F490885
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1153 | 494 | 2306 | 437 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10000847|Ga0182008_1000084716 |
| Length | 480 |
| Sequence | MGISVVKLANGTAFQARRPARSPPLNSYDVLCYLSHVSKSDKNKITQIQETRMGKDMPESLSQTASAPVTASFEDLAYRKVAWRILPLLLLCYLVAYLDRVNVGFAKLQMSEDLQFSEAVYGLGAGIFFIAYFLVEIPSNLILHRVGARLWIARIMISWGLISSCMAFVSTPTSFYVMRFLLGIAEAGFYPGVILYLSYWFPSNRRGKMYALFATAVPLSGLIGAHHGFAGWQWMFFLEGLPSILVGGLVIYCLSDRIADAGWLTREQKTLLQSRIEAETDGHQVHSVRQVFGQPRIWLLTAIYFCMIAGFYTVGFWLPSLIRQAGVSDVFQVGMLTAIPYAAAALTMVLISRSADRLRERRWHLALTAVLGGVGLMISATWSDNFTVSMIGLTLGAMGAFSTLPLFWSLPTAFLGGTAAAAGIALINSWGNLAGFVSPYLMGFLKDLTQSTTIGMYVMASALFVGALLVFKIPGKLVNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 166 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 182 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 185 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 186 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 187 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 188 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 189 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 190 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 196 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 302 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 323 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 324 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 328 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 331 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 332 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 334 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 336 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 339 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 342 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 343 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 344 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 345 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 346 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 347 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 348 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 349 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 350 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 351 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 352 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 353 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 354 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 355 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 356 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 357 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 358 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 359 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 360 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 361 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 362 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 363 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 364 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 365 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 366 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 367 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 368 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 369 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 370 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 371 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 372 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 373 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 374 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 375 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 376 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 377 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 378 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 379 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 380 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 381 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 382 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 383 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 384 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 385 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 386 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 387 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 388 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 389 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 390 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 391 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 392 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 393 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 394 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 395 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 396 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 397 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 398 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 399 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 400 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 401 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 402 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 403 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 404 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 405 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 406 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 407 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 408 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 409 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 410 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 411 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 412 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 413 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 414 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 415 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 416 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 417 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 418 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 419 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 420 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 421 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 422 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 423 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 424 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 425 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 426 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 427 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 428 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 429 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 430 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 431 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 432 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 433 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 434 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 435 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 436 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 437 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 438 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 439 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 440 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 441 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 442 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 443 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 444 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 445 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 446 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 447 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 448 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 449 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 450 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 451 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 452 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 453 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 454 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 455 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 456 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 457 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 458 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 459 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 460 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 461 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 462 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 463 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 464 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 465 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 466 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 467 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 468 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 469 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 470 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 471 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 472 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 473 | 2941479691 | |||
| 474 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 475 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 476 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 477 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 478 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 479 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 480 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 481 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 482 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 483 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 484 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 485 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 486 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 487 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 488 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 489 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 490 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 491 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 492 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 493 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 494 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.57 |
| Metatranscriptomes | 0.09 |
| Isolates | 17.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 14.92 |
| Nodule | 1.99 |
| Rhizoplane | 5.29 |
| Rhizosphere | 62.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10000847 | 3300014497 | Bacteria | 21271 |
| 2 | JGI24740J21852_10005825 | 3300001979 | Bacteria | 5172 |
| 3 | JGI24735J21928_10000157 | 3300002067 | Bacteria | 23953 |
| 4 | JGI24735J21928_10008037 | 3300002067 | Bacteria | 3425 |
| 5 | JGI24735J21928_10014603 | 3300002067 | Bacteria | 2458 |
| 6 | JGI24735J21928_10031205 | 3300002067 | Bacteria | 1580 |
| 7 | JGI24738J21930_10002732 | 3300002075 | Bacteria | 4536 |
| 8 | JGI25156J39149_1000161 | 3300002705 | Bacteria | 49302 |
| 9 | JGI25156J39149_1000925 | 3300002705 | Bacteria | 14269 |
| 10 | JGI25156J39149_1007675 | 3300002705 | Bacteria | 2802 |
| 11 | JGI25162J39368_1000085 | 3300002737 | Bacteria | 107722 |
| 12 | JGI25162J39368_1000251 | 3300002737 | Bacteria | 52332 |
| 13 | JGI25163J39215_1000077 | 3300002771 | Bacteria | 43838 |
| 14 | JGI25163J39215_1000590 | 3300002771 | Bacteria | 10192 |
| 15 | JGI25164J39214_1000063 | 3300002772 | Bacteria | 107722 |
| 16 | JGI25164J39214_1000194 | 3300002772 | Bacteria | 52332 |
| 17 | JGI25152J39213_1001519 | 3300002773 | Bacteria | 9870 |
| 18 | JGI25152J39213_1002390 | 3300002773 | Bacteria | 7185 |
| 19 | JGI25150J39212_1000587 | 3300002774 | Bacteria | 14362 |
| 20 | JGI25159J45721_1001477 | 3300002987 | Bacteria | 9696 |
| 21 | JGI25159J45721_1004504 | 3300002987 | Bacteria | 4608 |
| 22 | JGI25151J46595_10000159 | 3300003187 | Bacteria | 87280 |
| 23 | JGI25151J46595_10002728 | 3300003187 | Bacteria | 10299 |
| 24 | JGI25165J46597_1000160 | 3300003214 | Bacteria | 107722 |
| 25 | JGI25165J46597_1000348 | 3300003214 | Bacteria | 52332 |
| 26 | JGI25165J46597_1001388 | 3300003214 | Bacteria | 13281 |
| 27 | JGI25153J46596_10002616 | 3300003215 | Bacteria | 10299 |
| 28 | rootH1_10076874 | 3300003316 | Bacteria | 3067 |
| 29 | rootH2_10004706 | 3300003320 | Bacteria | 7529 |
| 30 | rootH2_10006723 | 3300003320 | Bacteria | 9356 |
| 31 | rootL2_10111661 | 3300003322 | Bacteria | 5873 |
| 32 | rootH1_10290880 | 3300003323 | Bacteria | 2390 |
| 33 | JGI25160J50197_1002012 | 3300003354 | Bacteria | 9696 |
| 34 | JGI25160J50197_1009144 | 3300003354 | Bacteria | 3703 |
| 35 | JGI25161J50226_1000954 | 3300003374 | Bacteria | 10300 |
| 36 | JGI25161J50226_1003092 | 3300003374 | Bacteria | 3968 |
| 37 | Ga0055533_1000246 | 3300003756 | Bacteria | 33950 |
| 38 | Ga0055532_1000012 | 3300003758 | Bacteria | 382698 |
| 39 | Ga0055532_1000236 | 3300003758 | Bacteria | 40700 |
| 40 | Ga0055532_1000645 | 3300003758 | Bacteria | 13457 |
| 41 | Ga0055532_1000796 | 3300003758 | Bacteria | 10925 |
| 42 | Ga0055532_1000950 | 3300003758 | Bacteria | 9310 |
| 43 | Ga0055527_1000011 | 3300003760 | Bacteria | 354560 |
| 44 | Ga0055527_1000421 | 3300003760 | Bacteria | 17392 |
| 45 | Ga0055535_1000009 | 3300003761 | Bacteria | 382698 |
| 46 | Ga0055535_1000267 | 3300003761 | Bacteria | 54799 |
| 47 | Ga0055535_1000345 | 3300003761 | Bacteria | 46284 |
| 48 | Ga0055542_1000009 | 3300003762 | Bacteria | 416550 |
| 49 | Ga0055542_1000015 | 3300003762 | Bacteria | 382698 |
| 50 | Ga0055542_1000175 | 3300003762 | Bacteria | 79760 |
| 51 | Ga0055542_1001534 | 3300003762 | Bacteria | 11083 |
| 52 | Ga0055529_1000011 | 3300003763 | Bacteria | 382698 |
| 53 | Ga0055529_1000131 | 3300003763 | Bacteria | 105530 |
| 54 | Ga0055526_1002126 | 3300003771 | Bacteria | 13599 |
| 55 | Ga0055526_1003318 | 3300003771 | Bacteria | 10299 |
| 56 | Ga0055537_1001028 | 3300003773 | Bacteria | 12602 |
| 57 | Ga0055537_1004341 | 3300003773 | Bacteria | 4070 |
| 58 | Ga0055524_1002180 | 3300003775 | Bacteria | 10299 |
| 59 | Ga0055524_1004347 | 3300003775 | Bacteria | 6554 |
| 60 | Ga0055536_1000283 | 3300003781 | Bacteria | 38490 |
| 61 | Ga0055534_1000998 | 3300003784 | Bacteria | 12428 |
| 62 | Ga0055534_1001306 | 3300003784 | Bacteria | 10073 |
| 63 | Ga0055528_1001735 | 3300003790 | Bacteria | 12602 |
