F490895

General Info

Members Datasets Scaffolds Average Seq Length
1153 1001 2306 479

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306086|2551694173
Length 555
Sequence TYPVYGEITGPIVMIGFGSIGHGTLPLIERHFKYDKNRLIVVEPREDAKDTEIFVRHGVRHVRAAVTRDNYKELLKPLLTEGGGQGFCVNLSVDTSSLDIIKLCRKLDVLYVDTVIEPWLGFYFDAEMDNAARTNYALRETVRREKEKNPGGTTAVSTCGANPGMVSWFVKKALLNLADDLGLKYEEPHQDDREGWAKLMKKAGVKGVHIAERDTQRAKHPKPLNVFWNTWSVEGFISEGLQPAELGWGTHENWMPKNAKKHKKGCKAAIYLEQPGANTRVRSWCPTPGPQYGFLVTHNESISIADFFTVRDKDGEVSYRPTCHYAYHPANDAVLSLHEMFGNGGKAQPELHVLDEHELVDGVDELGVLLYGHAKNAYWYGSXXXPAASRPTRTPPACRSRAPFLPAWSGLLKTRRPASSKPTRWTTSAAWKCRCLISAPSRGTTPTGHRSMGARAFSRKTSTRRTPGSSGTFSSAEVHATKHDLSARSSPAPGLFFCECRARRAHARSCFQLMIAACFAQCSTRVSQKTHNGRCGALKRRTIAPGSVPIRAIMR

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
55 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
56 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
57 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
58 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
59 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
60 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
105 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
106 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
113 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
172 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
173 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
174 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
176 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
177 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
178 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
179 2509276019 Ensifer aridi TW10 Isolate Nodule
180 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
181 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
182 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
183 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
184 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
185 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
186 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
187 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
188 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
189 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
190 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
191 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
192 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
193 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
194 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
195 2512875024
196 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
197 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
198 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
199 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
200 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
201 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
202 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
203 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
204 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
205 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
206 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
207 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
208 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
209 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
210 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
211 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
212 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
213 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
214 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
215 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
216 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
217 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
218 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
219 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
220 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
221 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
222 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
223 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
224 2516143018 Ensifer sp. BR816 Isolate Nodule
225 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
226 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
227 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
228 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
229 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
230 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
231 2519899620 Rhizobium sp. Pop5 Isolate Nodule
232 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
233 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
234 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
235 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
236 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
237 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
238 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
239 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
240 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
241 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
242 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
243 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
244 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
245 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
246 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
247 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
248 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
249 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
250 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
251 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
252 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
253 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
254 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
255 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
256 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
257 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
258 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
259 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
260 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
261 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
262 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
263 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
264 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
265 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
266 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
267 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
268 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
269 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
270 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
271 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
272 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
273 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
274 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
275 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
276 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
277 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
278 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
279 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
280 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
281 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
282 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
283 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
284 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
285 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
286 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
287 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
288 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
289 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
290 2643221557 Ensifer sp. Root558 Isolate Unclassified
291 2643221558 Rhizobium sp. Root149 Isolate Unclassified
292 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
293 2643221568 Rhizobium sp. Root564 Isolate Unclassified
294 2643221582 Rhizobium sp. Root651 Isolate Unclassified
295 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
296 2643221599 Rhizobium sp. Root708 Isolate Unclassified
297 2643221607 Rhizobium sp. Root73 Isolate Unclassified
298 2643221610 Ensifer sp. Root74 Isolate Unclassified
299 2643221618 Ensifer sp. Root231 Isolate Unclassified
300 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
301 2643221626 Ensifer sp. Root31 Isolate Unclassified
302 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
303 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
304 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
305 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
306 2643221655 Ensifer sp. Root1252 Isolate Unclassified
307 2643221659 Ensifer sp. Root127 Isolate Unclassified
308 2643221668 Ensifer sp. Root423 Isolate Unclassified
309 2643221675 Ensifer sp. Root1298 Isolate Unclassified
310 2643221680 Ensifer sp. Root1312 Isolate Unclassified
311 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
312 2643221688 Rhizobium sp. Root482 Isolate Unclassified
313 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
314 2643221693 Rhizobium sp. Root491 Isolate Unclassified
315 2643221698 Ensifer sp. Root142 Isolate Unclassified
316 2643221712 Ensifer sp. Root258 Isolate Unclassified
317 2643221718 Rhizobium sp. Root268 Isolate Unclassified
318 2643221723 Ensifer sp. Root278 Isolate Unclassified
319 2643221726 Ensifer sp. Root954 Isolate Unclassified
320 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
321 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
322 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
323 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
324 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
325 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
326 2718217882 Rhizobium sp. N741 Isolate Nodule
327 2718217927 Rhizobium sp. N324 Isolate Nodule
328 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
329 2718218009 Rhizobium sp. N561 Isolate Nodule
330 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
331 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
332 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
333 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
334 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
335 2718218363 Rhizobium sp. N113 Isolate Nodule
336 2718218365 Rhizobium sp. N731 Isolate Nodule
337 2718218366 Rhizobium sp. N621 Isolate Nodule
338 2718218423 Rhizobium sp. N941 Isolate Nodule
339 2721755514 Rhizobium sp. N6212 Isolate Nodule
340 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
341 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
342 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
343 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
344 2721755809 Rhizobium sp. N541 Isolate Nodule
345 2721755810 Rhizobium sp. N871 Isolate Nodule
346 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
347 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
348 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
349 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
350 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
351 2728369365 Rhizobium sp. N1341 Isolate Nodule
352 2728369397 Rhizobium sp. N1314 Isolate Nodule
353 2738541293 Rhizobium sp. GV031 Isolate Unclassified
354 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
355 2738543024 Aminobacter sp. AP02 Isolate Unclassified
356 2751185800 Brucella pituitosa AA2 Isolate Unclassified
357 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
358 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
359 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
360 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
361 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
362 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
363 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
364 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
365 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
366 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
367 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
368 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
369 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
370 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
371 2791355256 Rhizobium sp. M10 Isolate Nodule
372 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
373 2791355260 Rhizobium sp. L9 Isolate Nodule
374 2791355261 Rhizobium sp. J15 Isolate Nodule
375 2791355262 Rhizobium sp. M1 Isolate Nodule
376 2791355263 Rhizobium chutanense C5 Isolate Nodule
377 2791355264 Rhizobium sp. S9 Isolate Nodule
378 2791355265 Rhizobium sp. H4 Isolate Nodule
379 2791355266 Rhizobium sp. L43 Isolate Nodule
380 2791355267 Rhizobium sp. L18 Isolate Nodule
381 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
382 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
383 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
384 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
385 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
386 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
387 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
388 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
389 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
390 2802429633 Rhizobium anhuiense J3 Isolate Nodule
391 2802429634 Rhizobium anhuiense S10 Isolate Nodule
392 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
393 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
394 2802429637 Rhizobium anhuiense C15 Isolate Nodule
395 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
396 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
397 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
398 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
399 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
400 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
401 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
402 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
403 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
404 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
405 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
406 2838048938 Rhizobium pisi 27/80 Isolate Nodule
407 2838061910 Rhizobium phaseoli L15 Isolate Nodule
408 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
409 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
410 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
411 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
412 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
413 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
414 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
415 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
416 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
417 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
418 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
419 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
420 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
421 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
