F490885

General Info

Members Datasets Scaffolds Average Seq Length
1153 494 2306 437

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10000847|Ga0182008_1000084716
Length 480
Sequence MGISVVKLANGTAFQARRPARSPPLNSYDVLCYLSHVSKSDKNKITQIQETRMGKDMPESLSQTASAPVTASFEDLAYRKVAWRILPLLLLCYLVAYLDRVNVGFAKLQMSEDLQFSEAVYGLGAGIFFIAYFLVEIPSNLILHRVGARLWIARIMISWGLISSCMAFVSTPTSFYVMRFLLGIAEAGFYPGVILYLSYWFPSNRRGKMYALFATAVPLSGLIGAHHGFAGWQWMFFLEGLPSILVGGLVIYCLSDRIADAGWLTREQKTLLQSRIEAETDGHQVHSVRQVFGQPRIWLLTAIYFCMIAGFYTVGFWLPSLIRQAGVSDVFQVGMLTAIPYAAAALTMVLISRSADRLRERRWHLALTAVLGGVGLMISATWSDNFTVSMIGLTLGAMGAFSTLPLFWSLPTAFLGGTAAAAGIALINSWGNLAGFVSPYLMGFLKDLTQSTTIGMYVMASALFVGALLVFKIPGKLVNR

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
313 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
325 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
328 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
331 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
341 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
343 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
344 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
345 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
346 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
347 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
348 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
349 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
350 2511231021 Pseudomonas sp. GM78 Isolate Nodule
351 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
352 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
353 2519103095 Burkholderia sp. KJ006 Isolate Nodule
354 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
355 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
356 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
357 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
358 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
359 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
360 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
361 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
362 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
363 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
364 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
365 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
366 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
367 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
368 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
369 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
370 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
371 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
372 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
373 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
374 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
375 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
376 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
377 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
378 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
379 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
380 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
381 2643221569 Achromobacter sp. Root565 Isolate Unclassified
382 2643221594 Achromobacter sp. Root170 Isolate Unclassified
383 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
384 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
385 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
386 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
387 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
388 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
389 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
390 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
391 2738541307 Variovorax sp. GV008 Isolate Unclassified
392 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
393 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
394 2738543013 Variovorax sp. BT01 Isolate Unclassified
395 2738543019 Variovorax sp. GV040 Isolate Unclassified
396 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
397 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
398 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
399 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
400 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
401 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
402 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
403 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
404 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
405 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
406 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
407 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
408 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
409 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
410 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
411 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
412 2818991446 Variovorax sp. 1180 Isolate Unclassified
413 2818991450 Burkholderia sp. 604 Isolate Unclassified
414 2818991452 Burkholderia cepacia 561 Isolate Unclassified
415 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
416 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
417 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
418 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
419 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
420 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
421 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
422 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
423 2855730933 Achromobacter sp. HZ28 Isolate Nodule
424 2855767633 Achromobacter sp. HZ34 Isolate Nodule
425 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
426 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
427 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
428 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
429 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
430 2858950400 Achromobacter sp. K91 Isolate Unclassified
431 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
432 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
433 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
434 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
435 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
436 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
437 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
438 2885198086 Variovorax sp. 679 Isolate Unclassified
439 2885211737 Variovorax sp. 553 Isolate Unclassified
440 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
441 2899924645 Variovorax sp. 369 Isolate Unclassified
442 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
443 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
444 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
445 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
446 2904564687 Burkholderia sp. 571 Isolate Unclassified
447 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
448 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
449 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
450 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
451 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
452 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
453 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
454 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
455 2928037797 Variovorax sp. 1126 Isolate Unclassified
456 2928044640 Variovorax sp. 1128 Isolate Unclassified
457 2928051484 Variovorax sp. 1133 Isolate Unclassified
458 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
459 2928070936 Variovorax gossypii 1167 Isolate Unclassified
460 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
461 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
462 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
463 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
464 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
465 2928163908 Burkholderia sp. 567 Isolate Unclassified
466 2928170801 Burkholderia sp. 572 Isolate Unclassified
467 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
468 2928536128 Burkholderia sola 565 Isolate Unclassified
469 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
470 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
471 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
472 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
473 2941479691
474 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
475 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
476 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
477 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
478 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
479 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
480 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
481 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
482 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
483 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
484 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
485 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
486 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
487 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
488 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
489 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
490 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
491 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
492 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
493 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
494 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.57
Metatranscriptomes 0.09
Isolates 17.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 14.92
Nodule 1.99
Rhizoplane 5.29
Rhizosphere 62.62
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10000847 3300014497 Bacteria 21271
2 JGI24740J21852_10005825 3300001979 Bacteria 5172
3 JGI24735J21928_10000157 3300002067 Bacteria 23953
4 JGI24735J21928_10008037 3300002067 Bacteria 3425
5 JGI24735J21928_10014603 3300002067 Bacteria 2458
6 JGI24735J21928_10031205 3300002067 Bacteria 1580
7 JGI24738J21930_10002732 3300002075 Bacteria 4536
8 JGI25156J39149_1000161 3300002705 Bacteria 49302
9 JGI25156J39149_1000925 3300002705 Bacteria 14269
10 JGI25156J39149_1007675 3300002705 Bacteria 2802
11 JGI25162J39368_1000085 3300002737 Bacteria 107722
12 JGI25162J39368_1000251 3300002737 Bacteria 52332
13 JGI25163J39215_1000077 3300002771 Bacteria 43838
14 JGI25163J39215_1000590 3300002771 Bacteria 10192
15 JGI25164J39214_1000063 3300002772 Bacteria 107722
16 JGI25164J39214_1000194 3300002772 Bacteria 52332
17 JGI25152J39213_1001519 3300002773 Bacteria 9870
18 JGI25152J39213_1002390 3300002773 Bacteria 7185
19 JGI25150J39212_1000587 3300002774 Bacteria 14362
20 JGI25159J45721_1001477 3300002987 Bacteria 9696
21 JGI25159J45721_1004504 3300002987 Bacteria 4608
22 JGI25151J46595_10000159 3300003187 Bacteria 87280
23 JGI25151J46595_10002728 3300003187 Bacteria 10299
24 JGI25165J46597_1000160 3300003214 Bacteria 107722
25 JGI25165J46597_1000348 3300003214 Bacteria 52332
26 JGI25165J46597_1001388 3300003214 Bacteria 13281
27 JGI25153J46596_10002616 3300003215 Bacteria 10299
28 rootH1_10076874 3300003316 Bacteria 3067