| 64 | Ga0055528_1007335 | 3300003790 | Bacteria | 4890 |
| 65 | Ga0055528_1009455 | 3300003790 | Bacteria | 4069 |
| 66 | Ga0055530_10000442 | 3300003791 | Bacteria | 36800 |
| 67 | Ga0055540_1001556 | 3300003792 | Bacteria | 13426 |
| 68 | Ga0055540_1010976 | 3300003792 | Bacteria | 2968 |
| 69 | Ga0055531_10000459 | 3300003794 | Bacteria | 37704 |
| 70 | Ga0055531_10006647 | 3300003794 | Bacteria | 6496 |
| 71 | Ga0055543_1003052 | 3300004625 | Bacteria | 5154 |
| 72 | Ga0065165_1001684 | 3300005262 | Bacteria | 22325 |
| 73 | Ga0065165_1007053 | 3300005262 | Bacteria | 5652 |
| 74 | Ga0065703_1000120 | 3300005272 | Bacteria | 47864 |
| 75 | Ga0065714_10064585 | 3300005288 | Bacteria | 31987 |
| 76 | Ga0065715_10013607 | 3300005293 | Bacteria | 2048 |
| 77 | Ga0070658_10015084 | 3300005327 | Bacteria | 6185 |
| 78 | Ga0070658_10040983 | 3300005327 | Bacteria | 3736 |
| 79 | Ga0070676_10031057 | 3300005328 | Bacteria | 3050 |
| 80 | Ga0070683_100003572 | 3300005329 | Bacteria | 12654 |
| 81 | Ga0070690_100056010 | 3300005330 | Bacteria | 2527 |
| 82 | Ga0070670_100006156 | 3300005331 | Bacteria | 10143 |
| 83 | Ga0070670_100088097 | 3300005331 | Bacteria | 2668 |
| 84 | Ga0070666_10010909 | 3300005335 | Bacteria | 5693 |
| 85 | Ga0070682_100169365 | 3300005337 | Bacteria | 1516 |
| 86 | Ga0070660_100000106 | 3300005339 | Bacteria | 52000 |
| 87 | Ga0070689_100006546 | 3300005340 | Bacteria | 8075 |
| 88 | Ga0070661_100006676 | 3300005344 | Bacteria | 7959 |
| 89 | Ga0070661_100090596 | 3300005344 | Bacteria | 2265 |
| 90 | Ga0070669_100014584 | 3300005353 | Bacteria | 5593 |
| 91 | Ga0070669_100075722 | 3300005353 | Bacteria | 2497 |
| 92 | Ga0070675_100145053 | 3300005354 | Bacteria | 2032 |
| 93 | Ga0070671_100023790 | 3300005355 | Bacteria | 5015 |
| 94 | Ga0070659_100000064 | 3300005366 | Bacteria | 83862 |
| 95 | Ga0070659_100096229 | 3300005366 | Bacteria | 2378 |
| 96 | Ga0070667_100074211 | 3300005367 | Bacteria | 2901 |
| 97 | Ga0070663_100000132 | 3300005455 | Bacteria | 35487 |
| 98 | Ga0070663_100010082 | 3300005455 | Bacteria | 5877 |
| 99 | Ga0070663_100075072 | 3300005455 | Bacteria | 2470 |
| 100 | Ga0070662_100013507 | 3300005457 | Bacteria | 5434 |
| 101 | Ga0070662_100048456 | 3300005457 | Bacteria | 3061 |
| 102 | Ga0070685_10031644 | 3300005466 | Bacteria | 2958 |
| 103 | Ga0070699_100109999 | 3300005518 | Bacteria | 2419 |
| 104 | Ga0070684_100000373 | 3300005535 | Bacteria | 30982 |
| 105 | Ga0068853_100041157 | 3300005539 | Bacteria | 3945 |
| 106 | Ga0070672_100018944 | 3300005543 | Bacteria | 4987 |
| 107 | Ga0070686_100003229 | 3300005544 | Bacteria | 8923 |
| 108 | Ga0070696_100030534 | 3300005546 | Bacteria | 3690 |
| 109 | Ga0070665_100055765 | 3300005548 | Bacteria | 3963 |
| 110 | Ga0068855_100005080 | 3300005563 | Bacteria | 16040 |
| 111 | Ga0068855_100162155 | 3300005563 | Bacteria | 2536 |
| 112 | Ga0068855_100212178 | 3300005563 | Bacteria | 2175 |
| 113 | Ga0068855_100306679 | 3300005563 | Bacteria | 1757 |
| 114 | Ga0070664_100017268 | 3300005564 | Bacteria | 5927 |
| 115 | Ga0070664_100254520 | 3300005564 | Bacteria | 1579 |
| 116 | Ga0068857_100047784 | 3300005577 | Bacteria | 3800 |
| 117 | Ga0068857_100048534 | 3300005577 | Bacteria | 3769 |
| 118 | Ga0068852_100001073 | 3300005616 | Bacteria | 18055 |
| 119 | Ga0068852_100022733 | 3300005616 | Bacteria | 5034 |
| 120 | Ga0068864_100081612 | 3300005618 | Bacteria | 2835 |
| 121 | Ga0068851_10012984 | 3300005834 | Bacteria | 3936 |
| 122 | Ga0068858_100088099 | 3300005842 | Bacteria | 2888 |
| 123 | Ga0075363_100057476 | 3300006048 | Bacteria | 2088 |
| 124 | Ga0075432_10001694 | 3300006058 | Bacteria | 7262 |
| 125 | Ga0075432_10008789 | 3300006058 | Bacteria | 3447 |
| 126 | Ga0075367_10102702 | 3300006178 | Bacteria | 1749 |
| 127 | Ga0075366_10008606 | 3300006195 | Bacteria | 5682 |
| 128 | Ga0075370_10004522 | 3300006353 | Bacteria | 6769 |
| 129 | Ga0075428_100041861 | 3300006844 | Bacteria | 5037 |
| 130 | Ga0075428_100137161 | 3300006844 | Bacteria | 2660 |
| 131 | Ga0075431_100050894 | 3300006847 | Bacteria | 4271 |
| 132 | Ga0075433_10064876 | 3300006852 | Bacteria | 3202 |
| 133 | Ga0075434_100003681 | 3300006871 | Bacteria | 13695 |
| 134 | Ga0075434_100150535 | 3300006871 | Bacteria | 2347 |
| 135 | Ga0075436_100027914 | 3300006914 | Bacteria | 3885 |
| 136 | Ga0075436_100064354 | 3300006914 | Bacteria | 2535 |
| 137 | Ga0079104_1000037 | 3300006946 | Bacteria | 189207 |
| 138 | Ga0105251_10000001 | 3300009011 | Bacteria | 466643 |
| 139 | Ga0105251_10000552 | 3300009011 | Bacteria | 35215 |
| 140 | Ga0105251_10002824 | 3300009011 | Bacteria | 13136 |
| 141 | Ga0105251_10003864 | 3300009011 | Bacteria | 10673 |
| 142 | Ga0105244_10000979 | 3300009036 | Bacteria | 23974 |
| 143 | Ga0105244_10009990 | 3300009036 | Bacteria | 5783 |
| 144 | Ga0105244_10010769 | 3300009036 | Bacteria | 5525 |
| 145 | Ga0105244_10022563 | 3300009036 | Bacteria | 3464 |
| 146 | Ga0105244_10024821 | 3300009036 | Bacteria | 3266 |
| 147 | Ga0105244_10025351 | 3300009036 | Bacteria | 3224 |
| 148 | Ga0105244_10093347 | 3300009036 | Bacteria | 1478 |
| 149 | Ga0105250_10004563 | 3300009092 | Bacteria | 6348 |
| 150 | Ga0105250_10007581 | 3300009092 | Bacteria | 4652 |
| 151 | Ga0105250_10011747 | 3300009092 | Bacteria | 3630 |
| 152 | Ga0105250_10015738 | 3300009092 | Bacteria | 3095 |
| 153 | Ga0105250_10067669 | 3300009092 | Bacteria | 1441 |
| 154 | Ga0105240_10001449 | 3300009093 | Bacteria | 40535 |
| 155 | Ga0105240_10002265 | 3300009093 | Bacteria | 31201 |
| 156 | Ga0105240_10003616 | 3300009093 | Bacteria | 23943 |
| 157 | Ga0105240_10007199 | 3300009093 | Bacteria | 16203 |
| 158 | Ga0105240_10021483 | 3300009093 | Bacteria | 8583 |
| 159 | Ga0105240_10067906 | 3300009093 | Bacteria | 4418 |
| 160 | Ga0105240_10119574 | 3300009093 | Bacteria | 3173 |
| 161 | Ga0111539_10029633 | 3300009094 | Bacteria | 6662 |
| 162 | Ga0111539_10049801 | 3300009094 | Bacteria | 4992 |
| 163 | Ga0111539_10166613 | 3300009094 | Bacteria | 2576 |
| 164 | Ga0105247_10000502 | 3300009101 | Bacteria | 32176 |
| 165 | Ga0114129_10080529 | 3300009147 | Bacteria | 4526 |
| 166 | Ga0105243_10000163 | 3300009148 | Bacteria | 75904 |
| 167 | Ga0105243_10000480 | 3300009148 | Bacteria | 40986 |
| 168 | Ga0105243_10004544 | 3300009148 | Bacteria | 10962 |
| 169 | Ga0105243_10007340 | 3300009148 | Bacteria | 8474 |
| 170 | Ga0105248_10014853 | 3300009177 | Bacteria | 8577 |
| 171 | Ga0105248_10097577 | 3300009177 | Bacteria | 3311 |
| 172 | Ga0105248_10171808 | 3300009177 | Bacteria | 2443 |
| 173 | Ga0105248_10196664 | 3300009177 | Bacteria | 2272 |
| 174 | Ga0105237_10000882 | 3300009545 | Bacteria | 40534 |
| 175 | Ga0105237_10004918 | 3300009545 | Bacteria | 15285 |
| 176 | Ga0105237_10034532 | 3300009545 | Bacteria | 5120 |
| 177 | Ga0105237_10077392 | 3300009545 | Bacteria | 3316 |
| 178 | Ga0105237_10244875 | 3300009545 | Bacteria | 1794 |
| 179 | Ga0105237_10263490 | 3300009545 | Bacteria | 1726 |
| 180 | Ga0105238_10007420 | 3300009551 | Bacteria | 10984 |
| 181 | Ga0105238_10038751 | 3300009551 | Bacteria | 4839 |
| 182 | Ga0105238_10062179 | 3300009551 | Bacteria | 3734 |
| 183 | Ga0105238_10190366 | 3300009551 | Bacteria | 2028 |
| 184 | Ga0105238_10194313 | 3300009551 | Bacteria | 2005 |
| 185 | Ga0105249_10014642 | 3300009553 | Bacteria | 6935 |
| 186 | Ga0105239_10003438 | 3300010375 | Bacteria | 19385 |
| 187 | Ga0105239_10006149 | 3300010375 | Bacteria | 13968 |
| 188 | Ga0105239_10116348 | 3300010375 | Bacteria | 2967 |
| 189 | Ga0105239_10295547 | 3300010375 | Bacteria | 1824 |
| 190 | Ga0157373_10015863 | 3300013100 | Bacteria | 5499 |
| 191 | Ga0157373_10033662 | 3300013100 | Bacteria | 3685 |
| 192 | Ga0157373_10136962 | 3300013100 | Bacteria | 1722 |
| 193 | Ga0157371_10000087 | 3300013102 | Bacteria | 146302 |
| 194 | Ga0157371_10000788 | 3300013102 | Bacteria | 36497 |
| 195 | Ga0157371_10003399 | 3300013102 | Bacteria | 14460 |
| 196 | Ga0157371_10019544 | 3300013102 | Bacteria | 4992 |
| 197 | Ga0157370_10068275 | 3300013104 | Bacteria | 3360 |
| 198 | Ga0157369_10000267 | 3300013105 | Bacteria | 70715 |
| 199 | Ga0157369_10000868 | 3300013105 | Bacteria | 38582 |
| 200 | Ga0157369_10004250 | 3300013105 | Bacteria | 16959 |
| 201 | Ga0157369_10008742 | 3300013105 | Bacteria | 11599 |
| 202 | Ga0157369_10279560 | 3300013105 | Bacteria | 1739 |
| 203 | Ga0157374_10000121 | 3300013296 | Bacteria | 70618 |
| 204 | Ga0157372_10005676 | 3300013307 | Bacteria | 13274 |
| 205 | Ga0157372_10006208 | 3300013307 | Bacteria | 12699 |
| 206 | Ga0157372_10007809 | 3300013307 | Bacteria | 11363 |
| 207 | Ga0163163_10042909 | 3300014325 | Bacteria | 4432 |
| 208 | Ga0182008_10000481 | 3300014497 | Bacteria | 30439 |
| 209 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 210 | Ga0182007_10000045 | 3300015262 | Bacteria | 106028 |
| 211 | Ga0182007_10000537 | 3300015262 | Bacteria | 22367 |
| 212 | Ga0182007_10005198 | 3300015262 | Bacteria | 5751 |
| 213 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 214 | Ga0224712_10001994 | 3300022467 | Bacteria | 4942 |
| 215 | Ga0209760_100039 | 3300025207 | Bacteria | 118977 |
| 216 | Ga0209760_100064 | 3300025207 | Bacteria | 91180 |
| 217 | Ga0209566_100089 | 3300025225 | Bacteria | 142951 |
| 218 | Ga0209566_100145 | 3300025225 | Bacteria | 83624 |
| 219 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 220 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 221 | Ga0209672_100015 | 3300025228 | Bacteria | 529352 |
| 222 | Ga0209672_100031 | 3300025228 | Bacteria | 332889 |
| 223 | Ga0209672_100370 | 3300025228 | Bacteria | 27678 |
| 224 | Ga0209672_100432 | 3300025228 | Bacteria | 24158 |
| 225 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 226 | Ga0209147_100016 | 3300025229 | Bacteria | 527606 |
| 227 | Ga0209147_100034 | 3300025229 | Bacteria | 346646 |
| 228 | Ga0209147_100040 | 3300025229 | Bacteria | 307612 |
| 229 | Ga0209147_100150 | 3300025229 | Bacteria | 100971 |
| 230 | Ga0209563_101172 | 3300025230 | Bacteria | 7363 |
| 231 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 232 | Ga0207427_100082 | 3300025231 | Bacteria | 142809 |
| 233 | Ga0207427_100426 | 3300025231 | Bacteria | 23713 |
| 234 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 235 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 236 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 237 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 238 | Ga0209258_100026 | 3300025242 | Bacteria | 527606 |
| 239 | Ga0209258_100061 | 3300025242 | Bacteria | 313501 |
| 240 | Ga0207425_1000240 | 3300025245 | Bacteria | 42664 |
| 241 | Ga0207425_1002072 | 3300025245 | Bacteria | 7454 |
| 242 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 243 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 244 | Ga0209148_1000070 | 3300025254 | Bacteria | 332889 |
| 245 | Ga0209148_1000510 | 3300025254 | Bacteria | 39093 |
| 246 | Ga0209148_1001241 | 3300025254 | Bacteria | 14247 |
| 247 | Ga0209759_1000235 | 3300025256 | Bacteria | 82953 |
| 248 | Ga0209759_1000256 | 3300025256 | Bacteria | 78188 |
| 249 | Ga0209759_1000297 | 3300025256 | Bacteria | 68515 |
| 250 | Ga0209759_1003194 | 3300025256 | Bacteria | 6651 |
| 251 | Ga0209759_1006343 | 3300025256 | Bacteria | 3989 |
| 252 | Ga0209759_1015415 | 3300025256 | Bacteria | 1974 |
| 253 | Ga0209129_1000013 | 3300025258 | Bacteria | 524874 |
| 254 | Ga0209129_1002013 | 3300025258 | Bacteria | 10541 |
| 255 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 256 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 257 | Ga0209233_1000229 | 3300025261 | Bacteria | 100048 |
| 258 | Ga0209565_1000289 | 3300025263 | Bacteria | 48879 |
| 259 | Ga0209565_1000725 | 3300025263 | Bacteria | 19897 |
| 260 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 261 | Ga0209455_1000069 | 3300025272 | Bacteria | 308247 |
| 262 | Ga0209455_1000580 | 3300025272 | Bacteria | 23806 |
| 263 | Ga0209673_1000026 | 3300025273 | Bacteria | 373739 |
| 264 | Ga0209673_1000188 | 3300025273 | Bacteria | 124010 |
| 265 | Ga0209673_1000260 | 3300025273 | Bacteria | 99762 |
| 266 | Ga0209130_1000249 | 3300025284 | Bacteria | 68232 |
| 267 | Ga0209130_1000405 | 3300025284 | Bacteria | 47098 |
| 268 | Ga0209675_1000086 | 3300025291 | Bacteria | 151270 |
| 269 | Ga0209675_1000182 | 3300025291 | Bacteria | 70962 |
| 270 | Ga0209675_1003379 | 3300025291 | Bacteria | 7612 |
| 271 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 272 | Ga0209676_1004043 | 3300025292 | Bacteria | 8443 |
| 273 | Ga0209676_1009820 | 3300025292 | Bacteria | 4071 |
| 274 | Ga0209025_1000057 | 3300025294 | Bacteria | 314601 |
| 275 | Ga0209025_1000220 | 3300025294 | Bacteria | 136977 |
| 276 | Ga0209025_1000381 | 3300025294 | Bacteria | 92162 |
| 277 | Ga0209025_1006990 | 3300025294 | Bacteria | 8565 |
| 278 | Ga0209025_1016906 | 3300025294 | Bacteria | 4256 |
| 279 | Ga0209564_1000214 | 3300025295 | Bacteria | 132937 |
| 280 | Ga0209564_1000267 | 3300025295 | Bacteria | 109962 |
| 281 | Ga0209564_1003899 | 3300025295 | Bacteria | 9578 |
| 282 | Ga0209758_1000134 | 3300025297 | Bacteria | 178294 |
| 283 | Ga0209758_1003687 | 3300025297 | Bacteria | 13617 |
| 284 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 285 | Ga0209050_1003474 | 3300025298 | Bacteria | 11559 |
| 286 | Ga0209050_1006910 | 3300025298 | Bacteria | 6564 |
| 287 | Ga0209050_1027025 | 3300025298 | Bacteria | 1904 |
| 288 | Ga0209256_1000060 | 3300025299 | Bacteria | 262342 |
| 289 | Ga0209256_1000222 | 3300025299 | Bacteria | 105596 |
| 290 | Ga0207426_1000095 | 3300025302 | Bacteria | 274234 |
| 291 | Ga0207426_1000100 | 3300025302 | Bacteria | 262342 |
| 292 | Ga0207426_1006475 | 3300025302 | Bacteria | 5087 |
| 293 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 294 | Ga0209051_1001545 | 3300025303 | Bacteria | 19063 |
| 295 | Ga0209051_1032961 | 3300025303 | Bacteria | 1967 |
| 296 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 297 | Ga0209257_1000689 | 3300025304 | Bacteria | 52385 |
| 298 | Ga0209257_1000996 | 3300025304 | Bacteria | 38379 |
| 299 | Ga0209257_1019409 | 3300025304 | Bacteria | 2562 |
| 300 | Ga0207656_10018671 | 3300025321 | Bacteria | 2733 |
| 301 | Ga0207696_1001811 | 3300025711 | Bacteria | 11015 |
| 302 | Ga0207696_1003569 | 3300025711 | Bacteria | 7024 |
| 303 | Ga0207696_1017707 | 3300025711 | Bacteria | 2354 |
| 304 | Ga0207655_1000822 | 3300025728 | Bacteria | 33630 |
| 305 | Ga0207655_1001110 | 3300025728 | Bacteria | 26288 |
| 306 | Ga0207655_1001712 | 3300025728 | Bacteria | 19282 |
| 307 | Ga0207655_1012856 | 3300025728 | Bacteria | 4849 |
| 308 | Ga0207713_1000929 | 3300025735 | Bacteria | 26289 |