422 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
423 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
424 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
425 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
426 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
427 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
428 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
429 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
430 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
431 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
432 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
433 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
434 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
435 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
436 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
437 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
438 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
439 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
440 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
441 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
442 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
443 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
444 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
445 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
446 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
447 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
448 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
449 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
450 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
451 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
452 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
453 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
454 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
455 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
456 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
457 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
458 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
459 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
460 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
461 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
462 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
463 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
464 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
465 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
466 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
467 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
468 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
469 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
470 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
471 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
472 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
473 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
474 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
475 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
476 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
477 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
478 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
479 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
480 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
481 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
482 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
483 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
484 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
485 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
486 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
487 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
488 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
489 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
490 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
491 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
492 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
493 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
494 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
495 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
496 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
497 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
498 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
499 2854911287 Brucella lupini LUP21 Isolate Unclassified
500 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
501 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
502 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
503 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
504 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
505 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
506 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
507 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
508 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
509 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
510 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
511 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
512 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
513 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
514 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
515 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
516 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
517 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
518 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
519 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
520 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
521 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
522 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
523 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
524 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
525 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
526 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
527 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
528 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
529 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
530 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
531 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
532 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
533 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
534 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
535 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
536 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
537 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
538 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
539 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
540 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
541 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
542 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
543 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
544 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
545 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
546 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
547 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
548 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
549 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
550 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
551 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
552 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
553 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
554 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
555 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
556 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
557 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
558 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
559 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
560 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
561 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
562 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
563 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
564 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
565 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
566 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
567 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
568 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
569 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
570 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
571 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
572 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
573 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
574 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
575 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
576 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
577 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
578 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
579 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
580 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
581 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
582 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
583 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
584 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
585 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
586 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
587 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
588 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
589 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
590 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
591 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
592 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
593 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
594 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
595 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
596 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
597 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
598 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
599 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
600 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
601 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
602 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
603 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
604 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
605 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
606 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
607 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
608 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
609 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
610 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
611 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
612 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
613 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
614 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
615 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
616 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
617 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
618 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
619 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
620 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
621 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
622 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
623 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
624 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
625 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
626 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
627 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
628 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
629 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
630 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
631 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
632 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
633 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
634 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
635 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
636 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
637 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
638 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
639 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
640 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
641 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
642 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
643 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
644 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
645 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
646 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
647 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
648 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
649 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
650 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
651 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
652 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
653 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
654 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
655 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
656 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
657 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
658 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
659 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
660 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
661 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
662 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
663 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
664 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
665 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
666 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
667 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
668 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
669 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
670 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
671 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
672 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
673 2933599457 Rhizobium phaseoli M3 Isolate Nodule
674 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
675 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
676 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
677 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
678 2936381700 Rhizobium chutanense C16 Isolate Unclassified
679 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
680 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
681 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
682 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
683 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
684 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
685 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
686 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
687 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
