F490899

General Info

Members Datasets Scaffolds Average Seq Length
1154 494 2308 132

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10028779|Ga0105241_100287794
Length 156
Sequence MMAPTFGRLPFRLTPRTAIGSETAMPHFTIEYSANMDKRVDMAKVVDVVRKAAVETGIFPLGGIRVRAIKCEHYAIADGNPDLGFLSMVLRLGEGRDLAARKKAGEHIFKALSSHLDPVFAQSKFALSFDMQINDKETSWKRNNIHEALKAEAAHG

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
91 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
92 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
195 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
202 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
203 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
207 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
208 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
213 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
232 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
236 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
262 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
263 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
264 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
321 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
325 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
326 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
327 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
328 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
340 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
341 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
342 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
343 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
360 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
403 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
404 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
409 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
410 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
411 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
412 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
413 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
416 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
417 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
420 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
421 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
424 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
425 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
426 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
427 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
428 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
429 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
430 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
431 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
432 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
433 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
434 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
435 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
436 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
437 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
438 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
439 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
440 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
441 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
442 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
443 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
444 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
445 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
446 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
447 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
448 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
449 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
450 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
451 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
452 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
453 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
454 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
457 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
458 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
459 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
460 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
462 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
463 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
464 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
465 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
466 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
467 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
468 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
469 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
470 2791355199
471 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
472 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
473 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
474 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
475 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
476 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
477 2904699407
478 2906610324
479 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
480 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
481 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
482 2922425934
483 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
484 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
485 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
486 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
487 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
488 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
489 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
490 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
491 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
492 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
493 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
494 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 0.43
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 2.51
Rhizoplane 5.2
Rhizosphere 77.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10028779 3300009174 Bacteria 4140
2 JGI25406J46586_10009343 3300003203 Bacteria 4392
3 JGI25165J46597_1011939 3300003214 Bacteria 1227
4 JGI25153J46596_10051467 3300003215 Bacteria 1179
5 JGI25404J52841_10003019 3300003659 Bacteria 3277
6 JGI25404J52841_10010753 3300003659 Bacteria 1969
7 JGI25404J52841_10016744 3300003659 Bacteria 1590
8 JGI25404J52841_10041444 3300003659 Bacteria 974
9 Ga0070658_10150878 3300005327 Bacteria 1946
10 Ga0070658_10362781 3300005327 Bacteria 1241
11 Ga0070676_10668089 3300005328 Bacteria 756