| 309 | Ga0207713_1001156 | 3300025735 | Bacteria | 22283 |
| 310 | Ga0207713_1002800 | 3300025735 | Bacteria | 12310 |
| 311 | Ga0207713_1019934 | 3300025735 | Bacteria | 3265 |
| 312 | Ga0207710_10000009 | 3300025900 | Bacteria | 485205 |
| 313 | Ga0207647_10000341 | 3300025904 | Bacteria | 37808 |
| 314 | Ga0207647_10009687 | 3300025904 | Bacteria | 6836 |
| 315 | Ga0207647_10010144 | 3300025904 | Bacteria | 6662 |
| 316 | Ga0207647_10010476 | 3300025904 | Bacteria | 6548 |
| 317 | Ga0207647_10042834 | 3300025904 | Bacteria | 2836 |
| 318 | Ga0207647_10057077 | 3300025904 | Bacteria | 2394 |
| 319 | Ga0207705_10014750 | 3300025909 | Bacteria | 5618 |
| 320 | Ga0207654_10021218 | 3300025911 | Bacteria | 3451 |
| 321 | Ga0207695_10001490 | 3300025913 | Bacteria | 39048 |
| 322 | Ga0207695_10001811 | 3300025913 | Bacteria | 33658 |
| 323 | Ga0207695_10003068 | 3300025913 | Bacteria | 23948 |
| 324 | Ga0207695_10066620 | 3300025913 | Bacteria | 3697 |
| 325 | Ga0207695_10076749 | 3300025913 | Bacteria | 3396 |
| 326 | Ga0207695_10203453 | 3300025913 | Bacteria | 1893 |
| 327 | Ga0207671_10005638 | 3300025914 | Bacteria | 11472 |
| 328 | Ga0207671_10010984 | 3300025914 | Bacteria | 7416 |
| 329 | Ga0207671_10054064 | 3300025914 | Bacteria | 2975 |
| 330 | Ga0207657_10000097 | 3300025919 | Bacteria | 83815 |
| 331 | Ga0207657_10000312 | 3300025919 | Bacteria | 51565 |
| 332 | Ga0207657_10006989 | 3300025919 | Bacteria | 11620 |
| 333 | Ga0207649_10014501 | 3300025920 | Bacteria | 4415 |
| 334 | Ga0207694_10004425 | 3300025924 | Bacteria | 10984 |
| 335 | Ga0207694_10026078 | 3300025924 | Bacteria | 4444 |
| 336 | Ga0207694_10043942 | 3300025924 | Bacteria | 3449 |
| 337 | Ga0207650_10008739 | 3300025925 | Bacteria | 6918 |
| 338 | Ga0207650_10158312 | 3300025925 | Bacteria | 1792 |
| 339 | Ga0207659_10116879 | 3300025926 | Bacteria | 2037 |
| 340 | Ga0207690_10000079 | 3300025932 | Bacteria | 83880 |
| 341 | Ga0207690_10000163 | 3300025932 | Bacteria | 52135 |
| 342 | Ga0207706_10059136 | 3300025933 | Bacteria | 3375 |
| 343 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 344 | Ga0207709_10000167 | 3300025935 | Bacteria | 88877 |
| 345 | Ga0207709_10001419 | 3300025935 | Bacteria | 16783 |
| 346 | Ga0207709_10073365 | 3300025935 | Bacteria | 2180 |
| 347 | Ga0207670_10003726 | 3300025936 | Bacteria | 8090 |
| 348 | Ga0207711_10005624 | 3300025941 | Bacteria | 10599 |
| 349 | Ga0207661_10002583 | 3300025944 | Bacteria | 12457 |
| 350 | Ga0207679_10026201 | 3300025945 | Bacteria | 4019 |
| 351 | Ga0207667_10002715 | 3300025949 | Bacteria | 21883 |
| 352 | Ga0207667_10010846 | 3300025949 | Bacteria | 10628 |
| 353 | Ga0207703_10050092 | 3300026035 | Bacteria | 3379 |
| 354 | Ga0207639_10005487 | 3300026041 | Bacteria | 8576 |
| 355 | Ga0207639_10030024 | 3300026041 | Bacteria | 3984 |
| 356 | Ga0207678_10001291 | 3300026067 | Bacteria | 23177 |
| 357 | Ga0207678_10021082 | 3300026067 | Bacteria | 5712 |
| 358 | Ga0207648_10047491 | 3300026089 | Bacteria | 3763 |
| 359 | Ga0207674_10026486 | 3300026116 | Bacteria | 6155 |
| 360 | Ga0207698_10024618 | 3300026142 | Bacteria | 4229 |
| 361 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 362 | Ga0209371_1000751 | 3300027312 | Bacteria | 27079 |
| 363 | Ga0209371_1013748 | 3300027312 | Bacteria | 2252 |
| 364 | Ga0268266_10039868 | 3300028379 | Bacteria | 4002 |
| 365 | Ga0268265_10116675 | 3300028380 | Bacteria | 2191 |
| 366 | Ga0268256_1001017 | 3300030500 | Bacteria | 18893 |
| 367 | Ga0268256_1004529 | 3300030500 | Bacteria | 5734 |
| 368 | Ga0268256_1015710 | 3300030500 | Bacteria | 2197 |
| 369 | Ga0307408_100001890 | 3300031548 | Bacteria | 15263 |
| 370 | Ga0307405_10038866 | 3300031731 | Bacteria | 2872 |
| 371 | Ga0307412_10000016 | 3300031911 | Bacteria | 312878 |
| 372 | Ga0307412_10012724 | 3300031911 | Bacteria | 4909 |
| 373 | Ga0307409_100176270 | 3300031995 | Bacteria | 1887 |
| 374 | Ga0307416_100000420 | 3300032002 | Bacteria | 21577 |
| 375 | Ga0307416_100029721 | 3300032002 | Bacteria | 4087 |
| 376 | Ga0307510_10129755 | 3300033180 | Bacteria | 2198 |
| 377 | Ga0395900_0001186 | 3300037418 | Bacteria | 32332 |
| 378 | Ga0395900_0042424 | 3300037418 | Bacteria | 4689 |
| 379 | Ga0395898_0148397 | 3300037466 | Bacteria | 2244 |
| 380 | Ga0436364_0399617 | 3300037853 | Bacteria | 2968 |
| 381 | Ga0395901_0000075 | 3300038443 | Bacteria | 138340 |
| 382 | Ga0436365_0047346 | 3300039437 | Bacteria | 1675 |
| 383 | Ga0436361_0293421 | 3300039447 | Bacteria | 7816 |
| 384 | Ga0436363_0468856 | 3300039450 | Bacteria | 2796 |
| 385 | Ga0436362_0635593 | 3300039453 | Bacteria | 7227 |
| 386 | Ga0439438_010410 | 3300041405 | Bacteria | 2941 |
| 387 | Ga0439466_0001368 | 3300041411 | Bacteria | 9477 |
| 388 | Ga0439466_0016112 | 3300041411 | Bacteria | 2706 |
| 389 | Ga0439448_0000619 | 3300042005 | Bacteria | 8366 |
| 390 | Ga0439449_0011500 | 3300042007 | Bacteria | 3329 |
| 391 | Ga0439451_002481 | 3300042009 | Bacteria | 3741 |
| 392 | Ga0439452_000691 | 3300042010 | Bacteria | 16547 |
| 393 | Ga0450903_002876 | 3300042138 | Bacteria | 3011 |
| 394 | Ga0466969_0031897 | 3300044656 | Bacteria | 2681 |
| 395 | Ga0466972_0048545 | 3300044658 | Bacteria | 2051 |
| 396 | Ga0466966_0000318 | 3300044684 | Bacteria | 31193 |
| 397 | Ga0466966_0000499 | 3300044684 | Bacteria | 25175 |
| 398 | Ga0466966_0011173 | 3300044684 | Bacteria | 5955 |
| 399 | Ga0466961_0015677 | 3300044693 | Bacteria | 4862 |
| 400 | Ga0453684_0075339 | 3300044712 | Bacteria | 4242 |
| 401 | Ga0466971_0010116 | 3300044719 | Bacteria | 4119 |
| 402 | Ga0466971_0023201 | 3300044719 | Bacteria | 2765 |
| 403 | Ga0466970_0003463 | 3300044765 | Bacteria | 7685 |
| 404 | Ga0466957_0016398 | 3300044842 | Bacteria | 4334 |
| 405 | Ga0466957_0030899 | 3300044842 | Bacteria | 3199 |
| 406 | Ga0466959_0137787 | 3300045049 | Bacteria | 1726 |
| 407 | Ga0466958_0001989 | 3300045836 | Bacteria | 10053 |
| 408 | Ga0466958_0010339 | 3300045836 | Bacteria | 5226 |
| 409 | Ga0466958_0038217 | 3300045836 | Bacteria | 2879 |
| 410 | Ga0495617_000164 | 3300046452 | Bacteria | 42308 |
| 411 | Ga0495617_002221 | 3300046452 | Bacteria | 7897 |
| 412 | Ga0495617_007969 | 3300046452 | Bacteria | 3661 |
| 413 | Ga0495627_004293 | 3300046453 | Bacteria | 5994 |
| 414 | Ga0495627_006524 | 3300046453 | Bacteria | 4568 |
| 415 | Ga0495627_012844 | 3300046453 | Bacteria | 2959 |
| 416 | Ga0495592_0003749 | 3300046454 | Bacteria | 10964 |
| 417 | Ga0495592_0020431 | 3300046454 | Bacteria | 5036 |
| 418 | Ga0495592_0021064 | 3300046454 | Bacteria | 4957 |
| 419 | Ga0495592_0022573 | 3300046454 | Bacteria | 4787 |
| 420 | Ga0495592_0139494 | 3300046454 | Bacteria | 1688 |
| 421 | Ga0495603_0001506 | 3300046455 | Bacteria | 13588 |
| 422 | Ga0495603_0003463 | 3300046455 | Bacteria | 9389 |
| 423 | Ga0495603_0007811 | 3300046455 | Bacteria | 6447 |
| 424 | Ga0495603_0008106 | 3300046455 | Bacteria | 6346 |
| 425 | Ga0495603_0019864 | 3300046455 | Bacteria | 4068 |
| 426 | Ga0495590_0003820 | 3300046457 | Bacteria | 6130 |
| 427 | Ga0495590_0006210 | 3300046457 | Bacteria | 4677 |
| 428 | Ga0495590_0012046 | 3300046457 | Bacteria | 3219 |
| 429 | Ga0495591_000053 | 3300046458 | Bacteria | 135500 |
| 430 | Ga0495591_000054 | 3300046458 | Bacteria | 135364 |
| 431 | Ga0495591_000143 | 3300046458 | Bacteria | 76321 |
| 432 | Ga0495591_000172 | 3300046458 | Bacteria | 67392 |
| 433 | Ga0495591_000559 | 3300046458 | Bacteria | 28604 |
| 434 | Ga0495591_001695 | 3300046458 | Bacteria | 13164 |
| 435 | Ga0495591_004785 | 3300046458 | Bacteria | 6473 |
| 436 | Ga0495591_009817 | 3300046458 | Bacteria | 3769 |
| 437 | Ga0495591_022131 | 3300046458 | Bacteria | 2060 |
| 438 | Ga0495629_0000217 | 3300046459 | Bacteria | 51491 |
| 439 | Ga0495629_0000376 | 3300046459 | Bacteria | 37310 |
| 440 | Ga0495629_0000700 | 3300046459 | Bacteria | 27156 |
| 441 | Ga0495629_0009044 | 3300046459 | Bacteria | 7304 |
| 442 | Ga0495629_0010821 | 3300046459 | Bacteria | 6635 |
| 443 | Ga0495629_0011591 | 3300046459 | Bacteria | 6401 |
| 444 | Ga0495638_0000381 | 3300046460 | Bacteria | 55116 |
| 445 | Ga0495638_0005027 | 3300046460 | Bacteria | 9924 |
| 446 | Ga0495638_0006765 | 3300046460 | Bacteria | 8297 |
| 447 | Ga0495638_0016389 | 3300046460 | Bacteria | 4965 |
| 448 | Ga0495638_0040113 | 3300046460 | Bacteria | 2968 |
| 449 | Ga0495641_0006000 | 3300046461 | Bacteria | 8004 |
| 450 | Ga0495641_0017686 | 3300046461 | Bacteria | 3704 |
| 451 | Ga0495651_0001907 | 3300046462 | Bacteria | 16140 |
| 452 | Ga0495653_0000051 | 3300046463 | Bacteria | 106012 |
| 453 | Ga0495653_0000403 | 3300046463 | Bacteria | 34677 |
| 454 | Ga0495653_0000439 | 3300046463 | Bacteria | 32688 |
| 455 | Ga0495653_0002819 | 3300046463 | Bacteria | 13871 |
| 456 | Ga0495653_0037604 | 3300046463 | Bacteria | 3801 |
| 457 | Ga0495653_0069700 | 3300046463 | Bacteria | 2633 |
| 458 | Ga0495653_0081860 | 3300046463 | Bacteria | 2384 |
| 459 | Ga0495650_0002322 | 3300046471 | Bacteria | 15747 |
| 460 | Ga0495650_0002406 | 3300046471 | Bacteria | 15233 |
| 461 | Ga0495650_0004787 | 3300046471 | Bacteria | 9089 |
| 462 | Ga0495650_0016412 | 3300046471 | Bacteria | 3752 |
| 463 | Ga0495650_0028866 | 3300046471 | Bacteria | 2536 |
| 464 | Ga0495580_0000474 | 3300046472 | Bacteria | 33436 |
| 465 | Ga0495580_0000869 | 3300046472 | Bacteria | 26086 |
| 466 | Ga0495580_0000923 | 3300046472 | Bacteria | 25670 |
| 467 | Ga0495580_0002854 | 3300046472 | Bacteria | 14871 |
| 468 | Ga0495580_0008691 | 3300046472 | Bacteria | 8053 |
| 469 | Ga0495580_0016408 | 3300046472 | Bacteria | 5557 |
| 470 | Ga0495580_0019984 | 3300046472 | Bacteria | 4964 |
| 471 | Ga0495580_0022241 | 3300046472 | Bacteria | 4668 |
| 472 | Ga0495580_0023336 | 3300046472 | Bacteria | 4544 |
| 473 | Ga0495580_0044059 | 3300046472 | Bacteria | 3174 |
| 474 | Ga0495580_0047207 | 3300046472 | Bacteria | 3053 |
| 475 | Ga0495580_0071939 | 3300046472 | Bacteria | 2415 |
| 476 | Ga0495582_0000537 | 3300046473 | Bacteria | 20961 |
| 477 | Ga0495582_0012293 | 3300046473 | Bacteria | 4715 |
| 478 | Ga0495582_0047620 | 3300046473 | Bacteria | 2361 |
| 479 | Ga0495605_0000080 | 3300046474 | Bacteria | 125370 |
| 480 | Ga0495605_0003762 | 3300046474 | Bacteria | 9004 |
| 481 | Ga0495605_0006370 | 3300046474 | Bacteria | 6798 |
| 482 | Ga0495662_0006561 | 3300046476 | Bacteria | 5808 |
| 483 | Ga0495662_0032745 | 3300046476 | Bacteria | 2511 |
| 484 | Ga0495664_0000945 | 3300046477 | Bacteria | 14931 |
| 485 | Ga0495664_0006513 | 3300046477 | Bacteria | 6454 |
| 486 | Ga0495664_0007716 | 3300046477 | Bacteria | 5986 |
| 487 | Ga0495664_0022377 | 3300046477 | Unclassified | 3663 |
| 488 | Ga0495664_0064159 | 3300046477 | Bacteria | 2189 |
| 489 | Ga0495584_0000018 | 3300046491 | Bacteria | 142382 |
| 490 | Ga0495584_0000803 | 3300046491 | Bacteria | 20648 |
| 491 | Ga0495584_0058809 | 3300046491 | Bacteria | 1933 |
| 492 | Ga0495585_0005977 | 3300046492 | Bacteria | 7615 |
| 493 | Ga0495585_0012873 | 3300046492 | Bacteria | 4917 |
| 494 | Ga0495585_0074056 | 3300046492 | Bacteria | 1853 |
| 495 | Ga0495585_0075146 | 3300046492 | Bacteria | 1837 |
| 496 | Ga0495594_0003001 | 3300046499 | Bacteria | 8741 |
| 497 | Ga0495596_0000050 | 3300046500 | Bacteria | 87493 |
| 498 | Ga0495596_0013176 | 3300046500 | Bacteria | 3516 |
| 499 | Ga0495596_0015892 | 3300046500 | Bacteria | 3136 |
| 500 | Ga0495596_0021568 | 3300046500 | Bacteria | 2628 |
| 501 | Ga0495596_0028410 | 3300046500 | Bacteria | 2245 |
| 502 | Ga0495607_0000036 | 3300046501 | Bacteria | 140259 |
| 503 | Ga0495607_0000333 | 3300046501 | Bacteria | 48937 |
| 504 | Ga0495607_0002696 | 3300046501 | Bacteria | 14172 |
| 505 | Ga0495607_0004370 | 3300046501 | Bacteria | 10415 |
| 506 | Ga0495607_0005147 | 3300046501 | Bacteria | 9445 |
| 507 | Ga0495607_0012932 | 3300046501 | Bacteria | 5488 |
| 508 | Ga0495583_0000125 | 3300046506 | Bacteria | 129291 |
| 509 | Ga0495583_0000169 | 3300046506 | Bacteria | 111114 |
| 510 | Ga0495583_0000672 | 3300046506 | Bacteria | 44628 |
| 511 | Ga0495583_0001076 | 3300046506 | Bacteria | 30467 |
| 512 | Ga0495583_0001261 | 3300046506 | Bacteria | 26577 |
| 513 | Ga0495583_0002360 | 3300046506 | Bacteria | 16304 |
| 514 | Ga0495583_0003881 | 3300046506 | Bacteria | 11070 |
| 515 | Ga0495583_0012611 | 3300046506 | Bacteria | 4769 |
| 516 | Ga0495606_0000079 | 3300046507 | Bacteria | 164788 |
| 517 | Ga0495606_0000170 | 3300046507 | Bacteria | 115276 |
| 518 | Ga0495606_0000555 | 3300046507 | Bacteria | 59635 |
| 519 | Ga0495606_0002882 | 3300046507 | Bacteria | 19013 |
| 520 | Ga0495606_0004100 | 3300046507 | Bacteria | 14800 |
| 521 | Ga0495606_0005455 | 3300046507 | Bacteria | 12177 |
| 522 | Ga0495606_0052052 | 3300046507 | Bacteria | 2665 |
| 523 | Ga0495610_0000203 | 3300046512 | Bacteria | 65990 |
| 524 | Ga0495610_0003169 | 3300046512 | Bacteria | 13045 |
| 525 | Ga0495610_0003639 | 3300046512 | Bacteria | 11868 |
| 526 | Ga0495610_0015146 | 3300046512 | Bacteria | 4494 |
| 527 | Ga0495610_0024940 | 3300046512 | Bacteria | 3219 |
| 528 | Ga0495610_0065274 | 3300046512 | Bacteria | 1718 |
| 529 | Ga0495616_0002871 | 3300046513 | Bacteria | 11244 |
| 530 | Ga0495616_0012148 | 3300046513 | Bacteria | 4901 |
| 531 | Ga0495616_0062316 | 3300046513 | Bacteria | 1826 |
| 532 | Ga0495618_0001423 | 3300046514 | Bacteria | 16078 |
| 533 | Ga0495618_0001820 | 3300046514 | Bacteria | 14063 |
| 534 | Ga0495618_0109876 | 3300046514 | Bacteria | 1765 |
| 535 | Ga0495620_0000592 | 3300046515 | Bacteria | 22694 |
| 536 | Ga0495620_0001362 | 3300046515 | Bacteria | 14777 |
| 537 | Ga0495620_0004675 | 3300046515 | Bacteria | 7692 |
| 538 | Ga0495620_0032492 | 3300046515 | Bacteria | 2377 |
| 539 | Ga0495628_0001457 | 3300046516 | Bacteria | 21697 |
| 540 | Ga0495628_0008298 | 3300046516 | Bacteria | 8923 |
| 541 | Ga0495628_0010142 | 3300046516 | Bacteria | 8010 |
| 542 | Ga0495628_0011870 | 3300046516 | Bacteria | 7349 |
| 543 | Ga0495628_0022375 | 3300046516 | Bacteria | 5192 |
| 544 | Ga0495628_0045946 | 3300046516 | Bacteria | 3470 |
| 545 | Ga0495628_0128087 | 3300046516 | Bacteria | 1943 |
| 546 | Ga0495630_0002379 | 3300046517 | Bacteria | 13061 |
| 547 | Ga0495630_0003360 | 3300046517 | Bacteria | 11137 |
| 548 | Ga0495630_0047480 | 3300046517 | Unclassified | 3211 |
| 549 | Ga0495630_0117012 | 3300046517 | Bacteria | 2020 |
| 550 | Ga0495631_0001747 | 3300046518 | Bacteria | 12903 |
| 551 | Ga0495631_0001748 | 3300046518 | Bacteria | 12901 |
| 552 | Ga0495631_0019782 | 3300046518 | Bacteria | 3154 |
| 553 | Ga0495631_0068636 | 3300046518 | Bacteria | 1533 |
| 554 | Ga0495632_0004289 | 3300046519 | Bacteria | 9730 |
