156003
1674 Ga0207641_10311435
1675 Ga0207648_10000193
1676 Ga0207648_10000309
1677 Ga0207648_10001698
1678 Ga0207648_10004374
1679 Ga0207648_10005619
1680 Ga0207648_10109552
1681 Ga0207674_10013210
1682 Ga0207674_10028128
1683 Ga0207675_100000089
1684 Ga0207675_100112223
1685 Ga0207675_100257609
1686 Ga0207683_10000443
1687 Ga0207683_10032306
1688 Ga0207698_10002643
1689 Ga0207698_10089109
1690 Ga0207698_10273872
1691 Ga0207698_10387682
1692 Ga0209281_1000084
1693 Ga0209371_1000079
1694 Ga0209371_1006443
1695 Ga0209969_1011643
1696 Ga0209999_1006617
1697 Ga0207428_10001059
1698 Ga0207428_10002692
1699 Ga0207428_10031335
1700 Ga0207428_10094310
1701 Ga0268266_10150619
1702 Ga0268266_10543925
1703 Ga0268265_10002816
1704 Ga0268265_10010412
1705 Ga0268265_10073719
1706 Ga0268265_10198809
1707 Ga0268264_10001651
1708 Ga0268264_10005991
1709 Ga0268264_10060358
1710 Ga0268264_10469492
1711 Ga0265336_10000008
1712 Ga0307517_10000671
1713 Ga0307517_10153306
1714 Ga0307517_10155498
1715 Ga0307515_10001283
1716 Ga0307515_10036077
1717 Ga0307515_10070801
1718 Ga0307515_10086283
1719 Ga0307515_10088603
1720 Ga0307515_10137364
1721 Ga0307515_10143815
1722 Ga0307515_10262153
1723 Ga0265324_10001714
1724 Ga0268256_1000429
1725 Ga0268256_1006028
1726 Ga0307511_10000623
1727 Ga0307512_10058658
1728 Ga0307512_10099361
1729 Ga0265331_10001526
1730 Ga0265327_10000144
1731 Ga0265327_10001301
1732 Ga0307513_10000004
1733 Ga0307513_10027729
1734 Ga0307513_10039345
1735 Ga0307513_10134285
1736 Ga0307509_10000041
1737 Ga0307509_10041365
1738 Ga0307509_10047402
1739 Ga0307509_10087870
1740 Ga0307509_10088275
1741 Ga0307509_10122263
1742 Ga0307408_100061382
1743 Ga0307508_10065449
1744 Ga0307508_10392976
1745 Ga0307514_10000795
1746 Ga0307514_10001506
1747 Ga0307514_10064361
1748 Ga0307514_10102061
1749 Ga0307516_10003211
1750 Ga0307516_10016177
1751 Ga0307405_10108420
1752 Ga0307405_10209366
1753 Ga0307413_10001960
1754 Ga0307410_10021641
1755 Ga0307412_10000008
1756 Ga0307412_10030512
1757 Ga0307409_100133281
1758 Ga0307416_100012234
1759 Ga0307416_100211655
1760 Ga0307416_100308841
1761 Ga0307416_100318279
1762 Ga0307414_10275228
1763 Ga0307411_10000263
1764 Ga0307411_10002529
1765 Ga0307411_10248541
1766 Ga0307415_100004459
1767 Ga0307507_10231909
1768 Ga0307507_10296179
1769 Ga0373926_0008602
1770 Ga0373940_0010689
1771 Ga0373949_0004709
1772 Ga0373951_0041973
1773 Ga0373932_0021211
1774 Ga0373939_0000017
1775 Ga0373945_0013270
1776 Ga0373960_0021202
1777 Ga0373946_0040508
1778 Ga0373942_0010184
1779 Ga0373961_0018880
1780 Ga0373961_0042724
1781 Ga0373962_0004175
1782 Ga0373924_0038989
1783 Ga0373931_0002168
1784 Ga0373931_0004530
1785 Ga0373931_0011317
1786 Ga0373931_0159233
1787 Ga0373931_0161563
1788 Ga0373931_0165154
1789 Ga0373935_0011919
1790 Ga0373927_0019101
1791 Ga0373927_0183269
1792 Ga0373937_0078854
1793 Ga0373925_0333433
1794 Ga0373925_0337481
1795 Ga0395899_0000007
1796 Ga0395899_0020035
1797 Ga0395899_0090394
1798 Ga0395899_0137060
1799 Ga0395900_0000066
1800 Ga0395900_0001782
1801 Ga0395900_0026541
1802 Ga0395900_0132162
1803 Ga0395900_0301275