29 rootH2_10004706 3300003320 Bacteria 7529
30 rootH2_10006723 3300003320 Bacteria 9356
31 rootL2_10111661 3300003322 Bacteria 5873
32 rootH1_10290880 3300003323 Bacteria 2390
33 JGI25160J50197_1002012 3300003354 Bacteria 9696
34 JGI25160J50197_1009144 3300003354 Bacteria 3703
35 JGI25161J50226_1000954 3300003374 Bacteria 10300
36 JGI25161J50226_1003092 3300003374 Bacteria 3968
37 Ga0055533_1000246 3300003756 Bacteria 33950
38 Ga0055532_1000012 3300003758 Bacteria 382698
39 Ga0055532_1000236 3300003758 Bacteria 40700
40 Ga0055532_1000645 3300003758 Bacteria 13457
41 Ga0055532_1000796 3300003758 Bacteria 10925
42 Ga0055532_1000950 3300003758 Bacteria 9310
43 Ga0055527_1000011 3300003760 Bacteria 354560
44 Ga0055527_1000421 3300003760 Bacteria 17392
45 Ga0055535_1000009 3300003761 Bacteria 382698
46 Ga0055535_1000267 3300003761 Bacteria 54799
47 Ga0055535_1000345 3300003761 Bacteria 46284
48 Ga0055542_1000009 3300003762 Bacteria 416550
49 Ga0055542_1000015 3300003762 Bacteria 382698
50 Ga0055542_1000175 3300003762 Bacteria 79760
51 Ga0055542_1001534 3300003762 Bacteria 11083
52 Ga0055529_1000011 3300003763 Bacteria 382698
53 Ga0055529_1000131 3300003763 Bacteria 105530
54 Ga0055526_1002126 3300003771 Bacteria 13599
55 Ga0055526_1003318 3300003771 Bacteria 10299
56 Ga0055537_1001028 3300003773 Bacteria 12602
57 Ga0055537_1004341 3300003773 Bacteria 4070
58 Ga0055524_1002180 3300003775 Bacteria 10299
59 Ga0055524_1004347 3300003775 Bacteria 6554
60 Ga0055536_1000283 3300003781 Bacteria 38490
61 Ga0055534_1000998 3300003784 Bacteria 12428
62 Ga0055534_1001306 3300003784 Bacteria 10073
63 Ga0055528_1001735 3300003790 Bacteria 12602
64 Ga0055528_1007335 3300003790 Bacteria 4890
65 Ga0055528_1009455 3300003790 Bacteria 4069
66 Ga0055530_10000442 3300003791 Bacteria 36800
67 Ga0055540_1001556 3300003792 Bacteria 13426
68 Ga0055540_1010976 3300003792 Bacteria 2968
69 Ga0055531_10000459 3300003794 Bacteria 37704
70 Ga0055531_10006647 3300003794 Bacteria 6496
71 Ga0055543_1003052 3300004625 Bacteria 5154
72 Ga0065165_1001684 3300005262 Bacteria 22325
73 Ga0065165_1007053 3300005262 Bacteria 5652
74 Ga0065703_1000120 3300005272 Bacteria 47864
75 Ga0065714_10064585 3300005288 Bacteria 31987
76 Ga0065715_10013607 3300005293 Bacteria 2048
77 Ga0070658_10015084 3300005327 Bacteria 6185
78 Ga0070658_10040983 3300005327 Bacteria 3736
79 Ga0070676_10031057 3300005328 Bacteria 3050
80 Ga0070683_100003572 3300005329 Bacteria 12654
81 Ga0070690_100056010 3300005330 Bacteria 2527
82 Ga0070670_100006156 3300005331 Bacteria 10143
83 Ga0070670_100088097 3300005331 Bacteria 2668
84 Ga0070666_10010909 3300005335 Bacteria 5693
85 Ga0070682_100169365 3300005337 Bacteria 1516
86 Ga0070660_100000106 3300005339 Bacteria 52000
87 Ga0070689_100006546 3300005340 Bacteria 8075
88 Ga0070661_100006676 3300005344 Bacteria 7959
89 Ga0070661_100090596 3300005344 Bacteria 2265
90 Ga0070669_100014584 3300005353 Bacteria 5593
91 Ga0070669_100075722 3300005353 Bacteria 2497
92 Ga0070675_100145053 3300005354 Bacteria 2032
93 Ga0070671_100023790 3300005355 Bacteria 5015
94 Ga0070659_100000064 3300005366 Bacteria 83862
95 Ga0070659_100096229 3300005366 Bacteria 2378
96 Ga0070667_100074211 3300005367 Bacteria 2901
97 Ga0070663_100000132 3300005455 Bacteria 35487
98 Ga0070663_100010082 3300005455 Bacteria 5877
99 Ga0070663_100075072 3300005455 Bacteria 2470
100 Ga0070662_100013507 3300005457 Bacteria 5434
101 Ga0070662_100048456 3300005457 Bacteria 3061
102 Ga0070685_10031644 3300005466 Bacteria 2958
103 Ga0070699_100109999 3300005518 Bacteria 2419
104 Ga0070684_100000373 3300005535 Bacteria 30982
105 Ga0068853_100041157 3300005539 Bacteria 3945
106 Ga0070672_100018944 3300005543 Bacteria 4987
107 Ga0070686_100003229 3300005544 Bacteria 8923
108 Ga0070696_100030534 3300005546 Bacteria 3690
109 Ga0070665_100055765 3300005548 Bacteria 3963
110 Ga0068855_100005080 3300005563 Bacteria 16040
111 Ga0068855_100162155 3300005563 Bacteria 2536
112 Ga0068855_100212178 3300005563 Bacteria 2175
113 Ga0068855_100306679 3300005563 Bacteria 1757
114 Ga0070664_100017268 3300005564 Bacteria 5927
115 Ga0070664_100254520 3300005564 Bacteria 1579
116 Ga0068857_100047784 3300005577 Bacteria 3800
117 Ga0068857_100048534 3300005577 Bacteria 3769
118 Ga0068852_100001073 3300005616 Bacteria 18055
119 Ga0068852_100022733 3300005616 Bacteria 5034
120 Ga0068864_100081612 3300005618 Bacteria 2835
121 Ga0068851_10012984 3300005834 Bacteria 3936
122 Ga0068858_100088099 3300005842 Bacteria 2888
123 Ga0075363_100057476 3300006048 Bacteria 2088
124 Ga0075432_10001694 3300006058 Bacteria 7262
125 Ga0075432_10008789 3300006058 Bacteria 3447
126 Ga0075367_10102702 3300006178 Bacteria 1749
127 Ga0075366_10008606 3300006195 Bacteria 5682
128 Ga0075370_10004522 3300006353 Bacteria 6769
129 Ga0075428_100041861 3300006844 Bacteria 5037
130 Ga0075428_100137161 3300006844 Bacteria 2660
131 Ga0075431_100050894 3300006847 Bacteria 4271
132 Ga0075433_10064876 3300006852 Bacteria 3202
133 Ga0075434_100003681 3300006871 Bacteria 13695
134 Ga0075434_100150535 3300006871 Bacteria 2347
135 Ga0075436_100027914 3300006914 Bacteria 3885
136 Ga0075436_100064354 3300006914 Bacteria 2535
137 Ga0079104_1000037 3300006946 Bacteria 189207
138 Ga0105251_10000001 3300009011 Bacteria 466643
139 Ga0105251_10000552 3300009011 Bacteria 35215
140 Ga0105251_10002824 3300009011 Bacteria 13136
141 Ga0105251_10003864 3300009011 Bacteria 10673
142 Ga0105244_10000979 3300009036 Bacteria 23974
143 Ga0105244_10009990 3300009036 Bacteria 5783
144 Ga0105244_10010769 3300009036 Bacteria 5525
145 Ga0105244_10022563 3300009036 Bacteria 3464
146 Ga0105244_10024821 3300009036 Bacteria 3266
147 Ga0105244_10025351 3300009036 Bacteria 3224
148 Ga0105244_10093347 3300009036 Bacteria 1478
149 Ga0105250_10004563 3300009092 Bacteria 6348
150 Ga0105250_10007581 3300009092 Bacteria 4652
151 Ga0105250_10011747 3300009092 Bacteria 3630
152 Ga0105250_10015738 3300009092 Bacteria 3095
153 Ga0105250_10067669 3300009092 Bacteria 1441
154 Ga0105240_10001449 3300009093 Bacteria 40535
155 Ga0105240_10002265 3300009093 Bacteria 31201
156 Ga0105240_10003616 3300009093 Bacteria 23943
157 Ga0105240_10007199 3300009093 Bacteria 16203
158 Ga0105240_10021483 3300009093 Bacteria 8583
159 Ga0105240_10067906 3300009093 Bacteria 4418
160 Ga0105240_10119574 3300009093 Bacteria 3173
161 Ga0111539_10029633 3300009094 Bacteria 6662
162 Ga0111539_10049801 3300009094 Bacteria 4992
163 Ga0111539_10166613 3300009094 Bacteria 2576
164 Ga0105247_10000502 3300009101 Bacteria 32176
165 Ga0114129_10080529 3300009147 Bacteria 4526
166 Ga0105243_10000163 3300009148 Bacteria 75904
167 Ga0105243_10000480 3300009148 Bacteria 40986
168 Ga0105243_10004544 3300009148 Bacteria 10962
169 Ga0105243_10007340 3300009148 Bacteria 8474
170 Ga0105248_10014853 3300009177 Bacteria 8577
171 Ga0105248_10097577 3300009177 Bacteria 3311
172 Ga0105248_10171808 3300009177 Bacteria 2443
173 Ga0105248_10196664 3300009177 Bacteria 2272
174 Ga0105237_10000882 3300009545 Bacteria 40534
175 Ga0105237_10004918 3300009545 Bacteria 15285
176 Ga0105237_10034532 3300009545 Bacteria 5120
177 Ga0105237_10077392 3300009545 Bacteria 3316
178 Ga0105237_10244875 3300009545 Bacteria 1794
179 Ga0105237_10263490 3300009545 Bacteria 1726
180 Ga0105238_10007420 3300009551 Bacteria 10984
181 Ga0105238_10038751 3300009551 Bacteria 4839
182 Ga0105238_10062179 3300009551 Bacteria 3734
183 Ga0105238_10190366 3300009551 Bacteria 2028
184 Ga0105238_10194313 3300009551 Bacteria 2005
185 Ga0105249_10014642 3300009553 Bacteria 6935
186 Ga0105239_10003438 3300010375 Bacteria 19385
187 Ga0105239_10006149 3300010375 Bacteria 13968
188 Ga0105239_10116348 3300010375 Bacteria 2967
189 Ga0105239_10295547 3300010375 Bacteria 1824
190 Ga0157373_10015863 3300013100 Bacteria 5499
191 Ga0157373_10033662 3300013100 Bacteria 3685
192 Ga0157373_10136962 3300013100 Bacteria 1722
193 Ga0157371_10000087 3300013102 Bacteria 146302
194 Ga0157371_10000788 3300013102 Bacteria 36497
195 Ga0157371_10003399 3300013102 Bacteria 14460
196 Ga0157371_10019544 3300013102 Bacteria 4992
197 Ga0157370_10068275 3300013104 Bacteria 3360
198 Ga0157369_10000267 3300013105 Bacteria 70715
199 Ga0157369_10000868 3300013105 Bacteria 38582
200 Ga0157369_10004250 3300013105 Bacteria 16959
201 Ga0157369_10008742 3300013105 Bacteria 11599
202 Ga0157369_10279560 3300013105 Bacteria 1739
203 Ga0157374_10000121 3300013296 Bacteria 70618
204 Ga0157372_10005676 3300013307 Bacteria 13274
205 Ga0157372_10006208 3300013307 Bacteria 12699
206 Ga0157372_10007809 3300013307 Bacteria 11363
207 Ga0163163_10042909 3300014325 Bacteria 4432
208 Ga0182008_10000481 3300014497 Bacteria 30439
209 Ga0182006_1000002 3300015261 Bacteria 887990
210 Ga0182007_10000045 3300015262 Bacteria 106028
211 Ga0182007_10000537 3300015262 Bacteria 22367
212 Ga0182007_10005198 3300015262 Bacteria 5751
213 Ga0182005_1000002 3300015265 Bacteria 908499
214 Ga0224712_10001994 3300022467 Bacteria 4942
215 Ga0209760_100039 3300025207 Bacteria 118977
216 Ga0209760_100064 3300025207 Bacteria 91180
217 Ga0209566_100089 3300025225 Bacteria 142951
218 Ga0209566_100145 3300025225 Bacteria 83624
219 Ga0209674_100013 3300025226 Bacteria 813140
220 Ga0209672_100010 3300025228 Bacteria 873151
221 Ga0209672_100015 3300025228 Bacteria 529352
222 Ga0209672_100031 3300025228 Bacteria 332889
223 Ga0209672_100370 3300025228 Bacteria 27678
224 Ga0209672_100432 3300025228 Bacteria 24158
225 Ga0209147_100006 3300025229 Bacteria 873276
226 Ga0209147_100016 3300025229 Bacteria 527606
227 Ga0209147_100034 3300025229 Bacteria 346646
228 Ga0209147_100040 3300025229 Bacteria 307612
229 Ga0209147_100150 3300025229 Bacteria 100971
230 Ga0209563_101172 3300025230 Bacteria 7363
231 Ga0207427_100001 3300025231 Bacteria 1410763
232 Ga0207427_100082 3300025231 Bacteria 142809
233 Ga0207427_100426 3300025231 Bacteria 23713
234 Ga0209437_100003 3300025233 Bacteria 1517827
235 Ga0209437_100006 3300025233 Bacteria 1042724
236 Ga0209258_100009 3300025242 Bacteria 996276
237 Ga0209258_100010 3300025242 Bacteria 873276
238 Ga0209258_100026 3300025242 Bacteria 527606
239 Ga0209258_100061 3300025242 Bacteria 313501
240 Ga0207425_1000240 3300025245 Bacteria 42664
241 Ga0207425_1002072 3300025245 Bacteria 7454
242 Ga0209148_1000007 3300025254 Bacteria 1592273
243 Ga0209148_1000018 3300025254 Bacteria 756247
244 Ga0209148_1000070 3300025254 Bacteria 332889
245 Ga0209148_1000510 3300025254 Bacteria 39093
246 Ga0209148_1001241 3300025254 Bacteria 14247
247 Ga0209759_1000235 3300025256 Bacteria 82953
248 Ga0209759_1000256 3300025256 Bacteria 78188
249 Ga0209759_1000297 3300025256 Bacteria 68515
250 Ga0209759_1003194 3300025256 Bacteria 6651
251 Ga0209759_1006343 3300025256 Bacteria 3989
252 Ga0209759_1015415 3300025256 Bacteria 1974
253 Ga0209129_1000013 3300025258 Bacteria 524874
254 Ga0209129_1002013 3300025258 Bacteria 10541
255 Ga0209233_1000007 3300025261 Bacteria 1411234
256 Ga0209233_1000105 3300025261 Bacteria 272035
257 Ga0209233_1000229 3300025261 Bacteria 100048
258 Ga0209565_1000289 3300025263 Bacteria 48879
259 Ga0209565_1000725 3300025263 Bacteria 19897
260 Ga0209455_1000015 3300025272 Bacteria 756128
261 Ga0209455_1000069 3300025272 Bacteria 308247
262 Ga0209455_1000580 3300025272 Bacteria 23806
263 Ga0209673_1000026 3300025273 Bacteria 373739
264 Ga0209673_1000188 3300025273 Bacteria 124010