| 555 | Ga0495632_0004844 | 3300046519 | Bacteria | 9039 |
| 556 | Ga0495632_0013733 | 3300046519 | Bacteria | 4608 |
| 557 | Ga0495637_0000062 | 3300046520 | Bacteria | 95064 |
| 558 | Ga0495637_0000159 | 3300046520 | Bacteria | 51658 |
| 559 | Ga0495637_0000818 | 3300046520 | Bacteria | 20550 |
| 560 | Ga0495637_0002100 | 3300046520 | Bacteria | 11206 |
| 561 | Ga0495637_0020317 | 3300046520 | Bacteria | 3057 |
| 562 | Ga0495643_0004279 | 3300046522 | Bacteria | 10071 |
| 563 | Ga0495643_0005482 | 3300046522 | Bacteria | 8578 |
| 564 | Ga0495643_0008821 | 3300046522 | Bacteria | 6347 |
| 565 | Ga0495643_0010885 | 3300046522 | Bacteria | 5572 |
| 566 | Ga0495643_0029640 | 3300046522 | Bacteria | 3060 |
| 567 | Ga0495644_0000031 | 3300046523 | Bacteria | 65825 |
| 568 | Ga0495644_0000536 | 3300046523 | Bacteria | 16103 |
| 569 | Ga0495644_0002089 | 3300046523 | Bacteria | 8046 |
| 570 | Ga0495644_0003977 | 3300046523 | Bacteria | 5809 |
| 571 | Ga0495648_0000590 | 3300046524 | Bacteria | 38832 |
| 572 | Ga0495648_0002420 | 3300046524 | Bacteria | 17298 |
| 573 | Ga0495648_0005906 | 3300046524 | Bacteria | 10072 |
| 574 | Ga0495648_0008573 | 3300046524 | Bacteria | 8026 |
| 575 | Ga0495648_0015281 | 3300046524 | Bacteria | 5582 |
| 576 | Ga0495648_0039455 | 3300046524 | Bacteria | 3004 |
| 577 | Ga0495648_0046310 | 3300046524 | Bacteria | 2696 |
| 578 | Ga0495666_0000308 | 3300046526 | Bacteria | 21302 |
| 579 | Ga0495666_0001041 | 3300046526 | Bacteria | 13146 |
| 580 | Ga0495666_0002594 | 3300046526 | Bacteria | 8991 |
| 581 | Ga0495666_0007836 | 3300046526 | Bacteria | 5349 |
| 582 | Ga0495666_0008707 | 3300046526 | Bacteria | 5082 |
| 583 | Ga0495666_0041322 | 3300046526 | Bacteria | 2233 |
| 584 | Ga0495642_0008289 | 3300046528 | Bacteria | 3975 |
| 585 | Ga0495652_0008919 | 3300046529 | Bacteria | 9125 |
| 586 | Ga0495652_0032861 | 3300046529 | Bacteria | 4534 |
| 587 | Ga0495652_0037532 | 3300046529 | Bacteria | 4202 |
| 588 | Ga0495652_0049084 | 3300046529 | Bacteria | 3614 |
| 589 | Ga0495652_0078268 | 3300046529 | Bacteria | 2737 |
| 590 | Ga0495652_0224652 | 3300046529 | Bacteria | 1409 |
| 591 | Ga0495654_0000589 | 3300046530 | Bacteria | 29018 |
| 592 | Ga0495654_0002059 | 3300046530 | Bacteria | 13201 |
| 593 | Ga0495654_0003395 | 3300046530 | Bacteria | 9791 |
| 594 | Ga0495654_0007113 | 3300046530 | Bacteria | 6290 |
| 595 | Ga0495654_0011991 | 3300046530 | Bacteria | 4672 |
| 596 | Ga0495654_0016343 | 3300046530 | Bacteria | 3926 |
| 597 | Ga0495654_0063280 | 3300046530 | Bacteria | 1771 |
| 598 | Ga0495654_0090041 | 3300046530 | Bacteria | 1425 |
| 599 | Ga0495665_0002208 | 3300046531 | Bacteria | 10545 |
| 600 | Ga0495665_0012611 | 3300046531 | Bacteria | 4575 |
| 601 | Ga0495665_0013039 | 3300046531 | Bacteria | 4500 |
| 602 | Ga0495665_0016222 | 3300046531 | Bacteria | 4013 |
| 603 | Ga0495665_0022768 | 3300046531 | Bacteria | 3365 |
| 604 | Ga0495665_0061219 | 3300046531 | Bacteria | 1987 |
| 605 | Ga0495665_0071811 | 3300046531 | Bacteria | 1822 |
| 606 | Ga0495640_0006353 | 3300046533 | Bacteria | 9365 |
| 607 | Ga0495640_0016436 | 3300046533 | Bacteria | 5534 |
| 608 | Ga0495640_0021963 | 3300046533 | Bacteria | 4674 |
| 609 | Ga0495586_0002467 | 3300046535 | Bacteria | 10034 |
| 610 | Ga0495586_0002516 | 3300046535 | Bacteria | 9933 |
| 611 | Ga0495586_0009309 | 3300046535 | Bacteria | 5224 |
| 612 | Ga0495586_0022000 | 3300046535 | Bacteria | 3403 |
| 613 | Ga0495586_0052016 | 3300046535 | Bacteria | 2217 |
| 614 | Ga0495587_0006826 | 3300046536 | Bacteria | 7429 |
| 615 | Ga0495587_0008189 | 3300046536 | Bacteria | 6736 |
| 616 | Ga0495587_0009783 | 3300046536 | Bacteria | 6127 |
| 617 | Ga0495609_0000016 | 3300046538 | Bacteria | 312882 |
| 618 | Ga0495597_0005512 | 3300046542 | Bacteria | 6695 |
| 619 | Ga0495597_0006350 | 3300046542 | Bacteria | 6122 |
| 620 | Ga0495597_0018285 | 3300046542 | Bacteria | 3290 |
| 621 | Ga0495645_0001920 | 3300046543 | Bacteria | 14119 |
| 622 | Ga0495645_0004984 | 3300046543 | Bacteria | 9095 |
| 623 | Ga0495645_0006484 | 3300046543 | Bacteria | 8122 |
| 624 | Ga0495645_0025944 | 3300046543 | Bacteria | 4254 |
| 625 | Ga0495645_0027825 | 3300046543 | Bacteria | 4107 |
| 626 | Ga0495645_0121880 | 3300046543 | Bacteria | 1835 |
| 627 | Ga0495622_0000039 | 3300046557 | Bacteria | 119003 |
| 628 | Ga0495622_0000168 | 3300046557 | Bacteria | 54167 |
| 629 | Ga0495622_0002828 | 3300046557 | Bacteria | 8285 |
| 630 | Ga0495633_0021536 | 3300046558 | Bacteria | 3223 |
| 631 | Ga0495667_0035281 | 3300046559 | Bacteria | 3343 |
| 632 | Ga0495656_0008177 | 3300046615 | Bacteria | 3725 |
| 633 | Ga0495668_0000424 | 3300046616 | Bacteria | 55046 |
| 634 | Ga0495668_0006720 | 3300046616 | Bacteria | 7488 |
| 635 | Ga0495668_0009648 | 3300046616 | Bacteria | 5906 |
| 636 | Ga0495668_0059256 | 3300046616 | Bacteria | 2113 |
| 637 | Ga0495668_0110359 | 3300046616 | Bacteria | 1504 |
| 638 | Ga0495634_0000922 | 3300046642 | Bacteria | 27917 |
| 639 | Ga0495634_0001516 | 3300046642 | Bacteria | 20519 |
| 640 | Ga0495634_0003847 | 3300046642 | Bacteria | 11925 |
| 641 | Ga0495634_0015351 | 3300046642 | Bacteria | 5505 |
| 642 | Ga0495634_0031882 | 3300046642 | Bacteria | 3628 |
| 643 | Ga0495611_0000725 | 3300046648 | Bacteria | 18522 |
| 644 | Ga0495611_0006027 | 3300046648 | Bacteria | 5172 |
| 645 | Ga0495611_0018475 | 3300046648 | Bacteria | 2990 |
| 646 | Ga0495625_0000084 | 3300046660 | Bacteria | 151895 |
| 647 | Ga0495625_0002559 | 3300046660 | Bacteria | 19540 |
| 648 | Ga0495625_0015106 | 3300046660 | Bacteria | 6128 |
| 649 | Ga0495625_0028528 | 3300046660 | Bacteria | 4185 |
| 650 | Ga0495625_0040997 | 3300046660 | Bacteria | 3372 |
| 651 | Ga0495625_0043128 | 3300046660 | Bacteria | 3273 |
| 652 | Ga0495635_0002487 | 3300046663 | Bacteria | 12582 |
| 653 | Ga0495635_0011122 | 3300046663 | Bacteria | 6309 |
| 654 | Ga0495635_0013959 | 3300046663 | Bacteria | 5621 |
| 655 | Ga0495635_0019252 | 3300046663 | Bacteria | 4760 |
| 656 | Ga0495635_0021264 | 3300046663 | Bacteria | 4522 |
| 657 | Ga0495635_0073658 | 3300046663 | Bacteria | 2339 |
| 658 | Ga0495661_0000035 | 3300046665 | Bacteria | 165551 |
| 659 | Ga0495661_0004743 | 3300046665 | Bacteria | 9766 |
| 660 | Ga0495661_0005068 | 3300046665 | Bacteria | 9398 |
| 661 | Ga0495661_0008843 | 3300046665 | Bacteria | 6943 |
| 662 | Ga0495661_0009436 | 3300046665 | Bacteria | 6698 |
| 663 | Ga0495661_0021769 | 3300046665 | Bacteria | 4174 |
| 664 | Ga0495661_0042283 | 3300046665 | Bacteria | 2809 |
| 665 | Ga0495588_0001274 | 3300046674 | Bacteria | 10806 |
| 666 | Ga0495588_0013754 | 3300046674 | Bacteria | 3860 |
| 667 | Ga0495588_0041847 | 3300046674 | Bacteria | 2341 |
| 668 | Ga0495588_0053915 | 3300046674 | Bacteria | 2074 |
| 669 | Ga0495657_0006190 | 3300046675 | Bacteria | 9383 |
| 670 | Ga0495657_0106609 | 3300046675 | Bacteria | 1779 |
| 671 | Ga0495599_0001622 | 3300046678 | Bacteria | 12970 |
| 672 | Ga0495599_0008966 | 3300046678 | Bacteria | 6093 |
| 673 | Ga0495623_0006235 | 3300046679 | Bacteria | 7757 |
| 674 | Ga0495623_0007116 | 3300046679 | Bacteria | 7267 |
| 675 | Ga0495623_0016840 | 3300046679 | Bacteria | 4721 |
| 676 | Ga0495623_0019708 | 3300046679 | Bacteria | 4360 |
| 677 | Ga0495623_0088675 | 3300046679 | Bacteria | 1903 |
| 678 | Ga0495646_0000538 | 3300046680 | Bacteria | 20371 |
| 679 | Ga0495646_0000563 | 3300046680 | Bacteria | 20116 |
| 680 | Ga0495646_0000572 | 3300046680 | Bacteria | 19992 |
| 681 | Ga0495646_0011658 | 3300046680 | Bacteria | 5586 |
| 682 | Ga0495646_0039160 | 3300046680 | Bacteria | 2923 |
| 683 | Ga0495646_0039570 | 3300046680 | Bacteria | 2906 |
| 684 | Ga0495669_0002555 | 3300046684 | Bacteria | 7431 |
| 685 | Ga0495613_0000752 | 3300046689 | Bacteria | 25413 |
| 686 | Ga0495613_0002707 | 3300046689 | Bacteria | 13299 |
| 687 | Ga0495613_0006979 | 3300046689 | Bacteria | 8418 |
| 688 | Ga0495613_0030220 | 3300046689 | Bacteria | 4024 |
| 689 | Ga0495624_0000334 | 3300046690 | Bacteria | 37310 |
| 690 | Ga0495624_0002903 | 3300046690 | Bacteria | 12818 |
| 691 | Ga0495624_0005242 | 3300046690 | Bacteria | 9361 |
| 692 | Ga0495624_0006847 | 3300046690 | Bacteria | 8044 |
| 693 | Ga0495624_0028873 | 3300046690 | Bacteria | 3620 |
| 694 | Ga0495624_0045180 | 3300046690 | Bacteria | 2805 |
| 695 | Ga0495624_0065952 | 3300046690 | Bacteria | 2260 |
| 696 | Ga0495670_0015749 | 3300046691 | Bacteria | 3718 |
| 697 | Ga0495671_0000141 | 3300046692 | Bacteria | 63480 |
| 698 | Ga0495671_0009218 | 3300046692 | Bacteria | 5516 |
| 699 | Ga0495671_0024349 | 3300046692 | Bacteria | 3153 |
| 700 | Ga0495671_0024474 | 3300046692 | Bacteria | 3143 |
| 701 | Ga0495649_0001294 | 3300046694 | Bacteria | 19126 |
| 702 | Ga0495649_0027628 | 3300046694 | Bacteria | 3147 |
| 703 | Ga0495649_0032235 | 3300046694 | Bacteria | 2887 |
| 704 | Ga0495589_0002082 | 3300046794 | Bacteria | 11315 |
| 705 | Ga0495589_0024401 | 3300046794 | Bacteria | 3073 |
| 706 | Ga0495600_0006319 | 3300046809 | Bacteria | 7201 |
| 707 | Ga0495600_0013396 | 3300046809 | Bacteria | 5152 |
| 708 | Ga0495600_0058019 | 3300046809 | Bacteria | 2528 |
| 709 | Ga0495660_0002843 | 3300046810 | Bacteria | 10877 |
| 710 | Ga0495660_0003183 | 3300046810 | Bacteria | 10216 |
| 711 | Ga0495660_0010687 | 3300046810 | Bacteria | 5334 |
| 712 | Ga0495660_0020544 | 3300046810 | Bacteria | 3784 |
| 713 | Ga0495581_0001548 | 3300047315 | Bacteria | 12837 |
| 714 | Ga0495581_0007219 | 3300047315 | Bacteria | 6428 |
| 715 | Ga0495581_0008128 | 3300047315 | Bacteria | 6076 |
| 716 | Ga0495581_0019167 | 3300047315 | Bacteria | 3970 |
| 717 | Ga0495604_0007058 | 3300047317 | Bacteria | 8911 |
| 718 | Ga0495604_0007594 | 3300047317 | Bacteria | 8583 |
| 719 | Ga0495604_0020628 | 3300047317 | Bacteria | 5262 |
| 720 | Ga0495604_0024210 | 3300047317 | Bacteria | 4845 |
| 721 | Ga0495604_0026065 | 3300047317 | Bacteria | 4655 |
| 722 | Ga0495604_0042250 | 3300047317 | Bacteria | 3574 |
| 723 | Ga0495604_0044724 | 3300047317 | Bacteria | 3457 |
| 724 | Ga0495604_0087656 | 3300047317 | Bacteria | 2317 |
| 725 | Ga0495674_0001617 | 3300047319 | Bacteria | 22087 |
| 726 | Ga0495674_0017897 | 3300047319 | Bacteria | 6597 |
| 727 | Ga0495674_0028350 | 3300047319 | Bacteria | 5106 |
| 728 | Ga0495674_0030676 | 3300047319 | Bacteria | 4886 |
| 729 | Ga0495674_0041159 | 3300047319 | Bacteria | 4129 |
| 730 | Ga0495674_0062792 | 3300047319 | Unclassified | 3233 |
| 731 | Ga0495674_0124967 | 3300047319 | Bacteria | 2171 |
| 732 | Ga0495672_0005832 | 3300047320 | Bacteria | 9663 |
| 733 | Ga0495672_0007599 | 3300047320 | Bacteria | 8132 |
| 734 | Ga0495672_0009935 | 3300047320 | Bacteria | 6835 |
| 735 | Ga0495672_0022711 | 3300047320 | Bacteria | 4072 |
| 736 | Ga0495672_0024715 | 3300047320 | Bacteria | 3864 |
| 737 | Ga0495676_0000001 | 3300047321 | Bacteria | 624167 |
| 738 | Ga0495676_0005984 | 3300047321 | Bacteria | 11175 |
| 739 | Ga0495676_0009461 | 3300047321 | Bacteria | 8875 |
| 740 | Ga0495676_0011228 | 3300047321 | Bacteria | 8098 |
| 741 | Ga0495676_0092840 | 3300047321 | Bacteria | 2252 |
| 742 | Ga0495676_0124678 | 3300047321 | Bacteria | 1868 |
| 743 | Ga0495680_0013614 | 3300047322 | Bacteria | 7085 |
| 744 | Ga0495680_0020078 | 3300047322 | Bacteria | 5630 |
| 745 | Ga0495680_0026471 | 3300047322 | Bacteria | 4779 |
| 746 | Ga0495683_0000205 | 3300047323 | Bacteria | 56156 |
| 747 | Ga0495683_0001491 | 3300047323 | Bacteria | 15259 |
| 748 | Ga0495683_0001522 | 3300047323 | Bacteria | 15027 |
| 749 | Ga0495683_0003598 | 3300047323 | Bacteria | 9007 |
| 750 | Ga0495683_0007019 | 3300047323 | Bacteria | 6114 |
| 751 | Ga0495683_0012593 | 3300047323 | Bacteria | 4441 |
| 752 | Ga0495683_0023994 | 3300047323 | Bacteria | 3132 |
| 753 | Ga0495687_000114 | 3300047443 | Bacteria | 123531 |
| 754 | Ga0495687_006390 | 3300047443 | Bacteria | 7234 |
| 755 | Ga0495687_008417 | 3300047443 | Bacteria | 5908 |
| 756 | Ga0495687_010698 | 3300047443 | Bacteria | 5008 |
| 757 | Ga0495687_021126 | 3300047443 | Bacteria | 3158 |
| 758 | Ga0495687_030676 | 3300047443 | Bacteria | 2474 |
| 759 | Ga0495675_0003823 | 3300047444 | Bacteria | 9119 |
| 760 | Ga0495675_0014780 | 3300047444 | Bacteria | 4935 |
| 761 | Ga0495675_0024869 | 3300047444 | Bacteria | 3819 |
| 762 | Ga0495675_0059754 | 3300047444 | Bacteria | 2416 |
| 763 | Ga0495679_000037 | 3300047446 | Bacteria | 158099 |
| 764 | Ga0495679_000042 | 3300047446 | Bacteria | 143151 |
| 765 | Ga0495679_000359 | 3300047446 | Bacteria | 35532 |
| 766 | Ga0495679_000567 | 3300047446 | Bacteria | 25673 |
| 767 | Ga0495679_002985 | 3300047446 | Bacteria | 8338 |
| 768 | Ga0495679_005797 | 3300047446 | Bacteria | 5435 |
| 769 | Ga0495673_0000339 | 3300047469 | Bacteria | 59974 |
| 770 | Ga0495673_0000515 | 3300047469 | Bacteria | 40877 |
| 771 | Ga0495673_0001849 | 3300047469 | Bacteria | 15890 |
| 772 | Ga0495673_0002161 | 3300047469 | Bacteria | 14277 |
| 773 | Ga0495673_0002390 | 3300047469 | Bacteria | 13262 |
| 774 | Ga0495673_0003743 | 3300047469 | Bacteria | 9872 |
| 775 | Ga0495673_0004483 | 3300047469 | Bacteria | 8719 |
| 776 | Ga0495673_0012001 | 3300047469 | Bacteria | 4623 |
| 777 | Ga0495673_0016260 | 3300047469 | Bacteria | 3808 |
| 778 | Ga0495673_0023313 | 3300047469 | Bacteria | 3013 |
| 779 | Ga0495673_0027625 | 3300047469 | Bacteria | 2697 |
| 780 | Ga0495681_0000199 | 3300047470 | Bacteria | 50259 |
| 781 | Ga0495681_0000830 | 3300047470 | Bacteria | 23824 |
| 782 | Ga0495681_0003753 | 3300047470 | Bacteria | 10532 |
| 783 | Ga0495681_0006982 | 3300047470 | Bacteria | 7310 |
| 784 | Ga0495681_0013795 | 3300047470 | Bacteria | 4672 |
| 785 | Ga0495681_0030355 | 3300047470 | Bacteria | 2753 |
| 786 | Ga0495681_0033626 | 3300047470 | Bacteria | 2565 |
| 787 | Ga0495681_0046547 | 3300047470 | Bacteria | 2067 |
| 788 | Ga0495684_0032522 | 3300047471 | Bacteria | 4005 |
| 789 | Ga0495684_0126274 | 3300047471 | Bacteria | 1924 |
| 790 | Ga0495686_0003235 | 3300047472 | Bacteria | 14306 |
| 791 | Ga0495686_0030264 | 3300047472 | Bacteria | 3516 |
| 792 | Ga0495593_0000116 | 3300047673 | Bacteria | 38118 |
| 793 | Ga0495593_0007727 | 3300047673 | Bacteria | 6271 |
| 794 | Ga0495593_0009355 | 3300047673 | Bacteria | 5686 |
| 795 | Ga0495593_0010827 | 3300047673 | Bacteria | 5259 |
| 796 | Ga0495593_0012773 | 3300047673 | Bacteria | 4794 |
| 797 | Ga0495593_0040443 | 3300047673 | Bacteria | 2510 |
| 798 | Ga0495602_0001956 | 3300048088 | Bacteria | 20660 |
| 799 | Ga0495602_0018348 | 3300048088 | Bacteria | 6992 |
| 800 | Ga0495602_0034106 | 3300048088 | Bacteria | 4766 |
| 801 | Ga0495602_0036957 | 3300048088 | Bacteria | 4538 |
| 802 | Ga0495602_0040636 | 3300048088 | Bacteria | 4260 |