12 Ga0070683_100095571 3300005329 Bacteria 2794
13 Ga0070683_100306288 3300005329 Bacteria 1511
14 Ga0070683_101207674 3300005329 Bacteria 727
15 Ga0070683_101249715 3300005329 Bacteria 714
16 Ga0068869_100283829 3300005334 Bacteria 1332
17 Ga0068869_100411856 3300005334 Bacteria 1114
18 Ga0068869_101378147 3300005334 Bacteria 624
19 Ga0070680_100052018 3300005336 Bacteria 3343
20 Ga0070680_100194884 3300005336 Bacteria 1708
21 Ga0070680_100676728 3300005336 Bacteria 887
22 Ga0070682_100039753 3300005337 Bacteria 2891
23 Ga0070682_100175885 3300005337 Bacteria 1491
24 Ga0070682_100246809 3300005337 Bacteria 1285
25 Ga0070682_100503776 3300005337 Bacteria 939
26 Ga0068868_100034182 3300005338 Bacteria 3924
27 Ga0068868_100389483 3300005338 Bacteria 1200
28 Ga0068868_100548398 3300005338 Bacteria 1019
29 Ga0068868_100560813 3300005338 Bacteria 1008
30 Ga0070660_100051646 3300005339 Bacteria 3167
31 Ga0070687_100299556 3300005343 Bacteria 1020
32 Ga0070661_100328466 3300005344 Bacteria 1196
33 Ga0070661_100395995 3300005344 Bacteria 1091
34 Ga0070661_100556992 3300005344 Bacteria 923
35 Ga0070692_10391666 3300005345 Bacteria 875
36 Ga0070668_100044248 3300005347 Bacteria 3415
37 Ga0070668_100074675 3300005347 Bacteria 2645
38 Ga0070668_100207755 3300005347 Bacteria 1609
39 Ga0070668_100301249 3300005347 Bacteria 1344
40 Ga0070668_100481665 3300005347 Bacteria 1071
41 Ga0070668_100724073 3300005347 Bacteria 879
42 Ga0070669_100068986 3300005353 Bacteria 2611
43 Ga0070671_100342350 3300005355 Bacteria 1276
44 Ga0070671_100383792 3300005355 Bacteria 1201
45 Ga0070671_100708452 3300005355 Bacteria 873
46 Ga0070674_100034692 3300005356 Bacteria 3372
47 Ga0070688_100855168 3300005365 Bacteria 715
48 Ga0070659_100053918 3300005366 Bacteria 3166
49 Ga0070667_100236881 3300005367 Bacteria 1629
50 Ga0070667_100569881 3300005367 Bacteria 1042
51 Ga0070667_100623283 3300005367 Bacteria 995
52 Ga0070667_100797903 3300005367 Bacteria 876
53 Ga0070709_10004227 3300005434 Bacteria 7743
54 Ga0070709_10048345 3300005434 Bacteria 2654
55 Ga0070709_10311929 3300005434 Bacteria 1152
56 Ga0070714_100082971 3300005435 Bacteria 2793
57 Ga0070714_100280905 3300005435 Bacteria 1547
58 Ga0070714_100541466 3300005435 Bacteria 1114
59 Ga0070714_100551108 3300005435 Bacteria 1104
60 Ga0070713_100042275 3300005436 Bacteria 3719
61 Ga0070713_100088760 3300005436 Bacteria 2654
62 Ga0070713_100353933 3300005436 Bacteria 1363
63 Ga0070713_100363813 3300005436 Bacteria 1344
64 Ga0070710_10042080 3300005437 Bacteria 2524
65 Ga0070710_10179435 3300005437 Bacteria 1325
66 Ga0070711_100001730 3300005439 Bacteria 12117
67 Ga0070711_100011938 3300005439 Bacteria 5407
68 Ga0070711_100061879 3300005439 Bacteria 2607
69 Ga0070711_100131145 3300005439 Bacteria 1867
70 Ga0070711_100692074 3300005439 Bacteria 858
71 Ga0070705_100619464 3300005440 Bacteria 840
72 Ga0070700_100046080 3300005441 Bacteria 2692
73 Ga0070700_100755597 3300005441 Bacteria 778
74 Ga0070694_100787580 3300005444 Bacteria 779
75 Ga0070663_100010941 3300005455 Bacteria 5672
76 Ga0070663_100050917 3300005455 Bacteria 2947
77 Ga0070663_100068772 3300005455 Bacteria 2571
78 Ga0070663_100185086 3300005455 Bacteria 1618
79 Ga0070663_100891518 3300005455 Bacteria 768
80 Ga0070678_100010095 3300005456 Bacteria 5749
81 Ga0070678_100529455 3300005456 Bacteria 1044
82 Ga0070678_100647096 3300005456 Bacteria 948
83 Ga0070678_100700015 3300005456 Bacteria 913
84 Ga0070662_100031971 3300005457 Bacteria 3697
85 Ga0070662_100088266 3300005457 Bacteria 2324
86 Ga0070662_100457978 3300005457 Bacteria 1060
87 Ga0070662_100709265 3300005457 Bacteria 851
88 Ga0070681_10003273 3300005458 Bacteria 15113
89 Ga0070681_10025087 3300005458 Bacteria 6000
90 Ga0070681_10056849 3300005458 Bacteria 3893
91 Ga0070681_10065024 3300005458 Bacteria 3617
92 Ga0070681_10341341 3300005458 Bacteria 1408
93 Ga0068867_100250304 3300005459 Bacteria 1441
94 Ga0068867_100424557 3300005459 Bacteria 1127
95 Ga0070685_10729585 3300005466 Bacteria 725
96 Ga0070685_10756908 3300005466 Bacteria 713
97 Ga0070685_10911377 3300005466 Bacteria 655
98 Ga0070698_100536537 3300005471 Bacteria 1109
99 Ga0070698_101485996 3300005471 Bacteria 629
100 Ga0070699_101178226 3300005518 Bacteria 703
101 Ga0070679_100009864 3300005530 Bacteria 9035
102 Ga0070679_100017482 3300005530 Bacteria 6941
103 Ga0070679_100017715 3300005530 Bacteria 6896
104 Ga0070679_100036722 3300005530 Bacteria 4863
105 Ga0070679_100303056 3300005530 Bacteria 1548
106 Ga0070679_100865639 3300005530 Bacteria 847
107 Ga0070684_100013567 3300005535 Bacteria 6575
108 Ga0070684_100231212 3300005535 Bacteria 1688
109 Ga0070684_100338695 3300005535 Bacteria 1383
110 Ga0070684_100481400 3300005535 Bacteria 1149
111 Ga0070697_100328239 3300005536 Bacteria 1319
112 Ga0070697_100350906 3300005536 Bacteria 1274
113 Ga0068853_100040363 3300005539 Bacteria 3982
114 Ga0068853_100130357 3300005539 Bacteria 2250
115 Ga0068853_100286863 3300005539 Bacteria 1519
116 Ga0068853_100372296 3300005539 Bacteria 1333
117 Ga0068853_100411221 3300005539 Bacteria 1267
118 Ga0070672_100191116 3300005543 Bacteria 1709
119 Ga0070672_100191311 3300005543 Bacteria 1709
120 Ga0070672_100431858 3300005543 Bacteria 1132
121 Ga0070672_100895577 3300005543 Bacteria 784
122 Ga0070686_100740264 3300005544 Bacteria 788
123 Ga0070695_100764136 3300005545 Bacteria 772
124 Ga0070696_100760250 3300005546 Bacteria 795
125 Ga0070693_101383201 3300005547 Bacteria 547
126 Ga0070665_100189047 3300005548 Bacteria 2060
127 Ga0070665_100336297 3300005548 Bacteria 1514
128 Ga0070665_100357790 3300005548 Bacteria 1466
129 Ga0070665_101089130 3300005548 Bacteria 810
130 Ga0070665_101216753 3300005548 Bacteria 764
131 Ga0070665_101665143 3300005548 Bacteria 645
132 Ga0070704_100517830 3300005549 Bacteria 1038
133 Ga0068855_100010865 3300005563 Bacteria 10993
134 Ga0068855_100067952 3300005563 Bacteria 4150
135 Ga0068855_100116881 3300005563 Bacteria 3056
136 Ga0068855_100142865 3300005563 Bacteria 2727
137 Ga0070664_100089985 3300005564 Bacteria 2656
138 Ga0070664_100363338 3300005564 Bacteria 1319
139 Ga0068857_100016047 3300005577 Bacteria 6562
140 Ga0068857_100106311 3300005577 Bacteria 2520
141 Ga0068857_101483817 3300005577 Bacteria 660
142 Ga0068857_101752540 3300005577 Bacteria 607
143 Ga0068857_101803285 3300005577 Bacteria 599
144 Ga0068854_100316488 3300005578 Bacteria 1267
145 Ga0068854_100587678 3300005578 Bacteria 949
146 Ga0068856_100731211 3300005614 Bacteria 1010
147 Ga0070702_100130267 3300005615 Bacteria 1588
148 Ga0068852_100036815 3300005616 Bacteria 4099
149 Ga0068852_100249880 3300005616 Bacteria 1699
150 Ga0068852_100254398 3300005616 Bacteria 1684
151 Ga0068852_100477308 3300005616 Bacteria 1239
152 Ga0068852_101247821 3300005616 Bacteria 765
153 Ga0068852_101867233 3300005616 Bacteria 623
154 Ga0068859_100463120 3300005617 Bacteria 1363