265 Ga0209673_1000260 3300025273 Bacteria 99762
266 Ga0209130_1000249 3300025284 Bacteria 68232
267 Ga0209130_1000405 3300025284 Bacteria 47098
268 Ga0209675_1000086 3300025291 Bacteria 151270
269 Ga0209675_1000182 3300025291 Bacteria 70962
270 Ga0209675_1003379 3300025291 Bacteria 7612
271 Ga0209676_1000004 3300025292 Bacteria 1138360
272 Ga0209676_1004043 3300025292 Bacteria 8443
273 Ga0209676_1009820 3300025292 Bacteria 4071
274 Ga0209025_1000057 3300025294 Bacteria 314601
275 Ga0209025_1000220 3300025294 Bacteria 136977
276 Ga0209025_1000381 3300025294 Bacteria 92162
277 Ga0209025_1006990 3300025294 Bacteria 8565
278 Ga0209025_1016906 3300025294 Bacteria 4256
279 Ga0209564_1000214 3300025295 Bacteria 132937
280 Ga0209564_1000267 3300025295 Bacteria 109962
281 Ga0209564_1003899 3300025295 Bacteria 9578
282 Ga0209758_1000134 3300025297 Bacteria 178294
283 Ga0209758_1003687 3300025297 Bacteria 13617
284 Ga0209050_1000002 3300025298 Bacteria 1792849
285 Ga0209050_1003474 3300025298 Bacteria 11559
286 Ga0209050_1006910 3300025298 Bacteria 6564
287 Ga0209050_1027025 3300025298 Bacteria 1904
288 Ga0209256_1000060 3300025299 Bacteria 262342
289 Ga0209256_1000222 3300025299 Bacteria 105596
290 Ga0207426_1000095 3300025302 Bacteria 274234
291 Ga0207426_1000100 3300025302 Bacteria 262342
292 Ga0207426_1006475 3300025302 Bacteria 5087
293 Ga0209051_1000002 3300025303 Bacteria 1631846
294 Ga0209051_1001545 3300025303 Bacteria 19063
295 Ga0209051_1032961 3300025303 Bacteria 1967
296 Ga0209257_1000002 3300025304 Bacteria 1767052
297 Ga0209257_1000689 3300025304 Bacteria 52385
298 Ga0209257_1000996 3300025304 Bacteria 38379
299 Ga0209257_1019409 3300025304 Bacteria 2562
300 Ga0207656_10018671 3300025321 Bacteria 2733
301 Ga0207696_1001811 3300025711 Bacteria 11015
302 Ga0207696_1003569 3300025711 Bacteria 7024
303 Ga0207696_1017707 3300025711 Bacteria 2354
304 Ga0207655_1000822 3300025728 Bacteria 33630
305 Ga0207655_1001110 3300025728 Bacteria 26288
306 Ga0207655_1001712 3300025728 Bacteria 19282
307 Ga0207655_1012856 3300025728 Bacteria 4849
308 Ga0207713_1000929 3300025735 Bacteria 26289
309 Ga0207713_1001156 3300025735 Bacteria 22283
310 Ga0207713_1002800 3300025735 Bacteria 12310
311 Ga0207713_1019934 3300025735 Bacteria 3265
312 Ga0207710_10000009 3300025900 Bacteria 485205
313 Ga0207647_10000341 3300025904 Bacteria 37808
314 Ga0207647_10009687 3300025904 Bacteria 6836
315 Ga0207647_10010144 3300025904 Bacteria 6662
316 Ga0207647_10010476 3300025904 Bacteria 6548
317 Ga0207647_10042834 3300025904 Bacteria 2836
318 Ga0207647_10057077 3300025904 Bacteria 2394
319 Ga0207705_10014750 3300025909 Bacteria 5618
320 Ga0207654_10021218 3300025911 Bacteria 3451
321 Ga0207695_10001490 3300025913 Bacteria 39048
322 Ga0207695_10001811 3300025913 Bacteria 33658
323 Ga0207695_10003068 3300025913 Bacteria 23948
324 Ga0207695_10066620 3300025913 Bacteria 3697
325 Ga0207695_10076749 3300025913 Bacteria 3396
326 Ga0207695_10203453 3300025913 Bacteria 1893
327 Ga0207671_10005638 3300025914 Bacteria 11472
328 Ga0207671_10010984 3300025914 Bacteria 7416
329 Ga0207671_10054064 3300025914 Bacteria 2975
330 Ga0207657_10000097 3300025919 Bacteria 83815
331 Ga0207657_10000312 3300025919 Bacteria 51565
332 Ga0207657_10006989 3300025919 Bacteria 11620
333 Ga0207649_10014501 3300025920 Bacteria 4415
334 Ga0207694_10004425 3300025924 Bacteria 10984
335 Ga0207694_10026078 3300025924 Bacteria 4444
336 Ga0207694_10043942 3300025924 Bacteria 3449
337 Ga0207650_10008739 3300025925 Bacteria 6918
338 Ga0207650_10158312 3300025925 Bacteria 1792
339 Ga0207659_10116879 3300025926 Bacteria 2037
340 Ga0207690_10000079 3300025932 Bacteria 83880
341 Ga0207690_10000163 3300025932 Bacteria 52135
342 Ga0207706_10059136 3300025933 Bacteria 3375
343 Ga0207709_10000001 3300025935 Bacteria 2228154
344 Ga0207709_10000167 3300025935 Bacteria 88877
345 Ga0207709_10001419 3300025935 Bacteria 16783
346 Ga0207709_10073365 3300025935 Bacteria 2180
347 Ga0207670_10003726 3300025936 Bacteria 8090
348 Ga0207711_10005624 3300025941 Bacteria 10599
349 Ga0207661_10002583 3300025944 Bacteria 12457
350 Ga0207679_10026201 3300025945 Bacteria 4019
351 Ga0207667_10002715 3300025949 Bacteria 21883
352 Ga0207667_10010846 3300025949 Bacteria 10628
353 Ga0207703_10050092 3300026035 Bacteria 3379
354 Ga0207639_10005487 3300026041 Bacteria 8576
355 Ga0207639_10030024 3300026041 Bacteria 3984
356 Ga0207678_10001291 3300026067 Bacteria 23177
357 Ga0207678_10021082 3300026067 Bacteria 5712
358 Ga0207648_10047491 3300026089 Bacteria 3763
359 Ga0207674_10026486 3300026116 Bacteria 6155
360 Ga0207698_10024618 3300026142 Bacteria 4229
361 Ga0209281_1000002 3300027111 Bacteria 1924012
362 Ga0209371_1000751 3300027312 Bacteria 27079
363 Ga0209371_1013748 3300027312 Bacteria 2252
364 Ga0268266_10039868 3300028379 Bacteria 4002
365 Ga0268265_10116675 3300028380 Bacteria 2191
366 Ga0268256_1001017 3300030500 Bacteria 18893
367 Ga0268256_1004529 3300030500 Bacteria 5734
368 Ga0268256_1015710 3300030500 Bacteria 2197
369 Ga0307408_100001890 3300031548 Bacteria 15263
370 Ga0307405_10038866 3300031731 Bacteria 2872
371 Ga0307412_10000016 3300031911 Bacteria 312878
372 Ga0307412_10012724 3300031911 Bacteria 4909
373 Ga0307409_100176270 3300031995 Bacteria 1887
374 Ga0307416_100000420 3300032002 Bacteria 21577
375 Ga0307416_100029721 3300032002 Bacteria 4087
376 Ga0307510_10129755 3300033180 Bacteria 2198
377 Ga0395900_0001186 3300037418 Bacteria 32332
378 Ga0395900_0042424 3300037418 Bacteria 4689
379 Ga0395898_0148397 3300037466 Bacteria 2244
380 Ga0436364_0399617 3300037853 Bacteria 2968
381 Ga0395901_0000075 3300038443 Bacteria 138340
382 Ga0436365_0047346 3300039437 Bacteria 1675
383 Ga0436361_0293421 3300039447 Bacteria 7816
384 Ga0436363_0468856 3300039450 Bacteria 2796
385 Ga0436362_0635593 3300039453 Bacteria 7227
386 Ga0439438_010410 3300041405 Bacteria 2941
387 Ga0439466_0001368 3300041411 Bacteria 9477
388 Ga0439466_0016112 3300041411 Bacteria 2706
389 Ga0439448_0000619 3300042005 Bacteria 8366
390 Ga0439449_0011500 3300042007 Bacteria 3329
391 Ga0439451_002481 3300042009 Bacteria 3741
392 Ga0439452_000691 3300042010 Bacteria 16547
393 Ga0450903_002876 3300042138 Bacteria 3011
394 Ga0466969_0031897 3300044656 Bacteria 2681
395 Ga0466972_0048545 3300044658 Bacteria 2051
396 Ga0466966_0000318 3300044684 Bacteria 31193
397 Ga0466966_0000499 3300044684 Bacteria 25175
398 Ga0466966_0011173 3300044684 Bacteria 5955
399 Ga0466961_0015677 3300044693 Bacteria 4862
400 Ga0453684_0075339 3300044712 Bacteria 4242
401 Ga0466971_0010116 3300044719 Bacteria 4119
402 Ga0466971_0023201 3300044719 Bacteria 2765
403 Ga0466970_0003463 3300044765 Bacteria 7685
404 Ga0466957_0016398 3300044842 Bacteria 4334
405 Ga0466957_0030899 3300044842 Bacteria 3199
406 Ga0466959_0137787 3300045049 Bacteria 1726
407 Ga0466958_0001989 3300045836 Bacteria 10053
408 Ga0466958_0010339 3300045836 Bacteria 5226
409 Ga0466958_0038217 3300045836 Bacteria 2879
410 Ga0495617_000164 3300046452 Bacteria 42308
411 Ga0495617_002221 3300046452 Bacteria 7897
412 Ga0495617_007969 3300046452 Bacteria 3661
413 Ga0495627_004293 3300046453 Bacteria 5994
414 Ga0495627_006524 3300046453 Bacteria 4568
415 Ga0495627_012844 3300046453 Bacteria 2959
416 Ga0495592_0003749 3300046454 Bacteria 10964
417 Ga0495592_0020431 3300046454 Bacteria 5036
418 Ga0495592_0021064 3300046454 Bacteria 4957
419 Ga0495592_0022573 3300046454 Bacteria 4787
420 Ga0495592_0139494 3300046454 Bacteria 1688
421 Ga0495603_0001506 3300046455 Bacteria 13588
422 Ga0495603_0003463 3300046455 Bacteria 9389
423 Ga0495603_0007811 3300046455 Bacteria 6447
424 Ga0495603_0008106 3300046455 Bacteria 6346
425 Ga0495603_0019864 3300046455 Bacteria 4068
426 Ga0495590_0003820 3300046457 Bacteria 6130
427 Ga0495590_0006210 3300046457 Bacteria 4677
428 Ga0495590_0012046 3300046457 Bacteria 3219
429 Ga0495591_000053 3300046458 Bacteria 135500
430 Ga0495591_000054 3300046458 Bacteria 135364
431 Ga0495591_000143 3300046458 Bacteria 76321
432 Ga0495591_000172 3300046458 Bacteria 67392
433 Ga0495591_000559 3300046458 Bacteria 28604
434 Ga0495591_001695 3300046458 Bacteria 13164
435 Ga0495591_004785 3300046458 Bacteria 6473
436 Ga0495591_009817 3300046458 Bacteria 3769
437 Ga0495591_022131 3300046458 Bacteria 2060
438 Ga0495629_0000217 3300046459 Bacteria 51491
439 Ga0495629_0000376 3300046459 Bacteria 37310
440 Ga0495629_0000700 3300046459 Bacteria 27156
441 Ga0495629_0009044 3300046459 Bacteria 7304
442 Ga0495629_0010821 3300046459 Bacteria 6635
443 Ga0495629_0011591 3300046459 Bacteria 6401
444 Ga0495638_0000381 3300046460 Bacteria 55116
445 Ga0495638_0005027 3300046460 Bacteria 9924
446 Ga0495638_0006765 3300046460 Bacteria 8297
447 Ga0495638_0016389 3300046460 Bacteria 4965
448 Ga0495638_0040113 3300046460 Bacteria 2968
449 Ga0495641_0006000 3300046461 Bacteria 8004
450 Ga0495641_0017686 3300046461 Bacteria 3704
451 Ga0495651_0001907 3300046462 Bacteria 16140
452 Ga0495653_0000051 3300046463 Bacteria 106012
453 Ga0495653_0000403 3300046463 Bacteria 34677
454 Ga0495653_0000439 3300046463 Bacteria 32688
455 Ga0495653_0002819 3300046463 Bacteria 13871
456 Ga0495653_0037604 3300046463 Bacteria 3801
457 Ga0495653_0069700 3300046463 Bacteria 2633
458 Ga0495653_0081860 3300046463 Bacteria 2384
459 Ga0495650_0002322 3300046471 Bacteria 15747
460 Ga0495650_0002406 3300046471 Bacteria 15233
461 Ga0495650_0004787 3300046471 Bacteria 9089
462 Ga0495650_0016412 3300046471 Bacteria 3752
463 Ga0495650_0028866 3300046471 Bacteria 2536
464 Ga0495580_0000474 3300046472 Bacteria 33436
465 Ga0495580_0000869 3300046472 Bacteria 26086
466 Ga0495580_0000923 3300046472 Bacteria 25670
467 Ga0495580_0002854 3300046472 Bacteria 14871
468 Ga0495580_0008691 3300046472 Bacteria 8053
469 Ga0495580_0016408 3300046472 Bacteria 5557
470 Ga0495580_0019984 3300046472 Bacteria 4964
471 Ga0495580_0022241 3300046472 Bacteria 4668
472 Ga0495580_0023336 3300046472 Bacteria 4544
473 Ga0495580_0044059 3300046472 Bacteria 3174
474 Ga0495580_0047207 3300046472 Bacteria 3053
475 Ga0495580_0071939 3300046472 Bacteria 2415
476 Ga0495582_0000537 3300046473 Bacteria 20961
477 Ga0495582_0012293 3300046473 Bacteria 4715
478 Ga0495582_0047620 3300046473 Bacteria 2361
479 Ga0495605_0000080 3300046474 Bacteria 125370
480 Ga0495605_0003762 3300046474 Bacteria 9004
481 Ga0495605_0006370 3300046474 Bacteria 6798
482 Ga0495662_0006561 3300046476 Bacteria 5808
483 Ga0495662_0032745 3300046476 Bacteria 2511
484 Ga0495664_0000945 3300046477 Bacteria 14931
485 Ga0495664_0006513 3300046477 Bacteria 6454
486 Ga0495664_0007716 3300046477 Bacteria 5986
487 Ga0495664_0022377 3300046477 Unclassified 3663
488 Ga0495664_0064159 3300046477 Bacteria 2189
489 Ga0495584_0000018 3300046491 Bacteria 142382
490 Ga0495584_0000803 3300046491 Bacteria 20648
491 Ga0495584_0058809 3300046491 Bacteria 1933
492 Ga0495585_0005977 3300046492 Bacteria 7615
493 Ga0495585_0012873 3300046492 Bacteria 4917
494 Ga0495585_0074056 3300046492 Bacteria 1853
495 Ga0495585_0075146 3300046492 Bacteria 1837
496 Ga0495594_0003001 3300046499 Bacteria 8741
497 Ga0495596_0000050 3300046500 Bacteria 87493
498 Ga0495596_0013176 3300046500 Bacteria 3516
499 Ga0495596_0015892 3300046500 Bacteria 3136
500 Ga0495596_0021568 3300046500 Bacteria 2628
501 Ga0495596_0028410 3300046500 Bacteria 2245
502 Ga0495607_0000036 3300046501 Bacteria 140259
503 Ga0495607_0000333 3300046501 Bacteria 48937