| 803 | Ga0495602_0045345 | 3300048088 | Bacteria | 3979 |
| 804 | Ga0495602_0103947 | 3300048088 | Bacteria | 2324 |
| 805 | Ga0495614_0000437 | 3300048089 | Bacteria | 17115 |
| 806 | Ga0495614_0000682 | 3300048089 | Bacteria | 14295 |
| 807 | Ga0495614_0002976 | 3300048089 | Bacteria | 7547 |
| 808 | Ga0495614_0004097 | 3300048089 | Bacteria | 6560 |
| 809 | Ga0495614_0004315 | 3300048089 | Bacteria | 6405 |
| 810 | Ga0495614_0013473 | 3300048089 | Bacteria | 3586 |
| 811 | Ga0495626_0000002 | 3300048091 | Bacteria | 436012 |
| 812 | Ga0495626_0000198 | 3300048091 | Bacteria | 72611 |
| 813 | Ga0495626_0004471 | 3300048091 | Bacteria | 8572 |
| 814 | Ga0495626_0019485 | 3300048091 | Bacteria | 3395 |
| 815 | Ga0495626_0021413 | 3300048091 | Bacteria | 3208 |
| 816 | Ga0496101_0089707 | 3300048904 | Bacteria | 2285 |
| 817 | Ga0496102_0011231 | 3300048905 | Bacteria | 7716 |
| 818 | Ga0496102_0033615 | 3300048905 | Bacteria | 4609 |
| 819 | Ga0496102_0035404 | 3300048905 | Bacteria | 4494 |
| 820 | Ga0496103_0016833 | 3300048906 | Bacteria | 4366 |
| 821 | Ga0496104_0001117 | 3300048907 | Bacteria | 22960 |
| 822 | Ga0496104_0273535 | 3300048907 | Bacteria | 1602 |
| 823 | Ga0496106_0000001 | 3300048909 | Bacteria | 497458 |
| 824 | Ga0496106_0001628 | 3300048909 | Bacteria | 16880 |
| 825 | Ga0496108_0017729 | 3300048911 | Bacteria | 5823 |
| 826 | Ga0496109_0015971 | 3300048912 | Bacteria | 6559 |
| 827 | Ga0496110_0005787 | 3300048913 | Bacteria | 9717 |
| 828 | Ga0496110_0032950 | 3300048913 | Bacteria | 4479 |
| 829 | Ga0496111_0001230 | 3300048914 | Bacteria | 14311 |
| 830 | Ga0496112_0003275 | 3300048915 | Bacteria | 13366 |
| 831 | Ga0496112_0092146 | 3300048915 | Bacteria | 3000 |
| 832 | Ga0496114_0103898 | 3300048917 | Bacteria | 2429 |
| 833 | Ga0496114_0116276 | 3300048917 | Bacteria | 2296 |
| 834 | Ga0496116_0000366 | 3300048919 | Bacteria | 69492 |
| 835 | Ga0496116_0001043 | 3300048919 | Bacteria | 33784 |
| 836 | Ga0496116_0003958 | 3300048919 | Bacteria | 14391 |
| 837 | Ga0496116_0015870 | 3300048919 | Bacteria | 5928 |
| 838 | Ga0496116_0037666 | 3300048919 | Bacteria | 3369 |
| 839 | Ga0496116_0053613 | 3300048919 | Bacteria | 2662 |
| 840 | Ga0496116_0100749 | 3300048919 | Bacteria | 1726 |
| 841 | Ga0496116_0114342 | 3300048919 | Bacteria | 1577 |
| 842 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 843 | Ga0496117_0000708 | 3300048920 | Bacteria | 52863 |
| 844 | Ga0496117_0005160 | 3300048920 | Bacteria | 13937 |
| 845 | Ga0496117_0005298 | 3300048920 | Bacteria | 13653 |
| 846 | Ga0496117_0007016 | 3300048920 | Bacteria | 11161 |
| 847 | Ga0496117_0013706 | 3300048920 | Bacteria | 7046 |
| 848 | Ga0496117_0026235 | 3300048920 | Bacteria | 4563 |
| 849 | Ga0496117_0061521 | 3300048920 | Bacteria | 2580 |
| 850 | Ga0496118_0000078 | 3300048921 | Bacteria | 190946 |
| 851 | Ga0496118_0002492 | 3300048921 | Bacteria | 24682 |
| 852 | Ga0496118_0002805 | 3300048921 | Bacteria | 22819 |
| 853 | Ga0496118_0006693 | 3300048921 | Bacteria | 12560 |
| 854 | Ga0496118_0011808 | 3300048921 | Bacteria | 8479 |
| 855 | Ga0496118_0014479 | 3300048921 | Bacteria | 7382 |
| 856 | Ga0496118_0016573 | 3300048921 | Bacteria | 6756 |
| 857 | Ga0496118_0017447 | 3300048921 | Bacteria | 6535 |
| 858 | Ga0496118_0029698 | 3300048921 | Bacteria | 4580 |
| 859 | Ga0496118_0056965 | 3300048921 | Bacteria | 2933 |
| 860 | Ga0496119_0071182 | 3300048922 | Bacteria | 2037 |
| 861 | Ga0496120_0006258 | 3300048923 | Bacteria | 9189 |
| 862 | Ga0496121_0000478 | 3300048924 | Bacteria | 77761 |
| 863 | Ga0496121_0000540 | 3300048924 | Bacteria | 72033 |
| 864 | Ga0496121_0000722 | 3300048924 | Bacteria | 61133 |
| 865 | Ga0496121_0001087 | 3300048924 | Bacteria | 48027 |
| 866 | Ga0496121_0001828 | 3300048924 | Bacteria | 34313 |
| 867 | Ga0496121_0004165 | 3300048924 | Bacteria | 19771 |
| 868 | Ga0496121_0004875 | 3300048924 | Bacteria | 17620 |
| 869 | Ga0496121_0005928 | 3300048924 | Bacteria | 15460 |
| 870 | Ga0496121_0006832 | 3300048924 | Bacteria | 13959 |
| 871 | Ga0496121_0042866 | 3300048924 | Bacteria | 3928 |
| 872 | Ga0496121_0052997 | 3300048924 | Bacteria | 3401 |
| 873 | Ga0496121_0058817 | 3300048924 | Bacteria | 3174 |
| 874 | Ga0496121_0065926 | 3300048924 | Bacteria | 2943 |
| 875 | Ga0496121_0082536 | 3300048924 | Bacteria | 2540 |
| 876 | Ga0496122_0000077 | 3300048925 | Bacteria | 218099 |
| 877 | Ga0496122_0000411 | 3300048925 | Bacteria | 90936 |
| 878 | Ga0496122_0001006 | 3300048925 | Bacteria | 49938 |
| 879 | Ga0496122_0002310 | 3300048925 | Bacteria | 27515 |
| 880 | Ga0496122_0005070 | 3300048925 | Bacteria | 15911 |
| 881 | Ga0496122_0009347 | 3300048925 | Bacteria | 10350 |
| 882 | Ga0496122_0043548 | 3300048925 | Bacteria | 3515 |
| 883 | Ga0496122_0080646 | 3300048925 | Bacteria | 2268 |
| 884 | Ga0496123_0000055 | 3300048926 | Bacteria | 233626 |
| 885 | Ga0496123_0000526 | 3300048926 | Bacteria | 65966 |
| 886 | Ga0496123_0000784 | 3300048926 | Bacteria | 51269 |
| 887 | Ga0496123_0003334 | 3300048926 | Bacteria | 18178 |
| 888 | Ga0496123_0005445 | 3300048926 | Bacteria | 12818 |
| 889 | Ga0496123_0005565 | 3300048926 | Bacteria | 12613 |
| 890 | Ga0496123_0030323 | 3300048926 | Bacteria | 3961 |
| 891 | Ga0496123_0055059 | 3300048926 | Bacteria | 2612 |
| 892 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 893 | Ga0496124_0000423 | 3300048927 | Bacteria | 75679 |
| 894 | Ga0496124_0002136 | 3300048927 | Bacteria | 26565 |
| 895 | Ga0496124_0003253 | 3300048927 | Bacteria | 20062 |
| 896 | Ga0496124_0010388 | 3300048927 | Bacteria | 9433 |
| 897 | Ga0496124_0034915 | 3300048927 | Bacteria | 4404 |
| 898 | Ga0496124_0040359 | 3300048927 | Bacteria | 4038 |
| 899 | Ga0496124_0171849 | 3300048927 | Bacteria | 1677 |
| 900 | Ga0496125_0000146 | 3300048928 | Bacteria | 154919 |
| 901 | Ga0496125_0021807 | 3300048928 | Bacteria | 5960 |
| 902 | Ga0496125_0023112 | 3300048928 | Bacteria | 5750 |
| 903 | Ga0496125_0034996 | 3300048928 | Bacteria | 4416 |
| 904 | Ga0496126_0000184 | 3300048929 | Bacteria | 140502 |
| 905 | Ga0496126_0000225 | 3300048929 | Bacteria | 122842 |
| 906 | Ga0496126_0000287 | 3300048929 | Bacteria | 106718 |
| 907 | Ga0496126_0000376 | 3300048929 | Bacteria | 92338 |
| 908 | Ga0496126_0004422 | 3300048929 | Bacteria | 16821 |
| 909 | Ga0496126_0016966 | 3300048929 | Bacteria | 7265 |
| 910 | Ga0496126_0092654 | 3300048929 | Bacteria | 2654 |
| 911 | Ga0495678_000008 | 3300049459 | Bacteria | 445926 |
| 912 | Ga0495678_004177 | 3300049459 | Bacteria | 8510 |
| 913 | Ga0495678_007534 | 3300049459 | Bacteria | 5624 |
| 914 | Ga0495678_007933 | 3300049459 | Bacteria | 5440 |
| 915 | Ga0495678_018060 | 3300049459 | Bacteria | 3180 |
| 916 | Ga0495682_0000025 | 3300049460 | Bacteria | 147931 |
| 917 | Ga0501034_0215736 | 3300049571 | Bacteria | 1873 |
| 918 | Ga0501227_003399 | 3300049665 | Bacteria | 3449 |
| 919 | nmdc:mga0k408_8863_c1 | 3300050493 | Bacteria | 5411 |
| 920 | nmdc:mga07m45_387_c1 | 3300050496 | Bacteria | 18087 |
| 921 | nmdc:mga05p37_31596_c1 | 3300050507 | Bacteria | 6468 |
| 922 | nmdc:mga0n895_12900_c1 | 3300050512 | Bacteria | 7511 |
| 923 | nmdc:mga08x19_50560_c1 | 3300050514 | Bacteria | 2667 |
| 924 | nmdc:mga0a205_79958_c1 | 3300050515 | Bacteria | 3159 |
| 925 | Ga0500643_002053 | 3300053087 | Bacteria | 10777 |
| 926 | Ga0500651_0000077 | 3300053093 | Bacteria | 62750 |
| 927 | Ga0500566_0002377 | 3300053094 | Bacteria | 11137 |
| 928 | Ga0500640_000066 | 3300053095 | Bacteria | 17189 |
| 929 | Ga0500641_0002909 | 3300053096 | Bacteria | 6074 |
| 930 | Ga0500641_0027272 | 3300053096 | Bacteria | 2223 |
| 931 | Ga0500554_000079 | 3300053102 | Bacteria | 17589 |
| 932 | Ga0500571_000078 | 3300053110 | Bacteria | 30645 |
| 933 | Ga0500595_000118 | 3300053119 | Bacteria | 52764 |
| 934 | Ga0500595_000168 | 3300053119 | Bacteria | 43413 |
| 935 | Ga0500608_002587 | 3300053122 | Bacteria | 6617 |
| 936 | Ga0500614_000453 | 3300053123 | Bacteria | 10614 |
| 937 | Ga0500618_001477 | 3300053125 | Bacteria | 10420 |
| 938 | Ga0500618_001527 | 3300053125 | Bacteria | 10155 |
| 939 | Ga0500618_001646 | 3300053125 | Bacteria | 9616 |
| 940 | Ga0500618_001713 | 3300053125 | Bacteria | 9350 |
| 941 | Ga0500618_009876 | 3300053125 | Bacteria | 2587 |
| 942 | Ga0500655_000598 | 3300053133 | Bacteria | 7244 |
| 943 | Ga0500658_0002513 | 3300053134 | Bacteria | 7101 |
| 944 | Ga0500559_0004355 | 3300053136 | Bacteria | 6745 |
| 945 | Ga0500559_0015211 | 3300053136 | Bacteria | 3249 |
| 946 | Ga0500564_019022 | 3300053138 | Bacteria | 3137 |
| 947 | Ga0500568_0001417 | 3300053139 | Bacteria | 15543 |
| 948 | Ga0500574_000208 | 3300053141 | Bacteria | 6951 |
| 949 | Ga0500616_0003312 | 3300053153 | Bacteria | 12413 |
| 950 | Ga0500616_0034162 | 3300053153 | Bacteria | 2771 |
| 951 | Ga0500634_0009577 | 3300053161 | Bacteria | 4913 |
| 952 | Ga0500638_038468 | 3300053162 | Bacteria | 2322 |
| 953 | Ga0466962_0026364 | 3300061719 | Bacteria | 2791 |
| 954 | 2501084694 | 2501025502 | Bacteria | 9641094 |
| 955 | 2509130155 | 2508501125 | Bacteria | 7208311 |
| 956 | 2510283311 | 2510065053 | Bacteria | 5005518 |
| 957 | 2510292860 | 2510065055 | Bacteria | 5037935 |
| 958 | 2510313331 | 2510065058 | Bacteria | 5005894 |
| 959 | 2511092444 | 2510917013 | Bacteria | 9951648 |
| 960 | 2511248733 | 2511231003 | Bacteria | 5606035 |
| 961 | 2511358458 | 2511231021 | Bacteria | 7302637 |
| 962 | 2513962385 | 2513237151 | Bacteria | 6309801 |
| 963 | 2515680571 | 2515154122 | Bacteria | 8609520 |
| 964 | 2519459472 | 2519103095 | Bacteria | 6629912 |
| 965 | 2519461653 | 2519103095 | Bacteria | 6629912 |
| 966 | 2527077600 | 2526164713 | Bacteria | 6780608 |
| 967 | 2553003343 | 2551306416 | Bacteria | 6152985 |
| 968 | 2555668454 | 2554235341 | Bacteria | 6867980 |
| 969 | 2555671389 | 2554235341 | Bacteria | 6867980 |
| 970 | 2585291059 | 2582581311 | Bacteria | 6763856 |
| 971 | 2585293282 | 2582581311 | Bacteria | 6763856 |
| 972 | 2596374808 | 2595698237 | Bacteria | 6712432 |
| 973 | 2599354454 | 2599185160 | Bacteria | 6844013 |
| 974 | 2599355451 | 2599185160 | Bacteria | 6844013 |
| 975 | 2599359832 | 2599185161 | Bacteria | 6960462 |
| 976 | 2599360710 | 2599185161 | Bacteria | 6960462 |
| 977 | 2599366154 | 2599185162 | Bacteria | 6957254 |
| 978 | 2599367032 | 2599185162 | Bacteria | 6957254 |
| 979 | 2599372944 | 2599185163 | Bacteria | 6995158 |
| 980 | 2599373822 | 2599185163 | Bacteria | 6995158 |
| 981 | 2599379562 | 2599185164 | Bacteria | 6841688 |
| 982 | 2599380557 | 2599185164 | Bacteria | 6841688 |
| 983 | 2599385460 | 2599185165 | Bacteria | 6843250 |
| 984 | 2599387004 | 2599185165 | Bacteria | 6843250 |
| 985 | 2599391803 | 2599185166 | Bacteria | 6959206 |
| 986 | 2599392680 | 2599185166 | Bacteria | 6959206 |
| 987 | 2599403569 | 2599185168 | Bacteria | 6997636 |
| 988 | 2599404447 | 2599185168 | Bacteria | 6997636 |
| 989 | 2599461288 | 2599185181 | Bacteria | 6844519 |
| 990 | 2599462285 | 2599185181 | Bacteria | 6844519 |
| 991 | 2599466656 | 2599185182 | Bacteria | 6883168 |
| 992 | 2599469832 | 2599185182 | Bacteria | 6883168 |
| 993 | 2599490308 | 2599185186 | Bacteria | 6831633 |
| 994 | 2599490623 | 2599185186 | Bacteria | 6831633 |
| 995 | 2599622604 | 2599185214 | Bacteria | 8209958 |
| 996 | 2599671083 | 2599185226 | Bacteria | 8233575 |
| 997 | 2599679880 | 2599185227 | Bacteria | 8246414 |
| 998 | 2599691896 | 2599185229 | Bacteria | 8216126 |
| 999 | 2599735132 | 2599185239 | Bacteria | 8686614 |
| 1000 | 2599735906 | 2599185239 | Bacteria | 8686614 |
| 1001 | 2599743261 | 2599185240 | Bacteria | 7968121 |
| 1002 | 2599746642 | 2599185240 | Bacteria | 7968121 |
| 1003 | 2600205507 | 2599185355 | Bacteria | 7968906 |
| 1004 | 2600208548 | 2599185355 | Bacteria | 7968906 |
| 1005 | 2600213904 | 2599185356 | Bacteria | 6843884 |
| 1006 | 2600214907 | 2599185356 | Bacteria | 6843884 |
| 1007 | 2601667420 | 2600255292 | Bacteria | 6300551 |
| 1008 | 2601774070 | 2600255313 | Bacteria | 6842543 |
| 1009 | 2601774388 | 2600255313 | Bacteria | 6842543 |
| 1010 | 2643731139 | 2643221541 | Bacteria | 5498788 |
| 1011 | 2643860339 | 2643221569 | Bacteria | 6064337 |
| 1012 | 2643979438 | 2643221594 | Bacteria | 5811388 |
| 1013 | 2644045355 | 2643221606 | Bacteria | 5588032 |
| 1014 | 2644391868 | 2643221671 | Bacteria | 5496681 |
| 1015 | 2671097035 | 2667528171 | Bacteria | 6900659 |
| 1016 | 2671098071 | 2667528171 | Bacteria | 6900659 |
| 1017 | 2676740804 | 2675903129 | Bacteria | 7964495 |
| 1018 | 2676747095 | 2675903129 | Bacteria | 7964495 |
| 1019 | 2723878751 | 2721755763 | Bacteria | 4464185 |
| 1020 | 2738819093 | 2738541296 | Bacteria | 7285013 |
| 1021 | 2738830751 | 2738541298 | Bacteria | 7286732 |
| 1022 | 2738872277 | 2738541306 | Bacteria | 7284992 |
| 1023 | 2738884605 | 2738541307 | Bacteria | 8606193 |
| 1024 | 2739189844 | 2738543002 | Bacteria | 7284546 |
| 1025 | 2739218878 | 2738543008 | Bacteria | 7282815 |
| 1026 | 2739249328 | 2738543013 | Bacteria | 5618633 |
| 1027 | 2739280529 | 2738543019 | Bacteria | 7459457 |
| 1028 | 2746088275 | 2744054900 | Bacteria | 8399525 |
| 1029 | 2746096830 | 2744054901 | Bacteria | 8397047 |
| 1030 | 2753565756 | 2751185846 | Bacteria | 7242164 |
| 1031 | 2765568204 | 2765235838 | Bacteria | 5445269 |
| 1032 | 2765570822 | 2765235838 | Bacteria | 5445269 |
| 1033 | 2774128919 | 2773857672 | Bacteria | 4993178 |
| 1034 | 2808974108 | 2808606384 | Bacteria | 8474373 |
| 1035 | 2808983577 | 2808606386 | Bacteria | 4471946 |
| 1036 | 2809007620 | 2808606390 | Bacteria | 8476311 |
| 1037 | 2809016047 | 2808606391 | Bacteria | 8308166 |
| 1038 | 2809035709 | 2808606395 | Bacteria | 6020352 |
| 1039 | 2809129241 | 2808606415 | Bacteria | 4576710 |
| 1040 | 2809149704 | 2808606419 | Bacteria | 4576925 |
| 1041 | 2812477548 | 2811994917 | Bacteria | 7761064 |
| 1042 | 2817258528 | 2816332253 | Bacteria | 6764532 |
| 1043 | 2817261754 | 2816332253 | Bacteria | 6764532 |
| 1044 | 2817279438 | 2816332256 | Bacteria | 6891714 |
| 1045 | 2817453222 | 2816332286 | Bacteria | 6853759 |
| 1046 | 2817456806 | 2816332286 | Bacteria | 6853759 |
| 1047 | 2819600054 | 2818991446 | Bacteria | 7757362 |
| 1048 | 2819621768 | 2818991450 | Bacteria | 6962147 |
| 1049 | 2819630047 | 2818991452 | Bacteria | 8442785 |
| 1050 | 2819632040 | 2818991452 | Bacteria | 8442785 |
| 1051 | 2819702129 | 2818991464 | Bacteria | 6907494 |
| 1052 | 2819703138 | 2818991464 | Bacteria | 6907494 |
| 1053 | 2831267068 | 2831265667 | Bacteria | 7184833 |
| 1054 | 2838056153 | 2838054893 | Bacteria | 7451788 |
| 1055 | 2839097491 | 2839094727 | Bacteria | 5534556 |
| 1056 | 2839099472 | 2839094727 | Bacteria | 5534556 |