155 Ga0068864_100494527 3300005618 Bacteria 1176
156 Ga0068866_10021865 3300005718 Bacteria 2952
157 Ga0068866_10509547 3300005718 Bacteria 798
158 Ga0068861_100410264 3300005719 Bacteria 1204
159 Ga0068861_100816180 3300005719 Bacteria 877
160 Ga0068861_101639683 3300005719 Bacteria 635
161 Ga0068851_10004825 3300005834 Bacteria 6103
162 Ga0068870_10078252 3300005840 Bacteria 1821
163 Ga0068863_100655952 3300005841 Bacteria 1041
164 Ga0068863_100744625 3300005841 Bacteria 976
165 Ga0068863_100911131 3300005841 Bacteria 880
166 Ga0068863_101044798 3300005841 Bacteria 820
167 Ga0068863_101352280 3300005841 Bacteria 720
168 Ga0068858_100046102 3300005842 Bacteria 4041
169 Ga0068858_100074580 3300005842 Bacteria 3150
170 Ga0068858_100917487 3300005842 Bacteria 857
171 Ga0068860_100331144 3300005843 Bacteria 1496
172 Ga0068860_100352450 3300005843 Bacteria 1449
173 Ga0068860_100462292 3300005843 Bacteria 1263
174 Ga0068860_100483318 3300005843 Bacteria 1235
175 Ga0068860_100499225 3300005843 Bacteria 1215
176 Ga0068862_100129799 3300005844 Bacteria 2228
177 Ga0068862_100302221 3300005844 Bacteria 1472
178 Ga0068862_100414040 3300005844 Bacteria 1263
179 Ga0068862_100515000 3300005844 Bacteria 1137
180 Ga0068862_100669787 3300005844 Bacteria 1002
181 Ga0068862_101682387 3300005844 Bacteria 643
182 Ga0081455_10009971 3300005937 Bacteria 9713
183 Ga0081455_10037550 3300005937 Bacteria 4300
184 Ga0081455_10087531 3300005937 Bacteria 2534
185 Ga0081455_10127583 3300005937 Bacteria 1994
186 Ga0081455_10150862 3300005937 Bacteria 1792
187 Ga0081540_1006422 3300005983 Bacteria 8558
188 Ga0081540_1009663 3300005983 Bacteria 6629
189 Ga0081540_1011844 3300005983 Bacteria 5796
190 Ga0081540_1012349 3300005983 Bacteria 5635
191 Ga0081540_1013491 3300005983 Bacteria 5308
192 Ga0081540_1014382 3300005983 Bacteria 5071
193 Ga0081540_1018818 3300005983 Bacteria 4222
194 Ga0081539_10000768 3300005985 Bacteria 63055
195 Ga0081539_10001470 3300005985 Bacteria 39952
196 Ga0081539_10004445 3300005985 Bacteria 15477
197 Ga0081539_10058092 3300005985 Bacteria 2137
198 Ga0070717_10001267 3300006028 Bacteria 17258
199 Ga0070717_10017332 3300006028 Bacteria 5603
200 Ga0070717_10416085 3300006028 Bacteria 1209
201 Ga0070717_10501552 3300006028 Bacteria 1097
202 Ga0075365_10083284 3300006038 Bacteria 2169
203 Ga0075365_10101356 3300006038 Bacteria 1971
204 Ga0075365_10541421 3300006038 Bacteria 823
205 Ga0075365_10770016 3300006038 Bacteria 679
206 Ga0075363_100113059 3300006048 Bacteria 1510
207 Ga0075363_100352030 3300006048 Bacteria 860
208 Ga0075363_100407285 3300006048 Bacteria 800
209 Ga0075364_10088472 3300006051 Bacteria 2053
210 Ga0075432_10149429 3300006058 Bacteria 897
211 Ga0070716_100107458 3300006173 Bacteria 1723
212 Ga0070716_100189057 3300006173 Bacteria 1359
213 Ga0070716_100666400 3300006173 Bacteria 791
214 Ga0070716_101690869 3300006173 Bacteria 522
215 Ga0070712_100111079 3300006175 Bacteria 2046
216 Ga0070712_100118582 3300006175 Bacteria 1988
217 Ga0070712_100905172 3300006175 Bacteria 761
218 Ga0075362_10396330 3300006177 Bacteria 696
219 Ga0075367_10142444 3300006178 Bacteria 1485
220 Ga0075369_10127055 3300006186 Bacteria 1157
221 Ga0075369_10247272 3300006186 Bacteria 828
222 Ga0075369_10336005 3300006186 Bacteria 708
223 Ga0075366_10239677 3300006195 Bacteria 1106
224 Ga0075366_10593436 3300006195 Bacteria 686
225 Ga0075366_10603489 3300006195 Bacteria 680
226 Ga0075366_10853991 3300006195 Bacteria 567
227 Ga0097621_100209156 3300006237 Bacteria 1697
228 Ga0097621_101107206 3300006237 Bacteria 744
229 Ga0097621_101274183 3300006237 Bacteria 694
230 Ga0097621_101490690 3300006237 Bacteria 642
231 Ga0075370_10219152 3300006353 Bacteria 1124
232 Ga0075370_10380400 3300006353 Bacteria 846
233 Ga0068871_100254458 3300006358 Bacteria 1531
234 Ga0068871_100483860 3300006358 Bacteria 1114
235 Ga0068871_100802604 3300006358 Bacteria 868
236 Ga0068871_101385620 3300006358 Bacteria 663
237 Ga0075428_100700818 3300006844 Bacteria 1079
238 Ga0075433_10677350 3300006852 Bacteria 904
239 Ga0075429_100967043 3300006880 Bacteria 745
240 Ga0068865_100444871 3300006881 Bacteria 1070
241 Ga0068865_100647710 3300006881 Bacteria 898
242 Ga0068865_100847786 3300006881 Bacteria 791
243 Ga0068865_101028166 3300006881 Bacteria 723
244 Ga0097620_100463136 3300006931 Bacteria 1363
245 Ga0099825_1034140 3300006941 Bacteria 1916
246 Ga0099824_1007408 3300006942 Bacteria 14551
247 Ga0099822_1006547 3300006943 Bacteria 15161
248 Ga0099794_10013294 3300007265 Bacteria 3579
249 Ga0099794_10298454 3300007265 Bacteria 834
250 Ga0099794_10419992 3300007265 Bacteria 700
251 Ga0099795_10003875 3300007788 Bacteria 3771
252 Ga0099795_10184751 3300007788 Bacteria 872
253 Ga0105251_10576561 3300009011 Bacteria 532
254 Ga0105250_10539583 3300009092 Bacteria 534
255 Ga0105240_10034221 3300009093 Bacteria 6557
256 Ga0105240_10058690 3300009093 Bacteria 4804
257 Ga0105240_10105395 3300009093 Bacteria 3423
258 Ga0105240_10108708 3300009093 Bacteria 3359
259 Ga0105240_10522672 3300009093 Bacteria 1317
260 Ga0105240_11095681 3300009093 Bacteria 848
261 Ga0105240_11604799 3300009093 Bacteria 680
262 Ga0105240_12534470 3300009093 Bacteria 530
263 Ga0111539_10144248 3300009094 Bacteria 2787
264 Ga0111539_11656237 3300009094 Bacteria 742
265 Ga0105245_10105057 3300009098 Bacteria 2619
266 Ga0105245_10289341 3300009098 Bacteria 1604
267 Ga0105245_10829319 3300009098 Bacteria 964
268 Ga0105245_11842058 3300009098 Bacteria 658
269 Ga0105247_10110567 3300009101 Bacteria 1768
270 Ga0105247_10136367 3300009101 Bacteria 1604
271 Ga0105247_10155708 3300009101 Bacteria 1509
272 Ga0105247_10400587 3300009101 Bacteria 978
273 Ga0114129_10191104 3300009147 Bacteria 2780
274 Ga0105243_10078753 3300009148 Bacteria 2684
275 Ga0105243_10929161 3300009148 Bacteria 867
276 Ga0105243_11232577 3300009148 Bacteria 763
277 Ga0105243_12506854 3300009148 Bacteria 555
278 Ga0105242_10115715 3300009176 Bacteria 2293
279 Ga0105242_10131362 3300009176 Bacteria 2162
280 Ga0105242_11576074 3300009176 Bacteria 690
281 Ga0105242_11936273 3300009176 Bacteria 630
282 Ga0105248_10139917 3300009177 Bacteria 2730
283 Ga0105248_10204152 3300009177 Bacteria 2227
284 Ga0105248_10336933 3300009177 Bacteria 1698
285 Ga0105248_10881040 3300009177 Bacteria 1011
286 Ga0105237_10087664 3300009545 Bacteria 3102
287 Ga0105237_10508977 3300009545 Bacteria 1211
288 Ga0105237_10562761 3300009545 Bacteria 1147
289 Ga0105237_10641091 3300009545 Bacteria 1069
290 Ga0105237_10726224 3300009545 Bacteria 1000
291 Ga0105237_10766119 3300009545 Bacteria 972
292 Ga0105237_11358764 3300009545 Bacteria 717
293 Ga0105237_11568743 3300009545 Bacteria 665
294 Ga0105238_10017402 3300009551 Bacteria 7303
295 Ga0105238_10140974 3300009551 Bacteria 2387
296 Ga0105238_10358018 3300009551 Bacteria 1448