504 Ga0495607_0002696 3300046501 Bacteria 14172
505 Ga0495607_0004370 3300046501 Bacteria 10415
506 Ga0495607_0005147 3300046501 Bacteria 9445
507 Ga0495607_0012932 3300046501 Bacteria 5488
508 Ga0495583_0000125 3300046506 Bacteria 129291
509 Ga0495583_0000169 3300046506 Bacteria 111114
510 Ga0495583_0000672 3300046506 Bacteria 44628
511 Ga0495583_0001076 3300046506 Bacteria 30467
512 Ga0495583_0001261 3300046506 Bacteria 26577
513 Ga0495583_0002360 3300046506 Bacteria 16304
514 Ga0495583_0003881 3300046506 Bacteria 11070
515 Ga0495583_0012611 3300046506 Bacteria 4769
516 Ga0495606_0000079 3300046507 Bacteria 164788
517 Ga0495606_0000170 3300046507 Bacteria 115276
518 Ga0495606_0000555 3300046507 Bacteria 59635
519 Ga0495606_0002882 3300046507 Bacteria 19013
520 Ga0495606_0004100 3300046507 Bacteria 14800
521 Ga0495606_0005455 3300046507 Bacteria 12177
522 Ga0495606_0052052 3300046507 Bacteria 2665
523 Ga0495610_0000203 3300046512 Bacteria 65990
524 Ga0495610_0003169 3300046512 Bacteria 13045
525 Ga0495610_0003639 3300046512 Bacteria 11868
526 Ga0495610_0015146 3300046512 Bacteria 4494
527 Ga0495610_0024940 3300046512 Bacteria 3219
528 Ga0495610_0065274 3300046512 Bacteria 1718
529 Ga0495616_0002871 3300046513 Bacteria 11244
530 Ga0495616_0012148 3300046513 Bacteria 4901
531 Ga0495616_0062316 3300046513 Bacteria 1826
532 Ga0495618_0001423 3300046514 Bacteria 16078
533 Ga0495618_0001820 3300046514 Bacteria 14063
534 Ga0495618_0109876 3300046514 Bacteria 1765
535 Ga0495620_0000592 3300046515 Bacteria 22694
536 Ga0495620_0001362 3300046515 Bacteria 14777
537 Ga0495620_0004675 3300046515 Bacteria 7692
538 Ga0495620_0032492 3300046515 Bacteria 2377
539 Ga0495628_0001457 3300046516 Bacteria 21697
540 Ga0495628_0008298 3300046516 Bacteria 8923
541 Ga0495628_0010142 3300046516 Bacteria 8010
542 Ga0495628_0011870 3300046516 Bacteria 7349
543 Ga0495628_0022375 3300046516 Bacteria 5192
544 Ga0495628_0045946 3300046516 Bacteria 3470
545 Ga0495628_0128087 3300046516 Bacteria 1943
546 Ga0495630_0002379 3300046517 Bacteria 13061
547 Ga0495630_0003360 3300046517 Bacteria 11137
548 Ga0495630_0047480 3300046517 Unclassified 3211
549 Ga0495630_0117012 3300046517 Bacteria 2020
550 Ga0495631_0001747 3300046518 Bacteria 12903
551 Ga0495631_0001748 3300046518 Bacteria 12901
552 Ga0495631_0019782 3300046518 Bacteria 3154
553 Ga0495631_0068636 3300046518 Bacteria 1533
554 Ga0495632_0004289 3300046519 Bacteria 9730
555 Ga0495632_0004844 3300046519 Bacteria 9039
556 Ga0495632_0013733 3300046519 Bacteria 4608
557 Ga0495637_0000062 3300046520 Bacteria 95064
558 Ga0495637_0000159 3300046520 Bacteria 51658
559 Ga0495637_0000818 3300046520 Bacteria 20550
560 Ga0495637_0002100 3300046520 Bacteria 11206
561 Ga0495637_0020317 3300046520 Bacteria 3057
562 Ga0495643_0004279 3300046522 Bacteria 10071
563 Ga0495643_0005482 3300046522 Bacteria 8578
564 Ga0495643_0008821 3300046522 Bacteria 6347
565 Ga0495643_0010885 3300046522 Bacteria 5572
566 Ga0495643_0029640 3300046522 Bacteria 3060
567 Ga0495644_0000031 3300046523 Bacteria 65825
568 Ga0495644_0000536 3300046523 Bacteria 16103
569 Ga0495644_0002089 3300046523 Bacteria 8046
570 Ga0495644_0003977 3300046523 Bacteria 5809
571 Ga0495648_0000590 3300046524 Bacteria 38832
572 Ga0495648_0002420 3300046524 Bacteria 17298
573 Ga0495648_0005906 3300046524 Bacteria 10072
574 Ga0495648_0008573 3300046524 Bacteria 8026
575 Ga0495648_0015281 3300046524 Bacteria 5582
576 Ga0495648_0039455 3300046524 Bacteria 3004
577 Ga0495648_0046310 3300046524 Bacteria 2696
578 Ga0495666_0000308 3300046526 Bacteria 21302
579 Ga0495666_0001041 3300046526 Bacteria 13146
580 Ga0495666_0002594 3300046526 Bacteria 8991
581 Ga0495666_0007836 3300046526 Bacteria 5349
582 Ga0495666_0008707 3300046526 Bacteria 5082
583 Ga0495666_0041322 3300046526 Bacteria 2233
584 Ga0495642_0008289 3300046528 Bacteria 3975
585 Ga0495652_0008919 3300046529 Bacteria 9125
586 Ga0495652_0032861 3300046529 Bacteria 4534
587 Ga0495652_0037532 3300046529 Bacteria 4202
588 Ga0495652_0049084 3300046529 Bacteria 3614
589 Ga0495652_0078268 3300046529 Bacteria 2737
590 Ga0495652_0224652 3300046529 Bacteria 1409
591 Ga0495654_0000589 3300046530 Bacteria 29018
592 Ga0495654_0002059 3300046530 Bacteria 13201
593 Ga0495654_0003395 3300046530 Bacteria 9791
594 Ga0495654_0007113 3300046530 Bacteria 6290
595 Ga0495654_0011991 3300046530 Bacteria 4672
596 Ga0495654_0016343 3300046530 Bacteria 3926
597 Ga0495654_0063280 3300046530 Bacteria 1771
598 Ga0495654_0090041 3300046530 Bacteria 1425
599 Ga0495665_0002208 3300046531 Bacteria 10545
600 Ga0495665_0012611 3300046531 Bacteria 4575
601 Ga0495665_0013039 3300046531 Bacteria 4500
602 Ga0495665_0016222 3300046531 Bacteria 4013
603 Ga0495665_0022768 3300046531 Bacteria 3365
604 Ga0495665_0061219 3300046531 Bacteria 1987
605 Ga0495665_0071811 3300046531 Bacteria 1822
606 Ga0495640_0006353 3300046533 Bacteria 9365
607 Ga0495640_0016436 3300046533 Bacteria 5534
608 Ga0495640_0021963 3300046533 Bacteria 4674
609 Ga0495586_0002467 3300046535 Bacteria 10034
610 Ga0495586_0002516 3300046535 Bacteria 9933
611 Ga0495586_0009309 3300046535 Bacteria 5224
612 Ga0495586_0022000 3300046535 Bacteria 3403
613 Ga0495586_0052016 3300046535 Bacteria 2217
614 Ga0495587_0006826 3300046536 Bacteria 7429
615 Ga0495587_0008189 3300046536 Bacteria 6736
616 Ga0495587_0009783 3300046536 Bacteria 6127
617 Ga0495609_0000016 3300046538 Bacteria 312882
618 Ga0495597_0005512 3300046542 Bacteria 6695
619 Ga0495597_0006350 3300046542 Bacteria 6122
620 Ga0495597_0018285 3300046542 Bacteria 3290
621 Ga0495645_0001920 3300046543 Bacteria 14119
622 Ga0495645_0004984 3300046543 Bacteria 9095
623 Ga0495645_0006484 3300046543 Bacteria 8122
624 Ga0495645_0025944 3300046543 Bacteria 4254
625 Ga0495645_0027825 3300046543 Bacteria 4107
626 Ga0495645_0121880 3300046543 Bacteria 1835
627 Ga0495622_0000039 3300046557 Bacteria 119003
628 Ga0495622_0000168 3300046557 Bacteria 54167
629 Ga0495622_0002828 3300046557 Bacteria 8285
630 Ga0495633_0021536 3300046558 Bacteria 3223
631 Ga0495667_0035281 3300046559 Bacteria 3343
632 Ga0495656_0008177 3300046615 Bacteria 3725
633 Ga0495668_0000424 3300046616 Bacteria 55046
634 Ga0495668_0006720 3300046616 Bacteria 7488
635 Ga0495668_0009648 3300046616 Bacteria 5906
636 Ga0495668_0059256 3300046616 Bacteria 2113
637 Ga0495668_0110359 3300046616 Bacteria 1504
638 Ga0495634_0000922 3300046642 Bacteria 27917
639 Ga0495634_0001516 3300046642 Bacteria 20519
640 Ga0495634_0003847 3300046642 Bacteria 11925
641 Ga0495634_0015351 3300046642 Bacteria 5505
642 Ga0495634_0031882 3300046642 Bacteria 3628
643 Ga0495611_0000725 3300046648 Bacteria 18522
644 Ga0495611_0006027 3300046648 Bacteria 5172
645 Ga0495611_0018475 3300046648 Bacteria 2990
646 Ga0495625_0000084 3300046660 Bacteria 151895
647 Ga0495625_0002559 3300046660 Bacteria 19540
648 Ga0495625_0015106 3300046660 Bacteria 6128
649 Ga0495625_0028528 3300046660 Bacteria 4185
650 Ga0495625_0040997 3300046660 Bacteria 3372
651 Ga0495625_0043128 3300046660 Bacteria 3273
652 Ga0495635_0002487 3300046663 Bacteria 12582
653 Ga0495635_0011122 3300046663 Bacteria 6309
654 Ga0495635_0013959 3300046663 Bacteria 5621
655 Ga0495635_0019252 3300046663 Bacteria 4760
656 Ga0495635_0021264 3300046663 Bacteria 4522
657 Ga0495635_0073658 3300046663 Bacteria 2339
658 Ga0495661_0000035 3300046665 Bacteria 165551
659 Ga0495661_0004743 3300046665 Bacteria 9766
660 Ga0495661_0005068 3300046665 Bacteria 9398
661 Ga0495661_0008843 3300046665 Bacteria 6943
662 Ga0495661_0009436 3300046665 Bacteria 6698
663 Ga0495661_0021769 3300046665 Bacteria 4174
664 Ga0495661_0042283 3300046665 Bacteria 2809
665 Ga0495588_0001274 3300046674 Bacteria 10806
666 Ga0495588_0013754 3300046674 Bacteria 3860
667 Ga0495588_0041847 3300046674 Bacteria 2341
668 Ga0495588_0053915 3300046674 Bacteria 2074
669 Ga0495657_0006190 3300046675 Bacteria 9383
670 Ga0495657_0106609 3300046675 Bacteria 1779
671 Ga0495599_0001622 3300046678 Bacteria 12970
672 Ga0495599_0008966 3300046678 Bacteria 6093
673 Ga0495623_0006235 3300046679 Bacteria 7757
674 Ga0495623_0007116 3300046679 Bacteria 7267
675 Ga0495623_0016840 3300046679 Bacteria 4721
676 Ga0495623_0019708 3300046679 Bacteria 4360
677 Ga0495623_0088675 3300046679 Bacteria 1903
678 Ga0495646_0000538 3300046680 Bacteria 20371
679 Ga0495646_0000563 3300046680 Bacteria 20116
680 Ga0495646_0000572 3300046680 Bacteria 19992
681 Ga0495646_0011658 3300046680 Bacteria 5586
682 Ga0495646_0039160 3300046680 Bacteria 2923
683 Ga0495646_0039570 3300046680 Bacteria 2906
684 Ga0495669_0002555 3300046684 Bacteria 7431
685 Ga0495613_0000752 3300046689 Bacteria 25413
686 Ga0495613_0002707 3300046689 Bacteria 13299
687 Ga0495613_0006979 3300046689 Bacteria 8418
688 Ga0495613_0030220 3300046689 Bacteria 4024
689 Ga0495624_0000334 3300046690 Bacteria 37310
690 Ga0495624_0002903 3300046690 Bacteria 12818
691 Ga0495624_0005242 3300046690 Bacteria 9361
692 Ga0495624_0006847 3300046690 Bacteria 8044
693 Ga0495624_0028873 3300046690 Bacteria 3620
694 Ga0495624_0045180 3300046690 Bacteria 2805
695 Ga0495624_0065952 3300046690 Bacteria 2260
696 Ga0495670_0015749 3300046691 Bacteria 3718
697 Ga0495671_0000141 3300046692 Bacteria 63480
698 Ga0495671_0009218 3300046692 Bacteria 5516
699 Ga0495671_0024349 3300046692 Bacteria 3153
700 Ga0495671_0024474 3300046692 Bacteria 3143
701 Ga0495649_0001294 3300046694 Bacteria 19126
702 Ga0495649_0027628 3300046694 Bacteria 3147
703 Ga0495649_0032235 3300046694 Bacteria 2887
704 Ga0495589_0002082 3300046794 Bacteria 11315
705 Ga0495589_0024401 3300046794 Bacteria 3073
706 Ga0495600_0006319 3300046809 Bacteria 7201
707 Ga0495600_0013396 3300046809 Bacteria 5152
708 Ga0495600_0058019 3300046809 Bacteria 2528
709 Ga0495660_0002843 3300046810 Bacteria 10877
710 Ga0495660_0003183 3300046810 Bacteria 10216
711 Ga0495660_0010687 3300046810 Bacteria 5334
712 Ga0495660_0020544 3300046810 Bacteria 3784
713 Ga0495581_0001548 3300047315 Bacteria 12837
714 Ga0495581_0007219 3300047315 Bacteria 6428
715 Ga0495581_0008128 3300047315 Bacteria 6076
716 Ga0495581_0019167 3300047315 Bacteria 3970
717 Ga0495604_0007058 3300047317 Bacteria 8911
718 Ga0495604_0007594 3300047317 Bacteria 8583
719 Ga0495604_0020628 3300047317 Bacteria 5262
720 Ga0495604_0024210 3300047317 Bacteria 4845
721 Ga0495604_0026065 3300047317 Bacteria 4655
722 Ga0495604_0042250 3300047317 Bacteria 3574
723 Ga0495604_0044724 3300047317 Bacteria 3457
724 Ga0495604_0087656 3300047317 Bacteria 2317
725 Ga0495674_0001617 3300047319 Bacteria 22087
726 Ga0495674_0017897 3300047319 Bacteria 6597
727 Ga0495674_0028350 3300047319 Bacteria 5106
728 Ga0495674_0030676 3300047319 Bacteria 4886
729 Ga0495674_0041159 3300047319 Bacteria 4129
730 Ga0495674_0062792 3300047319 Unclassified 3233
731 Ga0495674_0124967 3300047319 Bacteria 2171
732 Ga0495672_0005832 3300047320 Bacteria 9663
733 Ga0495672_0007599 3300047320 Bacteria 8132
734 Ga0495672_0009935 3300047320 Bacteria 6835
735 Ga0495672_0022711 3300047320 Bacteria 4072
736 Ga0495672_0024715 3300047320 Bacteria 3864
737 Ga0495676_0000001 3300047321 Bacteria 624167
738 Ga0495676_0005984 3300047321 Bacteria 11175
739 Ga0495676_0009461 3300047321 Bacteria 8875
740 Ga0495676_0011228 3300047321 Bacteria 8098
741 Ga0495676_0092840 3300047321 Bacteria 2252
742 Ga0495676_0124678 3300047321 Bacteria 1868
743 Ga0495680_0013614 3300047322 Bacteria 7085