| 1057 | 2842324989 | 2842324504 | Bacteria | 9364110 |
| 1058 | 2842325822 | 2842324504 | Bacteria | 9364110 |
| 1059 | 2842349268 | 2842348783 | Bacteria | 9002918 |
| 1060 | 2842350101 | 2842348783 | Bacteria | 9002918 |
| 1061 | 2842454703 | 2842454564 | Bacteria | 8730687 |
| 1062 | 2842461808 | 2842454564 | Bacteria | 8730687 |
| 1063 | 2852619858 | 2852618963 | Bacteria | 4577824 |
| 1064 | 2855732490 | 2855730933 | Bacteria | 7047938 |
| 1065 | 2855769198 | 2855767633 | Bacteria | 7049357 |
| 1066 | 2856288778 | 2856287931 | Bacteria | 7223934 |
| 1067 | 2857364493 | 2857357740 | Bacteria | 9937880 |
| 1068 | 2857544462 | 2857542790 | Bacteria | 5326616 |
| 1069 | 2857551858 | 2857547612 | Bacteria | 6179999 |
| 1070 | 2857576548 | 2857576091 | Bacteria | 5465855 |
| 1071 | 2858950788 | 2858950400 | Bacteria | 6783797 |
| 1072 | 2863422431 | 2863421361 | Bacteria | 7300805 |
| 1073 | 2870070536 | 2870068957 | Bacteria | 8925310 |
| 1074 | 2870072656 | 2870068957 | Bacteria | 8925310 |
| 1075 | 2881414923 | 2881412998 | Bacteria | 6492157 |
| 1076 | 2884816293 | 2884811622 | Bacteria | 5552861 |
| 1077 | 2884841280 | 2884836552 | Bacteria | 5219991 |
| 1078 | 2884856155 | 2884852848 | Bacteria | 5221161 |
| 1079 | 2885080708 | 2885080285 | Bacteria | 6355622 |
| 1080 | 2885204908 | 2885198086 | Bacteria | 7212419 |
| 1081 | 2885218405 | 2885211737 | Bacteria | 7212420 |
| 1082 | 2896156920 | 2896154374 | Bacteria | 5221518 |
| 1083 | 2899925999 | 2899924645 | Bacteria | 7487985 |
| 1084 | 2900637713 | 2900634093 | Bacteria | 10263517 |
| 1085 | 2902687696 | 2902682994 | Bacteria | 8951596 |
| 1086 | 2904487512 | 2904483920 | Bacteria | 7545285 |
| 1087 | 2904548565 | 2904541872 | Bacteria | 8915136 |
| 1088 | 2904564929 | 2904564687 | Bacteria | 7609577 |
| 1089 | 2904569105 | 2904564687 | Bacteria | 7609577 |
| 1090 | 2904572375 | 2904571731 | Bacteria | 7608790 |
| 1091 | 2904576587 | 2904571731 | Bacteria | 7608790 |
| 1092 | 2904624707 | 2904615490 | Bacteria | 10047340 |
| 1093 | 2917072222 | 2917070673 | Bacteria | 6868303 |
| 1094 | 2917075255 | 2917070673 | Bacteria | 6868303 |
| 1095 | 2917832948 | 2917832318 | Bacteria | 5346010 |
| 1096 | 2919048853 | 2919046199 | Bacteria | 5567169 |
| 1097 | 2919128644 | 2919125081 | Bacteria | 5385106 |
| 1098 | 2919528818 | 2919527303 | Bacteria | 7718827 |
| 1099 | 2923511458 | 2923510766 | Bacteria | 5926163 |
| 1100 | 2928041605 | 2928037797 | Bacteria | 7273642 |
| 1101 | 2928049169 | 2928044640 | Bacteria | 7271509 |
| 1102 | 2928052223 | 2928051484 | Bacteria | 7773759 |
| 1103 | 2928065106 | 2928064002 | Bacteria | 7419480 |
| 1104 | 2928077515 | 2928070936 | Bacteria | 8062541 |
| 1105 | 2928087449 | 2928084124 | Bacteria | 7159212 |
| 1106 | 2928110943 | 2928108538 | Bacteria | 7360024 |
| 1107 | 2928125518 | 2928125067 | Bacteria | 5937560 |
| 1108 | 2928137499 | 2928135762 | Bacteria | 7259641 |
| 1109 | 2928157134 | 2928157003 | Bacteria | 7522202 |
| 1110 | 2928161470 | 2928157003 | Bacteria | 7522202 |
| 1111 | 2928168298 | 2928163908 | Bacteria | 7561269 |
| 1112 | 2928168968 | 2928163908 | Bacteria | 7561269 |
| 1113 | 2928172209 | 2928170801 | Bacteria | 8785406 |
| 1114 | 2928173985 | 2928170801 | Bacteria | 8785406 |
| 1115 | 2928505794 | 2928503688 | Bacteria | 7268108 |
| 1116 | 2928537701 | 2928536128 | Bacteria | 7657547 |
| 1117 | 2928541765 | 2928536128 | Bacteria | 7657547 |
| 1118 | 2929164767 | 2929160207 | Bacteria | 9075316 |
| 1119 | 2932411032 | 2932410948 | Bacteria | 6312192 |
| 1120 | 2932419401 | 2932416698 | Bacteria | 6315112 |
| 1121 | 2935354391 | 2935353572 | Unclassified | 6955622 |
| 1122 | 2935356243 | 2935353572 | Unclassified | 6955622 |
| 1123 | 2941485608 | |||
| 1124 | 2945937776 | 2945934425 | Bacteria | 7444609 |
| 1125 | 2974298960 | 2974298342 | Bacteria | 4840922 |
| 1126 | 2981993412 | 2981990288 | Bacteria | 7590678 |
| 1127 | 2981994983 | 2981990288 | Bacteria | 7590678 |
| 1128 | 2984501268 | 2984499530 | Bacteria | 5020881 |
| 1129 | 2984505271 | 2984504281 | Bacteria | 5262371 |
| 1130 | 2990705507 | 2990703756 | Bacteria | 7715990 |
| 1131 | 637318813 | 637000220 | Bacteria | 7074893 |
| 1132 | 637321711 | 637000220 | Bacteria | 7074893 |
| 1133 | 642424527 | 641736151 | Bacteria | 7477263 |
| 1134 | 642418197 | 641736154 | Bacteria | 7689995 |
| 1135 | 642420292 | 641736154 | Bacteria | 7689995 |
| 1136 | 642622604 | 642555113 | Bacteria | 8214658 |
| 1137 | 8018848360 | 8018845410 | Bacteria | 8933938 |
| 1138 | 8018852075 | 8018845410 | Bacteria | 8933938 |
| 1139 | 8020809190 | 8020807995 | Bacteria | 6801506 |
| 1140 | 8020813062 | 8020807995 | Bacteria | 6801506 |
| 1141 | 8020939747 | 8020938398 | Bacteria | 7472757 |
| 1142 | 8020945754 | 8020945358 | Bacteria | 8467355 |
| 1143 | 8020951609 | 8020945358 | Bacteria | 8467355 |
| 1144 | 8021120480 | 8021120328 | Bacteria | 8782274 |
| 1145 | 8021126236 | 8021120328 | Bacteria | 8782274 |
| 1146 | 8039100734 | 8039098773 | Bacteria | 6602928 |
| 1147 | 8039101299 | 8039098773 | Bacteria | 6602928 |
| 1148 | 8040169142 | 8040167225 | Bacteria | 6542727 |
| 1149 | 8040177687 | 8040173305 | Bacteria | 6827067 |
| 1150 | 8040179434 | 8040173305 | Bacteria | 6827067 |
| 1151 | 8055267065 | 8055266321 | Bacteria | 7999742 |
| 1152 | 8055301621 | 8055301274 | Bacteria | 8587385 |
| 1153 | 8056215472 | 8056207758 | Bacteria | 8639239 |
| 1154 | Ga0182008_10000847 | |||
| 1155 | JGI24740J21852_10005825 | |||
| 1156 | JGI24735J21928_10000157 | |||
| 1157 | JGI24735J21928_10008037 | |||
| 1158 | JGI24735J21928_10014603 | |||
| 1159 | JGI24735J21928_10031205 | |||
| 1160 | JGI24738J21930_10002732 | |||
| 1161 | JGI25156J39149_1000161 | |||
| 1162 | JGI25156J39149_1000925 | |||
| 1163 | JGI25156J39149_1007675 | |||
| 1164 | JGI25162J39368_1000085 | |||
| 1165 | JGI25162J39368_1000251 | |||
| 1166 | JGI25163J39215_1000077 | |||
| 1167 | JGI25163J39215_1000590 | |||
| 1168 | JGI25164J39214_1000063 | |||
| 1169 | JGI25164J39214_1000194 | |||
| 1170 | JGI25152J39213_1001519 | |||
| 1171 | JGI25152J39213_1002390 | |||
| 1172 | JGI25150J39212_1000587 | |||
| 1173 | JGI25159J45721_1001477 | |||
| 1174 | JGI25159J45721_1004504 | |||
| 1175 | JGI25151J46595_10000159 | |||
| 1176 | JGI25151J46595_10002728 | |||
| 1177 | JGI25165J46597_1000160 | |||
| 1178 | JGI25165J46597_1000348 | |||
| 1179 | JGI25165J46597_1001388 | |||
| 1180 | JGI25153J46596_10002616 | |||
| 1181 | rootH1_10076874 | |||
| 1182 | rootH2_10004706 | |||
| 1183 | rootH2_10006723 | |||
| 1184 | rootL2_10111661 | |||
| 1185 | rootH1_10290880 | |||
| 1186 | JGI25160J50197_1002012 | |||
| 1187 | JGI25160J50197_1009144 | |||
| 1188 | JGI25161J50226_1000954 | |||
| 1189 | JGI25161J50226_1003092 | |||
| 1190 | Ga0055533_1000246 | |||
| 1191 | Ga0055532_1000012 | |||
| 1192 | Ga0055532_1000236 | |||
| 1193 | Ga0055532_1000645 | |||
| 1194 | Ga0055532_1000796 | |||
| 1195 | Ga0055532_1000950 | |||
| 1196 | Ga0055527_1000011 | |||
| 1197 | Ga0055527_1000421 | |||
| 1198 | Ga0055535_1000009 | |||
| 1199 | Ga0055535_1000267 | |||
| 1200 | Ga0055535_1000345 | |||
| 1201 | Ga0055542_1000009 | |||
| 1202 | Ga0055542_1000015 | |||
| 1203 | Ga0055542_1000175 | |||
| 1204 | Ga0055542_1001534 | |||
| 1205 | Ga0055529_1000011 | |||
| 1206 | Ga0055529_1000131 | |||
| 1207 | Ga0055526_1002126 | |||
| 1208 | Ga0055526_1003318 | |||
| 1209 | Ga0055537_1001028 | |||
| 1210 | Ga0055537_1004341 | |||
| 1211 | Ga0055524_1002180 | |||
| 1212 | Ga0055524_1004347 | |||
| 1213 | Ga0055536_1000283 | |||
| 1214 | Ga0055534_1000998 | |||
| 1215 | Ga0055534_1001306 | |||
| 1216 | Ga0055528_1001735 | |||
| 1217 | Ga0055528_1007335 | |||
| 1218 | Ga0055528_1009455 | |||
| 1219 | Ga0055530_10000442 | |||
| 1220 | Ga0055540_1001556 | |||
| 1221 | Ga0055540_1010976 | |||
| 1222 | Ga0055531_10000459 | |||
| 1223 | Ga0055531_10006647 | |||
| 1224 | Ga0055543_1003052 | |||
| 1225 | Ga0065165_1001684 | |||
| 1226 | Ga0065165_1007053 | |||
| 1227 | Ga0065703_1000120 | |||
| 1228 | Ga0065714_10064585 | |||
| 1229 | Ga0065715_10013607 | |||
| 1230 | Ga0070658_10015084 | |||
| 1231 | Ga0070658_10040983 | |||
| 1232 | Ga0070676_10031057 | |||
| 1233 | Ga0070683_100003572 | |||
| 1234 | Ga0070690_100056010 | |||
| 1235 | Ga0070670_100006156 | |||
| 1236 | Ga0070670_100088097 | |||
| 1237 | Ga0070666_10010909 | |||
| 1238 | Ga0070682_100169365 | |||
| 1239 | Ga0070660_100000106 | |||
| 1240 | Ga0070689_100006546 | |||
| 1241 | Ga0070661_100006676 | |||
| 1242 | Ga0070661_100090596 | |||
| 1243 | Ga0070669_100014584 | |||
| 1244 | Ga0070669_100075722 | |||
| 1245 | Ga0070675_100145053 | |||
| 1246 | Ga0070671_100023790 | |||
| 1247 | Ga0070659_100000064 | |||
| 1248 | Ga0070659_100096229 | |||
| 1249 | Ga0070667_100074211 | |||
| 1250 | Ga0070663_100000132 | |||
| 1251 | Ga0070663_100010082 | |||
| 1252 | Ga0070663_100075072 | |||
| 1253 | Ga0070662_100013507 | |||
| 1254 | Ga0070662_100048456 | |||
| 1255 | Ga0070685_10031644 | |||
| 1256 | Ga0070699_100109999 | |||
| 1257 | Ga0070684_100000373 | |||
| 1258 | Ga0068853_100041157 | |||
| 1259 | Ga0070672_100018944 | |||
| 1260 | Ga0070686_100003229 | |||
| 1261 | Ga0070696_100030534 | |||
| 1262 | Ga0070665_100055765 | |||
| 1263 | Ga0068855_100005080 | |||
| 1264 | Ga0068855_100162155 | |||
| 1265 | Ga0068855_100212178 | |||
| 1266 | Ga0068855_100306679 | |||
| 1267 | Ga0070664_100017268 | |||
| 1268 | Ga0070664_100254520 | |||
| 1269 | Ga0068857_100047784 | |||
| 1270 | Ga0068857_100048534 | |||
| 1271 | Ga0068852_100001073 | |||
| 1272 | Ga0068852_100022733 | |||
| 1273 | Ga0068864_100081612 | |||
| 1274 | Ga0068851_10012984 | |||
| 1275 | Ga0068858_100088099 | |||
| 1276 | Ga0075363_100057476 | |||
| 1277 | Ga0075432_10001694 | |||
| 1278 | Ga0075432_10008789 | |||
| 1279 | Ga0075367_10102702 | |||
| 1280 | Ga0075366_10008606 | |||
| 1281 | Ga0075370_10004522 | |||
| 1282 | Ga0075428_100041861 | |||
| 1283 | Ga0075428_100137161 | |||
| 1284 | Ga0075431_100050894 | |||
| 1285 | Ga0075433_10064876 | |||
| 1286 | Ga0075434_100003681 | |||
| 1287 | Ga0075434_100150535 | |||
| 1288 | Ga0075436_100027914 | |||
| 1289 | Ga0075436_100064354 | |||
| 1290 | Ga0079104_1000037 | |||
| 1291 | Ga0105251_10000001 | |||
| 1292 | Ga0105251_10000552 | |||
| 1293 | Ga0105251_10002824 | |||
| 1294 | Ga0105251_10003864 | |||
| 1295 | Ga0105244_10000979 | |||
| 1296 | Ga0105244_10009990 | |||
| 1297 | Ga0105244_10010769 | |||
| 1298 | Ga0105244_10022563 | |||
| 1299 | Ga0105244_10024821 | |||
| 1300 | Ga0105244_10025351 | |||
| 1301 | Ga0105244_10093347 | |||
| 1302 | Ga0105250_10004563 | |||
| 1303 | Ga0105250_10007581 | |||
| 1304 | Ga0105250_10011747 | |||
| 1305 | Ga0105250_10015738 | |||
| 1306 | Ga0105250_10067669 | |||
| 1307 | Ga0105240_10001449 | |||
| 1308 | Ga0105240_10002265 | |||
| 1309 | Ga0105240_10003616 | |||
| 1310 | Ga0105240_10007199 | |||
| 1311 | Ga0105240_10021483 | |||
| 1312 | Ga0105240_10067906 | |||
| 1313 | Ga0105240_10119574 | |||
| 1314 | Ga0111539_10029633 | |||
| 1315 | Ga0111539_10049801 | |||
| 1316 | Ga0111539_10166613 | |||
| 1317 | Ga0105247_10000502 | |||
| 1318 | Ga0114129_10080529 | |||
| 1319 | Ga0105243_10000163 | |||
| 1320 | Ga0105243_10000480 | |||
| 1321 | Ga0105243_10004544 | |||
| 1322 | Ga0105243_10007340 | |||
| 1323 | Ga0105248_10014853 | |||
| 1324 | Ga0105248_10097577 | |||
| 1325 | Ga0105248_10171808 | |||
| 1326 | Ga0105248_10196664 | |||
| 1327 | Ga0105237_10000882 | |||
| 1328 | Ga0105237_10004918 | |||
| 1329 | Ga0105237_10034532 | |||
| 1330 | Ga0105237_10077392 | |||
| 1331 | Ga0105237_10244875 | |||
| 1332 | Ga0105237_10263490 | |||
| 1333 | Ga0105238_10007420 | |||
| 1334 | Ga0105238_10038751 | |||
| 1335 | Ga0105238_10062179 | |||
| 1336 | Ga0105238_10190366 | |||
| 1337 | Ga0105238_10194313 | |||
| 1338 | Ga0105249_10014642 | |||
| 1339 | Ga0105239_10003438 | |||
| 1340 | Ga0105239_10006149 | |||
| 1341 | Ga0105239_10116348 | |||
| 1342 | Ga0105239_10295547 | |||
| 1343 | Ga0157373_10015863 | |||
| 1344 | Ga0157373_10033662 | |||
| 1345 | Ga0157373_10136962 | |||
| 1346 | Ga0157371_10000087 | |||
| 1347 | Ga0157371_10000788 | |||
| 1348 | Ga0157371_10003399 | |||
| 1349 | Ga0157371_10019544 | |||
| 1350 | Ga0157370_10068275 | |||
| 1351 | Ga0157369_10000267 | |||
| 1352 | Ga0157369_10000868 | |||
| 1353 | Ga0157369_10004250 | |||
| 1354 | Ga0157369_10008742 | |||
| 1355 | Ga0157369_10279560 | |||
| 1356 | Ga0157374_10000121 | |||
| 1357 | Ga0157372_10005676 | |||
| 1358 | Ga0157372_10006208 | |||
| 1359 | Ga0157372_10007809 | |||
| 1360 | Ga0163163_10042909 | |||
| 1361 | Ga0182008_10000481 | |||
| 1362 | Ga0182006_1000002 | |||
| 1363 | Ga0182007_10000045 | |||
| 1364 | Ga0182007_10000537 | |||
| 1365 | Ga0182007_10005198 | |||
| 1366 | Ga0182005_1000002 | |||
| 1367 | Ga0224712_10001994 | |||
| 1368 | Ga0209760_100039 | |||
| 1369 | Ga0209760_100064 | |||
| 1370 | Ga0209566_100089 | |||
| 1371 | Ga0209566_100145 | |||
| 1372 | Ga0209674_100013 | |||
| 1373 | Ga0209672_100010 | |||
| 1374 | Ga0209672_100015 | |||
| 1375 | Ga0209672_100031 | |||
| 1376 | Ga0209672_100370 | |||
| 1377 | Ga0209672_100432 | |||
| 1378 | Ga0209147_100006 | |||
| 1379 | Ga0209147_100016 | |||
| 1380 | Ga0209147_100034 | |||
| 1381 | Ga0209147_100040 | |||
| 1382 | Ga0209147_100150 | |||
| 1383 | Ga0209563_101172 | |||
| 1384 | Ga0207427_100001 | |||
| 1385 | Ga0207427_100082 | |||
| 1386 | Ga0207427_100426 | |||
| 1387 | Ga0209437_100003 | |||
| 1388 | Ga0209437_100006 | |||
| 1389 | Ga0209258_100009 | |||
| 1390 | Ga0209258_100010 | |||
| 1391 | Ga0209258_100026 | |||
| 1392 | Ga0209258_100061 | |||
| 1393 | Ga0207425_1000240 | |||
| 1394 | Ga0207425_1002072 | |||
| 1395 | Ga0209148_1000007 | |||
| 1396 | Ga0209148_1000018 | |||
| 1397 | Ga0209148_1000070 | |||
| 1398 | Ga0209148_1000510 | |||
| 1399 | Ga0209148_1001241 | |||
| 1400 | Ga0209759_1000235 | |||
| 1401 | Ga0209759_1000256 | |||
| 1402 | Ga0209759_1000297 | |||
| 1403 | Ga0209759_1003194 | |||
| 1404 | Ga0209759_1006343 | |||
| 1405 | Ga0209759_1015415 | |||
| 1406 | Ga0209129_1000013 | |||
| 1407 | Ga0209129_1002013 | |||
| 1408 | Ga0209233_1000007 | |||
| 1409 | Ga0209233_1000105 | |||
| 1410 | Ga0209233_1000229 | |||
| 1411 | Ga0209565_1000289 | |||
| 1412 | Ga0209565_1000725 | |||
| 1413 | Ga0209455_1000015 | |||
| 1414 | Ga0209455_1000069 | |||
| 1415 | Ga0209455_1000580 | |||
| 1416 | Ga0209673_1000026 | |||
| 1417 | Ga0209673_1000188 | |||
| 1418 | Ga0209673_1000260 | |||
| 1419 | Ga0209130_1000249 | |||
| 1420 | Ga0209130_1000405 | |||
| 1421 | Ga0209675_1000086 | |||
| 1422 | Ga0209675_1000182 | |||
| 1423 | Ga0209675_1003379 | |||
| 1424 | Ga0209676_1000004 | |||
| 1425 | Ga0209676_1004043 | |||