297 Ga0105238_10360284 3300009551 Bacteria 1444
298 Ga0105238_10598531 3300009551 Bacteria 1110
299 Ga0105238_11028171 3300009551 Bacteria 845
300 Ga0105249_10080447 3300009553 Bacteria 3027
301 Ga0105249_10645237 3300009553 Bacteria 1116
302 Ga0099796_10459180 3300010159 Bacteria 567
303 Ga0105239_10020324 3300010375 Bacteria 7325
304 Ga0105239_10029566 3300010375 Bacteria 6024
305 Ga0105239_10118154 3300010375 Bacteria 2943
306 Ga0105239_10151085 3300010375 Bacteria 2592
307 Ga0105239_10404892 3300010375 Bacteria 1544
308 Ga0105239_10804993 3300010375 Bacteria 1077
309 Ga0105246_10106488 3300011119 Bacteria 2051
310 Ga0105246_10229454 3300011119 Bacteria 1461
311 Ga0105246_10256365 3300011119 Bacteria 1391
312 Ga0105246_10675292 3300011119 Bacteria 902
313 Ga0105246_11328480 3300011119 Bacteria 667
314 Ga0157338_1036802 3300012515 Bacteria 649
315 Ga0157371_10727887 3300013102 Bacteria 744
316 Ga0157371_11388202 3300013102 Bacteria 545
317 Ga0157370_10014947 3300013104 Bacteria 7918
318 Ga0157370_10025078 3300013104 Bacteria 5903
319 Ga0157370_10071347 3300013104 Bacteria 3277
320 Ga0157370_10296740 3300013104 Bacteria 1492
321 Ga0157370_10862740 3300013104 Bacteria 822
322 Ga0157370_10950068 3300013104 Bacteria 779
323 Ga0157369_10021190 3300013105 Bacteria 7267
324 Ga0157369_10047353 3300013105 Bacteria 4669
325 Ga0157369_10130028 3300013105 Bacteria 2669
326 Ga0157369_10501429 3300013105 Bacteria 1256
327 Ga0157369_10602033 3300013105 Bacteria 1134
328 Ga0157374_10033305 3300013296 Bacteria 4701
329 Ga0157374_10530713 3300013296 Bacteria 1183
330 Ga0157378_10070080 3300013297 Bacteria 3147
331 Ga0157378_10356319 3300013297 Bacteria 1431
332 Ga0157378_10368636 3300013297 Bacteria 1407
333 Ga0157378_11541203 3300013297 Bacteria 710
334 Ga0157378_13043504 3300013297 Bacteria 520
335 Ga0163162_10578216 3300013306 Bacteria 1250
336 Ga0163162_11108831 3300013306 Bacteria 897
337 Ga0163162_11309716 3300013306 Bacteria 823
338 Ga0163162_13152751 3300013306 Bacteria 529
339 Ga0157372_10196832 3300013307 Bacteria 2334
340 Ga0157372_10708827 3300013307 Bacteria 1171
341 Ga0157372_12031415 3300013307 Bacteria 661
342 Ga0157372_12344199 3300013307 Bacteria 613
343 Ga0157375_10009689 3300013308 Bacteria 8470
344 Ga0157375_11105739 3300013308 Bacteria 928
345 Ga0157375_11934839 3300013308 Bacteria 700
346 Ga0157375_12308347 3300013308 Bacteria 641
347 Ga0163163_10159204 3300014325 Bacteria 2303
348 Ga0163163_10453589 3300014325 Bacteria 1342
349 Ga0163163_10571962 3300014325 Bacteria 1193
350 Ga0163163_11094788 3300014325 Bacteria 860
351 Ga0163163_12257726 3300014325 Bacteria 603
352 Ga0157380_10184873 3300014326 Bacteria 1834
353 Ga0157380_10184912 3300014326 Bacteria 1834
354 Ga0157380_10811873 3300014326 Bacteria 953
355 Ga0157380_12152610 3300014326 Bacteria 621
356 Ga0157377_10094953 3300014745 Bacteria 1767
357 Ga0157377_10173047 3300014745 Bacteria 1352
358 Ga0157377_11356277 3300014745 Bacteria 559
359 Ga0157379_10085565 3300014968 Bacteria 2826
360 Ga0157379_10341117 3300014968 Bacteria 1370
361 Ga0157379_10659533 3300014968 Bacteria 980
362 Ga0157376_10092020 3300014969 Bacteria 2628
363 Ga0157376_10557471 3300014969 Bacteria 1135
364 Ga0163161_10128231 3300017792 Bacteria 1912
365 Ga0163161_10232435 3300017792 Bacteria 1431
366 Ga0163161_10303939 3300017792 Bacteria 1257
367 Ga0206356_10766524 3300020070 Bacteria 821
368 Ga0206356_11320371 3300020070 Bacteria 1449
369 Ga0206353_10272000 3300020082 Bacteria 539
370 Ga0213874_10013946 3300021377 Bacteria 2092
371 Ga0213876_10020027 3300021384 Bacteria 3534
372 Ga0213876_10072356 3300021384 Bacteria 1821
373 Ga0209233_1002384 3300025261 Bacteria 6957
374 Ga0209758_1030944 3300025297 Bacteria 2205
375 Ga0209758_1031236 3300025297 Bacteria 2189
376 Ga0209758_1050827 3300025297 Bacteria 1449
377 Ga0209758_1091452 3300025297 Bacteria 890
378 Ga0207697_10085069 3300025315 Bacteria 1335
379 Ga0207656_10034898 3300025321 Bacteria 2102
380 Ga0207682_10212877 3300025893 Bacteria 892
381 Ga0207642_10037371 3300025899 Bacteria 2092
382 Ga0207642_10398319 3300025899 Bacteria 823
383 Ga0207642_10478566 3300025899 Bacteria 759
384 Ga0207642_10583281 3300025899 Bacteria 694
385 Ga0207710_10176392 3300025900 Bacteria 1047
386 Ga0207710_10384506 3300025900 Bacteria 719
387 Ga0207710_10598127 3300025900 Bacteria 576
388 Ga0207688_10215003 3300025901 Bacteria 1156
389 Ga0207688_10282908 3300025901 Bacteria 1011
390 Ga0207688_10421078 3300025901 Bacteria 830
391 Ga0207688_10436633 3300025901 Bacteria 815
392 Ga0207688_10518079 3300025901 Bacteria 748
393 Ga0207680_10591542 3300025903 Bacteria 793
394 Ga0207685_10027483 3300025905 Bacteria 1991
395 Ga0207699_10025234 3300025906 Bacteria 3260
396 Ga0207699_10156951 3300025906 Bacteria 1511
397 Ga0207699_10490158 3300025906 Bacteria 886
398 Ga0207699_10910031 3300025906 Bacteria 649
399 Ga0207645_10058248 3300025907 Bacteria 2466
400 Ga0207645_10172342 3300025907 Bacteria 1419
401 Ga0207705_10269578 3300025909 Bacteria 1302
402 Ga0207705_10295605 3300025909 Bacteria 1241
403 Ga0207684_10216101 3300025910 Bacteria 1654
404 Ga0207684_10558714 3300025910 Bacteria 979
405 Ga0207684_11207051 3300025910 Bacteria 626
406 Ga0207654_10429061 3300025911 Bacteria 924
407 Ga0207707_10000419 3300025912 Bacteria 44410
408 Ga0207707_10002705 3300025912 Bacteria 15850
409 Ga0207707_10002868 3300025912 Bacteria 15401
410 Ga0207707_10045918 3300025912 Bacteria 3804
411 Ga0207707_10135089 3300025912 Bacteria 2156
412 Ga0207695_10048124 3300025913 Bacteria 4506
413 Ga0207695_10060686 3300025913 Bacteria 3913
414 Ga0207695_10140869 3300025913 Bacteria 2360
415 Ga0207695_10240619 3300025913 Bacteria 1711
416 Ga0207695_10363647 3300025913 Bacteria 1333
417 Ga0207671_10061259 3300025914 Bacteria 2792
418 Ga0207671_10378725 3300025914 Bacteria 1124
419 Ga0207671_10456499 3300025914 Bacteria 1018
420 Ga0207671_10485729 3300025914 Bacteria 984
421 Ga0207671_11174057 3300025914 Bacteria 601
422 Ga0207693_10041850 3300025915 Bacteria 3606
423 Ga0207693_10071447 3300025915 Bacteria 2716
424 Ga0207693_10086606 3300025915 Bacteria 2455
425 Ga0207693_10770161 3300025915 Bacteria 743
426 Ga0207663_10007087 3300025916 Bacteria 5789
427 Ga0207663_10043021 3300025916 Bacteria 2763
428 Ga0207663_10065948 3300025916 Bacteria 2316
429 Ga0207663_10116334 3300025916 Bacteria 1823
430 Ga0207663_10390605 3300025916 Bacteria 1062
431 Ga0207660_10012377 3300025917 Bacteria 5581
432 Ga0207660_10048142 3300025917 Bacteria 3017
433 Ga0207660_10305114 3300025917 Bacteria 1268
434 Ga0207660_10330707 3300025917 Bacteria 1218
435 Ga0207662_10113335 3300025918 Bacteria 1693
436 Ga0207662_11223767 3300025918 Bacteria 534
437 Ga0207657_10011308 3300025919 Bacteria 8865
438 Ga0207657_10420585 3300025919 Bacteria 1050
439 Ga0207649_10039488 3300025920 Bacteria 2862
440 Ga0207649_10557951 3300025920 Bacteria 877