688 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
689 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
690 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
691 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
692 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
693 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
694 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
695 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
696 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
697 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
698 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
699 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
700 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
701 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
702 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
703 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
704 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
705 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
706 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
707 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
708 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
709 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
710 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
711 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
712 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
713 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
714 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
715 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
716 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
717 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
718 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
719 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
720 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
721 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
722 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
723 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
724 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
725 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
726 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
727 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
728 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
729 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
730 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
731 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
732 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
733 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
734 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
735 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
736 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
737 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
738 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
739 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
740 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
741 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
742 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
743 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
744 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
745 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
746 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
747 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
748 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
749 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
750 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
751 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
752 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
753 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
754 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
755 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
756 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
757 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
758 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
759 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
760 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
761 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
762 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
763 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
764 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
765 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
766 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
767 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
768 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
769 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
770 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
771 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
772 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
773 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
774 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
775 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
776 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
777 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
778 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
779 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
780 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
781 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
782 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
783 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
784 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
785 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
786 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
787 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
788 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
789 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
790 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
791 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
792 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
793 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
794 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
795 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
796 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
797 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
798 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
799 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
800 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
801 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
802 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
803 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
804 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
805 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
806 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
807 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
808 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
809 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
810 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
811 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
812 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
813 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
814 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
815 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
816 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
817 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
818 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
819 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
820 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
821 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
822 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
823 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
824 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
825 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
826 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
827 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
828 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
829 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
830 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
831 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
832 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
833 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
834 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
835 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
836 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
837 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
838 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
839 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
840 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
841 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
842 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
843 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
844 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
845 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
846 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
847 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
848 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
849 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
850 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
851 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
852 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
853 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
854 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
855 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
856 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
857 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
858 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
859 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
860 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
861 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
862 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
863 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
864 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
865 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
866 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
867 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
868 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
869 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
870 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
871 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
872 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
873 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
874 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
875 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
876 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
877 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
878 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
879 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
880 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
881 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
882 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
883 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
884 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
885 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
886 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
887 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
888 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
889 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
890 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
891 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
892 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
893 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
894 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
895 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
896 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
897 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
898 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
899 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
900 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
901 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
902 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
903 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
904 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
905 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
906 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
907 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
908 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
909 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
910 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
911 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
912 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
913 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
914 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
915 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
916 2996887358 Rhizobium sp. R711 Isolate Nodule
917 2996893221 Rhizobium sp. R635 Isolate Nodule
918 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
919 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
920 3004167301 Mesorhizobium loti 582 Isolate Unclassified
921 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
922 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
923 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
924 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
925 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
926 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
927 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
928 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
929 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
930 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
931 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
932 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
933 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
934 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
935 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
936 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
937 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
938 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
939 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
940 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
941 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
942 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
943 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
944 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
945 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
946 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
947 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
948 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
949 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
950 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
951 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
952 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
953 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