744 Ga0495680_0020078 3300047322 Bacteria 5630
745 Ga0495680_0026471 3300047322 Bacteria 4779
746 Ga0495683_0000205 3300047323 Bacteria 56156
747 Ga0495683_0001491 3300047323 Bacteria 15259
748 Ga0495683_0001522 3300047323 Bacteria 15027
749 Ga0495683_0003598 3300047323 Bacteria 9007
750 Ga0495683_0007019 3300047323 Bacteria 6114
751 Ga0495683_0012593 3300047323 Bacteria 4441
752 Ga0495683_0023994 3300047323 Bacteria 3132
753 Ga0495687_000114 3300047443 Bacteria 123531
754 Ga0495687_006390 3300047443 Bacteria 7234
755 Ga0495687_008417 3300047443 Bacteria 5908
756 Ga0495687_010698 3300047443 Bacteria 5008
757 Ga0495687_021126 3300047443 Bacteria 3158
758 Ga0495687_030676 3300047443 Bacteria 2474
759 Ga0495675_0003823 3300047444 Bacteria 9119
760 Ga0495675_0014780 3300047444 Bacteria 4935
761 Ga0495675_0024869 3300047444 Bacteria 3819
762 Ga0495675_0059754 3300047444 Bacteria 2416
763 Ga0495679_000037 3300047446 Bacteria 158099
764 Ga0495679_000042 3300047446 Bacteria 143151
765 Ga0495679_000359 3300047446 Bacteria 35532
766 Ga0495679_000567 3300047446 Bacteria 25673
767 Ga0495679_002985 3300047446 Bacteria 8338
768 Ga0495679_005797 3300047446 Bacteria 5435
769 Ga0495673_0000339 3300047469 Bacteria 59974
770 Ga0495673_0000515 3300047469 Bacteria 40877
771 Ga0495673_0001849 3300047469 Bacteria 15890
772 Ga0495673_0002161 3300047469 Bacteria 14277
773 Ga0495673_0002390 3300047469 Bacteria 13262
774 Ga0495673_0003743 3300047469 Bacteria 9872
775 Ga0495673_0004483 3300047469 Bacteria 8719
776 Ga0495673_0012001 3300047469 Bacteria 4623
777 Ga0495673_0016260 3300047469 Bacteria 3808
778 Ga0495673_0023313 3300047469 Bacteria 3013
779 Ga0495673_0027625 3300047469 Bacteria 2697
780 Ga0495681_0000199 3300047470 Bacteria 50259
781 Ga0495681_0000830 3300047470 Bacteria 23824
782 Ga0495681_0003753 3300047470 Bacteria 10532
783 Ga0495681_0006982 3300047470 Bacteria 7310
784 Ga0495681_0013795 3300047470 Bacteria 4672
785 Ga0495681_0030355 3300047470 Bacteria 2753
786 Ga0495681_0033626 3300047470 Bacteria 2565
787 Ga0495681_0046547 3300047470 Bacteria 2067
788 Ga0495684_0032522 3300047471 Bacteria 4005
789 Ga0495684_0126274 3300047471 Bacteria 1924
790 Ga0495686_0003235 3300047472 Bacteria 14306
791 Ga0495686_0030264 3300047472 Bacteria 3516
792 Ga0495593_0000116 3300047673 Bacteria 38118
793 Ga0495593_0007727 3300047673 Bacteria 6271
794 Ga0495593_0009355 3300047673 Bacteria 5686
795 Ga0495593_0010827 3300047673 Bacteria 5259
796 Ga0495593_0012773 3300047673 Bacteria 4794
797 Ga0495593_0040443 3300047673 Bacteria 2510
798 Ga0495602_0001956 3300048088 Bacteria 20660
799 Ga0495602_0018348 3300048088 Bacteria 6992
800 Ga0495602_0034106 3300048088 Bacteria 4766
801 Ga0495602_0036957 3300048088 Bacteria 4538
802 Ga0495602_0040636 3300048088 Bacteria 4260
803 Ga0495602_0045345 3300048088 Bacteria 3979
804 Ga0495602_0103947 3300048088 Bacteria 2324
805 Ga0495614_0000437 3300048089 Bacteria 17115
806 Ga0495614_0000682 3300048089 Bacteria 14295
807 Ga0495614_0002976 3300048089 Bacteria 7547
808 Ga0495614_0004097 3300048089 Bacteria 6560
809 Ga0495614_0004315 3300048089 Bacteria 6405
810 Ga0495614_0013473 3300048089 Bacteria 3586
811 Ga0495626_0000002 3300048091 Bacteria 436012
812 Ga0495626_0000198 3300048091 Bacteria 72611
813 Ga0495626_0004471 3300048091 Bacteria 8572
814 Ga0495626_0019485 3300048091 Bacteria 3395
815 Ga0495626_0021413 3300048091 Bacteria 3208
816 Ga0496101_0089707 3300048904 Bacteria 2285
817 Ga0496102_0011231 3300048905 Bacteria 7716
818 Ga0496102_0033615 3300048905 Bacteria 4609
819 Ga0496102_0035404 3300048905 Bacteria 4494
820 Ga0496103_0016833 3300048906 Bacteria 4366
821 Ga0496104_0001117 3300048907 Bacteria 22960
822 Ga0496104_0273535 3300048907 Bacteria 1602
823 Ga0496106_0000001 3300048909 Bacteria 497458
824 Ga0496106_0001628 3300048909 Bacteria 16880
825 Ga0496108_0017729 3300048911 Bacteria 5823
826 Ga0496109_0015971 3300048912 Bacteria 6559
827 Ga0496110_0005787 3300048913 Bacteria 9717
828 Ga0496110_0032950 3300048913 Bacteria 4479
829 Ga0496111_0001230 3300048914 Bacteria 14311
830 Ga0496112_0003275 3300048915 Bacteria 13366
831 Ga0496112_0092146 3300048915 Bacteria 3000
832 Ga0496114_0103898 3300048917 Bacteria 2429
833 Ga0496114_0116276 3300048917 Bacteria 2296
834 Ga0496116_0000366 3300048919 Bacteria 69492
835 Ga0496116_0001043 3300048919 Bacteria 33784
836 Ga0496116_0003958 3300048919 Bacteria 14391
837 Ga0496116_0015870 3300048919 Bacteria 5928
838 Ga0496116_0037666 3300048919 Bacteria 3369
839 Ga0496116_0053613 3300048919 Bacteria 2662
840 Ga0496116_0100749 3300048919 Bacteria 1726
841 Ga0496116_0114342 3300048919 Bacteria 1577
842 Ga0496117_0000001 3300048920 Bacteria 2526244
843 Ga0496117_0000708 3300048920 Bacteria 52863
844 Ga0496117_0005160 3300048920 Bacteria 13937
845 Ga0496117_0005298 3300048920 Bacteria 13653
846 Ga0496117_0007016 3300048920 Bacteria 11161
847 Ga0496117_0013706 3300048920 Bacteria 7046
848 Ga0496117_0026235 3300048920 Bacteria 4563
849 Ga0496117_0061521 3300048920 Bacteria 2580
850 Ga0496118_0000078 3300048921 Bacteria 190946
851 Ga0496118_0002492 3300048921 Bacteria 24682
852 Ga0496118_0002805 3300048921 Bacteria 22819
853 Ga0496118_0006693 3300048921 Bacteria 12560
854 Ga0496118_0011808 3300048921 Bacteria 8479
855 Ga0496118_0014479 3300048921 Bacteria 7382
856 Ga0496118_0016573 3300048921 Bacteria 6756
857 Ga0496118_0017447 3300048921 Bacteria 6535
858 Ga0496118_0029698 3300048921 Bacteria 4580
859 Ga0496118_0056965 3300048921 Bacteria 2933
860 Ga0496119_0071182 3300048922 Bacteria 2037
861 Ga0496120_0006258 3300048923 Bacteria 9189
862 Ga0496121_0000478 3300048924 Bacteria 77761
863 Ga0496121_0000540 3300048924 Bacteria 72033
864 Ga0496121_0000722 3300048924 Bacteria 61133
865 Ga0496121_0001087 3300048924 Bacteria 48027
866 Ga0496121_0001828 3300048924 Bacteria 34313
867 Ga0496121_0004165 3300048924 Bacteria 19771
868 Ga0496121_0004875 3300048924 Bacteria 17620
869 Ga0496121_0005928 3300048924 Bacteria 15460
870 Ga0496121_0006832 3300048924 Bacteria 13959
871 Ga0496121_0042866 3300048924 Bacteria 3928
872 Ga0496121_0052997 3300048924 Bacteria 3401
873 Ga0496121_0058817 3300048924 Bacteria 3174
874 Ga0496121_0065926 3300048924 Bacteria 2943
875 Ga0496121_0082536 3300048924 Bacteria 2540
876 Ga0496122_0000077 3300048925 Bacteria 218099
877 Ga0496122_0000411 3300048925 Bacteria 90936
878 Ga0496122_0001006 3300048925 Bacteria 49938
879 Ga0496122_0002310 3300048925 Bacteria 27515
880 Ga0496122_0005070 3300048925 Bacteria 15911
881 Ga0496122_0009347 3300048925 Bacteria 10350
882 Ga0496122_0043548 3300048925 Bacteria 3515
883 Ga0496122_0080646 3300048925 Bacteria 2268
884 Ga0496123_0000055 3300048926 Bacteria 233626
885 Ga0496123_0000526 3300048926 Bacteria 65966
886 Ga0496123_0000784 3300048926 Bacteria 51269
887 Ga0496123_0003334 3300048926 Bacteria 18178
888 Ga0496123_0005445 3300048926 Bacteria 12818
889 Ga0496123_0005565 3300048926 Bacteria 12613
890 Ga0496123_0030323 3300048926 Bacteria 3961
891 Ga0496123_0055059 3300048926 Bacteria 2612
892 Ga0496124_0000007 3300048927 Bacteria 883534
893 Ga0496124_0000423 3300048927 Bacteria 75679
894 Ga0496124_0002136 3300048927 Bacteria 26565
895 Ga0496124_0003253 3300048927 Bacteria 20062
896 Ga0496124_0010388 3300048927 Bacteria 9433
897 Ga0496124_0034915 3300048927 Bacteria 4404
898 Ga0496124_0040359 3300048927 Bacteria 4038
899 Ga0496124_0171849 3300048927 Bacteria 1677
900 Ga0496125_0000146 3300048928 Bacteria 154919
901 Ga0496125_0021807 3300048928 Bacteria 5960
902 Ga0496125_0023112 3300048928 Bacteria 5750
903 Ga0496125_0034996 3300048928 Bacteria 4416
904 Ga0496126_0000184 3300048929 Bacteria 140502
905 Ga0496126_0000225 3300048929 Bacteria 122842
906 Ga0496126_0000287 3300048929 Bacteria 106718
907 Ga0496126_0000376 3300048929 Bacteria 92338
908 Ga0496126_0004422 3300048929 Bacteria 16821
909 Ga0496126_0016966 3300048929 Bacteria 7265
910 Ga0496126_0092654 3300048929 Bacteria 2654
911 Ga0495678_000008 3300049459 Bacteria 445926
912 Ga0495678_004177 3300049459 Bacteria 8510
913 Ga0495678_007534 3300049459 Bacteria 5624
914 Ga0495678_007933 3300049459 Bacteria 5440
915 Ga0495678_018060 3300049459 Bacteria 3180
916 Ga0495682_0000025 3300049460 Bacteria 147931
917 Ga0501034_0215736 3300049571 Bacteria 1873
918 Ga0501227_003399 3300049665 Bacteria 3449
919 nmdc:mga0k408_8863_c1 3300050493 Bacteria 5411
920 nmdc:mga07m45_387_c1 3300050496 Bacteria 18087
921 nmdc:mga05p37_31596_c1 3300050507 Bacteria 6468
922 nmdc:mga0n895_12900_c1 3300050512 Bacteria 7511
923 nmdc:mga08x19_50560_c1 3300050514 Bacteria 2667
924 nmdc:mga0a205_79958_c1 3300050515 Bacteria 3159
925 Ga0500643_002053 3300053087 Bacteria 10777
926 Ga0500651_0000077 3300053093 Bacteria 62750
927 Ga0500566_0002377 3300053094 Bacteria 11137
928 Ga0500640_000066 3300053095 Bacteria 17189
929 Ga0500641_0002909 3300053096 Bacteria 6074
930 Ga0500641_0027272 3300053096 Bacteria 2223
931 Ga0500554_000079 3300053102 Bacteria 17589
932 Ga0500571_000078 3300053110 Bacteria 30645
933 Ga0500595_000118 3300053119 Bacteria 52764
934 Ga0500595_000168 3300053119 Bacteria 43413
935 Ga0500608_002587 3300053122 Bacteria 6617
936 Ga0500614_000453 3300053123 Bacteria 10614
937 Ga0500618_001477 3300053125 Bacteria 10420
938 Ga0500618_001527 3300053125 Bacteria 10155
939 Ga0500618_001646 3300053125 Bacteria 9616
940 Ga0500618_001713 3300053125 Bacteria 9350
941 Ga0500618_009876 3300053125 Bacteria 2587
942 Ga0500655_000598 3300053133 Bacteria 7244
943 Ga0500658_0002513 3300053134 Bacteria 7101
944 Ga0500559_0004355 3300053136 Bacteria 6745
945 Ga0500559_0015211 3300053136 Bacteria 3249
946 Ga0500564_019022 3300053138 Bacteria 3137
947 Ga0500568_0001417 3300053139 Bacteria 15543
948 Ga0500574_000208 3300053141 Bacteria 6951
949 Ga0500616_0003312 3300053153 Bacteria 12413
950 Ga0500616_0034162 3300053153 Bacteria 2771
951 Ga0500634_0009577 3300053161 Bacteria 4913
952 Ga0500638_038468 3300053162 Bacteria 2322
953 Ga0466962_0026364 3300061719 Bacteria 2791
954 2501084694 2501025502 Bacteria 9641094
955 2509130155 2508501125 Bacteria 7208311
956 2510283311 2510065053 Bacteria 5005518
957 2510292860 2510065055 Bacteria 5037935
958 2510313331 2510065058 Bacteria 5005894
959 2511092444 2510917013 Bacteria 9951648
960 2511248733 2511231003 Bacteria 5606035
961 2511358458 2511231021 Bacteria 7302637
962 2513962385 2513237151 Bacteria 6309801
963 2515680571 2515154122 Bacteria 8609520
964 2519459472 2519103095 Bacteria 6629912
965 2519461653 2519103095 Bacteria 6629912
966 2527077600 2526164713 Bacteria 6780608
967 2553003343 2551306416 Bacteria 6152985
968 2555668454 2554235341 Bacteria 6867980
969 2555671389 2554235341 Bacteria 6867980
970 2585291059 2582581311 Bacteria 6763856
971 2585293282 2582581311 Bacteria 6763856
972 2596374808 2595698237 Bacteria 6712432
973 2599354454 2599185160 Bacteria 6844013
974 2599355451 2599185160 Bacteria 6844013
975 2599359832 2599185161 Bacteria 6960462
976 2599360710 2599185161 Bacteria 6960462
977 2599366154 2599185162 Bacteria 6957254
978 2599367032 2599185162 Bacteria 6957254
979 2599372944 2599185163 Bacteria 6995158
980 2599373822 2599185163 Bacteria 6995158
981 2599379562 2599185164 Bacteria 6841688
982 2599380557 2599185164 Bacteria 6841688
983 2599385460 2599185165 Bacteria 6843250
984 2599387004 2599185165 Bacteria 6843250
985 2599391803 2599185166 Bacteria 6959206