441 Ga0207652_10001690 3300025921 Bacteria 19300
442 Ga0207652_10009155 3300025921 Bacteria 7969
443 Ga0207652_10011695 3300025921 Bacteria 7082
444 Ga0207652_10047707 3300025921 Bacteria 3659
445 Ga0207652_10055058 3300025921 Bacteria 3420
446 Ga0207646_10826670 3300025922 Bacteria 824
447 Ga0207681_10039022 3300025923 Bacteria 3150
448 Ga0207681_10411264 3300025923 Bacteria 1094
449 Ga0207681_10889286 3300025923 Bacteria 746
450 Ga0207694_10027290 3300025924 Bacteria 4347
451 Ga0207694_10075966 3300025924 Bacteria 2631
452 Ga0207694_10321799 3300025924 Bacteria 1276
453 Ga0207694_10731282 3300025924 Bacteria 835
454 Ga0207694_11027946 3300025924 Bacteria 697
455 Ga0207659_10101426 3300025926 Bacteria 2171
456 Ga0207687_10157928 3300025927 Bacteria 1737
457 Ga0207687_10395148 3300025927 Bacteria 1136
458 Ga0207687_10641434 3300025927 Bacteria 898
459 Ga0207700_10005544 3300025928 Bacteria 7569
460 Ga0207700_10063406 3300025928 Bacteria 2811
461 Ga0207700_10118805 3300025928 Bacteria 2140
462 Ga0207700_10120991 3300025928 Bacteria 2123
463 Ga0207700_10183800 3300025928 Bacteria 1752
464 Ga0207700_11162919 3300025928 Bacteria 689
465 Ga0207664_10042851 3300025929 Bacteria 3536
466 Ga0207664_10150641 3300025929 Bacteria 1976
467 Ga0207664_10229936 3300025929 Bacteria 1612
468 Ga0207664_10489807 3300025929 Bacteria 1100
469 Ga0207644_10234854 3300025931 Bacteria 1458
470 Ga0207644_11082889 3300025931 Bacteria 673
471 Ga0207644_11312479 3300025931 Bacteria 608
472 Ga0207644_11400987 3300025931 Bacteria 587
473 Ga0207690_10587430 3300025932 Bacteria 908
474 Ga0207706_10015272 3300025933 Bacteria 6945
475 Ga0207706_10225273 3300025933 Bacteria 1641
476 Ga0207706_10408965 3300025933 Bacteria 1176
477 Ga0207709_10358165 3300025935 Bacteria 1104
478 Ga0207709_10503061 3300025935 Bacteria 946
479 Ga0207709_10528054 3300025935 Bacteria 925
480 Ga0207709_10862442 3300025935 Bacteria 734
481 Ga0207709_10893438 3300025935 Bacteria 722
482 Ga0207669_10095367 3300025937 Bacteria 1950
483 Ga0207669_10718476 3300025937 Bacteria 822
484 Ga0207669_11091687 3300025937 Bacteria 673
485 Ga0207704_10666308 3300025938 Bacteria 858
486 Ga0207704_11179898 3300025938 Bacteria 652
487 Ga0207665_10036449 3300025939 Bacteria 3271
488 Ga0207665_10088797 3300025939 Bacteria 2139
489 Ga0207665_10195726 3300025939 Bacteria 1471
490 Ga0207665_10253201 3300025939 Bacteria 1302
491 Ga0207665_10611246 3300025939 Bacteria 852
492 Ga0207665_10847064 3300025939 Bacteria 724
493 Ga0207691_10054640 3300025940 Bacteria 3642
494 Ga0207691_10168119 3300025940 Bacteria 1921
495 Ga0207691_10426374 3300025940 Bacteria 1130
496 Ga0207691_10505181 3300025940 Bacteria 1026
497 Ga0207691_10765507 3300025940 Bacteria 812
498 Ga0207711_10284242 3300025941 Bacteria 1524
499 Ga0207689_10011785 3300025942 Bacteria 7491
500 Ga0207689_10125319 3300025942 Bacteria 2113
501 Ga0207689_10326522 3300025942 Bacteria 1274
502 Ga0207661_10001270 3300025944 Bacteria 16867
503 Ga0207661_10008213 3300025944 Bacteria 7451
504 Ga0207661_10021058 3300025944 Bacteria 4883
505 Ga0207679_10069235 3300025945 Bacteria 2654
506 Ga0207679_10271615 3300025945 Bacteria 1450
507 Ga0207679_10377220 3300025945 Bacteria 1242
508 Ga0207679_10916061 3300025945 Bacteria 802
509 Ga0207667_10002017 3300025949 Bacteria 25487
510 Ga0207667_10145129 3300025949 Bacteria 2443
511 Ga0207667_10201639 3300025949 Bacteria 2041
512 Ga0207667_10510487 3300025949 Bacteria 1218
513 Ga0207667_11719651 3300025949 Bacteria 593
514 Ga0207651_10112506 3300025960 Bacteria 2047
515 Ga0207651_10603500 3300025960 Bacteria 960
516 Ga0207712_10128621 3300025961 Bacteria 1927
517 Ga0207668_10150043 3300025972 Bacteria 1803
518 Ga0207668_10241238 3300025972 Bacteria 1462
519 Ga0207668_10335998 3300025972 Bacteria 1258
520 Ga0207668_10471341 3300025972 Bacteria 1075
521 Ga0207668_10481127 3300025972 Bacteria 1065
522 Ga0207668_10558761 3300025972 Bacteria 992
523 Ga0207640_10214238 3300025981 Bacteria 1470
524 Ga0207640_10407822 3300025981 Bacteria 1108
525 Ga0207640_10539537 3300025981 Bacteria 978
526 Ga0207658_10132641 3300025986 Bacteria 2004
527 Ga0207658_10375592 3300025986 Bacteria 1244
528 Ga0207658_11256020 3300025986 Bacteria 677
529 Ga0207658_11567847 3300025986 Bacteria 602
530 Ga0207677_10005891 3300026023 Bacteria 6669
531 Ga0207677_10532795 3300026023 Bacteria 1021
532 Ga0207703_10394218 3300026035 Bacteria 1283
533 Ga0207703_10999855 3300026035 Bacteria 802
534 Ga0207703_11300422 3300026035 Bacteria 699
535 Ga0207639_10173169 3300026041 Bacteria 1830
536 Ga0207639_10837909 3300026041 Bacteria 858
537 Ga0207639_10970591 3300026041 Bacteria 795
538 Ga0207639_12227199 3300026041 Bacteria 509
539 Ga0207678_10006479 3300026067 Bacteria 10385
540 Ga0207678_10044766 3300026067 Bacteria 3828
541 Ga0207678_10061454 3300026067 Bacteria 3231
542 Ga0207678_10196905 3300026067 Bacteria 1722
543 Ga0207678_10628445 3300026067 Bacteria 942
544 Ga0207678_10860880 3300026067 Bacteria 801
545 Ga0207678_11372541 3300026067 Bacteria 625
546 Ga0207678_11916079 3300026067 Bacteria 517
547 Ga0207708_10158521 3300026075 Bacteria 1786
548 Ga0207708_10981793 3300026075 Bacteria 733
549 Ga0207702_10273884 3300026078 Bacteria 1593
550 Ga0207702_10875316 3300026078 Bacteria 890
551 Ga0207702_10903267 3300026078 Bacteria 875
552 Ga0207641_10606623 3300026088 Bacteria 1072
553 Ga0207641_11251741 3300026088 Bacteria 742
554 Ga0207641_11833036 3300026088 Bacteria 608
555 Ga0207648_10797285 3300026089 Bacteria 879
556 Ga0207648_10821718 3300026089 Bacteria 866
557 Ga0207648_10936444 3300026089 Bacteria 810
558 Ga0207676_10069328 3300026095 Bacteria 2823
559 Ga0207674_10010575 3300026116 Bacteria 10440
560 Ga0207674_10113295 3300026116 Bacteria 2685
561 Ga0207674_10242397 3300026116 Bacteria 1750
562 Ga0207674_10457616 3300026116 Bacteria 1233
563 Ga0207674_10594400 3300026116 Bacteria 1069
564 Ga0207674_11383866 3300026116 Bacteria 673
565 Ga0207674_11674039 3300026116 Bacteria 604
566 Ga0207675_100031334 3300026118 Bacteria 4954
567 Ga0207675_100064640 3300026118 Bacteria 3420
568 Ga0207675_100274434 3300026118 Bacteria 1637
569 Ga0207675_100422111 3300026118 Bacteria 1317
570 Ga0207675_101532037 3300026118 Bacteria 687
571 Ga0207675_101742728 3300026118 Bacteria 642
572 Ga0207675_101791882 3300026118 Bacteria 633
573 Ga0207683_10021694 3300026121 Bacteria 5504
574 Ga0207683_10197482 3300026121 Bacteria 1828
575 Ga0207683_10648249 3300026121 Bacteria 978
576 Ga0207683_10766064 3300026121 Bacteria 895
577 Ga0207698_10226900 3300026142 Bacteria 1692
578 Ga0207698_10295269 3300026142 Bacteria 1506
579 Ga0207698_10317285 3300026142 Bacteria 1458
580 Ga0207698_10501287 3300026142 Bacteria 1181
581 Ga0207698_11430873 3300026142 Bacteria 706
582 Ga0209589_1000014 3300027357 Bacteria 227996
583 Ga0209489_100014 3300027361 Bacteria 227996