954 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
955 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
956 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
957 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
958 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
959 8005258706 Rhizobium sp. R693 Isolate Nodule
960 8005275841 Rhizobium sp. N4311 Isolate Nodule
961 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
962 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
963 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
964 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
965 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
966 8005321885 Rhizobium sp. R72 Isolate Nodule
967 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
968 8005382845 Rhizobium sp. R634 Isolate Nodule
969 8005395548 Rhizobium sp. R339 Isolate Nodule
970 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
971 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
972 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
973 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
974 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
975 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
976 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
977 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
978 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
979 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
980 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
981 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
982 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
983 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
984 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
985 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
986 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
987 8018176218 Rhizobium sp. N122 Isolate Nodule
988 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
989 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
990 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
991 8024501048 Rhizobium sp. H4 Isolate Nodule
992 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
993 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
994 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
995 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
996 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
997 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
998 8056382006 Rhizobium croatiense 13T Isolate Nodule
999 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1000 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1001 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 27.93
Metatranscriptomes 0.09
Isolates 71.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 12.66
Nodule 56.9
Rhizoplane 0.78
Rhizosphere 15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000215 3300002705 Bacteria 40194
2 JGI25154J39366_1000169 3300002738 Bacteria 50665
3 JGI25158J39367_1000249 3300002739 Bacteria 12392
4 JGI25157J39369_1000226 3300002741 Bacteria 44207
5 JGI25152J39213_1001612 3300002773 Bacteria 9433
6 JGI25152J39213_1002985 3300002773 Bacteria 6003
7 JGI25152J39213_1005237 3300002773 Bacteria 3854
8 JGI25152J39213_1010984 3300002773 Bacteria 2029
9 JGI25150J39212_1000142 3300002774 Bacteria 40535
10 JGI25159J45721_1000018 3300002987 Bacteria 132603
11 JGI25159J45721_1000470 3300002987 Bacteria 18595
12 JGI25159J45721_1006331 3300002987 Bacteria 3557
13 JGI25151J46595_10000031 3300003187 Bacteria 197865
14 JGI25151J46595_10001034 3300003187 Bacteria 20801
15 JGI25151J46595_10009744 3300003187 Bacteria 4525
16 JGI25151J46595_10027348 3300003187 Bacteria 2288
17 JGI25406J46586_10023766 3300003203 Bacteria 2416
18 JGI25165J46597_1000042 3300003214 Bacteria 271606
19 JGI25165J46597_1000443 3300003214 Bacteria 41663
20 JGI25165J46597_1001071 3300003214 Bacteria 17571
21 JGI25153J46596_10002913 3300003215 Bacteria 9684
22 JGI25160J50197_1000009 3300003354 Bacteria 282862
23 JGI25160J50197_1000114 3300003354 Bacteria 75947
24 JGI25160J50197_1000966 3300003354 Bacteria 15007
25 JGI25160J50197_1011262 3300003354 Bacteria 3180
26 JGI25161J50226_1000089 3300003374 Bacteria 73775
27 JGI25161J50226_1000114 3300003374 Bacteria 62957
28 JGI25161J50226_1000913 3300003374 Bacteria 10639
29 Ga0055542_1000981 3300003762 Bacteria 18535
30 Ga0055529_1001600 3300003763 Bacteria 6140
31 Ga0055526_1004043 3300003771 Bacteria 9009
32 Ga0055526_1006122 3300003771 Bacteria 6631
33 Ga0055524_1001259 3300003775 Bacteria 14879
34 Ga0055524_1001626 3300003775 Bacteria 12537
35 Ga0055524_1006998 3300003775 Bacteria 4844
36 Ga0055536_1002677 3300003781 Bacteria 9884
37 Ga0055536_1012610 3300003781 Bacteria 3120
38 Ga0055528_1010323 3300003790 Bacteria 3805
39 Ga0055530_10011658 3300003791 Bacteria 3138
40 Ga0055540_1006389 3300003792 Bacteria 4686
41 Ga0055531_10007080 3300003794 Bacteria 6201
42 Ga0055531_10034399 3300003794 Bacteria 1608
43 Ga0058692_1000707 3300003856 Bacteria 13669
44 Ga0058692_1000793 3300003856 Bacteria 12657
45 Ga0055543_1000002 3300004625 Bacteria 390020
46 Ga0055543_1000077 3300004625 Bacteria 86457
47 Ga0055543_1000379 3300004625 Bacteria 29065
48 Ga0055543_1002703 3300004625 Bacteria 5670
49 Ga0065165_1000020 3300005262 Bacteria 265570
50 Ga0065165_1000537 3300005262 Bacteria 57544
51 Ga0065165_1004996 3300005262 Bacteria 7772
52 Ga0070670_100002407 3300005331 Bacteria 15428
53 Ga0070668_100031812 3300005347 Bacteria 4015
54 Ga0070669_100034905 3300005353 Bacteria 3641
55 Ga0070671_100036933 3300005355 Bacteria 4051
56 Ga0070663_100042275 3300005455 Bacteria 3202
57 Ga0070665_100005334 3300005548 Bacteria 13283
58 Ga0068854_100071940 3300005578 Bacteria 2531
59 Ga0081539_10002331 3300005985 Bacteria 27334
60 Ga0075365_10000532 3300006038 Bacteria 14622
61 Ga0075365_10027524 3300006038 Bacteria 3619
62 Ga0075365_10044706 3300006038 Bacteria 2903
63 Ga0075365_10094439 3300006038 Bacteria 2041
64 Ga0075368_10000376 3300006042 Bacteria 13063
65 Ga0075363_100000028 3300006048 Bacteria 28528
66 Ga0075363_100016943 3300006048 Bacteria 3606
67 Ga0075364_10010752 3300006051 Bacteria 5537
68 Ga0075364_10028420 3300006051 Bacteria 3580
69 Ga0075362_10002625 3300006177 Bacteria 6088
70 Ga0075367_10062652 3300006178 Bacteria 2222
71 Ga0075369_10005611 3300006186 Bacteria 4699
72 Ga0075369_10054563 3300006186 Bacteria 1735
73 Ga0075366_10016141 3300006195 Bacteria 4288
74 Ga0075370_10001799 3300006353 Bacteria 9584
75 Ga0075370_10032952 3300006353 Bacteria 2899
76 Ga0079104_1002954 3300006946 Bacteria 8403
77 Ga0079104_1003793 3300006946 Bacteria 6799
78 Ga0099826_10016302 3300006948 Bacteria 5609
79 Ga0105240_10000019 3300009093 Bacteria 406211
80 Ga0105243_10006006 3300009148 Bacteria 9400
81 Ga0105248_10215580 3300009177 Bacteria 2162
82 Ga0105238_10005636 3300009551 Bacteria 12375
83 Ga0123342_1007669 3300009766 Bacteria 14126
84 Ga0105239_10006306 3300010375 Bacteria 13794
85 Ga0105239_10157357 3300010375 Bacteria 2538
86 Ga0157373_10026296 3300013100 Bacteria 4206
87 Ga0157371_10000002 3300013102 Bacteria 665040
88 Ga0157370_10000246 3300013104 Bacteria 69424
89 Ga0157370_10047724 3300013104 Bacteria 4104
90 Ga0171463_1006 3300013249 Bacteria 336402
91 Ga0183363_1018 3300015690 Bacteria 62625
92 Ga0214544_1001241 3300021320 Bacteria 52071
93 Ga0214542_1000115 3300021321 Bacteria 109873
94 Ga0214543_1000008 3300021327 Bacteria 385680
95 Ga0214543_1000098 3300021327 Bacteria 109894
96 Ga0228711_1000003 3300022739 Bacteria 258118
97 Ga0228710_1000003 3300022740 Bacteria 262981
98 Ga0209435_100005 3300025206 Bacteria 573745
99 Ga0209436_100050 3300025208 Bacteria 65942
100 Ga0209437_100078 3300025233 Bacteria 278088
101 Ga0209437_100291 3300025233 Bacteria 72764
102 Ga0207425_1000070 3300025245 Bacteria 116438
103 Ga0207425_1001972 3300025245 Bacteria 7681
104 Ga0209646_1000011 3300025246 Bacteria 573745
105 Ga0209026_1000008 3300025250 Bacteria 573745
106 Ga0209026_1000029 3300025250 Bacteria 337109
107 Ga0209677_100524 3300025253 Bacteria 21308
108 Ga0209148_1000080 3300025254 Bacteria 277806
109 Ga0209148_1005812 3300025254 Bacteria 2760
110 Ga0209759_1000004 3300025256 Bacteria 573745
111 Ga0209759_1000040 3300025256 Bacteria 254501
112 Ga0209129_1000080 3300025258 Bacteria 186416
113 Ga0209129_1003444 3300025258 Bacteria 6868
114 Ga0209233_1000028 3300025261 Bacteria 642062
115 Ga0209233_1000157 3300025261 Bacteria 164269
116 Ga0209233_1000192 3300025261 Bacteria 127171
117 Ga0209233_1000194 3300025261 Bacteria 126185
118 Ga0209455_1000171 3300025272 Bacteria 109696
119 Ga0209673_1000037 3300025273 Bacteria 313804
120 Ga0209673_1000060 3300025273 Bacteria 263602
121 Ga0209673_1000312 3300025273 Bacteria 89594
122 Ga0209673_1000439 3300025273 Bacteria 71645
123 Ga0209673_1003294 3300025273 Bacteria 9701
124 Ga0209673_1004728 3300025273 Bacteria 7166
125 Ga0209130_1000030 3300025284 Bacteria 323323
126 Ga0209130_1000037 3300025284 Bacteria 284019
127 Ga0209130_1000083 3300025284 Bacteria 162582
128 Ga0209676_1000239 3300025292 Bacteria 117696
129 Ga0209676_1010437 3300025292 Bacteria 3870
130 Ga0209025_1000052 3300025294 Bacteria 324648
131 Ga0209025_1000083 3300025294 Bacteria 265556
132 Ga0209025_1000196 3300025294 Bacteria 147356
133 Ga0209025_1000255 3300025294 Bacteria 125764
134 Ga0209025_1000389 3300025294 Bacteria 90997
135 Ga0209025_1003226 3300025294 Bacteria 15787
136 Ga0209025_1007724 3300025294 Bacteria 7932
137 Ga0209025_1014510 3300025294 Bacteria 4836
138 Ga0209025_1021093 3300025294 Bacteria 3527
139 Ga0209564_1000086 3300025295 Bacteria 251385
140 Ga0209564_1000116 3300025295 Bacteria 207889
141 Ga0209564_1000125 3300025295 Bacteria 201709
142 Ga0209564_1000281 3300025295 Bacteria 104019
143 Ga0209758_1000090 3300025297 Bacteria 246564
144 Ga0209758_1000357 3300025297 Bacteria 82792
145 Ga0209758_1000621 3300025297 Bacteria 54479
146 Ga0209758_1000657 3300025297 Bacteria 51923
147 Ga0209758_1001459 3300025297 Bacteria 27768
148 Ga0209758_1017627 3300025297 Bacteria 3542
149 Ga0209050_1005669 3300025298 Bacteria 7727
150 Ga0209050_1008097 3300025298 Bacteria 5706
151 Ga0209256_1000276 3300025299 Bacteria 89888
152 Ga0209256_1002576 3300025299 Bacteria 14467
153 Ga0209256_1002625 3300025299 Bacteria 14193
154 Ga0209256_1004253 3300025299 Bacteria 9159
155 Ga0209256_1006950 3300025299 Bacteria 5776
156 Ga0209256_1008128 3300025299 Bacteria 4941
157 Ga0207426_1000047 3300025302 Bacteria 417011
158 Ga0207426_1000048 3300025302 Bacteria 409127
159 Ga0207426_1000173 3300025302 Bacteria 162697
160 Ga0207426_1000268 3300025302 Bacteria 109321
161 Ga0207426_1000984 3300025302 Bacteria 27966
162 Ga0209051_1000874 3300025303 Bacteria 30458
163 Ga0209051_1003034 3300025303 Bacteria 11368
164 Ga0209051_1005608 3300025303 Bacteria 7279
165 Ga0209051_1008583 3300025303 Bacteria 5390
166 Ga0209257_1001192 3300025304 Bacteria 32713
167 Ga0209257_1005971 3300025304 Bacteria 8165
168 Ga0207705_10015368 3300025909 Bacteria 5491
169 Ga0207695_10000049 3300025913 Bacteria 406233
170 Ga0207671_10000860 3300025914 Bacteria 38458
171 Ga0207671_10007609 3300025914 Bacteria 9372
172 Ga0207694_10031647 3300025924 Bacteria 4043
173 Ga0207650_10009773 3300025925 Bacteria 6559
174 Ga0207644_10021552 3300025931 Bacteria 4391
175 Ga0207711_10128597 3300025941 Bacteria 2268
176 Ga0207640_10039577 3300025981 Bacteria 2985
177 Ga0207640_10152046 3300025981 Bacteria 1702
178 Ga0207678_10075566 3300026067 Bacteria 2886
179 Ga0207678_10081149 3300026067 Bacteria 2776
180 Ga0209281_1000081 3300027111 Bacteria 258084
181 Ga0209281_1000269 3300027111 Bacteria 100505
182 Ga0209371_1000003 3300027312 Bacteria 1122971
183 Ga0209371_1001136 3300027312 Bacteria 19534
184 Ga0209371_1005797 3300027312 Bacteria 4779
185 Ga0209282_1000040 3300027666 Bacteria 127969
186 Ga0209282_1000870 3300027666 Bacteria 15631
187 Ga0268266_10024157 3300028379 Bacteria 5172
188 Ga0268266_10047949 3300028379 Bacteria 3661
189 Ga0307515_10000263 3300028794 Bacteria 130303
190 Ga0307515_10000386 3300028794 Bacteria 107196
191 Ga0307515_10049328 3300028794 Bacteria 6338
192 Ga0268256_1000004 3300030500 Bacteria 1122967
193 Ga0268256_1004149 3300030500 Bacteria 6149
194 Ga0268256_1007306 3300030500 Bacteria 3960
195 Ga0307513_10015647 3300031456 Bacteria 9183
196 Ga0307513_10022547 3300031456 Bacteria 7395
197 Ga0307408_100093977 3300031548 Bacteria 2270
198 Ga0307516_10039908 3300031730 Bacteria 4676
199 Ga0307406_10005532 3300031901 Bacteria 6911
200 Ga0307406_10078406 3300031901 Bacteria 2188
201 Ga0307412_10003898 3300031911 Bacteria 8304
202 Ga0315914_1000002 3300031967 Bacteria 365357
203 Ga0315913_1000016 3300033430 Bacteria 113410
204 Ga0315915_1000005 3300033464 Bacteria 397591
205 Ga0373927_0000095 3300035695 Bacteria 66646
206 Ga0373925_0001900 3300037068 Bacteria 17334
207 Ga0395905_0000479 3300037471 Bacteria 55266
208 Ga0395905_0042590 3300037471 Bacteria 4260
209 Ga0395901_0097607 3300038443 Bacteria 3080
210 Ga0451841_0811656 3300041498 Bacteria 2572
211 Ga0451845_0612574 3300041501 Bacteria 2371
212 Ga0451847_0787006 3300041503 Bacteria 5398
213 Ga0451851_0687044 3300041507 Bacteria 3016
214 Ga0466972_0004602 3300044658 Bacteria 6911
215 Ga0466965_0032775 3300044683 Bacteria 2538
216 Ga0466960_0009402 3300044901 Bacteria 4028
217 Ga0495638_0000377 3300046460 Bacteria 55414
218 Ga0495606_0001835 3300046507 Bacteria 26895
219 Ga0495633_0016900 3300046558 Bacteria 3745
220 Ga0495625_0025060 3300046660 Bacteria 4528
221 Ga0495604_0021754 3300047317 Bacteria 5120
222 Ga0495687_035816 3300047443 Bacteria 2227
223 Ga0495681_0014334 3300047470 Bacteria 4549
224 Ga0496116_0009050 3300048919 Bacteria 8545
225 Ga0496116_0014212 3300048919 Bacteria 6370
226 Ga0496117_0000052 3300048920 Bacteria 280463
227 Ga0496118_0000709 3300048921 Bacteria 53670
228 Ga0496118_0032794 3300048921 Bacteria 4271
229 Ga0496119_0002287 3300048922 Bacteria 21206
230 Ga0496119_0016179 3300048922 Bacteria 5697
231 Ga0496119_0043664 3300048922 Bacteria 2830
232 Ga0496120_0000019 3300048923 Bacteria 260115
233 Ga0496120_0001370 3300048923 Bacteria 29844
234 Ga0496120_0048589 3300048923 Bacteria 2441
235 Ga0496121_0021259 3300048924 Bacteria 6367
236 Ga0496122_0000024 3300048925 Bacteria 372400
237 Ga0496122_0000053 3300048925 Bacteria 260120
238 Ga0496122_0002990 3300048925 Bacteria 23012
239 Ga0496122_0008551 3300048925 Bacteria 11011
240 Ga0496122_0008795 3300048925 Bacteria 10788
241 Ga0496123_0000038 3300048926 Bacteria 260120
242 Ga0496123_0000063 3300048926 Bacteria 216072
243 Ga0496123_0000086 3300048926 Bacteria 183266
244 Ga0496123_0007881 3300048926 Bacteria 9898
245 Ga0496123_0040184 3300048926 Bacteria 3262
246 Ga0496124_0000139 3300048927 Bacteria 149873
247 Ga0496124_0015328 3300048927 Bacteria 7355
248 Ga0496125_0020651 3300048928 Bacteria 6176
249 Ga0496126_0000763 3300048929 Bacteria 58240
250 Ga0496126_0109258 3300048929 Bacteria 2410
251 Ga0501031_0008039 3300049568 Bacteria 6869
252 Ga0501032_0000007 3300049569 Bacteria 253881
253 Ga0501032_0000248 3300049569 Bacteria 45043
254 Ga0501032_0011413 3300049569 Bacteria 6383
255 Ga0501033_0000051 3300049570 Bacteria 111291
256 Ga0501033_0001374 3300049570 Bacteria 21696
257 Ga0501033_0004047 3300049570 Bacteria 11840
258 Ga0501033_0016361 3300049570 Bacteria 5616
259 Ga0501034_0000029 3300049571 Bacteria 253881