1804 Ga0395898_0000225
1805 Ga0395898_0000921
1806 Ga0395898_0055484
1807 Ga0395898_0079984
1808 Ga0395898_0337574
1809 Ga0395905_0000050
1810 Ga0395905_0000733
1811 Ga0395901_0000067
1812 Ga0395901_0000133
1813 Ga0395901_0003229
1814 Ga0395901_0029424
1815 Ga0395901_0357875
1816 Ga0436361_0494111
1817 Ga0436361_0677882
1818 Ga0436361_0939131
1819 Ga0436361_1040196
1820 Ga0439448_0000283
1821 Ga0450890_002028
1822 Ga0450891_008112
1823 Ga0450892_001891
1824 Ga0450889_000080
1825 Ga0439459_0021734
1826 Ga0450918_000362
1827 Ga0450893_0000522
1828 Ga0451577_0003800
1829 Ga0451577_0003831
1830 Ga0451577_0006873
1831 Ga0451577_0334375
1832 Ga0466986_0182397
1833 Ga0466969_0001463
1834 Ga0466969_0007667
1835 Ga0466969_0008720
1836 Ga0466969_0037623
1837 Ga0466969_0090505
1838 Ga0466972_0007876
1839 Ga0466973_0074960
1840 Ga0466978_0103880
1841 Ga0466982_0097121
1842 Ga0453683_0028341
1843 Ga0466965_0001438
1844 Ga0466965_0002260
1845 Ga0466966_0000194
1846 Ga0466966_0001860
1847 Ga0466966_0002364
1848 Ga0466966_0007860
1849 Ga0466966_0028107
1850 Ga0466966_0130621
1851 Ga0466961_0000151
1852 Ga0466961_0000628
1853 Ga0466961_0006856
1854 Ga0466961_0016198
1855 Ga0466961_0041951
1856 Ga0466961_0048450
1857 Ga0466963_0001052
1858 Ga0466963_0085188
1859 Ga0466963_0085486
1860 Ga0466964_0036610
1861 Ga0453684_0000149
1862 Ga0466971_0000194
1863 Ga0466971_0007086
1864 Ga0466971_0009721
1865 Ga0466971_0036026
1866 Ga0466968_0013237
1867 Ga0466968_0015862
1868 Ga0466970_0005638
1869 Ga0466970_0034783
1870 Ga0466970_0073542
1871 Ga0466957_0000847
1872 Ga0466957_0001803
1873 Ga0466957_0008467
1874 Ga0466960_0170237
1875 Ga0466959_0002631
1876 Ga0466959_0006950
1877 Ga0466959_0010672
1878 Ga0466959_0023909
1879 Ga0466959_0036866
1880 Ga0466959_0222807
1881 Ga0451576_0000114
1882 Ga0451576_0000656
1883 Ga0451576_0002721
1884 Ga0451576_0014283
1885 Ga0451576_0056505
1886 Ga0451576_0063244
1887 Ga0451576_0067604
1888 Ga0451576_0186597
1889 Ga0466958_0000925
1890 Ga0466958_0003153
1891 Ga0466967_0018609
1892 Ga0466967_0529138
1893 Ga0495592_0000028
1894 Ga0495592_0005491
1895 Ga0495592_0103595
1896 Ga0495592_0246043
1897 Ga0495603_0001931
1898 Ga0495603_0003257
1899 Ga0495603_0005093
1900 Ga0495603_0017440
1901 Ga0495590_0057246
1902 Ga0495629_0001146
1903 Ga0495629_0001890
1904 Ga0495629_0002163
1905 Ga0495629_0091798
1906 Ga0495638_0015120
1907 Ga0495638_0017957
1908 Ga0495651_0012126
1909 Ga0495651_0097279
1910 Ga0495651_0147642
1911 Ga0495653_0022460
1912 Ga0495653_0048684
1913 Ga0495653_0086002
1914 Ga0495653_0209685
1915 Ga0495650_0011299
1916 Ga0495650_0013298
1917 Ga0495650_0014003
1918 Ga0495580_0000517
1919 Ga0495580_0016734
1920 Ga0495580_0017140
1921 Ga0495580_0017698
1922 Ga0495580_0106584
1923 Ga0495580_0235969
1924 Ga0495582_0077436
1925 Ga0495582_0116145
1926 Ga0495605_0003018
1927 Ga0495605_0021788
1928 Ga0495639_0004838
1929 Ga0495664_0011488
1930 Ga0495664_0011977
1931 Ga0495664_0016892
1932 Ga0495664_0112764
1933 Ga0495584_0041969
1934 Ga0495596_0002474
1935 Ga0495596_0004382
1936 Ga0495583_0000171
1937 Ga0495583_0008171
1938 Ga0495583_0011405
1939 Ga0495606_0032177