584 Ga0209700_100024 3300027363 Bacteria 227996
585 Ga0209179_1012641 3300027512 Bacteria 1520
586 Ga0209179_1048167 3300027512 Bacteria 909
587 Ga0209588_1002539 3300027671 Bacteria 4953
588 Ga0268266_10147257 3300028379 Bacteria 2118
589 Ga0268266_10201322 3300028379 Bacteria 1822
590 Ga0268266_10391978 3300028379 Bacteria 1312
591 Ga0268266_10570437 3300028379 Bacteria 1085
592 Ga0268266_11270396 3300028379 Bacteria 711
593 Ga0268265_10198420 3300028380 Bacteria 1738
594 Ga0268265_10268121 3300028380 Bacteria 1521
595 Ga0268265_10304954 3300028380 Bacteria 1435
596 Ga0268265_10753171 3300028380 Bacteria 945
597 Ga0268265_11590458 3300028380 Bacteria 658
598 Ga0268265_11681054 3300028380 Bacteria 640
599 Ga0268265_11964165 3300028380 Bacteria 592
600 Ga0268265_12483165 3300028380 Bacteria 524
601 Ga0268264_10055549 3300028381 Bacteria 3309
602 Ga0268264_10292401 3300028381 Bacteria 1530
603 Ga0268264_10568056 3300028381 Bacteria 1114
604 Ga0268264_10893234 3300028381 Bacteria 891
605 Ga0268264_11123623 3300028381 Bacteria 794
606 Ga0268264_11758227 3300028381 Bacteria 630
607 Ga0265337_1007001 3300028556 Bacteria 4268
608 Ga0265326_10065353 3300028558 Bacteria 1028
609 Ga0265319_1006536 3300028563 Bacteria 5385
610 Ga0265334_10001696 3300028573 Bacteria 10529
611 Ga0265318_10008197 3300028577 Bacteria 4667
612 Ga0265323_10001106 3300028653 Bacteria 13928
613 Ga0265322_10001590 3300028654 Bacteria 7289
614 Ga0265336_10000135 3300028666 Bacteria 52478
615 Ga0307517_10000634 3300028786 Bacteria 60194
616 Ga0307517_10039620 3300028786 Bacteria 5167
617 Ga0307517_10324896 3300028786 Bacteria 849
618 Ga0307517_10594244 3300028786 Bacteria 546
619 Ga0307515_10006012 3300028794 Bacteria 24419
620 Ga0307515_10512273 3300028794 Bacteria 810
621 Ga0265338_10000034 3300028800 Bacteria 244623
622 Ga0265338_10361635 3300028800 Bacteria 1041
623 Ga0265324_10001466 3300029957 Bacteria 13424
624 Ga0265324_10156835 3300029957 Bacteria 773
625 Ga0307511_10024264 3300030521 Bacteria 5626
626 Ga0265332_10013209 3300031238 Bacteria 3662
627 Ga0307513_10125438 3300031456 Bacteria 2524
628 Ga0307513_10444506 3300031456 Bacteria 1022
629 Ga0307513_10645174 3300031456 Bacteria 766
630 Ga0307509_10132445 3300031507 Bacteria 2445
631 Ga0307509_10826352 3300031507 Bacteria 591
632 Ga0307508_10000032 3300031616 Bacteria 163293
633 Ga0307508_10022899 3300031616 Bacteria 5677
634 Ga0307508_10139265 3300031616 Bacteria 2030
635 Ga0307508_10715631 3300031616 Bacteria 612
636 Ga0265314_10195305 3300031711 Bacteria 1201
637 Ga0307516_10005934 3300031730 Bacteria 14450
638 Ga0307516_10039539 3300031730 Bacteria 4700
639 Ga0307516_10300751 3300031730 Bacteria 1280
640 Ga0307405_10879540 3300031731 Bacteria 756
641 Ga0307413_10061917 3300031824 Bacteria 2312
642 Ga0307413_10440005 3300031824 Bacteria 1032
643 Ga0307410_10143713 3300031852 Bacteria 1768
644 Ga0307406_10896882 3300031901 Bacteria 754
645 Ga0307407_10186122 3300031903 Bacteria 1380
646 Ga0307412_10093307 3300031911 Bacteria 2111
647 Ga0307412_11811460 3300031911 Bacteria 562
648 Ga0307416_100738479 3300032002 Bacteria 1076
649 Ga0307411_10300285 3300032005 Bacteria 1287
650 Ga0307415_100094054 3300032126 Bacteria 2178
651 Ga0307415_100687932 3300032126 Bacteria 921
652 Ga0307507_10011278 3300033179 Bacteria 11327
653 Ga0307510_10016157 3300033180 Bacteria 8816
654 Ga0307510_10091519 3300033180 Bacteria 2883
655 Ga0373930_0001351 3300034816 Bacteria 3619
656 Ga0373959_0055718 3300034820 Bacteria 864
657 Ga0373926_0007554 3300035083 Bacteria 3620
658 Ga0373934_0187215 3300035086 Bacteria 851
659 Ga0373951_0013653 3300035091 Bacteria 1825
660 Ga0373952_0108085 3300035092 Bacteria 741
661 Ga0373923_0061471 3300035111 Bacteria 1596
662 Ga0373923_0236904 3300035111 Bacteria 852
663 Ga0373936_0061479 3300035113 Bacteria 1534
664 Ga0373936_0068996 3300035113 Bacteria 1454
665 Ga0373939_0227291 3300035114 Bacteria 717
666 Ga0373939_0489452 3300035114 Bacteria 523
667 Ga0373954_0081500 3300035118 Bacteria 1546
668 Ga0373954_0166773 3300035118 Bacteria 1078
669 Ga0373956_0304788 3300035119 Bacteria 759
670 Ga0373956_0407056 3300035119 Bacteria 649
671 Ga0373943_0083782 3300035170 Bacteria 1639
672 Ga0373946_0026464 3300035171 Bacteria 2289
673 Ga0373946_0058279 3300035171 Bacteria 1635
674 Ga0373955_0040395 3300035172 Bacteria 2495
675 Ga0373955_0058451 3300035172 Bacteria 2122
676 Ga0373955_0880774 3300035172 Bacteria 551
677 Ga0373924_0017175 3300035410 Bacteria 2772
678 Ga0373931_0002187 3300035691 Bacteria 8629
679 Ga0373931_0384182 3300035691 Bacteria 886
680 Ga0373931_0390676 3300035691 Bacteria 879
681 Ga0373931_0434475 3300035691 Bacteria 837
682 Ga0373931_1246755 3300035691 Bacteria 510
683 Ga0373935_0012923 3300035692 Bacteria 5031
684 Ga0373935_0032924 3300035692 Bacteria 3223
685 Ga0373935_0063455 3300035692 Bacteria 2368
686 Ga0373935_0069468 3300035692 Bacteria 2269
687 Ga0373935_0324990 3300035692 Bacteria 1092
688 Ga0373935_0607081 3300035692 Bacteria 800
689 Ga0373927_0014717 3300035695 Bacteria 5172
690 Ga0373927_0015621 3300035695 Bacteria 5014
691 Ga0373927_0044610 3300035695 Bacteria 2868
692 Ga0373927_0060854 3300035695 Bacteria 2443
693 Ga0373927_0169814 3300035695 Bacteria 1429
694 Ga0373927_0523744 3300035695 Bacteria 783
695 Ga0373927_0605220 3300035695 Bacteria 724
696 Ga0373927_0732936 3300035695 Bacteria 653
697 Ga0373933_0000182 3300035724 Bacteria 41434
698 Ga0373933_0219645 3300035724 Bacteria 1219
699 Ga0373933_1055597 3300035724 Bacteria 535
700 Ga0373947_0025925 3300035725 Bacteria 3420
701 Ga0373947_0028707 3300035725 Bacteria 3263
702 Ga0373947_0076608 3300035725 Bacteria 2061
703 Ga0373937_0399859 3300036401 Bacteria 1303
704 Ga0372808_009572 3300036459 Bacteria 1355
705 Ga0373925_0025108 3300037068 Bacteria 4351
706 Ga0373925_0054383 3300037068 Bacteria 2994
707 Ga0373925_0102550 3300037068 Bacteria 2201
708 Ga0373925_0125508 3300037068 Bacteria 1996
709 Ga0373925_0453465 3300037068 Bacteria 1050
710 Ga0373925_0589940 3300037068 Bacteria 915
711 Ga0395900_0017080 3300037418 Bacteria 7408
712 Ga0395900_0082779 3300037418 Bacteria 3297
713 Ga0395900_0200935 3300037418 Bacteria 2017
714 Ga0395898_0099842 3300037466 Bacteria 2788
715 Ga0395905_0996464 3300037471 Bacteria 741
716 Ga0395901_0044477 3300038443 Bacteria 4606
717 Ga0395901_0153963 3300038443 Bacteria 2415
718 Ga0395901_0251715 3300038443 Bacteria 1840
719 Ga0436365_0229539 3300039437 Bacteria 3406
720 Ga0436365_0585470 3300039437 Bacteria 722
721 Ga0436365_0644236 3300039437 Bacteria 1141
722 Ga0436365_1524424 3300039437 Bacteria 1377
723 Ga0436365_1891875 3300039437 Bacteria 1374
724 Ga0436363_0130820 3300039450 Bacteria 640
725 Ga0436363_0194304 3300039450 Bacteria 1684
726 Ga0436363_0749925 3300039450 Bacteria 610
727 Ga0436363_1284900 3300039450 Bacteria 4856
728 Ga0439465_0026133 3300041413 Bacteria 1845