260 Ga0501034_0000507 3300049571 Bacteria 62716
261 Ga0501034_0007241 3300049571 Bacteria 11841
262 Ga0501036_0000004 3300049572 Bacteria 253881
263 Ga0501036_0078483 3300049572 Bacteria 2792
264 Ga0501037_0000004 3300049573 Bacteria 253989
265 Ga0501037_0052678 3300049573 Bacteria 2975
266 Ga0501038_0000005 3300049574 Bacteria 253881
267 Ga0501038_0000238 3300049574 Bacteria 46357
268 Ga0501038_0090618 3300049574 Bacteria 2562
269 Ga0501039_0000009 3300049575 Bacteria 253881
270 Ga0501039_0000073 3300049575 Bacteria 75516
271 Ga0501039_0083683 3300049575 Bacteria 2484
272 Ga0501042_0007394 3300049578 Bacteria 7193
273 Ga0501043_0000214 3300049579 Bacteria 52431
274 Ga0501043_0001215 3300049579 Bacteria 22693
275 Ga0501046_0021719 3300049580 Bacteria 5294
276 Ga0501047_0040490 3300049581 Bacteria 4506
277 Ga0501047_0095191 3300049581 Bacteria 2857
278 Ga0501048_0006373 3300049582 Bacteria 8968
279 Ga0501068_0052683 3300049584 Bacteria 2462
280 Ga0501069_0004063 3300049585 Bacteria 7556
281 Ga0501070_0003212 3300049586 Bacteria 14212
282 Ga0501070_0023667 3300049586 Bacteria 5146
283 Ga0501070_0025370 3300049586 Bacteria 4972
284 Ga0501070_0058097 3300049586 Bacteria 3206
285 Ga0501070_0072673 3300049586 Bacteria 2847
286 Ga0501072_0028309 3300049588 Bacteria 4375
287 Ga0501073_0095743 3300049589 Bacteria 2062
288 Ga0501080_0017096 3300049742 Bacteria 6699
289 Ga0501035_0000014 3300049822 Bacteria 253874
290 Ga0501035_0000189 3300049822 Bacteria 75562
291 Ga0501035_0001928 3300049822 Bacteria 20781
292 Ga0501035_0012975 3300049822 Bacteria 7688
293 Ga0501035_0013614 3300049822 Bacteria 7504
294 Ga0501044_0000012 3300049823 Bacteria 253881
295 Ga0501044_0010493 3300049823 Bacteria 10054
296 Ga0501044_0027624 3300049823 Bacteria 5994
297 Ga0501044_0058787 3300049823 Bacteria 3941
298 Ga0501044_0111683 3300049823 Bacteria 2740
299 Ga0501044_0132916 3300049823 Bacteria 2481
300 Ga0501044_0240757 3300049823 Bacteria 1753
301 Ga0501045_0009505 3300049824 Bacteria 6805
302 nmdc:mga03683_124_c1 3300050489 Bacteria 25785
303 nmdc:mga03n38_17317_c1 3300050490 Bacteria 2820
304 nmdc:mga00v17_141469_c1 3300050491 Bacteria 1543
305 nmdc:mga00v17_55_c1 3300050491 Bacteria 72029
306 nmdc:mga00v17_97909_c1 3300050491 Bacteria 1849
307 nmdc:mga0yw44_11225_c1 3300050492 Bacteria 4613
308 nmdc:mga0k408_3360_c1 3300050493 Bacteria 8476
309 nmdc:mga06z11_103920_c1 3300050494 Bacteria 1563
310 nmdc:mga06z11_33873_c1 3300050494 Bacteria 2502
311 nmdc:mga07m45_50944_c1 3300050496 Bacteria 2334
312 nmdc:mga0sz30_586_c1 3300050516 Bacteria 13725
313 Ga0500578_0089628 3300053086 Bacteria 1952
314 Ga0500658_0000067 3300053134 Bacteria 48662
315 Ga0500561_0000105 3300053137 Bacteria 16341
316 Ga0500568_0000177 3300053139 Bacteria 55762
317 Ga0500616_0000526 3300053153 Bacteria 48257
318 Ga0500616_0022183 3300053153 Bacteria 3549
319 Ga0500624_000343 3300053157 Bacteria 15439
320 Ga0500634_0074198 3300053161 Bacteria 1772
321 Ga0500636_0000005 3300053177 Bacteria 197561
322 Ga0500636_0001535 3300053177 Bacteria 12578
323 Ga0587076_006715 3300059645 Bacteria 1544
324 2551694173 2551306086 Bacteria 6843938
325 2503199964 2503198000 Bacteria 6884444
326 2509109796 2508501122 Bacteria 6292184
327 2509142586 2508501127 Bacteria 7037543
328 2509379052 2509276019 Bacteria 6802256
329 2509386430 2509276021 Bacteria 7634384
330 2509389893 2509276021 Bacteria 7634384
331 2509394875 2509276022 Bacteria 6200534
332 2509447861 2509276033 Bacteria 7180565
333 2510134794 2510065019 Bacteria 6903379
334 2510303637 2510065057 Bacteria 6649661
335 2510319258 2510065059 Bacteria 6847884
336 2510896200 2510461076 Bacteria 8618824
337 2511136607 2510917022 Bacteria 6504556
338 2511170730 2510917026 Bacteria 7046020
339 2511185144 2510917028 Bacteria 6185411
340 2511198455 2510917030 Bacteria 7460662
341 2511390326 2511231027 Bacteria 5013807
342 2511502944 2511231052 Bacteria 6974333
343 2512534187 2512047086 Bacteria 6850303
344 2512932568 2512875016 Bacteria 6529530
345 2512960582 2512875024 Bacteria 7195110
346 2512973977 2512875026 Bacteria 6861065
347 2513572559 2513237084 Bacteria 7231967
348 2513581274 2513237085 Bacteria 7695351
349 2513585271 2513237086 Bacteria 7265287
350 2513597123 2513237088 Bacteria 6927906
351 2513602305 2513237089 Bacteria 6553624
352 2513608680 2513237090 Bacteria 7096802
353 2513620107 2513237091 Bacteria 6900273
354 2513631367 2513237093 Bacteria 7545552
355 2513710698 2513237103 Bacteria 7647401
356 2513870860 2513237138 Bacteria 7368160
357 2513885852 2513237140 Bacteria 7076289
358 2513902872 2513237143 Bacteria 6664116
359 2513908241 2513237144 Bacteria 7530820
360 2513926895 2513237146 Bacteria 7166346
361 2513985968 2513237156 Bacteria 6402557
362 2513998048 2513237159 Bacteria 6810126
363 2514003948 2513237160 Bacteria 6650282
364 2514022383 2513237162 Bacteria 7468464
365 2514036328 2513237164 Bacteria 7563725
366 2514416492 2513237305 Bacteria 7293571
367 2514587536 2513237351 Bacteria 6968952
368 2515113879 2515075009 Bacteria 7288508
369 2515610395 2515154107 Bacteria 6795637
370 2515634752 2515154113 Bacteria 7807172
371 2515645946 2515154114 Bacteria 7848616
372 2515656827 2515154116 Bacteria 7552979
373 2515743606 2515154134 Bacteria 7220242
374 2516205190 2516143018 Bacteria 6951533
375 2516894349 2516653046 Bacteria 6989037
376 2517037495 2516653077 Bacteria 7555578
377 2517077794 2516653085 Bacteria 7346596
378 2517096593 2517093000 Bacteria 7412387
379 2517410309 2517287029 Bacteria 6905599
380 2517570959 2517487022 Bacteria 7227575
381 2520377898 2519899620 Bacteria 6499161
382 2524451816 2524023207 Bacteria 6813453
383 2524460118 2524023209 Bacteria 6679728
384 2530646904 2529292951 Bacteria 6916614
385 2535519494 2534681796 Bacteria 7146037
386 2537873711 2537561587 Bacteria 5425293
387 2551685992 2551306085 Bacteria 7347181
388 2551699892 2551306087 Bacteria 7351905
389 2551711433 2551306089 Bacteria 7162724
390 2551724071 2551306090 Bacteria 7953713
391 2551724961 2551306091 Bacteria 7086830
392 2551737980 2551306092 Bacteria 6992595
393 2551743385 2551306093 Bacteria 7064773
394 2554245186 2554235003 Bacteria 5877155
395 2558860370 2558860100 Bacteria 8458965
396 2559296984 2558860242 Bacteria 5568029
397 2585167985 2582581283 Bacteria 6030556
398 2585202525 2582581294 Bacteria 6626667
399 2585224834 2582581298 Bacteria 7315509
400 2585227768 2582581299 Bacteria 6518058
401 2585257758 2582581304 Bacteria 5831370
402 2585265410 2582581306 Bacteria 6450535
403 2585274236 2582581307 Bacteria 6597605
404 2585280351 2582581308 Bacteria 7413247
405 2585322629 2582581315 Bacteria 7318924
406 2585330742 2582581316 Bacteria 7774528
407 2585388509 2582581865 Bacteria 6644329
408 2585392385 2582581866 Bacteria 6859583
409 2585402164 2582581867 Bacteria 7184437
410 2585530223 2585427526 Bacteria 7258840
411 2585532581 2585427527 Bacteria 7273426
412 2585541067 2585427528 Bacteria 6842387
413 2585547390 2585427529 Bacteria 7395659
414 2585554403 2585427530 Bacteria 7383882
415 2585560685 2585427531 Bacteria 6992870
416 2585822536 2585427590 Bacteria 6824633
417 2585839829 2585427593 Bacteria 7141551
418 2585845285 2585427594 Bacteria 6180594
419 2585898891 2585427608 Bacteria 6544331
420 2585903517 2585427609 Bacteria 6667127
421 2585997091 2585427633 Bacteria 6413184
422 2586001690 2585427634 Bacteria 6455027
423 2587981364 2585428125 Bacteria 6662905
424 2588518647 2588253730 Bacteria 6881675
425 2597812130 2597489875 Bacteria 7010078
426 2599334782 2599185156 Bacteria 5403036
427 2599420611 2599185170 Bacteria 7295545
428 2599604685 2599185210 Bacteria 5624189
429 2599936433 2599185301 Bacteria 6161860
430 2600194594 2599185352 Bacteria 7228948
431 2601611169 2600255279 Bacteria 5605316
432 2601747942 2600255308 Bacteria 5611129
433 2616295508 2615840624 Bacteria 6557588
434 2616307348 2615840626 Bacteria 7921970
435 2616554892 2615840698 Bacteria 7319877
436 2617383564 2617270742 Bacteria 6808054
437 2643774406 2643221550 Bacteria 4619371
438 2643776560 2643221551 Bacteria 3750538
439 2643795007 2643221555 Bacteria 3749717
440 2643804129 2643221557 Bacteria 7184309
441 2643813205 2643221558 Bacteria 5460675
442 2643839068 2643221564 Bacteria 4193379
443 2643858208 2643221568 Bacteria 5187270
444 2643916910 2643221582 Bacteria 5804683
445 2643984875 2643221595 Bacteria 6565519
446 2644006349 2643221599 Bacteria 6292121
447 2644051074 2643221607 Bacteria 6314006
448 2644064929 2643221610 Bacteria 7480339
449 2644108528 2643221618 Bacteria 7717186
450 2644133247 2643221623 Bacteria 5239945
451 2644145574 2643221626 Bacteria 8069654
452 2644153202 2643221627 Bacteria 6761570
453 2644195828 2643221634 Bacteria 6705461
454 2644205554 2643221636 Bacteria 6583769
455 2644241809 2643221643 Bacteria 5749658
456 2644312349 2643221655 Bacteria 7722067
457 2644335977 2643221659 Bacteria 7890716
458 2644376129 2643221668 Bacteria 7306521
459 2644416602 2643221675 Bacteria 7473456
460 2644449642 2643221680 Bacteria 7473610
461 2644483978 2643221686 Bacteria 6310811
462 2644496331 2643221688 Bacteria 5260751
463 2644500240 2643221689 Bacteria 6042950
464 2644521226 2643221693 Bacteria 5513853
465 2644546834 2643221698 Bacteria 7756764
466 2644618032 2643221712 Bacteria 7729434
467 2644653462 2643221718 Bacteria 5345506
468 2644676791 2643221723 Bacteria 7095460
469 2644688217 2643221726 Bacteria 7455827
470 2657684027 2657244999 Bacteria 5946535
471 2671112141 2667528174 Bacteria 6435400
472 2688597214 2687453392 Bacteria 6880454
473 2692314552 2690316117 Bacteria 6800650
474 2694628723 2693429783 Bacteria 7019804
475 2694637363 2693429784 Bacteria 7241525
476 2719182551 2718217882 Bacteria 6556348
477 2719387221 2718217927 Bacteria 6972593
478 2719666861 2718217997 Bacteria 6740740
479 2719733270 2718218009 Bacteria 6478651
480 2720493281 2718218199 Bacteria 6740745
481 2720614756 2718218232 Bacteria 6720332
482 2720621529 2718218233 Bacteria 6662049
483 2720632857 2718218235 Bacteria 6630699
484 2720776581 2718218269 Bacteria 6906114
485 2721148664 2718218363 Bacteria 6524337
486 2721160050 2718218365 Bacteria 6274507
487 2721165478 2718218366 Bacteria 6425255
488 2721400856 2718218423 Bacteria 6438183
489 2722841648 2721755514 Bacteria 6424414
490 2723028169 2721755556 Bacteria 6745503
491 2723561800 2721755684 Bacteria 6859907
492 2723568429 2721755685 Bacteria 6704835
493 2723574416 2721755686 Bacteria 7343952
494 2724039669 2721755809 Bacteria 6438790
495 2724046026 2721755810 Bacteria 6479005
496 2724091188 2721755819 Bacteria 6906405
497 2724105694 2721755822 Bacteria 6726041
498 2724111523 2721755823 Bacteria 6752556
499 2725947781 2724679232 Bacteria 7646494
500 2730109105 2728369352 Bacteria 6745171
501 2730165786 2728369365 Bacteria 6555560
502 2730299682 2728369397 Bacteria 6274511
503 2738800509 2738541293 Bacteria 7065685
504 2739035620 2738541333 Bacteria 7106503
505 2739307517 2738543024 Bacteria 5603683
506 2753357261 2751185800 Bacteria 5467370
507 2753458658 2751185821 Bacteria 6189929
508 2756671504 2756170246 Bacteria 7451806
509 2757571318 2757320392 Bacteria 3737298
510 2758639667 2758568016 Bacteria 5645291
511 2765466354 2765235802 Bacteria 5618596
512 2766065370 2765235942 Bacteria 7445910
513 2770198989 2767802442 Bacteria 5747986
514 2776270256 2775506902 Bacteria 6208009
515 2778175958 2775507266 Bacteria 7392367
516 2792582590 2791355082 Bacteria 5973319
517 2792622952 2791355091 Bacteria 6135441
518 2792629206 2791355092 Bacteria 6248105
519 2792640442 2791355094 Bacteria 7011481
520 2792748001 2791355123 Bacteria 8049106
521 2793293697 2791355256 Bacteria 6798008
522 2793313120 2791355259 Bacteria 7254731
523 2793319768 2791355260 Bacteria 6598818
524 2793327725 2791355261 Bacteria 6661293
525 2793333318 2791355262 Bacteria 6774204
526 2793344259 2791355263 Bacteria 6872478
527 2793347324 2791355264 Bacteria 6429314
528 2793353648 2791355265 Bacteria 6539969
529 2793359784 2791355266 Bacteria 7116587
530 2793369501 2791355267 Bacteria 7222458
531 2802717951 2802428858 Bacteria 6636079
532 2802725198 2802428859 Bacteria 6667919
533 2802730678 2802428860 Bacteria 6525526
534 2802738025 2802428861 Bacteria 6534206
535 2802744105 2802428862 Bacteria 6633353
536 2802750984 2802428863 Bacteria 6410669
537 2804753283 2802429268 Bacteria 6094027
538 2805930544 2802429605 Bacteria 6875453
539 2805934276 2802429606 Bacteria 6346811
540 2806044608 2802429633 Bacteria 7341974
541 2806052808 2802429634 Bacteria 7083200
542 2806059108 2802429635 Bacteria 7650140
543 2806068229 2802429636 Bacteria 7597525
544 2806074349 2802429637 Bacteria 7067217
545 2808989056 2808606387 Bacteria 5697198
546 2819557183 2818991439 Bacteria 6907412
547 2819609653 2818991448 Bacteria 6772224
548 2819639750 2818991453 Bacteria 7181617
549 2819685620 2818991461 Bacteria 7026071
550 2837653394 2837651117 Bacteria 3772164
551 2838019057 2838016132 Bacteria 6577831
552 2838024347 2838022645 Bacteria 6494267
553 2838033080 2838029111 Bacteria 6603031
554 2838040715 2838035591 Bacteria 7166484
555 2838046304 2838042994 Bacteria 6046894
556 2838051225 2838048938 Bacteria 6044578
557 2838063799 2838061910 Bacteria 6794874
558 2838073282 2838068647 Bacteria 6208656
559 2838077391 2838074704 Bacteria 6785777
560 2838664898 2838661181 Bacteria 7385261
561 2838671192 2838668709 Bacteria 6671819
562 2838678277 2838675328 Bacteria 4909118
563 2838685009 2838680041 Bacteria 6545511
564 2838691372 2838686498 Bacteria 7807632
565 2838699154 2838694306 Bacteria 6853137
566 2838703628 2838701080 Bacteria 6669771
567 2838712635 2838707686 Bacteria 6619912
568 2838716817 2838714209 Bacteria 5525906
569 2838722573 2838719591 Bacteria 5523910
570 2838727566 2838724970 Bacteria 4908691
571 2838733331 2838729681 Bacteria 7400765
572 2838746097 2838742623 Bacteria 7396178
573 2839998296 2839993093 Bacteria 5512535
574 2840769132 2840764183 Bacteria 6358399
575 2841738119 2841734538 Bacteria 6784580
576 2841849172 2841846520 Bacteria 5345850
577 2841853809 2841851746 Bacteria 7532261
578 2841861768 2841859092 Bacteria 5436171
579 2841868222 2841864319 Bacteria 6742987
580 2842082112 2842077413 Bacteria 6508645
581 2842113486 2842110456 Bacteria 7656360
582 2842123034 2842118031 Bacteria 7033875
583 2842128079 2842124991 Bacteria 5346824
584 2842133170 2842130223 Bacteria 4909145
585 2842149370 2842146304 Bacteria 5957337
586 2842155164 2842152218 Bacteria 4908957
587 2842162184 2842156927 Bacteria 6894975
588 2842169739 2842163707 Bacteria 6916235
589 2842173663 2842170452 Bacteria 5525737
590 2842178785 2842175837 Bacteria 4908771
591 2842185110 2842180545 Bacteria 6888678
592 2842189924 2842187318 Bacteria 5524014
593 2842198308 2842192696 Bacteria 6147454
594 2842199890 2842198810 Bacteria 6608673
595 2842208251 2842205361 Bacteria 6340321
596 2842214238 2842211629 Bacteria 5523832
597 2842220128 2842217011 Bacteria 7497767
598 2842226957 2842224351 Bacteria 5524473
599 2842233548 2842229732 Bacteria 7475766
600 2842242063 2842237096 Bacteria 6620661
601 2842247641 2842243621 Bacteria 7421798
602 2842253992 2842250916 Bacteria 6579627
603 2842262091 2842257432 Bacteria 7401195
604 2842266562 2842264693 Bacteria 6472963
605 2842275846 2842271015 Bacteria 7807131
606 2842281740 2842278818 Bacteria 6340002
607 2842288847 2842285085 Bacteria 6011953
608 2842296112 2842291075 Bacteria 7076806
609 2842298656 2842298080 Bacteria 6123127
610 2842308170 2842304105 Bacteria 7023636