986 2599392680 2599185166 Bacteria 6959206
987 2599403569 2599185168 Bacteria 6997636
988 2599404447 2599185168 Bacteria 6997636
989 2599461288 2599185181 Bacteria 6844519
990 2599462285 2599185181 Bacteria 6844519
991 2599466656 2599185182 Bacteria 6883168
992 2599469832 2599185182 Bacteria 6883168
993 2599490308 2599185186 Bacteria 6831633
994 2599490623 2599185186 Bacteria 6831633
995 2599622604 2599185214 Bacteria 8209958
996 2599671083 2599185226 Bacteria 8233575
997 2599679880 2599185227 Bacteria 8246414
998 2599691896 2599185229 Bacteria 8216126
999 2599735132 2599185239 Bacteria 8686614
1000 2599735906 2599185239 Bacteria 8686614
1001 2599743261 2599185240 Bacteria 7968121
1002 2599746642 2599185240 Bacteria 7968121
1003 2600205507 2599185355 Bacteria 7968906
1004 2600208548 2599185355 Bacteria 7968906
1005 2600213904 2599185356 Bacteria 6843884
1006 2600214907 2599185356 Bacteria 6843884
1007 2601667420 2600255292 Bacteria 6300551
1008 2601774070 2600255313 Bacteria 6842543
1009 2601774388 2600255313 Bacteria 6842543
1010 2643731139 2643221541 Bacteria 5498788
1011 2643860339 2643221569 Bacteria 6064337
1012 2643979438 2643221594 Bacteria 5811388
1013 2644045355 2643221606 Bacteria 5588032
1014 2644391868 2643221671 Bacteria 5496681
1015 2671097035 2667528171 Bacteria 6900659
1016 2671098071 2667528171 Bacteria 6900659
1017 2676740804 2675903129 Bacteria 7964495
1018 2676747095 2675903129 Bacteria 7964495
1019 2723878751 2721755763 Bacteria 4464185
1020 2738819093 2738541296 Bacteria 7285013
1021 2738830751 2738541298 Bacteria 7286732
1022 2738872277 2738541306 Bacteria 7284992
1023 2738884605 2738541307 Bacteria 8606193
1024 2739189844 2738543002 Bacteria 7284546
1025 2739218878 2738543008 Bacteria 7282815
1026 2739249328 2738543013 Bacteria 5618633
1027 2739280529 2738543019 Bacteria 7459457
1028 2746088275 2744054900 Bacteria 8399525
1029 2746096830 2744054901 Bacteria 8397047
1030 2753565756 2751185846 Bacteria 7242164
1031 2765568204 2765235838 Bacteria 5445269
1032 2765570822 2765235838 Bacteria 5445269
1033 2774128919 2773857672 Bacteria 4993178
1034 2808974108 2808606384 Bacteria 8474373
1035 2808983577 2808606386 Bacteria 4471946
1036 2809007620 2808606390 Bacteria 8476311
1037 2809016047 2808606391 Bacteria 8308166
1038 2809035709 2808606395 Bacteria 6020352
1039 2809129241 2808606415 Bacteria 4576710
1040 2809149704 2808606419 Bacteria 4576925
1041 2812477548 2811994917 Bacteria 7761064
1042 2817258528 2816332253 Bacteria 6764532
1043 2817261754 2816332253 Bacteria 6764532
1044 2817279438 2816332256 Bacteria 6891714
1045 2817453222 2816332286 Bacteria 6853759
1046 2817456806 2816332286 Bacteria 6853759
1047 2819600054 2818991446 Bacteria 7757362
1048 2819621768 2818991450 Bacteria 6962147
1049 2819630047 2818991452 Bacteria 8442785
1050 2819632040 2818991452 Bacteria 8442785
1051 2819702129 2818991464 Bacteria 6907494
1052 2819703138 2818991464 Bacteria 6907494
1053 2831267068 2831265667 Bacteria 7184833
1054 2838056153 2838054893 Bacteria 7451788
1055 2839097491 2839094727 Bacteria 5534556
1056 2839099472 2839094727 Bacteria 5534556
1057 2842324989 2842324504 Bacteria 9364110
1058 2842325822 2842324504 Bacteria 9364110
1059 2842349268 2842348783 Bacteria 9002918
1060 2842350101 2842348783 Bacteria 9002918
1061 2842454703 2842454564 Bacteria 8730687
1062 2842461808 2842454564 Bacteria 8730687
1063 2852619858 2852618963 Bacteria 4577824
1064 2855732490 2855730933 Bacteria 7047938
1065 2855769198 2855767633 Bacteria 7049357
1066 2856288778 2856287931 Bacteria 7223934
1067 2857364493 2857357740 Bacteria 9937880
1068 2857544462 2857542790 Bacteria 5326616
1069 2857551858 2857547612 Bacteria 6179999
1070 2857576548 2857576091 Bacteria 5465855
1071 2858950788 2858950400 Bacteria 6783797
1072 2863422431 2863421361 Bacteria 7300805
1073 2870070536 2870068957 Bacteria 8925310
1074 2870072656 2870068957 Bacteria 8925310
1075 2881414923 2881412998 Bacteria 6492157
1076 2884816293 2884811622 Bacteria 5552861
1077 2884841280 2884836552 Bacteria 5219991
1078 2884856155 2884852848 Bacteria 5221161
1079 2885080708 2885080285 Bacteria 6355622
1080 2885204908 2885198086 Bacteria 7212419
1081 2885218405 2885211737 Bacteria 7212420
1082 2896156920 2896154374 Bacteria 5221518
1083 2899925999 2899924645 Bacteria 7487985
1084 2900637713 2900634093 Bacteria 10263517
1085 2902687696 2902682994 Bacteria 8951596
1086 2904487512 2904483920 Bacteria 7545285
1087 2904548565 2904541872 Bacteria 8915136
1088 2904564929 2904564687 Bacteria 7609577
1089 2904569105 2904564687 Bacteria 7609577
1090 2904572375 2904571731 Bacteria 7608790
1091 2904576587 2904571731 Bacteria 7608790
1092 2904624707 2904615490 Bacteria 10047340
1093 2917072222 2917070673 Bacteria 6868303
1094 2917075255 2917070673 Bacteria 6868303
1095 2917832948 2917832318 Bacteria 5346010
1096 2919048853 2919046199 Bacteria 5567169
1097 2919128644 2919125081 Bacteria 5385106
1098 2919528818 2919527303 Bacteria 7718827
1099 2923511458 2923510766 Bacteria 5926163
1100 2928041605 2928037797 Bacteria 7273642
1101 2928049169 2928044640 Bacteria 7271509
1102 2928052223 2928051484 Bacteria 7773759
1103 2928065106 2928064002 Bacteria 7419480
1104 2928077515 2928070936 Bacteria 8062541
1105 2928087449 2928084124 Bacteria 7159212
1106 2928110943 2928108538 Bacteria 7360024
1107 2928125518 2928125067 Bacteria 5937560
1108 2928137499 2928135762 Bacteria 7259641
1109 2928157134 2928157003 Bacteria 7522202
1110 2928161470 2928157003 Bacteria 7522202
1111 2928168298 2928163908 Bacteria 7561269
1112 2928168968 2928163908 Bacteria 7561269
1113 2928172209 2928170801 Bacteria 8785406
1114 2928173985 2928170801 Bacteria 8785406
1115 2928505794 2928503688 Bacteria 7268108
1116 2928537701 2928536128 Bacteria 7657547
1117 2928541765 2928536128 Bacteria 7657547
1118 2929164767 2929160207 Bacteria 9075316
1119 2932411032 2932410948 Bacteria 6312192
1120 2932419401 2932416698 Bacteria 6315112
1121 2935354391 2935353572 Unclassified 6955622
1122 2935356243 2935353572 Unclassified 6955622
1123 2941485608
1124 2945937776 2945934425 Bacteria 7444609
1125 2974298960 2974298342 Bacteria 4840922
1126 2981993412 2981990288 Bacteria 7590678
1127 2981994983 2981990288 Bacteria 7590678
1128 2984501268 2984499530 Bacteria 5020881
1129 2984505271 2984504281 Bacteria 5262371
1130 2990705507 2990703756 Bacteria 7715990
1131 637318813 637000220 Bacteria 7074893
1132 637321711 637000220 Bacteria 7074893
1133 642424527 641736151 Bacteria 7477263
1134 642418197 641736154 Bacteria 7689995
1135 642420292 641736154 Bacteria 7689995
1136 642622604 642555113 Bacteria 8214658
1137 8018848360 8018845410 Bacteria 8933938
1138 8018852075 8018845410 Bacteria 8933938
1139 8020809190 8020807995 Bacteria 6801506
1140 8020813062 8020807995 Bacteria 6801506
1141 8020939747 8020938398 Bacteria 7472757
1142 8020945754 8020945358 Bacteria 8467355
1143 8020951609 8020945358 Bacteria 8467355
1144 8021120480 8021120328 Bacteria 8782274
1145 8021126236 8021120328 Bacteria 8782274
1146 8039100734 8039098773 Bacteria 6602928
1147 8039101299 8039098773 Bacteria 6602928
1148 8040169142 8040167225 Bacteria 6542727
1149 8040177687 8040173305 Bacteria 6827067
1150 8040179434 8040173305 Bacteria 6827067
1151 8055267065 8055266321 Bacteria 7999742
1152 8055301621 8055301274 Bacteria 8587385
1153 8056215472 8056207758 Bacteria 8639239
1154 Ga0182008_10000847
1155 JGI24740J21852_10005825
1156 JGI24735J21928_10000157
1157 JGI24735J21928_10008037
1158 JGI24735J21928_10014603
1159 JGI24735J21928_10031205
1160 JGI24738J21930_10002732
1161 JGI25156J39149_1000161
1162 JGI25156J39149_1000925
1163 JGI25156J39149_1007675
1164 JGI25162J39368_1000085
1165 JGI25162J39368_1000251
1166 JGI25163J39215_1000077
1167 JGI25163J39215_1000590
1168 JGI25164J39214_1000063
1169 JGI25164J39214_1000194
1170 JGI25152J39213_1001519
1171 JGI25152J39213_1002390
1172 JGI25150J39212_1000587
1173 JGI25159J45721_1001477
1174 JGI25159J45721_1004504
1175 JGI25151J46595_10000159
1176 JGI25151J46595_10002728
1177 JGI25165J46597_1000160
1178 JGI25165J46597_1000348
1179 JGI25165J46597_1001388
1180 JGI25153J46596_10002616
1181 rootH1_10076874
1182 rootH2_10004706
1183 rootH2_10006723
1184 rootL2_10111661
1185 rootH1_10290880
1186 JGI25160J50197_1002012
1187 JGI25160J50197_1009144
1188 JGI25161J50226_1000954
1189 JGI25161J50226_1003092
1190 Ga0055533_1000246
1191 Ga0055532_1000012
1192 Ga0055532_1000236
1193 Ga0055532_1000645
1194 Ga0055532_1000796
1195 Ga0055532_1000950
1196 Ga0055527_1000011
1197 Ga0055527_1000421
1198 Ga0055535_1000009
1199 Ga0055535_1000267
1200 Ga0055535_1000345
1201 Ga0055542_1000009
1202 Ga0055542_1000015
1203 Ga0055542_1000175
1204 Ga0055542_1001534
1205 Ga0055529_1000011
1206 Ga0055529_1000131
1207 Ga0055526_1002126
1208 Ga0055526_1003318
1209 Ga0055537_1001028
1210 Ga0055537_1004341
1211 Ga0055524_1002180
1212 Ga0055524_1004347
1213 Ga0055536_1000283
1214 Ga0055534_1000998
1215 Ga0055534_1001306
1216 Ga0055528_1001735
1217 Ga0055528_1007335
1218 Ga0055528_1009455
1219 Ga0055530_10000442
1220 Ga0055540_1001556
1221 Ga0055540_1010976
1222 Ga0055531_10000459
1223 Ga0055531_10006647
1224 Ga0055543_1003052
1225 Ga0065165_1001684
1226 Ga0065165_1007053
1227 Ga0065703_1000120
1228 Ga0065714_10064585
1229 Ga0065715_10013607
1230 Ga0070658_10015084
1231 Ga0070658_10040983
1232 Ga0070676_10031057
1233 Ga0070683_100003572
1234 Ga0070690_100056010
1235 Ga0070670_100006156
1236 Ga0070670_100088097
1237 Ga0070666_10010909
1238 Ga0070682_100169365
1239 Ga0070660_100000106
1240 Ga0070689_100006546
1241 Ga0070661_100006676
1242 Ga0070661_100090596
1243 Ga0070669_100014584
1244 Ga0070669_100075722
1245 Ga0070675_100145053
1246 Ga0070671_100023790
1247 Ga0070659_100000064
1248 Ga0070659_100096229
1249 Ga0070667_100074211
1250 Ga0070663_100000132
1251 Ga0070663_100010082
1252 Ga0070663_100075072
1253 Ga0070662_100013507
1254 Ga0070662_100048456
1255 Ga0070685_10031644
1256 Ga0070699_100109999
1257 Ga0070684_100000373
1258 Ga0068853_100041157
1259 Ga0070672_100018944
1260 Ga0070686_100003229
1261 Ga0070696_100030534
1262 Ga0070665_100055765
1263 Ga0068855_100005080
1264 Ga0068855_100162155
1265 Ga0068855_100212178
1266 Ga0068855_100306679
1267 Ga0070664_100017268
1268 Ga0070664_100254520
1269 Ga0068857_100047784
1270 Ga0068857_100048534
1271 Ga0068852_100001073
1272 Ga0068852_100022733
1273 Ga0068864_100081612
1274 Ga0068851_10012984
1275 Ga0068858_100088099
1276 Ga0075363_100057476
1277 Ga0075432_10001694
1278 Ga0075432_10008789
1279 Ga0075367_10102702
1280 Ga0075366_10008606
1281 Ga0075370_10004522
1282 Ga0075428_100041861
1283 Ga0075428_100137161
1284 Ga0075431_100050894
1285 Ga0075433_10064876
1286 Ga0075434_100003681
1287 Ga0075434_100150535
1288 Ga0075436_100027914
1289 Ga0075436_100064354
1290 Ga0079104_1000037
1291 Ga0105251_10000001
1292 Ga0105251_10000552
1293 Ga0105251_10002824
1294 Ga0105251_10003864
1295 Ga0105244_10000979
1296 Ga0105244_10009990
1297 Ga0105244_10010769
1298 Ga0105244_10022563
1299 Ga0105244_10024821
1300 Ga0105244_10025351
1301 Ga0105244_10093347
1302 Ga0105250_10004563
1303 Ga0105250_10007581
1304 Ga0105250_10011747
1305 Ga0105250_10015738
1306 Ga0105250_10067669
1307 Ga0105240_10001449
1308 Ga0105240_10002265
1309 Ga0105240_10003616
1310 Ga0105240_10007199
1311 Ga0105240_10021483
1312 Ga0105240_10067906
1313 Ga0105240_10119574
1314 Ga0111539_10029633
1315 Ga0111539_10049801
1316 Ga0111539_10166613