729 Ga0451793_1610473 3300041452 Bacteria 1027
730 Ga0451807_0104523 3300041486 Bacteria 1009
731 Ga0451851_0290019 3300041507 Bacteria 631
732 Ga0451855_0070536 3300041511 Bacteria 865
733 Ga0451853_1007521 3300041512 Bacteria 854
734 Ga0439459_0016118 3300042438 Bacteria 1378
735 Ga0466961_0065107 3300044693 Bacteria 2316
736 Ga0466964_0154855 3300044706 Bacteria 1066
737 Ga0466971_0518372 3300044719 Bacteria 589
738 Ga0466970_0232843 3300044765 Bacteria 1030
739 Ga0466959_0778571 3300045049 Bacteria 640
740 Ga0466967_0285270 3300045976 Bacteria 1585
741 Ga0466967_0306657 3300045976 Bacteria 1528
742 Ga0466967_0347873 3300045976 Bacteria 1434
743 Ga0466967_0392747 3300045976 Bacteria 1349
744 Ga0495617_013046 3300046452 Bacteria 2830
745 Ga0495617_155269 3300046452 Bacteria 727
746 Ga0495592_0022948 3300046454 Bacteria 4748
747 Ga0495592_0068249 3300046454 Bacteria 2596
748 Ga0495603_0003836 3300046455 Bacteria 8949
749 Ga0495603_0023547 3300046455 Bacteria 3724
750 Ga0495603_0043708 3300046455 Bacteria 2674
751 Ga0495603_0080616 3300046455 Bacteria 1907
752 Ga0495603_0622622 3300046455 Bacteria 618
753 Ga0495629_0000862 3300046459 Bacteria 24478
754 Ga0495629_0091399 3300046459 Bacteria 2124
755 Ga0495629_0406317 3300046459 Bacteria 925
756 Ga0495638_0019608 3300046460 Bacteria 4473
757 Ga0495638_0148689 3300046460 Bacteria 1360
758 Ga0495638_0200917 3300046460 Bacteria 1125
759 Ga0495641_0348703 3300046461 Bacteria 669
760 Ga0495651_0267567 3300046462 Bacteria 1160
761 Ga0495653_0373644 3300046463 Bacteria 912
762 Ga0495580_0010268 3300046472 Bacteria 7303
763 Ga0495580_0037193 3300046472 Bacteria 3495
764 Ga0495580_0059540 3300046472 Bacteria 2684
765 Ga0495582_0006572 3300046473 Bacteria 6452
766 Ga0495582_0025793 3300046473 Bacteria 3220
767 Ga0495582_0107941 3300046473 Bacteria 1563
768 Ga0495582_0187308 3300046473 Bacteria 1180
769 Ga0495605_0194958 3300046474 Bacteria 885
770 Ga0495639_0000544 3300046475 Bacteria 17562
771 Ga0495639_0703245 3300046475 Bacteria 522
772 Ga0495662_0042974 3300046476 Bacteria 2181
773 Ga0495664_0063932 3300046477 Bacteria 2193
774 Ga0495664_0077097 3300046477 Bacteria 1996
775 Ga0495585_0032350 3300046492 Bacteria 2963
776 Ga0495585_0037849 3300046492 Bacteria 2716
777 Ga0495585_0341597 3300046492 Bacteria 729
778 Ga0495585_0355030 3300046492 Bacteria 712
779 Ga0495585_0388404 3300046492 Bacteria 673
780 Ga0495594_0026789 3300046499 Bacteria 3103
781 Ga0495594_0154774 3300046499 Bacteria 1302
782 Ga0495594_0198833 3300046499 Bacteria 1142
783 Ga0495596_0066425 3300046500 Bacteria 1402
784 Ga0495606_0253460 3300046507 Bacteria 975
785 Ga0495606_0551029 3300046507 Bacteria 574
786 Ga0495608_0143484 3300046511 Bacteria 1523
787 Ga0495610_0144252 3300046512 Bacteria 1022
788 Ga0495610_0249092 3300046512 Bacteria 705
789 Ga0495610_0337008 3300046512 Bacteria 571
790 Ga0495616_0269497 3300046513 Bacteria 726
791 Ga0495618_0430387 3300046514 Bacteria 803
792 Ga0495620_0088969 3300046515 Bacteria 1240
793 Ga0495630_0026624 3300046517 Bacteria 4283
794 Ga0495630_0029536 3300046517 Bacteria 4075
795 Ga0495631_0067517 3300046518 Bacteria 1547
796 Ga0495631_0191757 3300046518 Bacteria 875
797 Ga0495631_0215006 3300046518 Bacteria 821
798 Ga0495631_0284483 3300046518 Bacteria 704
799 Ga0495631_0307965 3300046518 Bacteria 674
800 Ga0495632_0136433 3300046519 Bacteria 1140
801 Ga0495632_0227779 3300046519 Bacteria 841
802 Ga0495644_0073339 3300046523 Bacteria 1287
803 Ga0495663_0081096 3300046525 Bacteria 1045
804 Ga0495666_0051203 3300046526 Bacteria 1984
805 Ga0495666_0502043 3300046526 Bacteria 542
806 Ga0495652_0111297 3300046529 Bacteria 2202
807 Ga0495652_0465025 3300046529 Bacteria 883
808 Ga0495665_0007397 3300046531 Bacteria 5938
809 Ga0495665_0155014 3300046531 Bacteria 1195
810 Ga0495665_0208083 3300046531 Bacteria 1013
811 Ga0495640_0002595 3300046533 Bacteria 14526
812 Ga0495640_0853911 3300046533 Bacteria 541
813 Ga0495586_0111796 3300046535 Bacteria 1521
814 Ga0495587_0035087 3300046536 Bacteria 3022
815 Ga0495598_0383886 3300046537 Bacteria 546
816 Ga0495609_0135061 3300046538 Bacteria 1055
817 Ga0495609_0318243 3300046538 Bacteria 631
818 Ga0495597_0086925 3300046542 Bacteria 1331
819 Ga0495645_0228866 3300046543 Bacteria 1246
820 Ga0495645_0466904 3300046543 Bacteria 794
821 Ga0495645_0617971 3300046543 Bacteria 665
822 Ga0495645_0750689 3300046543 Bacteria 589
823 Ga0495622_0012042 3300046557 Bacteria 3999
824 Ga0495622_0064031 3300046557 Bacteria 1701
825 Ga0495633_0267211 3300046558 Bacteria 779
826 Ga0495667_0154776 3300046559 Bacteria 1475
827 Ga0495667_0785131 3300046559 Bacteria 588
828 Ga0495656_0026839 3300046615 Bacteria 2296
829 Ga0495656_0052703 3300046615 Bacteria 1745
830 Ga0495656_0179193 3300046615 Bacteria 1041
831 Ga0495668_0077670 3300046616 Bacteria 1823
832 Ga0495668_0085192 3300046616 Bacteria 1733
833 Ga0495668_0249305 3300046616 Bacteria 972
834 Ga0495668_0255578 3300046616 Bacteria 959
835 Ga0495668_0282838 3300046616 Bacteria 909
836 Ga0495634_0290709 3300046642 Bacteria 990
837 Ga0495611_0072829 3300046648 Bacteria 1572
838 Ga0495611_0121136 3300046648 Bacteria 1220
839 Ga0495611_0316384 3300046648 Bacteria 718
840 Ga0495625_0183777 3300046660 Bacteria 1388
841 Ga0495625_0433421 3300046660 Bacteria 815
842 Ga0495625_0484986 3300046660 Bacteria 758
843 Ga0495625_0590184 3300046660 Bacteria 668
844 Ga0495635_0000436 3300046663 Bacteria 26341
845 Ga0495635_0070320 3300046663 Bacteria 2399
846 Ga0495635_0402096 3300046663 Bacteria 910
847 Ga0495659_0060867 3300046664 Bacteria 1394
848 Ga0495661_0085330 3300046665 Bacteria 1810
849 Ga0495661_0326307 3300046665 Bacteria 762
850 Ga0495588_0013756 3300046674 Bacteria 3860
851 Ga0495657_0827946 3300046675 Bacteria 528
852 Ga0495599_0138845 3300046678 Bacteria 1508
853 Ga0495599_0400473 3300046678 Bacteria 818
854 Ga0495599_0891822 3300046678 Bacteria 504
855 Ga0495623_0599247 3300046679 Bacteria 572
856 Ga0495646_0078212 3300046680 Bacteria 1933
857 Ga0495647_0474697 3300046681 Bacteria 580
858 Ga0495658_0375563 3300046683 Bacteria 905
859 Ga0495669_0000650 3300046684 Bacteria 15146
860 Ga0495669_0125391 3300046684 Bacteria 1206
861 Ga0495669_0252889 3300046684 Bacteria 846
862 Ga0495669_0608343 3300046684 Bacteria 532
863 Ga0495613_0013842 3300046689 Bacteria 5984
864 Ga0495624_0023168 3300046690 Bacteria 4096
865 Ga0495624_0044261 3300046690 Bacteria 2838
866 Ga0495624_0312140 3300046690 Bacteria 947
867 Ga0495670_0044258 3300046691 Bacteria 2222
868 Ga0495670_0187388 3300046691 Bacteria 1094
869 Ga0495670_0245510 3300046691 Bacteria 954
870 Ga0495670_0341585 3300046691 Bacteria 805
871 Ga0495649_0070708 3300046694 Bacteria 1871
872 Ga0495649_0220052 3300046694 Bacteria 982
873 Ga0495649_0505208 3300046694 Bacteria 601
874 Ga0495649_0565877 3300046694 Bacteria 562