611 2842315547 2842311132 Bacteria 6616990
612 2842321444 2842317721 Bacteria 6793725
613 2842344950 2842341865 Bacteria 7003929
614 2842359477 2842357229 Bacteria 6485165
615 2842369998 2842363717 Bacteria 6844742
616 2842375687 2842370503 Bacteria 7038661
617 2842382511 2842377471 Bacteria 7140707
618 2842389912 2842384541 Bacteria 7057858
619 2842398570 2842395702 Bacteria 6780583
620 2842406486 2842402390 Bacteria 6681310
621 2842413087 2842409023 Bacteria 6687331
622 2842419730 2842415677 Bacteria 6596907
623 2842426916 2842422224 Bacteria 6239196
624 2842429881 2842428310 Bacteria 6767288
625 2842436459 2842434925 Bacteria 6502746
626 2842444162 2842441272 Bacteria 6769273
627 2842450980 2842447887 Bacteria 6754142
628 2842464302 2842462802 Bacteria 6588055
629 2842470788 2842469257 Bacteria 6752936
630 2842479813 2842475841 Bacteria 6603183
631 2842483441 2842482326 Bacteria 7212537
632 2842493222 2842489311 Bacteria 6620893
633 2842499210 2842495871 Bacteria 6820686
634 2842506989 2842502639 Bacteria 6604161
635 2842510684 2842509118 Bacteria 6850950
636 2842517966 2842515876 Bacteria 5436280
637 2842523153 2842521101 Bacteria 6569494
638 2842872296 2842871566 Bacteria 4827117
639 2842925909 2842922631 Bacteria 5824079
640 2844008585 2844002411 Bacteria 7168230
641 2844012591 2844009547 Bacteria 6728125
642 2844457546 2844454524 Bacteria 7952546
643 2847420396 2847417321 Bacteria 6913799
644 2847691097 2847686936 Bacteria 6278406
645 2848995202 2848992105 Bacteria 6810864
646 2850082268 2850079185 Bacteria 6848280
647 2852391141 2852387548 Bacteria 8025568
648 2854900291 2854896431 Bacteria 5869725
649 2854916739 2854911287 Bacteria 5582813
650 2854919541 2854916844 Bacteria 5725939
651 2855826984 2855825444 Bacteria 6785811
652 2855842380 2855839649 Bacteria 7135830
653 2855878477 2855872281 Bacteria 6964271
654 2856323076 2856320880 Bacteria 7263508
655 2856334835 2856328259 Bacteria 6528202
656 2856341614 2856334872 Bacteria 7037011
657 2856347343 2856342000 Bacteria 7176905
658 2856355457 2856349417 Bacteria 6230045
659 2856362642 2856356410 Bacteria 6297484
660 2856368035 2856364286 Bacteria 6939991
661 2857351843 2857349434 Bacteria 7926032
662 2857371263 2857367948 Bacteria 6965560
663 2857518953 2857516855 Bacteria 7787325
664 2858803196 2858800743 Bacteria 6603254
665 2869163833 2869162929 Bacteria 6399702
666 2869241551 2869234852 Bacteria 6654993
667 2869247874 2869242130 Bacteria 6609239
668 2869251591 2869249662 Bacteria 6868783
669 2869260134 2869256925 Bacteria 6981691
670 2869265207 2869264136 Bacteria 6880765
671 2869271906 2869271264 Bacteria 6908218
672 2869282627 2869278585 Bacteria 7077053
673 2869290346 2869285874 Bacteria 6901219
674 2871432630 2871429161 Bacteria 6547891
675 2871436953 2871435913 Bacteria 6880295
676 2871452301 2871451962 Bacteria 7336357
677 2871460329 2871459585 Bacteria 6866887
678 2871472024 2871466892 Bacteria 6923287
679 2871474826 2871474448 Bacteria 6806570
680 2871484516 2871481445 Bacteria 6700002
681 2871493248 2871488783 Bacteria 6929816
682 2871496773 2871495908 Bacteria 6935695
683 2874108815 2874102143 Bacteria 6342645
684 2874122146 2874116593 Bacteria 6674494
685 2874124091 2874123672 Bacteria 7238285
686 2874134836 2874131515 Bacteria 6820270
687 2874142283 2874139085 Bacteria 7021506
688 2874152597 2874146452 Bacteria 7533118
689 2874159997 2874155637 Bacteria 6724144
690 2874167987 2874162495 Bacteria 6174670
691 2874174816 2874168670 Bacteria 8062617
692 2876365179 2876363079 Bacteria 6544991
693 2876377772 2876369609 Bacteria 6807521
694 2876384842 2876377896 Bacteria 6565995
695 2876387476 2876386047 Bacteria 6698674
696 2876397994 2876392853 Bacteria 6660880
697 2876402830 2876399893 Bacteria 6927900
698 2876410727 2876406927 Bacteria 6191900
699 2876418513 2876413966 Bacteria 6831344
700 2876424288 2876420981 Bacteria 6687741
701 2878735459 2878730984 Bacteria 6380721
702 2878744533 2878738818 Bacteria 7136951
703 2878750244 2878745973 Bacteria 6867388
704 2878757293 2878753008 Bacteria 6922523
705 2878760997 2878760144 Bacteria 6823465
706 2878767961 2878767105 Bacteria 6898628
707 2878778623 2878774303 Bacteria 6108671
708 2878787598 2878781027 Bacteria 6834456
709 2878794980 2878788777 Bacteria 6567085
710 2881149892 2881147464 Bacteria 7779814
711 2881161040 2881155292 Bacteria 6461656
712 2881166773 2881161766 Bacteria 7127907
713 2881848054 2881845957 Bacteria 6611900
714 2881853881 2881853255 Bacteria 6698367
715 2881866787 2881861095 Bacteria 7128710
716 2882632533 2882632389 Bacteria 8154593
717 2882917489 2882912400 Bacteria 6801539
718 2885308289 2885305155 Bacteria 7348390
719 2885312917 2885312484 Bacteria 6415165
720 2885319789 2885318864 Bacteria 6729568
721 2885329761 2885326080 Bacteria 7134805
722 2885334736 2885334103 Bacteria 7216818
723 2885355399 2885350715 Bacteria 6787678
724 2888338295 2888337043 Bacteria 6629336
725 2888345898 2888343758 Bacteria 6611049
726 2888355131 2888350351 Bacteria 7372807
727 2889010107 2889010040 Bacteria 6749192
728 2889018220 2889016732 Bacteria 6700763
729 2889791348 2889790730 Bacteria 5689708
730 2889919085 2889914905 Bacteria 5702301
731 2891049189 2891048133 Bacteria 4447501
732 2891377556 2891373044 Bacteria 5202277
733 2894655584 2894652903 Bacteria 4587256
734 2894818569 2894817345 Bacteria 4892941
735 2896386404 2896384573 Bacteria 7700774
736 2899792858 2899792073 Bacteria 4926588
737 2899845418 2899845264 Bacteria 5672268
738 2903450179 2903448605 Bacteria 7357801
739 2903501020 2903492973 Bacteria 13473544
740 2903504462 2903492973 Bacteria 13473544
741 2903522086 2903521522 Bacteria 6525694
742 2903528464 2903528002 Bacteria 6586099
743 2903541569 2903540706 Bacteria 7062119
744 2904582277 2904578770 Bacteria 5302906
745 2904664645 2904659560 Bacteria 6685615
746 2906312602 2906308376 Bacteria 6841989
747 2906325311 2906321335 Bacteria 6579571
748 2906330709 2906328253 Bacteria 6585166
749 2906369660 2906363423 Bacteria 6856682
750 2906373345 2906370794 Bacteria 6881062
751 2906384637 2906378014 Bacteria 6911440
752 2906389932 2906386501 Bacteria 5977019
753 2906402527 2906401398 Bacteria 6693206
754 2906411326 2906408224 Bacteria 6162342
755 2913299801 2913295892 Bacteria 6333755
756 2915652006 2915650412 Bacteria 4288180
757 2915980505 2915980308 Bacteria 6624279
758 2915987421 2915986958 Bacteria 6739310
759 2915996699 2915993759 Bacteria 7016183
760 2916005109 2916000859 Bacteria 6865702
761 2916014092 2916007675 Bacteria 6898660
762 2916016965 2916014648 Bacteria 6946486
763 2916026427 2916021584 Bacteria 6854472
764 2916029263 2916028427 Bacteria 6748433
765 2916038361 2916035215 Bacteria 6755766
766 2916044881 2916041962 Bacteria 6820487
767 2916049235 2916048683 Bacteria 6543552
768 2916058200 2916055098 Bacteria 6758838
769 2916067083 2916061851 Bacteria 6737736
770 2916073982 2916068649 Bacteria 6943657
771 2916080368 2916076590 Bacteria 6596108
772 2919104512 2919100787 Bacteria 7710546
773 2919117008 2919114240 Bacteria 5700270
774 2919122941 2919119836 Bacteria 5208557
775 2919169828 2919166419 Bacteria 4952238
776 2919173340 2919171160 Bacteria 6499771
777 2919410626 2919408235 Bacteria 6149349
778 2920760820 2920760137 Bacteria 7427611
779 2920828534 2920822456 Bacteria 6897201
780 2921202251 2921201388 Bacteria 6926299
781 2921213333 2921208531 Bacteria 6745326
782 2921242334 2921237296 Bacteria 6876710
783 2921247758 2921244191 Bacteria 6568419
784 2921255339 2921250672 Bacteria 6677771
785 2921260138 2921257292 Bacteria 6808382
786 2921266133 2921263974 Bacteria 6864552
787 2921288337 2921282425 Bacteria 6826397
788 2921294715 2921289301 Bacteria 7316391
789 2921298721 2921296804 Bacteria 7176999
790 2922165226 2922158528 Bacteria 6573167
791 2922172770 2922172374 Bacteria 6167644
792 2922190610 2922185730 Bacteria 7113964
793 2923558799 2923556063 Bacteria 6793593
794 2924148251 2924144063 Bacteria 6883928
795 2924152279 2924150972 Bacteria 7169444
796 2924164027 2924158325 Bacteria 7188855
797 2924168665 2924165586 Bacteria 7260590
798 2924176928 2924172951 Bacteria 6749356
799 2924183815 2924179722 Bacteria 6843264
800 2924189984 2924186466 Bacteria 6876637
801 2924193727 2924193448 Bacteria 6955718
802 2924202681 2924200457 Bacteria 6757188
803 2924213451 2924207177 Bacteria 6917007
804 2924220314 2924214083 Bacteria 7080103
805 2924221814 2924221636 Bacteria 7113495
806 2924232446 2924228884 Bacteria 6633132
807 2924719828 2924718760 Bacteria 6331356
808 2924727508 2924726620 Bacteria 6271473
809 2924737905 2924733363 Bacteria 7574837
810 2924745802 2924741084 Bacteria 6661321
811 2924762454 2924754689 Bacteria 6774424
812 2924768114 2924762789 Bacteria 6561353
813 2924782563 2924776078 Bacteria 7492003
814 2924786598 2924784321 Bacteria 7416538
815 2926758521 2926754445 Bacteria 5964435
816 2926763947 2926760298 Bacteria 5505990
817 2928524217 2928521798 Bacteria 4960112
818 2933009457 2933006813 Bacteria 4912075
819 2933013595 2933011516 Bacteria 5439334
820 2933020628 2933016740 Bacteria 6355406
821 2933574619 2933570622 Bacteria 7023390
822 2933589224 2933586486 Bacteria 7667493
823 2933598152 2933594066 Bacteria 5594265
824 2933603588 2933599457 Bacteria 5858799
825 2935899784 2935894831 Bacteria 6620579
826 2935906948 2935901341 Bacteria 7341747
827 2936374921 2936367885 Bacteria 7324495
828 2936380612 2936375103 Bacteria 6652732
829 2936382213 2936381700 Bacteria 7006523
830 2936999992 2936996657 Bacteria 6298727
831 2937007036 2937002841 Bacteria 6934057
832 2937015505 2937009748 Bacteria 6746052
833 2937018225 2937016420 Bacteria 6782579
834 2937026754 2937023124 Bacteria 6815156
835 2937033053 2937029754 Bacteria 6424026
836 2937042165 2937036028 Bacteria 6846469
837 2937047861 2937042894 Bacteria 6741576
838 2937052392 2937049772 Bacteria 6757901
839 2937062188 2937056579 Bacteria 7107896
840 2937069412 2937063883 Bacteria 7199456
841 2937078279 2937071275 Bacteria 6984483
842 2937078572 2937078374 Bacteria 6610289
843 2937087249 2937084907 Bacteria 6618516
844 2937093444 2937091812 Bacteria 6979387
845 2937102264 2937098957 Bacteria 7249374
846 2937111362 2937106411 Bacteria 6947143
847 2937114890 2937113482 Bacteria 6505872
848 2937123649 2937119839 Bacteria 6597547
849 2937129373 2937126314 Bacteria 6771275
850 2937819253 2937813078 Bacteria 7783518
851 2937827804 2937822353 Bacteria 7290551
852 2937842648 2937836603 Bacteria 6811263
853 2937852032 2937848649 Bacteria 6983481
854 2937862691 2937861824 Bacteria 6660327
855 2937876295 2937868953 Bacteria 6639878
856 2937881206 2937877337 Bacteria 7246526
857 2937893821 2937891427 Bacteria 6357007
858 2937977296 2937972304 Bacteria 7532020
859 2937982519 2937980651 Bacteria 6517427
860 2937995426 2937994558 Bacteria 7036190
861 2938021136 2938014810 Bacteria 6700592
862 2941501741 2941499720 Bacteria 7599444
863 2954013164 2954011201 Bacteria 4762601
864 2957377497 2957375807 Bacteria 6425588
865 2957386134 2957382221 Bacteria 6737050
866 2957392113 2957388812 Bacteria 6778072
867 2957398453 2957395598 Bacteria 6822399
868 2957406315 2957402308 Bacteria 6741770
869 2957409068 2957408893 Bacteria 6558585
870 2957419927 2957415311 Bacteria 6991633
871 2957429404 2957422303 Bacteria 7172205
872 2957435006 2957430029 Bacteria 7022557
873 2957437330 2957437181 Bacteria 6568994
874 2957449498 2957443900 Bacteria 6869977
875 2957456287 2957450854 Bacteria 6765715
876 2957459054 2957457609 Bacteria 6967680
877 2957468355 2957464669 Bacteria 6568877
878 2957475155 2957471148 Bacteria 6797643
879 2957481151 2957478035 Bacteria 6756658
880 2957487560 2957484790 Bacteria 6703082
881 2957495323 2957491536 Bacteria 6695180
882 2957503538 2957498199 Bacteria 7126688
883 2957508703 2957505466 Bacteria 7253085
884 2958039410 2958034702 Bacteria 6989922
885 2958052962 2958041894 Bacteria 13082850
886 2958056449 2958041894 Bacteria 13082850
887 2958064917 2958064165 Bacteria 7158582
888 2958073754 2958071322 Bacteria 6815895
889 2958088237 2958084443 Bacteria 7312792
890 2958102181 2958100919 Bacteria 6800575
891 2958115487 2958115193 Bacteria 6923548
892 2958129448 2958122699 Bacteria 7280457
893 2958134734 2958130278 Bacteria 6897202
894 2958139938 2958137437 Bacteria 6050276
895 2958151020 2958144490 Bacteria 6677056
896 2958158728 2958158011 Bacteria 6058449
897 2958165899 2958165035 Bacteria 6906348
898 2958174115 2958172287 Bacteria 6716688
899 2958186486 2958179912 Bacteria 6874908
900 2960589192 2960584000 Bacteria 6864594
901 2960591220 2960591022 Bacteria 6622873
902 2960601292 2960597568 Bacteria 6550735
903 2960608318 2960603979 Bacteria 6898737
904 2960616648 2960610863 Bacteria 6691244
905 2960623497 2960617483 Bacteria 6727748
906 2960626583 2960624210 Bacteria 6875384
907 2960635073 2960631154 Bacteria 6732508
908 2960639111 2960637947 Bacteria 7296468
909 2960650106 2960645483 Bacteria 7211087
910 2960656714 2960652885 Bacteria 7083688
911 2960665325 2960660292 Bacteria 7041660
912 2960671547 2960667422 Bacteria 6763020
913 2960678305 2960674078 Bacteria 6609048
914 2960681301 2960680706 Bacteria 6624464
915 2960692406 2960687367 Bacteria 6535474
916 2960696407 2960693952 Bacteria 6749742
917 2961084985 2961077736 Bacteria 7079850
918 2961119643 2961114664 Bacteria 6680456
919 2961133139 2961127735 Bacteria 7196641
920 2961137250 2961136820 Bacteria 6775228
921 2961164362 2961163497 Bacteria 6901077
922 2961175378 2961170736 Bacteria 7072258
923 2961190230 2961183825 Bacteria 6688536
924 2963646634 2963644680 Bacteria 6530403
925 2964612960 2964607997 Bacteria 7101408
926 2964620452 2964615318 Bacteria 6809089
927 2964628504 2964621998 Bacteria 6834995
928 2964633550 2964628898 Bacteria 7083044
929 2964641266 2964636051 Bacteria 7091832
930 2964647292 2964643177 Bacteria 6820887
931 2964652316 2964649959 Bacteria 6675118
932 2964657749 2964656573 Bacteria 7100150
933 2964670056 2964663802 Bacteria 7019362
934 2964675034 2964670856 Bacteria 6851364
935 2964681842 2964678106 Bacteria 6792020
936 2964688181 2964685014 Bacteria 6839111
937 2964697653 2964691889 Bacteria 6802758
938 2964703009 2964698721 Bacteria 6765331
939 2964712103 2964705432 Bacteria 7114648
940 2964717491 2964712639 Bacteria 6695970
941 2964720496 2964719344 Bacteria 7286602
942 2965019348 2965018300 Bacteria 6883036
943 2965027590 2965025482 Bacteria 6532201
944 2965033270 2965032056 Bacteria 6887443
945 2965043468 2965040258 Bacteria 6855979
946 2965048960 2965047637 Bacteria 6623551
947 2965062511 2965062239 Bacteria 7412989
948 2965089583 2965089291 Bacteria 6866420
949 2965123051 2965119406 Bacteria 6956431
950 2967665319 2967664464 Bacteria 6948836
951 2967674399 2967671571 Bacteria 7021409
952 2967684098 2967678726 Bacteria 7264382
953 2967689361 2967686174 Bacteria 6678622
954 2967696210 2967693043 Bacteria 6804451
955 2967700956 2967699805 Bacteria 6854538
956 2967710054 2967706974 Bacteria 7186053
957 2967720028 2967714385 Bacteria 7000047
958 2967724842 2967721400 Bacteria 7073753
959 2967732545 2967728569 Bacteria 6641507
960 2967735336 2967735183 Bacteria 6827012
961 2967747254 2967742019 Bacteria 6794534
962 2967752391 2967748971 Bacteria 6733771
963 2967758889 2967755722 Bacteria 6814706
964 2967768524 2967762386 Bacteria 6923502
965 2967772790 2967769361 Bacteria 6587838
966 2967776408 2967775926 Bacteria 6738189
967 2967999620 2967996073 Bacteria 6787468
968 2968007978 2968003550 Bacteria 6929263
969 2968020737 2968016561 Bacteria 7022047