1317 Ga0105247_10000502
1318 Ga0114129_10080529
1319 Ga0105243_10000163
1320 Ga0105243_10000480
1321 Ga0105243_10004544
1322 Ga0105243_10007340
1323 Ga0105248_10014853
1324 Ga0105248_10097577
1325 Ga0105248_10171808
1326 Ga0105248_10196664
1327 Ga0105237_10000882
1328 Ga0105237_10004918
1329 Ga0105237_10034532
1330 Ga0105237_10077392
1331 Ga0105237_10244875
1332 Ga0105237_10263490
1333 Ga0105238_10007420
1334 Ga0105238_10038751
1335 Ga0105238_10062179
1336 Ga0105238_10190366
1337 Ga0105238_10194313
1338 Ga0105249_10014642
1339 Ga0105239_10003438
1340 Ga0105239_10006149
1341 Ga0105239_10116348
1342 Ga0105239_10295547
1343 Ga0157373_10015863
1344 Ga0157373_10033662
1345 Ga0157373_10136962
1346 Ga0157371_10000087
1347 Ga0157371_10000788
1348 Ga0157371_10003399
1349 Ga0157371_10019544
1350 Ga0157370_10068275
1351 Ga0157369_10000267
1352 Ga0157369_10000868
1353 Ga0157369_10004250
1354 Ga0157369_10008742
1355 Ga0157369_10279560
1356 Ga0157374_10000121
1357 Ga0157372_10005676
1358 Ga0157372_10006208
1359 Ga0157372_10007809
1360 Ga0163163_10042909
1361 Ga0182008_10000481
1362 Ga0182006_1000002
1363 Ga0182007_10000045
1364 Ga0182007_10000537
1365 Ga0182007_10005198
1366 Ga0182005_1000002
1367 Ga0224712_10001994
1368 Ga0209760_100039
1369 Ga0209760_100064
1370 Ga0209566_100089
1371 Ga0209566_100145
1372 Ga0209674_100013
1373 Ga0209672_100010
1374 Ga0209672_100015
1375 Ga0209672_100031
1376 Ga0209672_100370
1377 Ga0209672_100432
1378 Ga0209147_100006
1379 Ga0209147_100016
1380 Ga0209147_100034
1381 Ga0209147_100040
1382 Ga0209147_100150
1383 Ga0209563_101172
1384 Ga0207427_100001
1385 Ga0207427_100082
1386 Ga0207427_100426
1387 Ga0209437_100003
1388 Ga0209437_100006
1389 Ga0209258_100009
1390 Ga0209258_100010
1391 Ga0209258_100026
1392 Ga0209258_100061
1393 Ga0207425_1000240
1394 Ga0207425_1002072
1395 Ga0209148_1000007
1396 Ga0209148_1000018
1397 Ga0209148_1000070
1398 Ga0209148_1000510
1399 Ga0209148_1001241
1400 Ga0209759_1000235
1401 Ga0209759_1000256
1402 Ga0209759_1000297
1403 Ga0209759_1003194
1404 Ga0209759_1006343
1405 Ga0209759_1015415
1406 Ga0209129_1000013
1407 Ga0209129_1002013
1408 Ga0209233_1000007
1409 Ga0209233_1000105
1410 Ga0209233_1000229
1411 Ga0209565_1000289
1412 Ga0209565_1000725
1413 Ga0209455_1000015
1414 Ga0209455_1000069
1415 Ga0209455_1000580
1416 Ga0209673_1000026
1417 Ga0209673_1000188
1418 Ga0209673_1000260
1419 Ga0209130_1000249
1420 Ga0209130_1000405
1421 Ga0209675_1000086
1422 Ga0209675_1000182
1423 Ga0209675_1003379
1424 Ga0209676_1000004
1425 Ga0209676_1004043
1426 Ga0209676_1009820
1427 Ga0209025_1000057
1428 Ga0209025_1000220
1429 Ga0209025_1000381
1430 Ga0209025_1006990
1431 Ga0209025_1016906
1432 Ga0209564_1000214
1433 Ga0209564_1000267
1434 Ga0209564_1003899
1435 Ga0209758_1000134
1436 Ga0209758_1003687
1437 Ga0209050_1000002
1438 Ga0209050_1003474
1439 Ga0209050_1006910
1440 Ga0209050_1027025
1441 Ga0209256_1000060
1442 Ga0209256_1000222
1443 Ga0207426_1000095
1444 Ga0207426_1000100
1445 Ga0207426_1006475
1446 Ga0209051_1000002
1447 Ga0209051_1001545
1448 Ga0209051_1032961
1449 Ga0209257_1000002
1450 Ga0209257_1000689
1451 Ga0209257_1000996
1452 Ga0209257_1019409
1453 Ga0207656_10018671
1454 Ga0207696_1001811
1455 Ga0207696_1003569
1456 Ga0207696_1017707
1457 Ga0207655_1000822
1458 Ga0207655_1001110
1459 Ga0207655_1001712
1460 Ga0207655_1012856
1461 Ga0207713_1000929
1462 Ga0207713_1001156
1463 Ga0207713_1002800
1464 Ga0207713_1019934
1465 Ga0207710_10000009
1466 Ga0207647_10000341
1467 Ga0207647_10009687
1468 Ga0207647_10010144
1469 Ga0207647_10010476
1470 Ga0207647_10042834
1471 Ga0207647_10057077
1472 Ga0207705_10014750
1473 Ga0207654_10021218
1474 Ga0207695_10001490
1475 Ga0207695_10001811
1476 Ga0207695_10003068
1477 Ga0207695_10066620
1478 Ga0207695_10076749
1479 Ga0207695_10203453
1480 Ga0207671_10005638
1481 Ga0207671_10010984
1482 Ga0207671_10054064
1483 Ga0207657_10000097
1484 Ga0207657_10000312
1485 Ga0207657_10006989
1486 Ga0207649_10014501
1487 Ga0207694_10004425
1488 Ga0207694_10026078
1489 Ga0207694_10043942
1490 Ga0207650_10008739
1491 Ga0207650_10158312
1492 Ga0207659_10116879
1493 Ga0207690_10000079
1494 Ga0207690_10000163
1495 Ga0207706_10059136
1496 Ga0207709_10000001
1497 Ga0207709_10000167
1498 Ga0207709_10001419
1499 Ga0207709_10073365
1500 Ga0207670_10003726
1501 Ga0207711_10005624
1502 Ga0207661_10002583
1503 Ga0207679_10026201
1504 Ga0207667_10002715
1505 Ga0207667_10010846
1506 Ga0207703_10050092
1507 Ga0207639_10005487
1508 Ga0207639_10030024
1509 Ga0207678_10001291
1510 Ga0207678_10021082
1511 Ga0207648_10047491
1512 Ga0207674_10026486
1513 Ga0207698_10024618
1514 Ga0209281_1000002
1515 Ga0209371_1000751
1516 Ga0209371_1013748
1517 Ga0268266_10039868
1518 Ga0268265_10116675
1519 Ga0268256_1001017
1520 Ga0268256_1004529
1521 Ga0268256_1015710
1522 Ga0307408_100001890
1523 Ga0307405_10038866
1524 Ga0307412_10000016
1525 Ga0307412_10012724
1526 Ga0307409_100176270
1527 Ga0307416_100000420
1528 Ga0307416_100029721
1529 Ga0307510_10129755
1530 Ga0395900_0001186
1531 Ga0395900_0042424
1532 Ga0395898_0148397
1533 Ga0436364_0399617
1534 Ga0395901_0000075
1535 Ga0436365_0047346
1536 Ga0436361_0293421
1537 Ga0436363_0468856
1538 Ga0436362_0635593
1539 Ga0439438_010410
1540 Ga0439466_0001368
1541 Ga0439466_0016112
1542 Ga0439448_0000619
1543 Ga0439449_0011500
1544 Ga0439451_002481
1545 Ga0439452_000691
1546 Ga0450903_002876
1547 Ga0466969_0031897
1548 Ga0466972_0048545
1549 Ga0466966_0000318
1550 Ga0466966_0000499
1551 Ga0466966_0011173
1552 Ga0466961_0015677
1553 Ga0453684_0075339
1554 Ga0466971_0010116
1555 Ga0466971_0023201
1556 Ga0466970_0003463
1557 Ga0466957_0016398
1558 Ga0466957_0030899
1559 Ga0466959_0137787
1560 Ga0466958_0001989
1561 Ga0466958_0010339
1562 Ga0466958_0038217
1563 Ga0495617_000164
1564 Ga0495617_002221
1565 Ga0495617_007969
1566 Ga0495627_004293
1567 Ga0495627_006524
1568 Ga0495627_012844
1569 Ga0495592_0003749
1570 Ga0495592_0020431
1571 Ga0495592_0021064
1572 Ga0495592_0022573
1573 Ga0495592_0139494
1574 Ga0495603_0001506
1575 Ga0495603_0003463
1576 Ga0495603_0007811
1577 Ga0495603_0008106
1578 Ga0495603_0019864
1579 Ga0495590_0003820
1580 Ga0495590_0006210
1581 Ga0495590_0012046
1582 Ga0495591_000053
1583 Ga0495591_000054
1584 Ga0495591_000143
1585 Ga0495591_000172
1586 Ga0495591_000559
1587 Ga0495591_001695
1588 Ga0495591_004785
1589 Ga0495591_009817
1590 Ga0495591_022131
1591 Ga0495629_0000217
1592 Ga0495629_0000376
1593 Ga0495629_0000700
1594 Ga0495629_0009044
1595 Ga0495629_0010821
1596 Ga0495629_0011591
1597 Ga0495638_0000381
1598 Ga0495638_0005027
1599 Ga0495638_0006765
1600 Ga0495638_0016389
1601 Ga0495638_0040113
1602 Ga0495641_0006000
1603 Ga0495641_0017686
1604 Ga0495651_0001907
1605 Ga0495653_0000051
1606 Ga0495653_0000403
1607 Ga0495653_0000439
1608 Ga0495653_0002819
1609 Ga0495653_0037604
1610 Ga0495653_0069700
1611 Ga0495653_0081860
1612 Ga0495650_0002322
1613 Ga0495650_0002406
1614 Ga0495650_0004787
1615 Ga0495650_0016412
1616 Ga0495650_0028866
1617 Ga0495580_0000474
1618 Ga0495580_0000869
1619 Ga0495580_0000923
1620 Ga0495580_0002854
1621 Ga0495580_0008691
1622 Ga0495580_0016408
1623 Ga0495580_0019984
1624 Ga0495580_0022241
1625 Ga0495580_0023336
1626 Ga0495580_0044059
1627 Ga0495580_0047207
1628 Ga0495580_0071939
1629 Ga0495582_0000537
1630 Ga0495582_0012293
1631 Ga0495582_0047620
1632 Ga0495605_0000080
1633 Ga0495605_0003762
1634 Ga0495605_0006370
1635 Ga0495662_0006561
1636 Ga0495662_0032745
1637 Ga0495664_0000945
1638 Ga0495664_0006513
1639 Ga0495664_0007716
1640 Ga0495664_0022377
1641 Ga0495664_0064159
1642 Ga0495584_0000018
1643 Ga0495584_0000803
1644 Ga0495584_0058809
1645 Ga0495585_0005977
1646 Ga0495585_0012873
1647 Ga0495585_0074056
1648 Ga0495585_0075146
1649 Ga0495594_0003001
1650 Ga0495596_0000050
1651 Ga0495596_0013176
1652 Ga0495596_0015892
1653 Ga0495596_0021568
1654 Ga0495596_0028410
1655 Ga0495607_0000036
1656 Ga0495607_0000333
1657 Ga0495607_0002696
1658 Ga0495607_0004370
1659 Ga0495607_0005147
1660 Ga0495607_0012932
1661 Ga0495583_0000125
1662 Ga0495583_0000169
1663 Ga0495583_0000672
1664 Ga0495583_0001076
1665 Ga0495583_0001261
1666 Ga0495583_0002360
1667 Ga0495583_0003881
1668 Ga0495583_0012611
1669 Ga0495606_0000079
1670 Ga0495606_0000170
1671 Ga0495606_0000555
1672 Ga0495606_0002882
1673 Ga0495606_0004100
1674 Ga0495606_0005455
1675 Ga0495606_0052052
1676 Ga0495610_0000203
1677 Ga0495610_0003169
1678 Ga0495610_0003639
1679 Ga0495610_0015146
1680 Ga0495610_0024940
1681 Ga0495610_0065274
1682 Ga0495616_0002871
1683 Ga0495616_0012148
1684 Ga0495616_0062316
1685 Ga0495618_0001423
1686 Ga0495618_0001820
1687 Ga0495618_0109876
1688 Ga0495620_0000592
1689 Ga0495620_0001362
1690 Ga0495620_0004675
1691 Ga0495620_0032492
1692 Ga0495628_0001457
1693 Ga0495628_0008298
1694 Ga0495628_0010142
1695 Ga0495628_0011870
1696 Ga0495628_0022375
1697 Ga0495628_0045946
1698 Ga0495628_0128087
1699 Ga0495630_0002379
1700 Ga0495630_0003360
1701 Ga0495630_0047480
1702 Ga0495630_0117012
1703 Ga0495631_0001747
1704 Ga0495631_0001748
1705 Ga0495631_0019782
1706 Ga0495631_0068636
1707 Ga0495632_0004289
1708 Ga0495632_0004844
1709 Ga0495632_0013733
1710 Ga0495637_0000062
1711 Ga0495637_0000159
1712 Ga0495637_0000818
1713 Ga0495637_0002100
1714 Ga0495637_0020317
1715 Ga0495643_0004279
1716 Ga0495643_0005482
1717 Ga0495643_0008821
1718 Ga0495643_0010885
1719 Ga0495643_0029640
1720 Ga0495644_0000031
1721 Ga0495644_0000536
1722 Ga0495644_0002089
1723 Ga0495644_0003977
1724 Ga0495648_0000590
1725 Ga0495648_0002420
1726 Ga0495648_0005906
1727 Ga0495648_0008573
1728 Ga0495648_0015281
1729 Ga0495648_0039455
1730 Ga0495648_0046310
1731 Ga0495666_0000308
1732 Ga0495666_0001041
1733 Ga0495666_0002594
1734 Ga0495666_0007836
1735 Ga0495666_0008707
1736 Ga0495666_0041322
1737 Ga0495642_0008289
1738 Ga0495652_0008919
1739 Ga0495652_0032861
1740 Ga0495652_0037532
1741 Ga0495652_0049084
1742 Ga0495652_0078268
1743 Ga0495652_0224652
1744 Ga0495654_0000589
1745 Ga0495654_0002059
1746 Ga0495654_0003395
1747 Ga0495654_0007113
1748 Ga0495654_0011991
1749 Ga0495654_0016343
1750 Ga0495654_0063280
1751 Ga0495654_0090041
1752 Ga0495665_0002208
1753 Ga0495665_0012611
1754 Ga0495665_0013039
1755 Ga0495665_0016222
1756 Ga0495665_0022768
1757 Ga0495665_0061219
1758 Ga0495665_0071811
1759 Ga0495640_0006353
1760 Ga0495640_0016436
1761 Ga0495640_0021963
1762 Ga0495586_0002467
1763 Ga0495586_0002516
1764 Ga0495586_0009309
1765 Ga0495586_0022000
1766 Ga0495586_0052016
1767 Ga0495587_0006826
1768 Ga0495587_0008189
1769 Ga0495587_0009783
1770 Ga0495609_0000016
1771 Ga0495597_0005512
1772 Ga0495597_0006350
1773 Ga0495597_0018285
1774 Ga0495645_0001920
1775 Ga0495645_0004984
1776 Ga0495645_0006484
1777 Ga0495645_0025944
1778 Ga0495645_0027825
1779 Ga0495645_0121880
1780 Ga0495622_0000039
1781 Ga0495622_0000168
1782 Ga0495622_0002828
1783 Ga0495633_0021536
1784 Ga0495667_0035281
1785 Ga0495656_0008177
1786 Ga0495668_0000424
1787 Ga0495668_0006720
1788 Ga0495668_0009648
1789 Ga0495668_0059256
1790 Ga0495668_0110359
1791 Ga0495634_0000922
1792 Ga0495634_0001516
1793 Ga0495634_0003847
1794 Ga0495634_0015351
1795 Ga0495634_0031882
1796 Ga0495611_0000725
1797 Ga0495611_0006027
1798 Ga0495611_0018475
1799 Ga0495625_0000084
1800 Ga0495625_0002559
1801 Ga0495625_0015106
1802 Ga0495625_0028528
1803 Ga0495625_0040997
1804 Ga0495625_0043128
1805 Ga0495635_0002487
1806 Ga0495635_0011122
1807 Ga0495635_0013959
1808 Ga0495635_0019252