| 1426 | Ga0209676_1009820 | |||
| 1427 | Ga0209025_1000057 | |||
| 1428 | Ga0209025_1000220 | |||
| 1429 | Ga0209025_1000381 | |||
| 1430 | Ga0209025_1006990 | |||
| 1431 | Ga0209025_1016906 | |||
| 1432 | Ga0209564_1000214 | |||
| 1433 | Ga0209564_1000267 | |||
| 1434 | Ga0209564_1003899 | |||
| 1435 | Ga0209758_1000134 | |||
| 1436 | Ga0209758_1003687 | |||
| 1437 | Ga0209050_1000002 | |||
| 1438 | Ga0209050_1003474 | |||
| 1439 | Ga0209050_1006910 | |||
| 1440 | Ga0209050_1027025 | |||
| 1441 | Ga0209256_1000060 | |||
| 1442 | Ga0209256_1000222 | |||
| 1443 | Ga0207426_1000095 | |||
| 1444 | Ga0207426_1000100 | |||
| 1445 | Ga0207426_1006475 | |||
| 1446 | Ga0209051_1000002 | |||
| 1447 | Ga0209051_1001545 | |||
| 1448 | Ga0209051_1032961 | |||
| 1449 | Ga0209257_1000002 | |||
| 1450 | Ga0209257_1000689 | |||
| 1451 | Ga0209257_1000996 | |||
| 1452 | Ga0209257_1019409 | |||
| 1453 | Ga0207656_10018671 | |||
| 1454 | Ga0207696_1001811 | |||
| 1455 | Ga0207696_1003569 | |||
| 1456 | Ga0207696_1017707 | |||
| 1457 | Ga0207655_1000822 | |||
| 1458 | Ga0207655_1001110 | |||
| 1459 | Ga0207655_1001712 | |||
| 1460 | Ga0207655_1012856 | |||
| 1461 | Ga0207713_1000929 | |||
| 1462 | Ga0207713_1001156 | |||
| 1463 | Ga0207713_1002800 | |||
| 1464 | Ga0207713_1019934 | |||
| 1465 | Ga0207710_10000009 | |||
| 1466 | Ga0207647_10000341 | |||
| 1467 | Ga0207647_10009687 | |||
| 1468 | Ga0207647_10010144 | |||
| 1469 | Ga0207647_10010476 | |||
| 1470 | Ga0207647_10042834 | |||
| 1471 | Ga0207647_10057077 | |||
| 1472 | Ga0207705_10014750 | |||
| 1473 | Ga0207654_10021218 | |||
| 1474 | Ga0207695_10001490 | |||
| 1475 | Ga0207695_10001811 | |||
| 1476 | Ga0207695_10003068 | |||
| 1477 | Ga0207695_10066620 | |||
| 1478 | Ga0207695_10076749 | |||
| 1479 | Ga0207695_10203453 | |||
| 1480 | Ga0207671_10005638 | |||
| 1481 | Ga0207671_10010984 | |||
| 1482 | Ga0207671_10054064 | |||
| 1483 | Ga0207657_10000097 | |||
| 1484 | Ga0207657_10000312 | |||
| 1485 | Ga0207657_10006989 | |||
| 1486 | Ga0207649_10014501 | |||
| 1487 | Ga0207694_10004425 | |||
| 1488 | Ga0207694_10026078 | |||
| 1489 | Ga0207694_10043942 | |||
| 1490 | Ga0207650_10008739 | |||
| 1491 | Ga0207650_10158312 | |||
| 1492 | Ga0207659_10116879 | |||
| 1493 | Ga0207690_10000079 | |||
| 1494 | Ga0207690_10000163 | |||
| 1495 | Ga0207706_10059136 | |||
| 1496 | Ga0207709_10000001 | |||
| 1497 | Ga0207709_10000167 | |||
| 1498 | Ga0207709_10001419 | |||
| 1499 | Ga0207709_10073365 | |||
| 1500 | Ga0207670_10003726 | |||
| 1501 | Ga0207711_10005624 | |||
| 1502 | Ga0207661_10002583 | |||
| 1503 | Ga0207679_10026201 | |||
| 1504 | Ga0207667_10002715 | |||
| 1505 | Ga0207667_10010846 | |||
| 1506 | Ga0207703_10050092 | |||
| 1507 | Ga0207639_10005487 | |||
| 1508 | Ga0207639_10030024 | |||
| 1509 | Ga0207678_10001291 | |||
| 1510 | Ga0207678_10021082 | |||
| 1511 | Ga0207648_10047491 | |||
| 1512 | Ga0207674_10026486 | |||
| 1513 | Ga0207698_10024618 | |||
| 1514 | Ga0209281_1000002 | |||
| 1515 | Ga0209371_1000751 | |||
| 1516 | Ga0209371_1013748 | |||
| 1517 | Ga0268266_10039868 | |||
| 1518 | Ga0268265_10116675 | |||
| 1519 | Ga0268256_1001017 | |||
| 1520 | Ga0268256_1004529 | |||
| 1521 | Ga0268256_1015710 | |||
| 1522 | Ga0307408_100001890 | |||
| 1523 | Ga0307405_10038866 | |||
| 1524 | Ga0307412_10000016 | |||
| 1525 | Ga0307412_10012724 | |||
| 1526 | Ga0307409_100176270 | |||
| 1527 | Ga0307416_100000420 | |||
| 1528 | Ga0307416_100029721 | |||
| 1529 | Ga0307510_10129755 | |||
| 1530 | Ga0395900_0001186 | |||
| 1531 | Ga0395900_0042424 | |||
| 1532 | Ga0395898_0148397 | |||
| 1533 | Ga0436364_0399617 | |||
| 1534 | Ga0395901_0000075 | |||
| 1535 | Ga0436365_0047346 | |||
| 1536 | Ga0436361_0293421 | |||
| 1537 | Ga0436363_0468856 | |||
| 1538 | Ga0436362_0635593 | |||
| 1539 | Ga0439438_010410 | |||
| 1540 | Ga0439466_0001368 | |||
| 1541 | Ga0439466_0016112 | |||
| 1542 | Ga0439448_0000619 | |||
| 1543 | Ga0439449_0011500 | |||
| 1544 | Ga0439451_002481 | |||
| 1545 | Ga0439452_000691 | |||
| 1546 | Ga0450903_002876 | |||
| 1547 | Ga0466969_0031897 | |||
| 1548 | Ga0466972_0048545 | |||
| 1549 | Ga0466966_0000318 | |||
| 1550 | Ga0466966_0000499 | |||
| 1551 | Ga0466966_0011173 | |||
| 1552 | Ga0466961_0015677 | |||
| 1553 | Ga0453684_0075339 | |||
| 1554 | Ga0466971_0010116 | |||
| 1555 | Ga0466971_0023201 | |||
| 1556 | Ga0466970_0003463 | |||
| 1557 | Ga0466957_0016398 | |||
| 1558 | Ga0466957_0030899 | |||
| 1559 | Ga0466959_0137787 | |||
| 1560 | Ga0466958_0001989 | |||
| 1561 | Ga0466958_0010339 | |||
| 1562 | Ga0466958_0038217 | |||
| 1563 | Ga0495617_000164 | |||
| 1564 | Ga0495617_002221 | |||
| 1565 | Ga0495617_007969 | |||
| 1566 | Ga0495627_004293 | |||
| 1567 | Ga0495627_006524 | |||
| 1568 | Ga0495627_012844 | |||
| 1569 | Ga0495592_0003749 | |||
| 1570 | Ga0495592_0020431 | |||
| 1571 | Ga0495592_0021064 | |||
| 1572 | Ga0495592_0022573 | |||
| 1573 | Ga0495592_0139494 | |||
| 1574 | Ga0495603_0001506 | |||
| 1575 | Ga0495603_0003463 | |||
| 1576 | Ga0495603_0007811 | |||
| 1577 | Ga0495603_0008106 | |||
| 1578 | Ga0495603_0019864 | |||
| 1579 | Ga0495590_0003820 | |||
| 1580 | Ga0495590_0006210 | |||
| 1581 | Ga0495590_0012046 | |||
| 1582 | Ga0495591_000053 | |||
| 1583 | Ga0495591_000054 | |||
| 1584 | Ga0495591_000143 | |||
| 1585 | Ga0495591_000172 | |||
| 1586 | Ga0495591_000559 | |||
| 1587 | Ga0495591_001695 | |||
| 1588 | Ga0495591_004785 | |||
| 1589 | Ga0495591_009817 | |||
| 1590 | Ga0495591_022131 | |||
| 1591 | Ga0495629_0000217 | |||
| 1592 | Ga0495629_0000376 | |||
| 1593 | Ga0495629_0000700 | |||
| 1594 | Ga0495629_0009044 | |||
| 1595 | Ga0495629_0010821 | |||
| 1596 | Ga0495629_0011591 | |||
| 1597 | Ga0495638_0000381 | |||
| 1598 | Ga0495638_0005027 | |||
| 1599 | Ga0495638_0006765 | |||
| 1600 | Ga0495638_0016389 | |||
| 1601 | Ga0495638_0040113 | |||
| 1602 | Ga0495641_0006000 | |||
| 1603 | Ga0495641_0017686 | |||
| 1604 | Ga0495651_0001907 | |||
| 1605 | Ga0495653_0000051 | |||
| 1606 | Ga0495653_0000403 | |||
| 1607 | Ga0495653_0000439 | |||
| 1608 | Ga0495653_0002819 | |||
| 1609 | Ga0495653_0037604 | |||
| 1610 | Ga0495653_0069700 | |||
| 1611 | Ga0495653_0081860 | |||
| 1612 | Ga0495650_0002322 | |||
| 1613 | Ga0495650_0002406 | |||
| 1614 | Ga0495650_0004787 | |||
| 1615 | Ga0495650_0016412 | |||
| 1616 | Ga0495650_0028866 | |||
| 1617 | Ga0495580_0000474 | |||
| 1618 | Ga0495580_0000869 | |||
| 1619 | Ga0495580_0000923 | |||
| 1620 | Ga0495580_0002854 | |||
| 1621 | Ga0495580_0008691 | |||
| 1622 | Ga0495580_0016408 | |||
| 1623 | Ga0495580_0019984 | |||
| 1624 | Ga0495580_0022241 | |||
| 1625 | Ga0495580_0023336 | |||
| 1626 | Ga0495580_0044059 | |||
| 1627 | Ga0495580_0047207 | |||
| 1628 | Ga0495580_0071939 | |||
| 1629 | Ga0495582_0000537 | |||
| 1630 | Ga0495582_0012293 | |||
| 1631 | Ga0495582_0047620 | |||
| 1632 | Ga0495605_0000080 | |||
| 1633 | Ga0495605_0003762 | |||
| 1634 | Ga0495605_0006370 | |||
| 1635 | Ga0495662_0006561 | |||
| 1636 | Ga0495662_0032745 | |||
| 1637 | Ga0495664_0000945 | |||
| 1638 | Ga0495664_0006513 | |||
| 1639 | Ga0495664_0007716 | |||
| 1640 | Ga0495664_0022377 | |||
| 1641 | Ga0495664_0064159 | |||
| 1642 | Ga0495584_0000018 | |||
| 1643 | Ga0495584_0000803 | |||
| 1644 | Ga0495584_0058809 | |||
| 1645 | Ga0495585_0005977 | |||
| 1646 | Ga0495585_0012873 | |||
| 1647 | Ga0495585_0074056 | |||
| 1648 | Ga0495585_0075146 | |||
| 1649 | Ga0495594_0003001 | |||
| 1650 | Ga0495596_0000050 | |||
| 1651 | Ga0495596_0013176 | |||
| 1652 | Ga0495596_0015892 | |||
| 1653 | Ga0495596_0021568 | |||
| 1654 | Ga0495596_0028410 | |||
| 1655 | Ga0495607_0000036 | |||
| 1656 | Ga0495607_0000333 | |||
| 1657 | Ga0495607_0002696 | |||
| 1658 | Ga0495607_0004370 | |||
| 1659 | Ga0495607_0005147 | |||
| 1660 | Ga0495607_0012932 | |||
| 1661 | Ga0495583_0000125 | |||
| 1662 | Ga0495583_0000169 | |||
| 1663 | Ga0495583_0000672 | |||
| 1664 | Ga0495583_0001076 | |||
| 1665 | Ga0495583_0001261 | |||
| 1666 | Ga0495583_0002360 | |||
| 1667 | Ga0495583_0003881 | |||
| 1668 | Ga0495583_0012611 | |||
| 1669 | Ga0495606_0000079 | |||
| 1670 | Ga0495606_0000170 | |||
| 1671 | Ga0495606_0000555 | |||
| 1672 | Ga0495606_0002882 | |||
| 1673 | Ga0495606_0004100 | |||
| 1674 | Ga0495606_0005455 | |||
| 1675 | Ga0495606_0052052 | |||
| 1676 | Ga0495610_0000203 | |||
| 1677 | Ga0495610_0003169 | |||
| 1678 | Ga0495610_0003639 | |||
| 1679 | Ga0495610_0015146 | |||
| 1680 | Ga0495610_0024940 | |||
| 1681 | Ga0495610_0065274 | |||
| 1682 | Ga0495616_0002871 | |||
| 1683 | Ga0495616_0012148 | |||
| 1684 | Ga0495616_0062316 | |||
| 1685 | Ga0495618_0001423 | |||
| 1686 | Ga0495618_0001820 | |||
| 1687 | Ga0495618_0109876 | |||
| 1688 | Ga0495620_0000592 | |||
| 1689 | Ga0495620_0001362 | |||
| 1690 | Ga0495620_0004675 | |||
| 1691 | Ga0495620_0032492 | |||
| 1692 | Ga0495628_0001457 | |||
| 1693 | Ga0495628_0008298 | |||
| 1694 | Ga0495628_0010142 | |||
| 1695 | Ga0495628_0011870 | |||
| 1696 | Ga0495628_0022375 | |||
| 1697 | Ga0495628_0045946 | |||
| 1698 | Ga0495628_0128087 | |||
| 1699 | Ga0495630_0002379 | |||
| 1700 | Ga0495630_0003360 | |||
| 1701 | Ga0495630_0047480 | |||
| 1702 | Ga0495630_0117012 | |||
| 1703 | Ga0495631_0001747 | |||
| 1704 | Ga0495631_0001748 | |||
| 1705 | Ga0495631_0019782 | |||
| 1706 | Ga0495631_0068636 | |||
| 1707 | Ga0495632_0004289 | |||
| 1708 | Ga0495632_0004844 | |||
| 1709 | Ga0495632_0013733 | |||
| 1710 | Ga0495637_0000062 | |||
| 1711 | Ga0495637_0000159 | |||
| 1712 | Ga0495637_0000818 | |||
| 1713 | Ga0495637_0002100 | |||
| 1714 | Ga0495637_0020317 | |||
| 1715 | Ga0495643_0004279 | |||
| 1716 | Ga0495643_0005482 | |||
| 1717 | Ga0495643_0008821 | |||
| 1718 | Ga0495643_0010885 | |||
| 1719 | Ga0495643_0029640 | |||
| 1720 | Ga0495644_0000031 | |||
| 1721 | Ga0495644_0000536 | |||
| 1722 | Ga0495644_0002089 | |||
| 1723 | Ga0495644_0003977 | |||
| 1724 | Ga0495648_0000590 | |||
| 1725 | Ga0495648_0002420 | |||
| 1726 | Ga0495648_0005906 | |||
| 1727 | Ga0495648_0008573 | |||
| 1728 | Ga0495648_0015281 | |||
| 1729 | Ga0495648_0039455 | |||
| 1730 | Ga0495648_0046310 | |||
| 1731 | Ga0495666_0000308 | |||
| 1732 | Ga0495666_0001041 | |||
| 1733 | Ga0495666_0002594 | |||
| 1734 | Ga0495666_0007836 | |||
| 1735 | Ga0495666_0008707 | |||
| 1736 | Ga0495666_0041322 | |||
| 1737 | Ga0495642_0008289 | |||
| 1738 | Ga0495652_0008919 | |||
| 1739 | Ga0495652_0032861 | |||
| 1740 | Ga0495652_0037532 | |||
| 1741 | Ga0495652_0049084 | |||
| 1742 | Ga0495652_0078268 | |||
| 1743 | Ga0495652_0224652 | |||
| 1744 | Ga0495654_0000589 | |||
| 1745 | Ga0495654_0002059 | |||
| 1746 | Ga0495654_0003395 | |||
| 1747 | Ga0495654_0007113 | |||
| 1748 | Ga0495654_0011991 | |||
| 1749 | Ga0495654_0016343 | |||
| 1750 | Ga0495654_0063280 | |||
| 1751 | Ga0495654_0090041 | |||
| 1752 | Ga0495665_0002208 | |||
| 1753 | Ga0495665_0012611 | |||
| 1754 | Ga0495665_0013039 | |||
| 1755 | Ga0495665_0016222 | |||
| 1756 | Ga0495665_0022768 | |||
| 1757 | Ga0495665_0061219 | |||
| 1758 | Ga0495665_0071811 | |||
| 1759 | Ga0495640_0006353 | |||
| 1760 | Ga0495640_0016436 | |||
| 1761 | Ga0495640_0021963 | |||
| 1762 | Ga0495586_0002467 | |||
| 1763 | Ga0495586_0002516 | |||
| 1764 | Ga0495586_0009309 | |||
| 1765 | Ga0495586_0022000 | |||
| 1766 | Ga0495586_0052016 | |||
| 1767 | Ga0495587_0006826 | |||
| 1768 | Ga0495587_0008189 | |||
| 1769 | Ga0495587_0009783 | |||
| 1770 | Ga0495609_0000016 | |||
| 1771 | Ga0495597_0005512 | |||
| 1772 | Ga0495597_0006350 | |||
| 1773 | Ga0495597_0018285 | |||
| 1774 | Ga0495645_0001920 | |||
| 1775 | Ga0495645_0004984 | |||
| 1776 | Ga0495645_0006484 | |||
| 1777 | Ga0495645_0025944 | |||
| 1778 | Ga0495645_0027825 | |||
| 1779 | Ga0495645_0121880 | |||
| 1780 | Ga0495622_0000039 | |||
| 1781 | Ga0495622_0000168 | |||
| 1782 | Ga0495622_0002828 | |||
| 1783 | Ga0495633_0021536 | |||
| 1784 | Ga0495667_0035281 | |||
| 1785 | Ga0495656_0008177 | |||
| 1786 | Ga0495668_0000424 | |||
| 1787 | Ga0495668_0006720 | |||
| 1788 | Ga0495668_0009648 | |||
| 1789 | Ga0495668_0059256 | |||
| 1790 | Ga0495668_0110359 | |||
| 1791 | Ga0495634_0000922 | |||
| 1792 | Ga0495634_0001516 | |||
| 1793 | Ga0495634_0003847 | |||
| 1794 | Ga0495634_0015351 | |||
| 1795 | Ga0495634_0031882 | |||
| 1796 | Ga0495611_0000725 | |||
| 1797 | Ga0495611_0006027 | |||
| 1798 | Ga0495611_0018475 | |||
| 1799 | Ga0495625_0000084 | |||
| 1800 | Ga0495625_0002559 | |||
| 1801 | Ga0495625_0015106 | |||
| 1802 | Ga0495625_0028528 | |||
| 1803 | Ga0495625_0040997 | |||
| 1804 | Ga0495625_0043128 | |||
| 1805 | Ga0495635_0002487 | |||
| 1806 | Ga0495635_0011122 | |||
| 1807 | Ga0495635_0013959 | |||
| 1808 | Ga0495635_0019252 | |||
| 1809 | Ga0495635_0021264 | |||
| 1810 | Ga0495635_0073658 | |||
| 1811 | Ga0495661_0000035 | |||
| 1812 | Ga0495661_0004743 | |||
| 1813 | Ga0495661_0005068 | |||
| 1814 | Ga0495661_0008843 | |||
| 1815 | Ga0495661_0009436 | |||
| 1816 | Ga0495661_0021769 | |||
| 1817 | Ga0495661_0042283 | |||
| 1818 | Ga0495588_0001274 | |||
| 1819 | Ga0495588_0013754 | |||
| 1820 | Ga0495588_0041847 | |||
| 1821 | Ga0495588_0053915 | |||
| 1822 | Ga0495657_0006190 | |||
| 1823 | Ga0495657_0106609 | |||
| 1824 | Ga0495599_0001622 | |||
| 1825 | Ga0495599_0008966 | |||
| 1826 | Ga0495623_0006235 | |||
| 1827 | Ga0495623_0007116 | |||
| 1828 | Ga0495623_0016840 | |||
| 1829 | Ga0495623_0019708 | |||
| 1830 | Ga0495623_0088675 | |||
| 1831 | Ga0495646_0000538 | |||
| 1832 | Ga0495646_0000563 | |||
| 1833 | Ga0495646_0000572 | |||
| 1834 | Ga0495646_0011658 | |||
| 1835 | Ga0495646_0039160 | |||
| 1836 | Ga0495646_0039570 | |||
| 1837 | Ga0495669_0002555 | |||
| 1838 | Ga0495613_0000752 | |||
| 1839 | Ga0495613_0002707 | |||
| 1840 | Ga0495613_0006979 | |||
| 1841 | Ga0495613_0030220 | |||
| 1842 | Ga0495624_0000334 | |||
| 1843 | Ga0495624_0002903 | |||
| 1844 | Ga0495624_0005242 | |||
| 1845 | Ga0495624_0006847 | |||
| 1846 | Ga0495624_0028873 | |||
| 1847 | Ga0495624_0045180 | |||
| 1848 | Ga0495624_0065952 | |||
| 1849 | Ga0495670_0015749 | |||
| 1850 | Ga0495671_0000141 | |||
| 1851 | Ga0495671_0009218 | |||
| 1852 | Ga0495671_0024349 | |||
| 1853 | Ga0495671_0024474 | |||
| 1854 | Ga0495649_0001294 | |||
| 1855 | Ga0495649_0027628 | |||
| 1856 | Ga0495649_0032235 | |||
| 1857 | Ga0495589_0002082 | |||
| 1858 | Ga0495589_0024401 | |||
| 1859 | Ga0495600_0006319 | |||
| 1860 | Ga0495600_0013396 | |||
| 1861 | Ga0495600_0058019 | |||
| 1862 | Ga0495660_0002843 | |||
| 1863 | Ga0495660_0003183 | |||
| 1864 | Ga0495660_0010687 | |||
| 1865 | Ga0495660_0020544 | |||
| 1866 | Ga0495581_0001548 | |||
| 1867 | Ga0495581_0007219 | |||
| 1868 | Ga0495581_0008128 | |||