970 2968090573 2968083720 Bacteria 7351627
971 2968094745 2968091066 Bacteria 6052692
972 2968103112 2968097103 Bacteria 6107094
973 2968115898 2968110612 Bacteria 6814636
974 2968119285 2968117919 Bacteria 6536078
975 2968133685 2968128360 Bacteria 6270294
976 2968142667 2968138860 Bacteria 6605449
977 2968172763 2968171901 Bacteria 6894245
978 2970022229 2970019648 Bacteria 7072033
979 2970028246 2970026789 Bacteria 6785236
980 2970039590 2970033650 Bacteria 7118744
981 2970043450 2970040964 Bacteria 6731123
982 2970050592 2970047711 Bacteria 7088379
983 2970058424 2970054988 Bacteria 6611507
984 2970066855 2970061556 Bacteria 7099761
985 2970073985 2970068827 Bacteria 7123112
986 2970079168 2970076120 Bacteria 6697332
987 2970083475 2970082768 Bacteria 6183754
988 2970090085 2970088815 Bacteria 6933825
989 2970100404 2970095765 Bacteria 6936963
990 2970108915 2970102677 Bacteria 6812532
991 2970112744 2970109326 Bacteria 6863976
992 2970121297 2970116247 Bacteria 6501857
993 2970126522 2970122695 Bacteria 6625855
994 2970134385 2970129317 Bacteria 6806560
995 2970141260 2970136068 Bacteria 7207982
996 2970146574 2970143518 Bacteria 6446480
997 2970152767 2970149975 Bacteria 6779706
998 2970163621 2970156795 Bacteria 7168044
999 2970166774 2970164137 Bacteria 6861252
1000 2970173433 2970170962 Bacteria 6876229
1001 2970180727 2970177841 Bacteria 6768001
1002 2970187705 2970184632 Bacteria 7054431
1003 2970195114 2970191845 Bacteria 7032787
1004 2970474034 2970469710 Bacteria 6969209
1005 2970490673 2970489779 Bacteria 6517260
1006 2970507966 2970503327 Bacteria 7099517
1007 2970515331 2970510686 Bacteria 7006402
1008 2970527352 2970524798 Bacteria 6840927
1009 2970544680 2970540015 Bacteria 6977556
1010 2970552291 2970547951 Bacteria 6931819
1011 2970555855 2970554993 Bacteria 6814252
1012 2970597236 2970593180 Bacteria 7073582
1013 2970632740 2970627176 Bacteria 6680862
1014 2977523701 2977516862 Bacteria 6940108
1015 2977528067 2977523885 Bacteria 6960446
1016 2977534297 2977530762 Bacteria 6951399
1017 2977541055 2977537788 Bacteria 6929320
1018 2977548039 2977544691 Bacteria 6875412
1019 2977556935 2977551784 Bacteria 7125765
1020 2977563989 2977558990 Bacteria 6863948
1021 2977567213 2977565890 Bacteria 6901543
1022 2977576067 2977572785 Bacteria 6763888
1023 2977579798 2977579622 Bacteria 6772100
1024 2977826452 2977821940 Bacteria 6906439
1025 2977830304 2977828996 Bacteria 7007971
1026 2977848390 2977843712 Bacteria 6753583
1027 2977855562 2977851361 Bacteria 6694324
1028 2977865142 2977864932 Bacteria 7534097
1029 2977880107 2977872689 Bacteria 7270173
1030 2977906728 2977898635 Bacteria 6675551
1031 2977913904 2977907340 Bacteria 6577984
1032 2977916608 2977915119 Bacteria 6829656
1033 2977922954 2977922695 Bacteria 6956781
1034 2977940300 2977935797 Bacteria 6252826
1035 2977944763 2977942078 Bacteria 7570577
1036 2977952130 2977950692 Bacteria 6893264
1037 2977962328 2977957713 Bacteria 6877875
1038 2977974297 2977971508 Bacteria 7472917
1039 2977987806 2977986579 Bacteria 6581278
1040 2978972244 2978969890 Bacteria 5400756
1041 2979090955 2979089926 Bacteria 5670289
1042 2979102215 2979100975 Bacteria 5423623
1043 2979713893 2979710463 Bacteria 6785254
1044 2979751324 2979742915 Bacteria 7301278
1045 2979770656 2979764755 Bacteria 6610066
1046 2979779282 2979772303 Bacteria 6618277
1047 2979785294 2979779861 Bacteria 6219781
1048 2979797575 2979793036 Bacteria 6808957
1049 2979813150 2979808191 Bacteria 7179355
1050 2984509837 2984509177 Bacteria 5274802
1051 2984519466 2984518228 Bacteria 5277463
1052 2984538176 2984537506 Bacteria 5277481
1053 2984604928 2984601300 Bacteria 5455244
1054 2987639027 2987636660 Bacteria 8088555
1055 2987647027 2987645492 Bacteria 6117018
1056 2987656065 2987652177 Bacteria 6969023
1057 2987660366 2987659509 Bacteria 6966464
1058 2987671464 2987666974 Bacteria 6509233
1059 2987680976 2987673487 Bacteria 6884027
1060 2989354690 2989349275 Bacteria 6349068
1061 2989773477 2989771324 Bacteria 5605128
1062 2995395481 2995392953 Bacteria 4539380
1063 2996312116 2996310559 Bacteria 6357320
1064 2996338742 2996336353 Bacteria 5511628
1065 2996344242 2996341866 Bacteria 6643098
1066 2996352646 2996348954 Bacteria 7239054
1067 2996389996 2996386984 Bacteria 6978667
1068 2996890605 2996887358 Bacteria 5795980
1069 2996896325 2996893221 Bacteria 5823108
1070 3000139601 3000135777 Bacteria 6891109
1071 3003934884 3003930520 Bacteria 5667563
1072 3004167629 3004167301 Bacteria 8330599
1073 3004189417 3004188549 Bacteria 6952365
1074 3004203215 3004195979 Bacteria 6776956
1075 3004204730 3004203850 Bacteria 7307914
1076 3004218031 3004211236 Bacteria 7417683
1077 3004220921 3004218560 Bacteria 7421728
1078 3004234123 3004232784 Bacteria 6662140
1079 3004244116 3004239961 Bacteria 6892290
1080 3004249889 3004248173 Bacteria 6563236
1081 3004273930 3004268573 Bacteria 7043476
1082 3004279328 3004275668 Bacteria 7114440
1083 3004289268 3004289098 Bacteria 6135450
1084 3004335769 3004334049 Bacteria 8449246
1085 3005415545 3005409236 Bacteria 7188837
1086 3005418538 3005416602 Bacteria 7064308
1087 3005449227 3005445848 Bacteria 6906074
1088 3005455493 3005452660 Bacteria 5889319
1089 639649951 639633055 Bacteria 7751309
1090 643827039 643692032 Bacteria 6891900
1091 648735890 648276728 Bacteria 6968865
1092 649871768 649633066 Bacteria 6690028
1093 650843405 650716007 Bacteria 5573770
1094 8002291641 8002285264 Bacteria 6717907
1095 8003573002 8003570095 Bacteria 5747666
1096 8003994920 8003992118 Bacteria 7266902
1097 8004002674 8003999396 Bacteria 7063185
1098 8004302666 8004300914 Bacteria 6132239
1099 8004314180 8004312739 Bacteria 7444653
1100 8004362199 8004361976 Bacteria 6858373
1101 8004378868 8004374579 Bacteria 6898112
1102 8004392552 8004387939 Bacteria 7049250
1103 8004399313 8004395343 Bacteria 6620908
1104 8004449135 8004445564 Bacteria 6322258
1105 8004633395 8004633249 Bacteria 6723080
1106 8004645156 8004640170 Bacteria 6723001
1107 8004699335 8004695233 Bacteria 6731676
1108 8004712081 8004703790 Bacteria 8006957
1109 8004718861 8004714634 Bacteria 6776161
1110 8004733726 8004727605 Bacteria 6643904
1111 8005264276 8005258706 Bacteria 6184835
1112 8005281950 8005275841 Bacteria 6929066
1113 8005288938 8005282627 Bacteria 6675747
1114 8005294320 8005289223 Bacteria 6634003
1115 8005306726 8005301065 Bacteria 6614431
1116 8005311217 8005307578 Bacteria 7395396
1117 8005318570 8005314921 Bacteria 7072929
1118 8005325132 8005321885 Bacteria 5795980
1119 8005378243 8005376324 Bacteria 6590079
1120 8005383892 8005382845 Bacteria 6732062
1121 8005401218 8005395548 Bacteria 6806915
1122 8005434170 8005430974 Bacteria 6689030
1123 8005464566 8005460587 Bacteria 7157962
1124 8005488547 8005484373 Bacteria 6297373
1125 8005501612 8005497431 Bacteria 6477605
1126 8005547187 8005542996 Bacteria 7077758
1127 8005558433 8005556819 Bacteria 6908598
1128 8005566723 8005563573 Bacteria 7153261
1129 8005574994 8005570704 Bacteria 6957481
1130 8005622969 8005619151 Bacteria 7030230
1131 8005631728 8005626139 Bacteria 6534237
1132 8005649014 8005645114 Bacteria 6950293
1133 8005673033 8005668836 Bacteria 6953162
1134 8005682254 8005682033 Bacteria 6726518
1135 8005693579 8005688590 Bacteria 6610080
1136 8005700806 8005695170 Bacteria 6912330
1137 8018133664 8018127388 Bacteria 7351159
1138 8018170167 8018163183 Bacteria 7277977
1139 8018178516 8018176218 Bacteria 6896178
1140 8023687601 8023680758 Bacteria 7729763
1141 8024481728 8024479707 Bacteria 6954785
1142 8024489304 8024486573 Bacteria 6540512
1143 8024505995 8024501048 Bacteria 6427847
1144 8046773274 8046767195 Bacteria 7547379
1145 8049295896 8049293176 Bacteria 6128433
1146 8054463428 8054460903 Bacteria 4872905
1147 8054558557 8054558443 Bacteria 5204801
1148 8055619442 8055617313 Bacteria 7548464
1149 8056381533 8056375014 Bacteria 7006639
1150 8056386966 8056382006 Bacteria 6408074
1151 8056876122 8056875544 Bacteria 4355797
1152 8057580991 8057575449 Bacteria 7367519
1153 8057876774 8057874678 Bacteria 7494653
1154 JGI25156J39149_1000215
1155 JGI25154J39366_1000169
1156 JGI25158J39367_1000249
1157 JGI25157J39369_1000226
1158 JGI25152J39213_1001612
1159 JGI25152J39213_1002985
1160 JGI25152J39213_1005237
1161 JGI25152J39213_1010984
1162 JGI25150J39212_1000142
1163 JGI25159J45721_1000018
1164 JGI25159J45721_1000470
1165 JGI25159J45721_1006331
1166 JGI25151J46595_10000031
1167 JGI25151J46595_10001034
1168 JGI25151J46595_10009744
1169 JGI25151J46595_10027348
1170 JGI25406J46586_10023766
1171 JGI25165J46597_1000042
1172 JGI25165J46597_1000443
1173 JGI25165J46597_1001071
1174 JGI25153J46596_10002913
1175 JGI25160J50197_1000009
1176 JGI25160J50197_1000114
1177 JGI25160J50197_1000966
1178 JGI25160J50197_1011262
1179 JGI25161J50226_1000089
1180 JGI25161J50226_1000114
1181 JGI25161J50226_1000913
1182 Ga0055542_1000981
1183 Ga0055529_1001600
1184 Ga0055526_1004043
1185 Ga0055526_1006122
1186 Ga0055524_1001259
1187 Ga0055524_1001626
1188 Ga0055524_1006998
1189 Ga0055536_1002677
1190 Ga0055536_1012610
1191 Ga0055528_1010323
1192 Ga0055530_10011658
1193 Ga0055540_1006389
1194 Ga0055531_10007080
1195 Ga0055531_10034399
1196 Ga0058692_1000707
1197 Ga0058692_1000793
1198 Ga0055543_1000002
1199 Ga0055543_1000077
1200 Ga0055543_1000379
1201 Ga0055543_1002703
1202 Ga0065165_1000020
1203 Ga0065165_1000537
1204 Ga0065165_1004996
1205 Ga0070670_100002407
1206 Ga0070668_100031812
1207 Ga0070669_100034905
1208 Ga0070671_100036933
1209 Ga0070663_100042275
1210 Ga0070665_100005334
1211 Ga0068854_100071940
1212 Ga0081539_10002331
1213 Ga0075365_10000532
1214 Ga0075365_10027524
1215 Ga0075365_10044706
1216 Ga0075365_10094439
1217 Ga0075368_10000376
1218 Ga0075363_100000028
1219 Ga0075363_100016943
1220 Ga0075364_10010752
1221 Ga0075364_10028420
1222 Ga0075362_10002625
1223 Ga0075367_10062652
1224 Ga0075369_10005611
1225 Ga0075369_10054563
1226 Ga0075366_10016141
1227 Ga0075370_10001799
1228 Ga0075370_10032952
1229 Ga0079104_1002954
1230 Ga0079104_1003793
1231 Ga0099826_10016302
1232 Ga0105240_10000019
1233 Ga0105243_10006006
1234 Ga0105248_10215580
1235 Ga0105238_10005636
1236 Ga0123342_1007669
1237 Ga0105239_10006306
1238 Ga0105239_10157357
1239 Ga0157373_10026296
1240 Ga0157371_10000002
1241 Ga0157370_10000246
1242 Ga0157370_10047724
1243 Ga0171463_1006
1244 Ga0183363_1018
1245 Ga0214544_1001241
1246 Ga0214542_1000115
1247 Ga0214543_1000008
1248 Ga0214543_1000098
1249 Ga0228711_1000003
1250 Ga0228710_1000003
1251 Ga0209435_100005
1252 Ga0209436_100050
1253 Ga0209437_100078
1254 Ga0209437_100291
1255 Ga0207425_1000070
1256 Ga0207425_1001972
1257 Ga0209646_1000011
1258 Ga0209026_1000008
1259 Ga0209026_1000029
1260 Ga0209677_100524
1261 Ga0209148_1000080
1262 Ga0209148_1005812
1263 Ga0209759_1000004
1264 Ga0209759_1000040
1265 Ga0209129_1000080
1266 Ga0209129_1003444
1267 Ga0209233_1000028
1268 Ga0209233_1000157
1269 Ga0209233_1000192
1270 Ga0209233_1000194
1271 Ga0209455_1000171
1272 Ga0209673_1000037
1273 Ga0209673_1000060
1274 Ga0209673_1000312
1275 Ga0209673_1000439
1276 Ga0209673_1003294
1277 Ga0209673_1004728
1278 Ga0209130_1000030
1279 Ga0209130_1000037
1280 Ga0209130_1000083
1281 Ga0209676_1000239
1282 Ga0209676_1010437
1283 Ga0209025_1000052
1284 Ga0209025_1000083
1285 Ga0209025_1000196
1286 Ga0209025_1000255
1287 Ga0209025_1000389
1288 Ga0209025_1003226
1289 Ga0209025_1007724
1290 Ga0209025_1014510
1291 Ga0209025_1021093
1292 Ga0209564_1000086
1293 Ga0209564_1000116
1294 Ga0209564_1000125
1295 Ga0209564_1000281
1296 Ga0209758_1000090
1297 Ga0209758_1000357
1298 Ga0209758_1000621
1299 Ga0209758_1000657
1300 Ga0209758_1001459
1301 Ga0209758_1017627
1302 Ga0209050_1005669
1303 Ga0209050_1008097
1304 Ga0209256_1000276
1305 Ga0209256_1002576
1306 Ga0209256_1002625
1307 Ga0209256_1004253
1308 Ga0209256_1006950
1309 Ga0209256_1008128
1310 Ga0207426_1000047
1311 Ga0207426_1000048
1312 Ga0207426_1000173
1313 Ga0207426_1000268
1314 Ga0207426_1000984
1315 Ga0209051_1000874
1316 Ga0209051_1003034
1317 Ga0209051_1005608
1318 Ga0209051_1008583
1319 Ga0209257_1001192
1320 Ga0209257_1005971
1321 Ga0207705_10015368
1322 Ga0207695_10000049
1323 Ga0207671_10000860
1324 Ga0207671_10007609
1325 Ga0207694_10031647
1326 Ga0207650_10009773
1327 Ga0207644_10021552
1328 Ga0207711_10128597
1329 Ga0207640_10039577
1330 Ga0207640_10152046
1331 Ga0207678_10075566
1332 Ga0207678_10081149
1333 Ga0209281_1000081
1334 Ga0209281_1000269
1335 Ga0209371_1000003
1336 Ga0209371_1001136
1337 Ga0209371_1005797
1338 Ga0209282_1000040
1339 Ga0209282_1000870
1340 Ga0268266_10024157
1341 Ga0268266_10047949
1342 Ga0307515_10000263
1343 Ga0307515_10000386
1344 Ga0307515_10049328
1345 Ga0268256_1000004
1346 Ga0268256_1004149
1347 Ga0268256_1007306
1348 Ga0307513_10015647
1349 Ga0307513_10022547
1350 Ga0307408_100093977
1351 Ga0307516_10039908
1352 Ga0307406_10005532
1353 Ga0307406_10078406
1354 Ga0307412_10003898
1355 Ga0315914_1000002
1356 Ga0315913_1000016
1357 Ga0315915_1000005
1358 Ga0373927_0000095
1359 Ga0373925_0001900
1360 Ga0395905_0000479
1361 Ga0395905_0042590
1362 Ga0395901_0097607
1363 Ga0451841_0811656
1364 Ga0451845_0612574
1365 Ga0451847_0787006
1366 Ga0451851_0687044
1367 Ga0466972_0004602
1368 Ga0466965_0032775
1369 Ga0466960_0009402
1370 Ga0495638_0000377
1371 Ga0495606_0001835
1372 Ga0495633_0016900
1373 Ga0495625_0025060
1374 Ga0495604_0021754
1375 Ga0495687_035816
1376 Ga0495681_0014334
1377 Ga0496116_0009050
1378 Ga0496116_0014212
1379 Ga0496117_0000052
1380 Ga0496118_0000709
1381 Ga0496118_0032794
1382 Ga0496119_0002287
1383 Ga0496119_0016179
1384 Ga0496119_0043664
1385 Ga0496120_0000019
1386 Ga0496120_0001370
1387 Ga0496120_0048589
1388 Ga0496121_0021259
1389 Ga0496122_0000024
1390 Ga0496122_0000053
1391 Ga0496122_0002990
1392 Ga0496122_0008551
1393 Ga0496122_0008795
1394 Ga0496123_0000038
1395 Ga0496123_0000063
1396 Ga0496123_0000086
1397 Ga0496123_0007881
1398 Ga0496123_0040184
1399 Ga0496124_0000139
1400 Ga0496124_0015328
1401 Ga0496125_0020651
1402 Ga0496126_0000763
1403 Ga0496126_0109258
1404 Ga0501031_0008039
1405 Ga0501032_0000007
1406 Ga0501032_0000248
1407 Ga0501032_0011413
1408 Ga0501033_0000051
1409 Ga0501033_0001374
1410 Ga0501033_0004047
1411 Ga0501033_0016361
1412 Ga0501034_0000029
1413 Ga0501034_0000507
1414 Ga0501034_0007241
1415 Ga0501036_0000004
1416 Ga0501036_0078483
1417 Ga0501037_0000004
1418 Ga0501037_0052678
1419 Ga0501038_0000005
1420 Ga0501038_0000238
1421 Ga0501038_0090618
1422 Ga0501039_0000009
1423 Ga0501039_0000073
1424 Ga0501039_0083683
1425 Ga0501042_0007394
1426 Ga0501043_0000214
1427 Ga0501043_0001215
1428 Ga0501046_0021719
1429 Ga0501047_0040490
1430 Ga0501047_0095191
1431 Ga0501048_0006373
1432 Ga0501068_0052683
1433 Ga0501069_0004063
1434 Ga0501070_0003212
1435 Ga0501070_0023667
1436 Ga0501070_0025370
1437 Ga0501070_0058097
1438 Ga0501070_0072673
1439 Ga0501072_0028309
1440 Ga0501073_0095743
1441 Ga0501080_0017096
1442 Ga0501035_0000014
1443 Ga0501035_0000189
1444 Ga0501035_0001928
1445 Ga0501035_0012975
1446 Ga0501035_0013614
1447 Ga0501044_0000012
1448 Ga0501044_0010493
1449 Ga0501044_0027624
1450 Ga0501044_0058787
1451 Ga0501044_0111683
1452 Ga0501044_0132916
1453 Ga0501044_0240757
1454 Ga0501045_0009505
1455 nmdc:mga03683_124_c1
1456 nmdc:mga03n38_17317_c1
1457 nmdc:mga00v17_141469_c1
1458 nmdc:mga00v17_55_c1
1459 nmdc:mga00v17_97909_c1
1460 nmdc:mga0yw44_11225_c1
1461 nmdc:mga0k408_3360_c1
1462 nmdc:mga06z11_103920_c1