1940 Ga0495606_0034434
1941 Ga0495606_0054271
1942 Ga0495606_0056907
1943 Ga0495608_0007945
1944 Ga0495608_0013416
1945 Ga0495610_0017008
1946 Ga0495618_0005269
1947 Ga0495618_0048156
1948 Ga0495618_0116916
1949 Ga0495628_0001007
1950 Ga0495628_0074034
1951 Ga0495628_0119465
1952 Ga0495628_0181960
1953 Ga0495630_0006191
1954 Ga0495630_0008391
1955 Ga0495630_0011496
1956 Ga0495630_0024623
1957 Ga0495630_0026345
1958 Ga0495648_0013526
1959 Ga0495648_0068282
1960 Ga0495666_0006096
1961 Ga0495666_0010997
1962 Ga0495666_0099569
1963 Ga0495642_0058095
1964 Ga0495652_0004958
1965 Ga0495652_0134520
1966 Ga0495665_0000594
1967 Ga0495665_0002061
1968 Ga0495665_0006205
1969 Ga0495640_0005888
1970 Ga0495640_0167613
1971 Ga0495586_0002775
1972 Ga0495586_0003604
1973 Ga0495586_0013386
1974 Ga0495598_0047222
1975 Ga0495621_0036134
1976 Ga0495645_0006099
1977 Ga0495645_0010780
1978 Ga0495645_0075727
1979 Ga0495667_0034073
1980 Ga0495668_0050673
1981 Ga0495634_0008364
1982 Ga0495634_0020991
1983 Ga0495625_0010602
1984 Ga0495635_0016969
1985 Ga0495661_0006659
1986 Ga0495661_0023626
1987 Ga0495661_0049029
1988 Ga0495588_0031963
1989 Ga0495599_0091342
1990 Ga0495599_0112927
1991 Ga0495623_0053399
1992 Ga0495623_0083010
1993 Ga0495646_0037223
1994 Ga0495646_0046212
1995 Ga0495646_0066570
1996 Ga0495647_0002600
1997 Ga0495669_0002739
1998 Ga0495613_0021742
1999 Ga0495613_0079849
2000 Ga0495624_0001768
2001 Ga0495624_0007203
2002 Ga0495624_0049165
2003 Ga0495624_0049811
2004 Ga0495624_0107566
2005 Ga0495624_0137103
2006 Ga0495671_0009406
2007 Ga0495649_0000231
2008 Ga0495649_0009842
2009 Ga0495649_0015210
2010 Ga0495589_0003656
2011 Ga0495589_0045125
2012 Ga0495589_0129285
2013 Ga0495600_0002037
2014 Ga0495600_0009095
2015 Ga0495581_0053507
2016 Ga0495604_0055414
2017 Ga0495604_0104560
2018 Ga0495604_0112685
2019 Ga0495674_0008443
2020 Ga0495674_0016439
2021 Ga0495674_0041342
2022 Ga0495674_0084030
2023 Ga0495674_0264147
2024 Ga0495672_0001630
2025 Ga0495672_0017913
2026 Ga0495672_0039613
2027 Ga0495676_0015888
2028 Ga0495676_0048716
2029 Ga0495676_0066658
2030 Ga0495676_0069814
2031 Ga0495680_0001829
2032 Ga0495680_0012161
2033 Ga0495680_0031678
2034 Ga0495680_0097906
2035 Ga0495683_0001484
2036 Ga0495683_0012221
2037 Ga0495683_0064935
2038 Ga0495683_0066340
2039 Ga0495683_0118169
2040 Ga0495687_072515
2041 Ga0495687_127525
2042 Ga0495675_0001062
2043 Ga0495675_0020157
2044 Ga0495675_0037367
2045 Ga0495675_0098205
2046 Ga0495679_001045
2047 Ga0495679_001930
2048 Ga0495679_002911
2049 Ga0495673_0003222
2050 Ga0495673_0010992
2051 Ga0495684_0054243
2052 Ga0495686_0000002
2053 Ga0495686_0018809
2054 Ga0495593_0005941
2055 Ga0495593_0018522
2056 Ga0495593_0024611
2057 Ga0495593_0046822
2058 Ga0495602_0007108
2059 Ga0495602_0021822
2060 Ga0495602_0022728
2061 Ga0495602_0065391
2062 Ga0495602_0143660
2063 Ga0495602_0215459
2064 Ga0495614_0026820
2065 Ga0495614_0040063
2066 Ga0495614_0052410
2067 Ga0496100_0021083
2068 Ga0496100_0029489
2069 Ga0496100_0082208
2070 Ga0496100_0191396
2071 Ga0496101_0043975
2072 Ga0496101_0054630
2073 Ga0496102_0002584
2074 Ga0496102_0007189