1809 Ga0495635_0021264
1810 Ga0495635_0073658
1811 Ga0495661_0000035
1812 Ga0495661_0004743
1813 Ga0495661_0005068
1814 Ga0495661_0008843
1815 Ga0495661_0009436
1816 Ga0495661_0021769
1817 Ga0495661_0042283
1818 Ga0495588_0001274
1819 Ga0495588_0013754
1820 Ga0495588_0041847
1821 Ga0495588_0053915
1822 Ga0495657_0006190
1823 Ga0495657_0106609
1824 Ga0495599_0001622
1825 Ga0495599_0008966
1826 Ga0495623_0006235
1827 Ga0495623_0007116
1828 Ga0495623_0016840
1829 Ga0495623_0019708
1830 Ga0495623_0088675
1831 Ga0495646_0000538
1832 Ga0495646_0000563
1833 Ga0495646_0000572
1834 Ga0495646_0011658
1835 Ga0495646_0039160
1836 Ga0495646_0039570
1837 Ga0495669_0002555
1838 Ga0495613_0000752
1839 Ga0495613_0002707
1840 Ga0495613_0006979
1841 Ga0495613_0030220
1842 Ga0495624_0000334
1843 Ga0495624_0002903
1844 Ga0495624_0005242
1845 Ga0495624_0006847
1846 Ga0495624_0028873
1847 Ga0495624_0045180
1848 Ga0495624_0065952
1849 Ga0495670_0015749
1850 Ga0495671_0000141
1851 Ga0495671_0009218
1852 Ga0495671_0024349
1853 Ga0495671_0024474
1854 Ga0495649_0001294
1855 Ga0495649_0027628
1856 Ga0495649_0032235
1857 Ga0495589_0002082
1858 Ga0495589_0024401
1859 Ga0495600_0006319
1860 Ga0495600_0013396
1861 Ga0495600_0058019
1862 Ga0495660_0002843
1863 Ga0495660_0003183
1864 Ga0495660_0010687
1865 Ga0495660_0020544
1866 Ga0495581_0001548
1867 Ga0495581_0007219
1868 Ga0495581_0008128
1869 Ga0495581_0019167
1870 Ga0495604_0007058
1871 Ga0495604_0007594
1872 Ga0495604_0020628
1873 Ga0495604_0024210
1874 Ga0495604_0026065
1875 Ga0495604_0042250
1876 Ga0495604_0044724
1877 Ga0495604_0087656
1878 Ga0495674_0001617
1879 Ga0495674_0017897
1880 Ga0495674_0028350
1881 Ga0495674_0030676
1882 Ga0495674_0041159
1883 Ga0495674_0062792
1884 Ga0495674_0124967
1885 Ga0495672_0005832
1886 Ga0495672_0007599
1887 Ga0495672_0009935
1888 Ga0495672_0022711
1889 Ga0495672_0024715
1890 Ga0495676_0000001
1891 Ga0495676_0005984
1892 Ga0495676_0009461
1893 Ga0495676_0011228
1894 Ga0495676_0092840
1895 Ga0495676_0124678
1896 Ga0495680_0013614
1897 Ga0495680_0020078
1898 Ga0495680_0026471
1899 Ga0495683_0000205
1900 Ga0495683_0001491
1901 Ga0495683_0001522
1902 Ga0495683_0003598
1903 Ga0495683_0007019
1904 Ga0495683_0012593
1905 Ga0495683_0023994
1906 Ga0495687_000114
1907 Ga0495687_006390
1908 Ga0495687_008417
1909 Ga0495687_010698
1910 Ga0495687_021126
1911 Ga0495687_030676
1912 Ga0495675_0003823
1913 Ga0495675_0014780
1914 Ga0495675_0024869
1915 Ga0495675_0059754
1916 Ga0495679_000037
1917 Ga0495679_000042
1918 Ga0495679_000359
1919 Ga0495679_000567
1920 Ga0495679_002985
1921 Ga0495679_005797
1922 Ga0495673_0000339
1923 Ga0495673_0000515
1924 Ga0495673_0001849
1925 Ga0495673_0002161
1926 Ga0495673_0002390
1927 Ga0495673_0003743
1928 Ga0495673_0004483
1929 Ga0495673_0012001
1930 Ga0495673_0016260
1931 Ga0495673_0023313
1932 Ga0495673_0027625
1933 Ga0495681_0000199
1934 Ga0495681_0000830
1935 Ga0495681_0003753
1936 Ga0495681_0006982
1937 Ga0495681_0013795
1938 Ga0495681_0030355
1939 Ga0495681_0033626
1940 Ga0495681_0046547
1941 Ga0495684_0032522
1942 Ga0495684_0126274
1943 Ga0495686_0003235
1944 Ga0495686_0030264
1945 Ga0495593_0000116
1946 Ga0495593_0007727
1947 Ga0495593_0009355
1948 Ga0495593_0010827
1949 Ga0495593_0012773
1950 Ga0495593_0040443
1951 Ga0495602_0001956
1952 Ga0495602_0018348
1953 Ga0495602_0034106
1954 Ga0495602_0036957
1955 Ga0495602_0040636
1956 Ga0495602_0045345
1957 Ga0495602_0103947
1958 Ga0495614_0000437
1959 Ga0495614_0000682
1960 Ga0495614_0002976
1961 Ga0495614_0004097
1962 Ga0495614_0004315
1963 Ga0495614_0013473
1964 Ga0495626_0000002
1965 Ga0495626_0000198
1966 Ga0495626_0004471
1967 Ga0495626_0019485
1968 Ga0495626_0021413
1969 Ga0496101_0089707
1970 Ga0496102_0011231
1971 Ga0496102_0033615
1972 Ga0496102_0035404
1973 Ga0496103_0016833
1974 Ga0496104_0001117
1975 Ga0496104_0273535
1976 Ga0496106_0000001
1977 Ga0496106_0001628
1978 Ga0496108_0017729
1979 Ga0496109_0015971
1980 Ga0496110_0005787
1981 Ga0496110_0032950
1982 Ga0496111_0001230
1983 Ga0496112_0003275
1984 Ga0496112_0092146
1985 Ga0496114_0103898
1986 Ga0496114_0116276
1987 Ga0496116_0000366
1988 Ga0496116_0001043
1989 Ga0496116_0003958
1990 Ga0496116_0015870
1991 Ga0496116_0037666
1992 Ga0496116_0053613
1993 Ga0496116_0100749
1994 Ga0496116_0114342
1995 Ga0496117_0000001
1996 Ga0496117_0000708
1997 Ga0496117_0005160
1998 Ga0496117_0005298
1999 Ga0496117_0007016
2000 Ga0496117_0013706
2001 Ga0496117_0026235
2002 Ga0496117_0061521
2003 Ga0496118_0000078
2004 Ga0496118_0002492
2005 Ga0496118_0002805
2006 Ga0496118_0006693
2007 Ga0496118_0011808
2008 Ga0496118_0014479
2009 Ga0496118_0016573
2010 Ga0496118_0017447
2011 Ga0496118_0029698
2012 Ga0496118_0056965
2013 Ga0496119_0071182
2014 Ga0496120_0006258
2015 Ga0496121_0000478
2016 Ga0496121_0000540
2017 Ga0496121_0000722
2018 Ga0496121_0001087
2019 Ga0496121_0001828
2020 Ga0496121_0004165
2021 Ga0496121_0004875
2022 Ga0496121_0005928
2023 Ga0496121_0006832
2024 Ga0496121_0042866
2025 Ga0496121_0052997
2026 Ga0496121_0058817
2027 Ga0496121_0065926
2028 Ga0496121_0082536
2029 Ga0496122_0000077
2030 Ga0496122_0000411
2031 Ga0496122_0001006
2032 Ga0496122_0002310
2033 Ga0496122_0005070
2034 Ga0496122_0009347
2035 Ga0496122_0043548
2036 Ga0496122_0080646
2037 Ga0496123_0000055
2038 Ga0496123_0000526
2039 Ga0496123_0000784
2040 Ga0496123_0003334
2041 Ga0496123_0005445
2042 Ga0496123_0005565
2043 Ga0496123_0030323
2044 Ga0496123_0055059
2045 Ga0496124_0000007
2046 Ga0496124_0000423
2047 Ga0496124_0002136
2048 Ga0496124_0003253
2049 Ga0496124_0010388
2050 Ga0496124_0034915
2051 Ga0496124_0040359
2052 Ga0496124_0171849
2053 Ga0496125_0000146
2054 Ga0496125_0021807
2055 Ga0496125_0023112
2056 Ga0496125_0034996
2057 Ga0496126_0000184
2058 Ga0496126_0000225
2059 Ga0496126_0000287
2060 Ga0496126_0000376
2061 Ga0496126_0004422
2062 Ga0496126_0016966
2063 Ga0496126_0092654
2064 Ga0495678_000008
2065 Ga0495678_004177
2066 Ga0495678_007534
2067 Ga0495678_007933
2068 Ga0495678_018060
2069 Ga0495682_0000025
2070 Ga0501034_0215736
2071 Ga0501227_003399
2072 nmdc:mga0k408_8863_c1
2073 nmdc:mga07m45_387_c1
2074 nmdc:mga05p37_31596_c1
2075 nmdc:mga0n895_12900_c1
2076 nmdc:mga08x19_50560_c1
2077 nmdc:mga0a205_79958_c1
2078 Ga0500643_002053
2079 Ga0500651_0000077
2080 Ga0500566_0002377
2081 Ga0500640_000066
2082 Ga0500641_0002909
2083 Ga0500641_0027272
2084 Ga0500554_000079
2085 Ga0500571_000078
2086 Ga0500595_000118
2087 Ga0500595_000168
2088 Ga0500608_002587
2089 Ga0500614_000453
2090 Ga0500618_001477
2091 Ga0500618_001527
2092 Ga0500618_001646
2093 Ga0500618_001713
2094 Ga0500618_009876
2095 Ga0500655_000598
2096 Ga0500658_0002513
2097 Ga0500559_0004355
2098 Ga0500559_0015211
2099 Ga0500564_019022
2100 Ga0500568_0001417
2101 Ga0500574_000208
2102 Ga0500616_0003312
2103 Ga0500616_0034162
2104 Ga0500634_0009577
2105 Ga0500638_038468
2106 Ga0466962_0026364
2107 2501084694
2108 2509130155
2109 2510283311
2110 2510292860
2111 2510313331
2112 2511092444
2113 2511248733
2114 2511358458
2115 2513962385
2116 2515680571
2117 2519459472
2118 2519461653
2119 2527077600
2120 2553003343
2121 2555668454
2122 2555671389
2123 2585291059
2124 2585293282
2125 2596374808
2126 2599354454
2127 2599355451
2128 2599359832
2129 2599360710
2130 2599366154
2131 2599367032
2132 2599372944
2133 2599373822
2134 2599379562
2135 2599380557
2136 2599385460
2137 2599387004
2138 2599391803
2139 2599392680
2140 2599403569
2141 2599404447
2142 2599461288
2143 2599462285
2144 2599466656
2145 2599469832
2146 2599490308
2147 2599490623
2148 2599622604
2149 2599671083
2150 2599679880
2151 2599691896
2152 2599735132
2153 2599735906
2154 2599743261
2155 2599746642
2156 2600205507
2157 2600208548
2158 2600213904
2159 2600214907
2160 2601667420
2161 2601774070
2162 2601774388
2163 2643731139
2164 2643860339
2165 2643979438
2166 2644045355
2167 2644391868
2168 2671097035
2169 2671098071
2170 2676740804
2171 2676747095
2172 2723878751
2173 2738819093
2174 2738830751
2175 2738872277
2176 2738884605
2177 2739189844
2178 2739218878
2179 2739249328
2180 2739280529
2181 2746088275
2182 2746096830
2183 2753565756
2184 2765568204
2185 2765570822
2186 2774128919
2187 2808974108
2188 2808983577
2189 2809007620
2190 2809016047
2191 2809035709
2192 2809129241
2193 2809149704
2194 2812477548
2195 2817258528
2196 2817261754
2197 2817279438
2198 2817453222
2199 2817456806
2200 2819600054
2201 2819621768
2202 2819630047
2203 2819632040
2204 2819702129
2205 2819703138
2206 2831267068
2207 2838056153
2208 2839097491
2209 2839099472
2210 2842324989
2211 2842325822
2212 2842349268
2213 2842350101
2214 2842454703
2215 2842461808
2216 2852619858
2217 2855732490
2218 2855769198
2219 2856288778
2220 2857364493
2221 2857544462
2222 2857551858
2223 2857576548
2224 2858950788
2225 2863422431
2226 2870070536
2227 2870072656
2228 2881414923
2229 2884816293
2230 2884841280
2231 2884856155
2232 2885080708
2233 2885204908
2234 2885218405
2235 2896156920
2236 2899925999
2237 2900637713
2238 2902687696
2239 2904487512
2240 2904548565
2241 2904564929
2242 2904569105
2243 2904572375
2244 2904576587
2245 2904624707
2246 2917072222
2247 2917075255
2248 2917832948
2249 2919048853
2250 2919128644
2251 2919528818
2252 2923511458
2253 2928041605
2254 2928049169
2255 2928052223
2256 2928065106
2257 2928077515
2258 2928087449
2259 2928110943
2260 2928125518
2261 2928137499
2262 2928157134
2263 2928161470
2264 2928168298
2265 2928168968
2266 2928172209
2267 2928173985
2268 2928505794
2269 2928537701
2270 2928541765
2271 2929164767
2272 2932411032
2273 2932419401
2274 2935354391
2275 2935356243
2276 2941485608
2277 2945937776
2278 2974298960
2279 2981993412
2280 2981994983
2281 2984501268
2282 2984505271
2283 2990705507
2284 637318813
2285 637321711
2286 642424527
2287 642418197
2288 642420292
2289 642622604
2290 8018848360
2291 8018852075
2292 8020809190
2293 8020813062
2294 8020939747
2295 8020945754
2296 8020951609
2297 8021120480
2298 8021126236
2299 8039100734
2300 8039101299
2301 8040169142
2302 8040177687
2303 8040179434
2304 8055267065
2305 8055301621
2306 8056215472

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

89

439

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.9066 17 423
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.903 18 423
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.9008 21 423
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.8929 18 426
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.8712 21 423
ID Description Score Start End Superfamily
af_O53919_11_216_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9803 12 216 1.20.1250.20
af_P76470_6_212_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9727 10 215 1.20.1250.20
af_O53919_11_216_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9663 12 216 1.20.1250.20
af_Q9US44_52_251_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9663 16 212 1.20.1250.20
af_Q2FVB9_1_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9626 16 215 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1I3J5X4-F1-model_v4 D-galactonate transporter 0.99 4 435 GO:0016020
GO:0022857
AF-A0A2A4F663-F1-model_v4 MFS transporter 0.9891 4 435 GO:0016020
GO:0022857
AF-A0A2E7P3P9-F1-model_v4 MFS transporter 0.988 7 234 GO:0005886
GO:0022857
AF-A0A3R9TA00-F1-model_v4 MFS transporter 0.9876 7 224 GO:0005886
GO:0022857
AF-A0A3N8I5P9-F1-model_v4 MFS transporter 0.9861 22 425 GO:0016020
GO:0022857

Map