1463 nmdc:mga06z11_33873_c1
1464 nmdc:mga07m45_50944_c1
1465 nmdc:mga0sz30_586_c1
1466 Ga0500578_0089628
1467 Ga0500658_0000067
1468 Ga0500561_0000105
1469 Ga0500568_0000177
1470 Ga0500616_0000526
1471 Ga0500616_0022183
1472 Ga0500624_000343
1473 Ga0500634_0074198
1474 Ga0500636_0000005
1475 Ga0500636_0001535
1476 Ga0587076_006715
1477 2551694173
1478 2503199964
1479 2509109796
1480 2509142586
1481 2509379052
1482 2509386430
1483 2509389893
1484 2509394875
1485 2509447861
1486 2510134794
1487 2510303637
1488 2510319258
1489 2510896200
1490 2511136607
1491 2511170730
1492 2511185144
1493 2511198455
1494 2511390326
1495 2511502944
1496 2512534187
1497 2512932568
1498 2512960582
1499 2512973977
1500 2513572559
1501 2513581274
1502 2513585271
1503 2513597123
1504 2513602305
1505 2513608680
1506 2513620107
1507 2513631367
1508 2513710698
1509 2513870860
1510 2513885852
1511 2513902872
1512 2513908241
1513 2513926895
1514 2513985968
1515 2513998048
1516 2514003948
1517 2514022383
1518 2514036328
1519 2514416492
1520 2514587536
1521 2515113879
1522 2515610395
1523 2515634752
1524 2515645946
1525 2515656827
1526 2515743606
1527 2516205190
1528 2516894349
1529 2517037495
1530 2517077794
1531 2517096593
1532 2517410309
1533 2517570959
1534 2520377898
1535 2524451816
1536 2524460118
1537 2530646904
1538 2535519494
1539 2537873711
1540 2551685992
1541 2551699892
1542 2551711433
1543 2551724071
1544 2551724961
1545 2551737980
1546 2551743385
1547 2554245186
1548 2558860370
1549 2559296984
1550 2585167985
1551 2585202525
1552 2585224834
1553 2585227768
1554 2585257758
1555 2585265410
1556 2585274236
1557 2585280351
1558 2585322629
1559 2585330742
1560 2585388509
1561 2585392385
1562 2585402164
1563 2585530223
1564 2585532581
1565 2585541067
1566 2585547390
1567 2585554403
1568 2585560685
1569 2585822536
1570 2585839829
1571 2585845285
1572 2585898891
1573 2585903517
1574 2585997091
1575 2586001690
1576 2587981364
1577 2588518647
1578 2597812130
1579 2599334782
1580 2599420611
1581 2599604685
1582 2599936433
1583 2600194594
1584 2601611169
1585 2601747942
1586 2616295508
1587 2616307348
1588 2616554892
1589 2617383564
1590 2643774406
1591 2643776560
1592 2643795007
1593 2643804129
1594 2643813205
1595 2643839068
1596 2643858208
1597 2643916910
1598 2643984875
1599 2644006349
1600 2644051074
1601 2644064929
1602 2644108528
1603 2644133247
1604 2644145574
1605 2644153202
1606 2644195828
1607 2644205554
1608 2644241809
1609 2644312349
1610 2644335977
1611 2644376129
1612 2644416602
1613 2644449642
1614 2644483978
1615 2644496331
1616 2644500240
1617 2644521226
1618 2644546834
1619 2644618032
1620 2644653462
1621 2644676791
1622 2644688217
1623 2657684027
1624 2671112141
1625 2688597214
1626 2692314552
1627 2694628723
1628 2694637363
1629 2719182551
1630 2719387221
1631 2719666861
1632 2719733270
1633 2720493281
1634 2720614756
1635 2720621529
1636 2720632857
1637 2720776581
1638 2721148664
1639 2721160050
1640 2721165478
1641 2721400856
1642 2722841648
1643 2723028169
1644 2723561800
1645 2723568429
1646 2723574416
1647 2724039669
1648 2724046026
1649 2724091188
1650 2724105694
1651 2724111523
1652 2725947781
1653 2730109105
1654 2730165786
1655 2730299682
1656 2738800509
1657 2739035620
1658 2739307517
1659 2753357261
1660 2753458658
1661 2756671504
1662 2757571318
1663 2758639667
1664 2765466354
1665 2766065370
1666 2770198989
1667 2776270256
1668 2778175958
1669 2792582590
1670 2792622952
1671 2792629206
1672 2792640442
1673 2792748001
1674 2793293697
1675 2793313120
1676 2793319768
1677 2793327725
1678 2793333318
1679 2793344259
1680 2793347324
1681 2793353648
1682 2793359784
1683 2793369501
1684 2802717951
1685 2802725198
1686 2802730678
1687 2802738025
1688 2802744105
1689 2802750984
1690 2804753283
1691 2805930544
1692 2805934276
1693 2806044608
1694 2806052808
1695 2806059108
1696 2806068229
1697 2806074349
1698 2808989056
1699 2819557183
1700 2819609653
1701 2819639750
1702 2819685620
1703 2837653394
1704 2838019057
1705 2838024347
1706 2838033080
1707 2838040715
1708 2838046304
1709 2838051225
1710 2838063799
1711 2838073282
1712 2838077391
1713 2838664898
1714 2838671192
1715 2838678277
1716 2838685009
1717 2838691372
1718 2838699154
1719 2838703628
1720 2838712635
1721 2838716817
1722 2838722573
1723 2838727566
1724 2838733331
1725 2838746097
1726 2839998296
1727 2840769132
1728 2841738119
1729 2841849172
1730 2841853809
1731 2841861768
1732 2841868222
1733 2842082112
1734 2842113486
1735 2842123034
1736 2842128079
1737 2842133170
1738 2842149370
1739 2842155164
1740 2842162184
1741 2842169739
1742 2842173663
1743 2842178785
1744 2842185110
1745 2842189924
1746 2842198308
1747 2842199890
1748 2842208251
1749 2842214238
1750 2842220128
1751 2842226957
1752 2842233548
1753 2842242063
1754 2842247641
1755 2842253992
1756 2842262091
1757 2842266562
1758 2842275846
1759 2842281740
1760 2842288847
1761 2842296112
1762 2842298656
1763 2842308170
1764 2842315547
1765 2842321444
1766 2842344950
1767 2842359477
1768 2842369998
1769 2842375687
1770 2842382511
1771 2842389912
1772 2842398570
1773 2842406486
1774 2842413087
1775 2842419730
1776 2842426916
1777 2842429881
1778 2842436459
1779 2842444162
1780 2842450980
1781 2842464302
1782 2842470788
1783 2842479813
1784 2842483441
1785 2842493222
1786 2842499210
1787 2842506989
1788 2842510684
1789 2842517966
1790 2842523153
1791 2842872296
1792 2842925909
1793 2844008585
1794 2844012591
1795 2844457546
1796 2847420396
1797 2847691097
1798 2848995202
1799 2850082268
1800 2852391141
1801 2854900291
1802 2854916739
1803 2854919541
1804 2855826984
1805 2855842380
1806 2855878477
1807 2856323076
1808 2856334835
1809 2856341614
1810 2856347343
1811 2856355457
1812 2856362642
1813 2856368035
1814 2857351843
1815 2857371263
1816 2857518953
1817 2858803196
1818 2869163833
1819 2869241551
1820 2869247874
1821 2869251591
1822 2869260134
1823 2869265207
1824 2869271906
1825 2869282627
1826 2869290346
1827 2871432630
1828 2871436953
1829 2871452301
1830 2871460329
1831 2871472024
1832 2871474826
1833 2871484516
1834 2871493248
1835 2871496773
1836 2874108815
1837 2874122146
1838 2874124091
1839 2874134836
1840 2874142283
1841 2874152597
1842 2874159997
1843 2874167987
1844 2874174816
1845 2876365179
1846 2876377772
1847 2876384842
1848 2876387476
1849 2876397994
1850 2876402830
1851 2876410727
1852 2876418513
1853 2876424288
1854 2878735459
1855 2878744533
1856 2878750244
1857 2878757293
1858 2878760997
1859 2878767961
1860 2878778623
1861 2878787598
1862 2878794980
1863 2881149892
1864 2881161040
1865 2881166773
1866 2881848054
1867 2881853881
1868 2881866787
1869 2882632533
1870 2882917489
1871 2885308289
1872 2885312917
1873 2885319789
1874 2885329761
1875 2885334736
1876 2885355399
1877 2888338295
1878 2888345898
1879 2888355131
1880 2889010107
1881 2889018220
1882 2889791348
1883 2889919085
1884 2891049189
1885 2891377556
1886 2894655584
1887 2894818569
1888 2896386404
1889 2899792858
1890 2899845418
1891 2903450179
1892 2903501020
1893 2903504462
1894 2903522086
1895 2903528464
1896 2903541569
1897 2904582277
1898 2904664645
1899 2906312602
1900 2906325311
1901 2906330709
1902 2906369660
1903 2906373345
1904 2906384637
1905 2906389932
1906 2906402527
1907 2906411326
1908 2913299801
1909 2915652006
1910 2915980505
1911 2915987421
1912 2915996699
1913 2916005109
1914 2916014092
1915 2916016965
1916 2916026427
1917 2916029263
1918 2916038361
1919 2916044881
1920 2916049235
1921 2916058200
1922 2916067083
1923 2916073982
1924 2916080368
1925 2919104512
1926 2919117008
1927 2919122941
1928 2919169828
1929 2919173340
1930 2919410626
1931 2920760820
1932 2920828534
1933 2921202251
1934 2921213333
1935 2921242334
1936 2921247758
1937 2921255339
1938 2921260138
1939 2921266133
1940 2921288337
1941 2921294715
1942 2921298721
1943 2922165226
1944 2922172770
1945 2922190610
1946 2923558799
1947 2924148251
1948 2924152279
1949 2924164027
1950 2924168665
1951 2924176928
1952 2924183815
1953 2924189984
1954 2924193727
1955 2924202681
1956 2924213451
1957 2924220314
1958 2924221814
1959 2924232446
1960 2924719828
1961 2924727508
1962 2924737905
1963 2924745802
1964 2924762454
1965 2924768114
1966 2924782563
1967 2924786598
1968 2926758521
1969 2926763947
1970 2928524217
1971 2933009457
1972 2933013595
1973 2933020628
1974 2933574619
1975 2933589224
1976 2933598152
1977 2933603588
1978 2935899784
1979 2935906948
1980 2936374921
1981 2936380612
1982 2936382213
1983 2936999992
1984 2937007036
1985 2937015505
1986 2937018225
1987 2937026754
1988 2937033053
1989 2937042165
1990 2937047861
1991 2937052392
1992 2937062188
1993 2937069412
1994 2937078279
1995 2937078572
1996 2937087249
1997 2937093444
1998 2937102264
1999 2937111362
2000 2937114890
2001 2937123649
2002 2937129373
2003 2937819253
2004 2937827804
2005 2937842648
2006 2937852032
2007 2937862691
2008 2937876295
2009 2937881206
2010 2937893821
2011 2937977296
2012 2937982519
2013 2937995426
2014 2938021136
2015 2941501741
2016 2954013164
2017 2957377497
2018 2957386134
2019 2957392113
2020 2957398453
2021 2957406315
2022 2957409068
2023 2957419927
2024 2957429404
2025 2957435006
2026 2957437330
2027 2957449498
2028 2957456287
2029 2957459054
2030 2957468355
2031 2957475155
2032 2957481151
2033 2957487560
2034 2957495323
2035 2957503538
2036 2957508703
2037 2958039410
2038 2958052962
2039 2958056449
2040 2958064917
2041 2958073754
2042 2958088237
2043 2958102181
2044 2958115487
2045 2958129448
2046 2958134734
2047 2958139938
2048 2958151020
2049 2958158728
2050 2958165899
2051 2958174115
2052 2958186486
2053 2960589192
2054 2960591220
2055 2960601292
2056 2960608318
2057 2960616648
2058 2960623497
2059 2960626583
2060 2960635073
2061 2960639111
2062 2960650106
2063 2960656714
2064 2960665325
2065 2960671547
2066 2960678305
2067 2960681301
2068 2960692406
2069 2960696407
2070 2961084985
2071 2961119643
2072 2961133139
2073 2961137250
2074 2961164362
2075 2961175378
2076 2961190230
2077 2963646634
2078 2964612960
2079 2964620452
2080 2964628504
2081 2964633550
2082 2964641266
2083 2964647292
2084 2964652316
2085 2964657749
2086 2964670056
2087 2964675034
2088 2964681842
2089 2964688181
2090 2964697653
2091 2964703009
2092 2964712103
2093 2964717491
2094 2964720496
2095 2965019348
2096 2965027590
2097 2965033270
2098 2965043468
2099 2965048960
2100 2965062511
2101 2965089583
2102 2965123051
2103 2967665319
2104 2967674399
2105 2967684098
2106 2967689361
2107 2967696210
2108 2967700956
2109 2967710054
2110 2967720028
2111 2967724842
2112 2967732545
2113 2967735336
2114 2967747254
2115 2967752391
2116 2967758889
2117 2967768524
2118 2967772790
2119 2967776408
2120 2967999620
2121 2968007978
2122 2968020737
2123 2968090573
2124 2968094745
2125 2968103112
2126 2968115898
2127 2968119285
2128 2968133685
2129 2968142667
2130 2968172763
2131 2970022229
2132 2970028246
2133 2970039590
2134 2970043450
2135 2970050592
2136 2970058424
2137 2970066855
2138 2970073985
2139 2970079168
2140 2970083475
2141 2970090085
2142 2970100404
2143 2970108915
2144 2970112744
2145 2970121297
2146 2970126522
2147 2970134385
2148 2970141260
2149 2970146574
2150 2970152767
2151 2970163621
2152 2970166774
2153 2970173433
2154 2970180727
2155 2970187705
2156 2970195114
2157 2970474034
2158 2970490673
2159 2970507966
2160 2970515331
2161 2970527352
2162 2970544680
2163 2970552291
2164 2970555855
2165 2970597236
2166 2970632740
2167 2977523701
2168 2977528067
2169 2977534297
2170 2977541055
2171 2977548039
2172 2977556935
2173 2977563989
2174 2977567213
2175 2977576067
2176 2977579798
2177 2977826452
2178 2977830304
2179 2977848390
2180 2977855562
2181 2977865142
2182 2977880107
2183 2977906728
2184 2977913904
2185 2977916608
2186 2977922954
2187 2977940300
2188 2977944763
2189 2977952130
2190 2977962328
2191 2977974297
2192 2977987806
2193 2978972244
2194 2979090955
2195 2979102215
2196 2979713893
2197 2979751324
2198 2979770656
2199 2979779282
2200 2979785294
2201 2979797575
2202 2979813150
2203 2984509837
2204 2984519466
2205 2984538176
2206 2984604928
2207 2987639027
2208 2987647027
2209 2987656065
2210 2987660366
2211 2987671464
2212 2987680976
2213 2989354690
2214 2989773477
2215 2995395481
2216 2996312116
2217 2996338742
2218 2996344242
2219 2996352646
2220 2996389996
2221 2996890605
2222 2996896325
2223 3000139601
2224 3003934884
2225 3004167629
2226 3004189417
2227 3004203215
2228 3004204730
2229 3004218031
2230 3004220921
2231 3004234123
2232 3004244116
2233 3004249889
2234 3004273930
2235 3004279328
2236 3004289268
2237 3004335769
2238 3005415545
2239 3005418538
2240 3005449227
2241 3005455493
2242 639649951
2243 643827039
2244 648735890
2245 649871768
2246 650843405
2247 8002291641
2248 8003573002
2249 8003994920
2250 8004002674
2251 8004302666
2252 8004314180
2253 8004362199
2254 8004378868
2255 8004392552
2256 8004399313
2257 8004449135
2258 8004633395
2259 8004645156
2260 8004699335
2261 8004712081
2262 8004718861
2263 8004733726
2264 8005264276
2265 8005281950
2266 8005288938
2267 8005294320
2268 8005306726
2269 8005311217
2270 8005318570
2271 8005325132
2272 8005378243
2273 8005383892
2274 8005401218
2275 8005434170
2276 8005464566
2277 8005488547
2278 8005501612
2279 8005547187
2280 8005558433
2281 8005566723
2282 8005574994
2283 8005622969
2284 8005631728
2285 8005649014
2286 8005673033
2287 8005682254
2288 8005693579
2289 8005700806
2290 8018133664
2291 8018170167
2292 8018178516
2293 8023687601
2294 8024481728
2295 8024489304
2296 8024505995
2297 8046773274
2298 8049295896
2299 8054463428
2300 8054558557
2301 8055619442
2302 8056381533
2303 8056386966
2304 8056876122
2305 8057580991
2306 8057876774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

12

156

0.99

PF16653

Sacchrp_dh_C

Saccharopine dehydrogenase C-terminal domain

160

385

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xr4-assembly1.cif.gz_B crystal structure of the homospermidine synthase (hss) from blastochloris viridis in complex with nad and agmatine 0.9558 6 479
4xq9-assembly1.cif.gz_A crystal structure of the homospermidine synthase (hss) from blastochloris viridis in complex with nad 0.9547 6 479
6s65-assembly1.cif.gz_A crystal structure of the homospermidine synthase (hss) variant n135f from blastochloris viridis in complex with nad 0.9545 6 479
6s72-assembly1.cif.gz_B crystal structure of the homospermidine synthase (hss) variant w229a from blastochloris viridis in complex with nad and put 0.9543 6 479
6sep-assembly1.cif.gz_B crystal structure of the homospermidine synthase (hss) variant w229e from blastochloris viridis in complex with nad 0.9542 6 479
ID Description Score Start End Superfamily
4tvbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 6 161 3.40.50.720
4tvbB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;homospermidine synthase like 0.9191 164 479 3.30.360.30
4tvbB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;homospermidine synthase like 0.901 164 479 3.30.360.30
2ph5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8907 11 161 3.40.50.720
4tvbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8281 6 161 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X6EJ82-F1-model_v4 deleted 0.9897 1 92
AF-A0A8B3P1N7-F1-model_v4 Homospermidine synthase 0.983 1 147
AF-A0A436HBG5-F1-model_v4 Homospermidine synthase 0.9811 1 115
AF-A0A3S1Q426-F1-model_v4 Homospermidine synthase 0.9806 1 122
AF-A0A2P5M1B1-F1-model_v4 Homospermidine synthase 0.9774 6 229

Map