2075 Ga0496102_0059147
2076 Ga0496102_0083729
2077 Ga0496102_0118208
2078 Ga0496102_0498043
2079 Ga0496103_0001198
2080 Ga0496103_0002973
2081 Ga0496104_0038994
2082 Ga0496105_0111515
2083 Ga0496105_0318085
2084 Ga0496106_0006310
2085 Ga0496106_0013030
2086 Ga0496106_0038486
2087 Ga0496106_0228556
2088 Ga0496107_0014068
2089 Ga0496107_0136951
2090 Ga0496108_0050818
2091 Ga0496109_0018971
2092 Ga0496109_0073211
2093 Ga0496110_0042683
2094 Ga0496110_0099014
2095 Ga0496110_0198775
2096 Ga0496110_0220994
2097 Ga0496111_0006562
2098 Ga0496112_0062144
2099 Ga0496112_0069114
2100 Ga0496112_0094559
2101 Ga0496113_0007024
2102 Ga0496114_0006772
2103 Ga0496117_0000622
2104 Ga0496117_0003463
2105 Ga0496117_0008093
2106 Ga0496117_0038065
2107 Ga0496117_0059594
2108 Ga0496117_0070573
2109 Ga0496118_0001465
2110 Ga0496118_0005899
2111 Ga0496118_0011064
2112 Ga0496118_0016918
2113 Ga0496118_0018642
2114 Ga0496118_0064670
2115 Ga0496118_0147249
2116 Ga0496121_0004846
2117 Ga0496121_0004983
2118 Ga0496121_0007284
2119 Ga0496121_0013227
2120 Ga0496121_0027216
2121 Ga0496122_0014682
2122 Ga0496124_0000161
2123 Ga0496124_0235590
2124 Ga0496125_0006543
2125 Ga0496125_0025298
2126 Ga0496126_0004047
2127 Ga0496126_0005902
2128 Ga0496126_0008623
2129 Ga0496126_0012817
2130 Ga0496126_0112078
2131 Ga0496126_0221918
2132 Ga0501032_0230422
2133 Ga0501036_0260593
2134 Ga0501039_0073715
2135 Ga0501040_0017185
2136 Ga0501041_0063122
2137 Ga0501041_0078529
2138 Ga0501042_0009440
2139 Ga0501047_0003323
2140 Ga0501067_0004424
2141 Ga0501068_0000394
2142 Ga0501069_0000211
2143 Ga0501072_0000016
2144 Ga0501073_0004660
2145 Ga0501074_0003292
2146 Ga0501074_0017094
2147 Ga0501076_0003805
2148 Ga0501079_0005386
2149 Ga0501081_0003513
2150 Ga0501081_0314529
2151 Ga0501081_0386476
2152 Ga0501083_0005162
2153 Ga0501044_0002394
2154 nmdc:mga0yw44_43259_c1
2155 nmdc:mga0k408_1348_c1
2156 nmdc:mga0k408_54830_c1
2157 nmdc:mga0k408_59192_c2
2158 nmdc:mga07m45_1241_c1
2159 nmdc:mga07m45_176015_c1
2160 nmdc:mga07m45_1961_c1
2161 nmdc:mga05p37_72_c1
2162 nmdc:mga09592_7186_c1
2163 nmdc:mga0qj67_127854_c1
2164 nmdc:mga08y16_17302_c1
2165 nmdc:mga08y16_203259_c1
2166 nmdc:mga08y16_2144_c1
2167 nmdc:mga08y16_446_c1
2168 nmdc:mga08y16_79312_c1
2169 nmdc:mga0n895_7346_c1
2170 nmdc:mga0rr50_374_c1
2171 nmdc:mga08x19_1134_c1
2172 nmdc:mga0a205_1144_c1
2173 nmdc:mga0a205_424481_c1
2174 Ga0500578_0020678
2175 Ga0500651_0003954
2176 Ga0500651_0064096
2177 Ga0500594_0003862
2178 Ga0500608_052538
2179 Ga0500559_0000141
2180 Ga0500619_007960
2181 Ga0500622_0001173
2182 Ga0500636_0005519
2183 Ga0500636_0118835
2184 Ga0500645_003156
2185 Ga0500587_003876
2186 Ga0500587_004820
2187 Ga0501084_0000028
2188 Ga0590071_000905
2189 Ga0587084_000105
2190 Ga0587093_001819
2191 Ga0587070_019705
2192 Ga0587073_0006385
2193 Ga0587083_0000250
2194 Ga0587085_017200
2195 Ga0587088_000007
2196 Ga0587088_008846
2197 Ga0587106_014539
2198 Ga0587101_000297
2199 Ga0587128_004138
2200 Ga0587067_000065
2201 Ga0587068_000913
2202 Ga0587072_000021
2203 Ga0587072_025015
2204 Ga0587079_004324
2205 Ga0501082_0000787
2206 Ga0466962_0000946