| 1869 | Ga0495581_0019167 | |||
| 1870 | Ga0495604_0007058 | |||
| 1871 | Ga0495604_0007594 | |||
| 1872 | Ga0495604_0020628 | |||
| 1873 | Ga0495604_0024210 | |||
| 1874 | Ga0495604_0026065 | |||
| 1875 | Ga0495604_0042250 | |||
| 1876 | Ga0495604_0044724 | |||
| 1877 | Ga0495604_0087656 | |||
| 1878 | Ga0495674_0001617 | |||
| 1879 | Ga0495674_0017897 | |||
| 1880 | Ga0495674_0028350 | |||
| 1881 | Ga0495674_0030676 | |||
| 1882 | Ga0495674_0041159 | |||
| 1883 | Ga0495674_0062792 | |||
| 1884 | Ga0495674_0124967 | |||
| 1885 | Ga0495672_0005832 | |||
| 1886 | Ga0495672_0007599 | |||
| 1887 | Ga0495672_0009935 | |||
| 1888 | Ga0495672_0022711 | |||
| 1889 | Ga0495672_0024715 | |||
| 1890 | Ga0495676_0000001 | |||
| 1891 | Ga0495676_0005984 | |||
| 1892 | Ga0495676_0009461 | |||
| 1893 | Ga0495676_0011228 | |||
| 1894 | Ga0495676_0092840 | |||
| 1895 | Ga0495676_0124678 | |||
| 1896 | Ga0495680_0013614 | |||
| 1897 | Ga0495680_0020078 | |||
| 1898 | Ga0495680_0026471 | |||
| 1899 | Ga0495683_0000205 | |||
| 1900 | Ga0495683_0001491 | |||
| 1901 | Ga0495683_0001522 | |||
| 1902 | Ga0495683_0003598 | |||
| 1903 | Ga0495683_0007019 | |||
| 1904 | Ga0495683_0012593 | |||
| 1905 | Ga0495683_0023994 | |||
| 1906 | Ga0495687_000114 | |||
| 1907 | Ga0495687_006390 | |||
| 1908 | Ga0495687_008417 | |||
| 1909 | Ga0495687_010698 | |||
| 1910 | Ga0495687_021126 | |||
| 1911 | Ga0495687_030676 | |||
| 1912 | Ga0495675_0003823 | |||
| 1913 | Ga0495675_0014780 | |||
| 1914 | Ga0495675_0024869 | |||
| 1915 | Ga0495675_0059754 | |||
| 1916 | Ga0495679_000037 | |||
| 1917 | Ga0495679_000042 | |||
| 1918 | Ga0495679_000359 | |||
| 1919 | Ga0495679_000567 | |||
| 1920 | Ga0495679_002985 | |||
| 1921 | Ga0495679_005797 | |||
| 1922 | Ga0495673_0000339 | |||
| 1923 | Ga0495673_0000515 | |||
| 1924 | Ga0495673_0001849 | |||
| 1925 | Ga0495673_0002161 | |||
| 1926 | Ga0495673_0002390 | |||
| 1927 | Ga0495673_0003743 | |||
| 1928 | Ga0495673_0004483 | |||
| 1929 | Ga0495673_0012001 | |||
| 1930 | Ga0495673_0016260 | |||
| 1931 | Ga0495673_0023313 | |||
| 1932 | Ga0495673_0027625 | |||
| 1933 | Ga0495681_0000199 | |||
| 1934 | Ga0495681_0000830 | |||
| 1935 | Ga0495681_0003753 | |||
| 1936 | Ga0495681_0006982 | |||
| 1937 | Ga0495681_0013795 | |||
| 1938 | Ga0495681_0030355 | |||
| 1939 | Ga0495681_0033626 | |||
| 1940 | Ga0495681_0046547 | |||
| 1941 | Ga0495684_0032522 | |||
| 1942 | Ga0495684_0126274 | |||
| 1943 | Ga0495686_0003235 | |||
| 1944 | Ga0495686_0030264 | |||
| 1945 | Ga0495593_0000116 | |||
| 1946 | Ga0495593_0007727 | |||
| 1947 | Ga0495593_0009355 | |||
| 1948 | Ga0495593_0010827 | |||
| 1949 | Ga0495593_0012773 | |||
| 1950 | Ga0495593_0040443 | |||
| 1951 | Ga0495602_0001956 | |||
| 1952 | Ga0495602_0018348 | |||
| 1953 | Ga0495602_0034106 | |||
| 1954 | Ga0495602_0036957 | |||
| 1955 | Ga0495602_0040636 | |||
| 1956 | Ga0495602_0045345 | |||
| 1957 | Ga0495602_0103947 | |||
| 1958 | Ga0495614_0000437 | |||
| 1959 | Ga0495614_0000682 | |||
| 1960 | Ga0495614_0002976 | |||
| 1961 | Ga0495614_0004097 | |||
| 1962 | Ga0495614_0004315 | |||
| 1963 | Ga0495614_0013473 | |||
| 1964 | Ga0495626_0000002 | |||
| 1965 | Ga0495626_0000198 | |||
| 1966 | Ga0495626_0004471 | |||
| 1967 | Ga0495626_0019485 | |||
| 1968 | Ga0495626_0021413 | |||
| 1969 | Ga0496101_0089707 | |||
| 1970 | Ga0496102_0011231 | |||
| 1971 | Ga0496102_0033615 | |||
| 1972 | Ga0496102_0035404 | |||
| 1973 | Ga0496103_0016833 | |||
| 1974 | Ga0496104_0001117 | |||
| 1975 | Ga0496104_0273535 | |||
| 1976 | Ga0496106_0000001 | |||
| 1977 | Ga0496106_0001628 | |||
| 1978 | Ga0496108_0017729 | |||
| 1979 | Ga0496109_0015971 | |||
| 1980 | Ga0496110_0005787 | |||
| 1981 | Ga0496110_0032950 | |||
| 1982 | Ga0496111_0001230 | |||
| 1983 | Ga0496112_0003275 | |||
| 1984 | Ga0496112_0092146 | |||
| 1985 | Ga0496114_0103898 | |||
| 1986 | Ga0496114_0116276 | |||
| 1987 | Ga0496116_0000366 | |||
| 1988 | Ga0496116_0001043 | |||
| 1989 | Ga0496116_0003958 | |||
| 1990 | Ga0496116_0015870 | |||
| 1991 | Ga0496116_0037666 | |||
| 1992 | Ga0496116_0053613 | |||
| 1993 | Ga0496116_0100749 | |||
| 1994 | Ga0496116_0114342 | |||
| 1995 | Ga0496117_0000001 | |||
| 1996 | Ga0496117_0000708 | |||
| 1997 | Ga0496117_0005160 | |||
| 1998 | Ga0496117_0005298 | |||
| 1999 | Ga0496117_0007016 | |||
| 2000 | Ga0496117_0013706 | |||
| 2001 | Ga0496117_0026235 | |||
| 2002 | Ga0496117_0061521 | |||
| 2003 | Ga0496118_0000078 | |||
| 2004 | Ga0496118_0002492 | |||
| 2005 | Ga0496118_0002805 | |||
| 2006 | Ga0496118_0006693 | |||
| 2007 | Ga0496118_0011808 | |||
| 2008 | Ga0496118_0014479 | |||
| 2009 | Ga0496118_0016573 | |||
| 2010 | Ga0496118_0017447 | |||
| 2011 | Ga0496118_0029698 | |||
| 2012 | Ga0496118_0056965 | |||
| 2013 | Ga0496119_0071182 | |||
| 2014 | Ga0496120_0006258 | |||
| 2015 | Ga0496121_0000478 | |||
| 2016 | Ga0496121_0000540 | |||
| 2017 | Ga0496121_0000722 | |||
| 2018 | Ga0496121_0001087 | |||
| 2019 | Ga0496121_0001828 | |||
| 2020 | Ga0496121_0004165 | |||
| 2021 | Ga0496121_0004875 | |||
| 2022 | Ga0496121_0005928 | |||
| 2023 | Ga0496121_0006832 | |||
| 2024 | Ga0496121_0042866 | |||
| 2025 | Ga0496121_0052997 | |||
| 2026 | Ga0496121_0058817 | |||
| 2027 | Ga0496121_0065926 | |||
| 2028 | Ga0496121_0082536 | |||
| 2029 | Ga0496122_0000077 | |||
| 2030 | Ga0496122_0000411 | |||
| 2031 | Ga0496122_0001006 | |||
| 2032 | Ga0496122_0002310 | |||
| 2033 | Ga0496122_0005070 | |||
| 2034 | Ga0496122_0009347 | |||
| 2035 | Ga0496122_0043548 | |||
| 2036 | Ga0496122_0080646 | |||
| 2037 | Ga0496123_0000055 | |||
| 2038 | Ga0496123_0000526 | |||
| 2039 | Ga0496123_0000784 | |||
| 2040 | Ga0496123_0003334 | |||
| 2041 | Ga0496123_0005445 | |||
| 2042 | Ga0496123_0005565 | |||
| 2043 | Ga0496123_0030323 | |||
| 2044 | Ga0496123_0055059 | |||
| 2045 | Ga0496124_0000007 | |||
| 2046 | Ga0496124_0000423 | |||
| 2047 | Ga0496124_0002136 | |||
| 2048 | Ga0496124_0003253 | |||
| 2049 | Ga0496124_0010388 | |||
| 2050 | Ga0496124_0034915 | |||
| 2051 | Ga0496124_0040359 | |||
| 2052 | Ga0496124_0171849 | |||
| 2053 | Ga0496125_0000146 | |||
| 2054 | Ga0496125_0021807 | |||
| 2055 | Ga0496125_0023112 | |||
| 2056 | Ga0496125_0034996 | |||
| 2057 | Ga0496126_0000184 | |||
| 2058 | Ga0496126_0000225 | |||
| 2059 | Ga0496126_0000287 | |||
| 2060 | Ga0496126_0000376 | |||
| 2061 | Ga0496126_0004422 | |||
| 2062 | Ga0496126_0016966 | |||
| 2063 | Ga0496126_0092654 | |||
| 2064 | Ga0495678_000008 | |||
| 2065 | Ga0495678_004177 | |||
| 2066 | Ga0495678_007534 | |||
| 2067 | Ga0495678_007933 | |||
| 2068 | Ga0495678_018060 | |||
| 2069 | Ga0495682_0000025 | |||
| 2070 | Ga0501034_0215736 | |||
| 2071 | Ga0501227_003399 | |||
| 2072 | nmdc:mga0k408_8863_c1 | |||
| 2073 | nmdc:mga07m45_387_c1 | |||
| 2074 | nmdc:mga05p37_31596_c1 | |||
| 2075 | nmdc:mga0n895_12900_c1 | |||
| 2076 | nmdc:mga08x19_50560_c1 | |||
| 2077 | nmdc:mga0a205_79958_c1 | |||
| 2078 | Ga0500643_002053 | |||
| 2079 | Ga0500651_0000077 | |||
| 2080 | Ga0500566_0002377 | |||
| 2081 | Ga0500640_000066 | |||
| 2082 | Ga0500641_0002909 | |||
| 2083 | Ga0500641_0027272 | |||
| 2084 | Ga0500554_000079 | |||
| 2085 | Ga0500571_000078 | |||
| 2086 | Ga0500595_000118 | |||
| 2087 | Ga0500595_000168 | |||
| 2088 | Ga0500608_002587 | |||
| 2089 | Ga0500614_000453 | |||
| 2090 | Ga0500618_001477 | |||
| 2091 | Ga0500618_001527 | |||
| 2092 | Ga0500618_001646 | |||
| 2093 | Ga0500618_001713 | |||
| 2094 | Ga0500618_009876 | |||
| 2095 | Ga0500655_000598 | |||
| 2096 | Ga0500658_0002513 | |||
| 2097 | Ga0500559_0004355 | |||
| 2098 | Ga0500559_0015211 | |||
| 2099 | Ga0500564_019022 | |||
| 2100 | Ga0500568_0001417 | |||
| 2101 | Ga0500574_000208 | |||
| 2102 | Ga0500616_0003312 | |||
| 2103 | Ga0500616_0034162 | |||
| 2104 | Ga0500634_0009577 | |||
| 2105 | Ga0500638_038468 | |||
| 2106 | Ga0466962_0026364 | |||
| 2107 | 2501084694 | |||
| 2108 | 2509130155 | |||
| 2109 | 2510283311 | |||
| 2110 | 2510292860 | |||
| 2111 | 2510313331 | |||
| 2112 | 2511092444 | |||
| 2113 | 2511248733 | |||
| 2114 | 2511358458 | |||
| 2115 | 2513962385 | |||
| 2116 | 2515680571 | |||
| 2117 | 2519459472 | |||
| 2118 | 2519461653 | |||
| 2119 | 2527077600 | |||
| 2120 | 2553003343 | |||
| 2121 | 2555668454 | |||
| 2122 | 2555671389 | |||
| 2123 | 2585291059 | |||
| 2124 | 2585293282 | |||
| 2125 | 2596374808 | |||
| 2126 | 2599354454 | |||
| 2127 | 2599355451 | |||
| 2128 | 2599359832 | |||
| 2129 | 2599360710 | |||
| 2130 | 2599366154 | |||
| 2131 | 2599367032 | |||
| 2132 | 2599372944 | |||
| 2133 | 2599373822 | |||
| 2134 | 2599379562 | |||
| 2135 | 2599380557 | |||
| 2136 | 2599385460 | |||
| 2137 | 2599387004 | |||
| 2138 | 2599391803 | |||
| 2139 | 2599392680 | |||
| 2140 | 2599403569 | |||
| 2141 | 2599404447 | |||
| 2142 | 2599461288 | |||
| 2143 | 2599462285 | |||
| 2144 | 2599466656 | |||
| 2145 | 2599469832 | |||
| 2146 | 2599490308 | |||
| 2147 | 2599490623 | |||
| 2148 | 2599622604 | |||
| 2149 | 2599671083 | |||
| 2150 | 2599679880 | |||
| 2151 | 2599691896 | |||
| 2152 | 2599735132 | |||
| 2153 | 2599735906 | |||
| 2154 | 2599743261 | |||
| 2155 | 2599746642 | |||
| 2156 | 2600205507 | |||
| 2157 | 2600208548 | |||
| 2158 | 2600213904 | |||
| 2159 | 2600214907 | |||
| 2160 | 2601667420 | |||
| 2161 | 2601774070 | |||
| 2162 | 2601774388 | |||
| 2163 | 2643731139 | |||
| 2164 | 2643860339 | |||
| 2165 | 2643979438 | |||
| 2166 | 2644045355 | |||
| 2167 | 2644391868 | |||
| 2168 | 2671097035 | |||
| 2169 | 2671098071 | |||
| 2170 | 2676740804 | |||
| 2171 | 2676747095 | |||
| 2172 | 2723878751 | |||
| 2173 | 2738819093 | |||
| 2174 | 2738830751 | |||
| 2175 | 2738872277 | |||
| 2176 | 2738884605 | |||
| 2177 | 2739189844 | |||
| 2178 | 2739218878 | |||
| 2179 | 2739249328 | |||
| 2180 | 2739280529 | |||
| 2181 | 2746088275 | |||
| 2182 | 2746096830 | |||
| 2183 | 2753565756 | |||
| 2184 | 2765568204 | |||
| 2185 | 2765570822 | |||
| 2186 | 2774128919 | |||
| 2187 | 2808974108 | |||
| 2188 | 2808983577 | |||
| 2189 | 2809007620 | |||
| 2190 | 2809016047 | |||
| 2191 | 2809035709 | |||
| 2192 | 2809129241 | |||
| 2193 | 2809149704 | |||
| 2194 | 2812477548 | |||
| 2195 | 2817258528 | |||
| 2196 | 2817261754 | |||
| 2197 | 2817279438 | |||
| 2198 | 2817453222 | |||
| 2199 | 2817456806 | |||
| 2200 | 2819600054 | |||
| 2201 | 2819621768 | |||
| 2202 | 2819630047 | |||
| 2203 | 2819632040 | |||
| 2204 | 2819702129 | |||
| 2205 | 2819703138 | |||
| 2206 | 2831267068 | |||
| 2207 | 2838056153 | |||
| 2208 | 2839097491 | |||
| 2209 | 2839099472 | |||
| 2210 | 2842324989 | |||
| 2211 | 2842325822 | |||
| 2212 | 2842349268 | |||
| 2213 | 2842350101 | |||
| 2214 | 2842454703 | |||
| 2215 | 2842461808 | |||
| 2216 | 2852619858 | |||
| 2217 | 2855732490 | |||
| 2218 | 2855769198 | |||
| 2219 | 2856288778 | |||
| 2220 | 2857364493 | |||
| 2221 | 2857544462 | |||
| 2222 | 2857551858 | |||
| 2223 | 2857576548 | |||
| 2224 | 2858950788 | |||
| 2225 | 2863422431 | |||
| 2226 | 2870070536 | |||
| 2227 | 2870072656 | |||
| 2228 | 2881414923 | |||
| 2229 | 2884816293 | |||
| 2230 | 2884841280 | |||
| 2231 | 2884856155 | |||
| 2232 | 2885080708 | |||
| 2233 | 2885204908 | |||
| 2234 | 2885218405 | |||
| 2235 | 2896156920 | |||
| 2236 | 2899925999 | |||
| 2237 | 2900637713 | |||
| 2238 | 2902687696 | |||
| 2239 | 2904487512 | |||
| 2240 | 2904548565 | |||
| 2241 | 2904564929 | |||
| 2242 | 2904569105 | |||
| 2243 | 2904572375 | |||
| 2244 | 2904576587 | |||
| 2245 | 2904624707 | |||
| 2246 | 2917072222 | |||
| 2247 | 2917075255 | |||
| 2248 | 2917832948 | |||
| 2249 | 2919048853 | |||
| 2250 | 2919128644 | |||
| 2251 | 2919528818 | |||
| 2252 | 2923511458 | |||
| 2253 | 2928041605 | |||
| 2254 | 2928049169 | |||
| 2255 | 2928052223 | |||
| 2256 | 2928065106 | |||
| 2257 | 2928077515 | |||
| 2258 | 2928087449 | |||
| 2259 | 2928110943 | |||
| 2260 | 2928125518 | |||
| 2261 | 2928137499 | |||
| 2262 | 2928157134 | |||
| 2263 | 2928161470 | |||
| 2264 | 2928168298 | |||
| 2265 | 2928168968 | |||
| 2266 | 2928172209 | |||
| 2267 | 2928173985 | |||
| 2268 | 2928505794 | |||
| 2269 | 2928537701 | |||
| 2270 | 2928541765 | |||
| 2271 | 2929164767 | |||
| 2272 | 2932411032 | |||
| 2273 | 2932419401 | |||
| 2274 | 2935354391 | |||
| 2275 | 2935356243 | |||
| 2276 | 2941485608 | |||
| 2277 | 2945937776 | |||
| 2278 | 2974298960 | |||
| 2279 | 2981993412 | |||
| 2280 | 2981994983 | |||
| 2281 | 2984501268 | |||
| 2282 | 2984505271 | |||
| 2283 | 2990705507 | |||
| 2284 | 637318813 | |||
| 2285 | 637321711 | |||
| 2286 | 642424527 | |||
| 2287 | 642418197 | |||
| 2288 | 642420292 | |||
| 2289 | 642622604 | |||
| 2290 | 8018848360 | |||
| 2291 | 8018852075 | |||
| 2292 | 8020809190 | |||
| 2293 | 8020813062 | |||
| 2294 | 8020939747 | |||
| 2295 | 8020945754 | |||
| 2296 | 8020951609 | |||
| 2297 | 8021120480 | |||
| 2298 | 8021126236 | |||
| 2299 | 8039100734 | |||
| 2300 | 8039101299 | |||
| 2301 | 8040169142 | |||
| 2302 | 8040177687 | |||
| 2303 | 8040179434 | |||
| 2304 | 8055267065 | |||
| 2305 | 8055301621 | |||
| 2306 | 8056215472 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yr5-assembly1.cif.gz_A | embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state | 0.9066 | 17 | 423 |
| 7da5-assembly1.cif.gz_A | cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. | 0.903 | 18 | 423 |
| 6e9n-assembly2.cif.gz_B | e. coli d-galactonate:proton symporter in the inward open form | 0.9008 | 21 | 423 |
| 8dwi-assembly1.cif.gz_A | molecular mechanism of sialic acid transport mediated by sialin | 0.8929 | 18 | 426 |
| 6e9n-assembly2.cif.gz_B | e. coli d-galactonate:proton symporter in the inward open form | 0.8712 | 21 | 423 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53919_11_216_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9803 | 12 | 216 | 1.20.1250.20 |
| af_P76470_6_212_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9727 | 10 | 215 | 1.20.1250.20 |
| af_O53919_11_216_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9663 | 12 | 216 | 1.20.1250.20 |
| af_Q9US44_52_251_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9663 | 16 | 212 | 1.20.1250.20 |
| af_Q2FVB9_1_200_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9626 | 16 | 215 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3J5X4-F1-model_v4 | D-galactonate transporter | 0.99 | 4 | 435 |
GO:0016020
GO:0022857 |
| AF-A0A2A4F663-F1-model_v4 | MFS transporter | 0.9891 | 4 | 435 |
GO:0016020
GO:0022857 |
| AF-A0A2E7P3P9-F1-model_v4 | MFS transporter | 0.988 | 7 | 234 |
GO:0005886
GO:0022857 |
| AF-A0A3R9TA00-F1-model_v4 | MFS transporter | 0.9876 | 7 | 224 |
GO:0005886
GO:0022857 |
| AF-A0A3N8I5P9-F1-model_v4 | MFS transporter | 0.9861 | 22 | 425 |
GO:0016020
GO:0022857 |