2207 Ga0466962_0002327
2208 Ga0466962_0009479
2209 Ga0466962_0029937
2210 Ga0466962_0086844
2211 Ga0530510_0021621
2212 Ga0530510_0441795
2213 2921645893
2214 2501072682
2215 2501080542
2216 2501410565
2217 2509131318
2218 2510251482
2219 2511086999
2220 2511096968
2221 2511103778
2222 2512345560
2223 2513552214
2224 2513561000
2225 2513961851
2226 2514051970
2227 2515680845
2228 2515690672
2229 2516019445
2230 2563058801
2231 2599736748
2232 2599744820
2233 2600205816
2234 2600812081
2235 2643936825
2236 2644221656
2237 2644249029
2238 2644257579
2239 2644304217
2240 2644318726
2241 2676742949
2242 2713476545
2243 2719640596
2244 2735817510
2245 2738818652
2246 2738831191
2247 2738872719
2248 2739058565
2249 2739184349
2250 2739219318
2251 2746088721
2252 2746097338
2253 2792836049
2254 2808972748
2255 2809007730
2256 2809014730
2257 2817261436
2258 2817279122
2259 2817456278
2260 2819619999
2261 2819631272
2262 2842328653
2263 2842352969
2264 2842458686
2265 2856294236
2266 2857367493
2267 2863427413
2268 2870070881
2269 2883093039
2270 2885273003
2271 2900634281
2272 2902683701
2273 2904484591
2274 2904570032
2275 2904576057
2276 2904624183
2277 2919531445
2278 2928110508
2279 2928140024
2280 2928162906
2281 2928169578
2282 2928171596
2283 2928505516
2284 2928542596
2285 2945937351
2286 2981996797
2287 2990705955
2288 642425610
2289 642416305
2290 642593210
2291 642622107
2292 8003955570
2293 8018846985
2294 8020813638
2295 8020944946
2296 8020945523
2297 8020957017
2298 8021122125
2299 8039102624
2300 8040172784
2301 8040173745
2302 8055268936
2303 8055302080
2304 8057579237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

59

346

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.988 1 291
6p90-assembly1.cif.gz_B crystal structure of padhdps2-h56q mutant 0.9878 1 291
3qze-assembly2.cif.gz_D crystal structure of dapa (pa1010) at 1.6 a resolution 0.9873 2 291
3flu-assembly1.cif.gz_B crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis 0.986 1 291
3pud-assembly1.cif.gz_A crystal structure of dhydrodipicolinate synthase from acinetobacter baumannii at 2.8a resolution 0.9859 1 291
ID Description Score Start End Superfamily
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9783 3 291 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9755 3 291 3.20.20.70
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9724 3 291 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9714 3 291 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.971 1 287 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A521ZAB2-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.995 1 291 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2T5K103-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9935 2 289 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A4Q3JXT2-F1-model_v4 deleted 0.9931 57 291
AF-A0A7R6PD14-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.991 7 291 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2P5KB96-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9903 1 291 GO:0005829
GO:0008840
GO:0009089
GO:0019877

Map