875 Ga0495589_0051689 3300046794 Bacteria 2031
876 Ga0495589_0116759 3300046794 Bacteria 1286
877 Ga0495589_0258396 3300046794 Bacteria 813
878 Ga0495581_0282336 3300047315 Bacteria 970
879 Ga0495604_0323740 3300047317 Bacteria 1030
880 Ga0495636_0041720 3300047318 Bacteria 1905
881 Ga0495674_0008459 3300047319 Bacteria 9804
882 Ga0495674_0213064 3300047319 Bacteria 1599
883 Ga0495674_1290039 3300047319 Bacteria 548
884 Ga0495672_0043612 3300047320 Bacteria 2696
885 Ga0495672_0079874 3300047320 Bacteria 1826
886 Ga0495672_0516335 3300047320 Bacteria 529
887 Ga0495676_0192322 3300047321 Bacteria 1423
888 Ga0495676_0210521 3300047321 Bacteria 1345
889 Ga0495676_0306496 3300047321 Bacteria 1070
890 Ga0495683_0402623 3300047323 Bacteria 569
891 Ga0495685_145900 3300047447 Bacteria 770
892 Ga0495685_292251 3300047447 Bacteria 513
893 Ga0495673_0116317 3300047469 Bacteria 1063
894 Ga0495681_0098221 3300047470 Bacteria 1284
895 Ga0495684_0028441 3300047471 Bacteria 4292
896 Ga0495686_0026279 3300047472 Bacteria 3810
897 Ga0495686_0693037 3300047472 Bacteria 520
898 Ga0495593_0021586 3300047673 Bacteria 3593
899 Ga0495593_0133176 3300047673 Bacteria 1261
900 Ga0495593_0522266 3300047673 Bacteria 595
901 Ga0495614_0032035 3300048089 Bacteria 2263
902 Ga0495615_0137137 3300048090 Bacteria 719
903 Ga0496100_0131977 3300048903 Bacteria 1760
904 Ga0496100_0506484 3300048903 Bacteria 931
905 Ga0496100_1029391 3300048903 Bacteria 648
906 Ga0496100_1096012 3300048903 Bacteria 627
907 Ga0496101_0002052 3300048904 Bacteria 12255
908 Ga0496101_0177563 3300048904 Bacteria 1639
909 Ga0496101_0590416 3300048904 Bacteria 878
910 Ga0496101_0601141 3300048904 Bacteria 869
911 Ga0496102_0001771 3300048905 Bacteria 18745
912 Ga0496102_0028325 3300048905 Bacteria 5002
913 Ga0496102_0228574 3300048905 Bacteria 1754
914 Ga0496102_0789710 3300048905 Bacteria 872
915 Ga0496102_1180376 3300048905 Bacteria 685
916 Ga0496102_1421870 3300048905 Bacteria 613
917 Ga0496103_0005699 3300048906 Bacteria 7445
918 Ga0496103_0103765 3300048906 Bacteria 1801
919 Ga0496103_0345511 3300048906 Bacteria 957
920 Ga0496104_0074499 3300048907 Bacteria 3231
921 Ga0496105_0042375 3300048908 Bacteria 3752
922 Ga0496105_0085872 3300048908 Bacteria 2600
923 Ga0496106_0002858 3300048909 Bacteria 12824
924 Ga0496106_0009997 3300048909 Bacteria 7007
925 Ga0496106_0041953 3300048909 Bacteria 3430
926 Ga0496107_0002387 3300048910 Bacteria 12152
927 Ga0496107_0009519 3300048910 Bacteria 6741
928 Ga0496107_0051319 3300048910 Bacteria 2975
929 Ga0496107_0713590 3300048910 Bacteria 737
930 Ga0496108_0016020 3300048911 Bacteria 6111
931 Ga0496108_0524321 3300048911 Bacteria 1034
932 Ga0496108_0735223 3300048911 Bacteria 854
933 Ga0496108_0781677 3300048911 Bacteria 824
934 Ga0496109_0007060 3300048912 Bacteria 9476
935 Ga0496109_0197825 3300048912 Bacteria 1890
936 Ga0496109_0971871 3300048912 Bacteria 787
937 Ga0496110_0004493 3300048913 Bacteria 10817
938 Ga0496110_0015025 3300048913 Bacteria 6438
939 Ga0496110_0119761 3300048913 Bacteria 2371
940 Ga0496110_0153298 3300048913 Bacteria 2087
941 Ga0496110_0188337 3300048913 Bacteria 1874
942 Ga0496110_0291341 3300048913 Bacteria 1487
943 Ga0496110_0608064 3300048913 Bacteria 991
944 Ga0496111_0117480 3300048914 Bacteria 1962
945 Ga0496111_0459520 3300048914 Bacteria 939
946 Ga0496112_0000017 3300048915 Bacteria 191284
947 Ga0496112_0013582 3300048915 Bacteria 7524
948 Ga0496112_0105142 3300048915 Bacteria 2793
949 Ga0496112_0157337 3300048915 Bacteria 2239
950 Ga0496112_0172126 3300048915 Bacteria 2130
951 Ga0496112_0423891 3300048915 Bacteria 1269
952 Ga0496113_0031143 3300048916 Bacteria 3868
953 Ga0496113_0048870 3300048916 Bacteria 3148
954 Ga0496114_0011547 3300048917 Bacteria 7058
955 Ga0496114_0062101 3300048917 Bacteria 3126
956 Ga0496114_0254127 3300048917 Bacteria 1547
957 Ga0496115_0000535 3300048918 Bacteria 29580
958 Ga0496115_0492551 3300048918 Bacteria 986
959 Ga0496115_1352674 3300048918 Bacteria 528
960 Ga0496117_0129636 3300048920 Bacteria 1531
961 Ga0496117_0608009 3300048920 Bacteria 510
962 Ga0496118_0003407 3300048921 Bacteria 20095
963 Ga0496119_0269894 3300048922 Bacteria 850
964 Ga0496119_0291385 3300048922 Bacteria 808
965 Ga0496121_0045020 3300048924 Bacteria 3798
966 Ga0496121_0054677 3300048924 Bacteria 3333
967 Ga0496121_0129108 3300048924 Bacteria 1895
968 Ga0496121_0224635 3300048924 Bacteria 1320
969 Ga0496121_0291596 3300048924 Bacteria 1111
970 Ga0496121_0322012 3300048924 Bacteria 1040
971 Ga0496121_0327432 3300048924 Bacteria 1029
972 Ga0496121_0578250 3300048924 Bacteria 697
973 Ga0496124_0026548 3300048927 Bacteria 5219
974 Ga0496124_0178729 3300048927 Bacteria 1635
975 Ga0496124_0273454 3300048927 Bacteria 1236
976 Ga0496124_0404719 3300048927 Bacteria 946
977 Ga0496125_0051831 3300048928 Bacteria 3380
978 Ga0496125_0265018 3300048928 Bacteria 1074
979 Ga0496125_0303374 3300048928 Bacteria 977
980 Ga0496126_0002483 3300048929 Bacteria 24817
981 Ga0496126_0092604 3300048929 Bacteria 2655
982 Ga0496126_0149771 3300048929 Bacteria 2001
983 Ga0496126_0176947 3300048929 Bacteria 1814
984 Ga0496126_0212828 3300048929 Bacteria 1626
985 Ga0496126_0407184 3300048929 Bacteria 1102
986 Ga0496126_0494497 3300048929 Bacteria 978
987 Ga0496126_0572690 3300048929 Bacteria 893
988 Ga0496126_0645808 3300048929 Bacteria 828
989 Ga0496126_0758943 3300048929 Bacteria 748
990 Ga0495678_115396 3300049459 Bacteria 910
991 Ga0501031_0008184 3300049568 Bacteria 6805
992 Ga0501032_0000704 3300049569 Bacteria 27243
993 Ga0501033_0000311 3300049570 Bacteria 46039
994 Ga0501034_0000039 3300049571 Bacteria 237357
995 Ga0501036_0000127 3300049572 Bacteria 48559
996 Ga0501037_0000025 3300049573 Bacteria 143276
997 Ga0501038_0000342 3300049574 Bacteria 40148
998 Ga0501039_0000840 3300049575 Bacteria 22181
999 Ga0501042_0026448 3300049578 Bacteria 4078
1000 Ga0501043_0000120 3300049579 Bacteria 72670
1001 Ga0501046_0000359 3300049580 Bacteria 45929
1002 Ga0501046_0048465 3300049580 Bacteria 3364
1003 Ga0501047_0000379 3300049581 Bacteria 50147
1004 Ga0501047_0084770 3300049581 Bacteria 3045
1005 Ga0501047_1343705 3300049581 Bacteria 529
1006 Ga0501048_0000352 3300049582 Bacteria 31854
1007 Ga0501067_0000025 3300049583 Bacteria 91481
1008 Ga0501068_0001230 3300049584 Bacteria 13601
1009 Ga0501069_0007011 3300049585 Bacteria 5899
1010 Ga0501069_0175721 3300049585 Bacteria 1237
1011 Ga0501070_0002185 3300049586 Bacteria 17207
1012 Ga0501070_0042781 3300049586 Bacteria 3772
1013 Ga0501071_0244492 3300049587 Bacteria 1353
1014 Ga0501072_0002767 3300049588 Bacteria 13186
1015 Ga0501072_0624932 3300049588 Bacteria 849
1016 Ga0501073_0000091 3300049589 Bacteria 57029
1017 Ga0501073_0258618 3300049589 Bacteria 1201
1018 Ga0501074_0000489 3300049590 Bacteria 24170
1019 Ga0501074_0025368 3300049590 Bacteria 4305
1020 Ga0501076_0228198 3300049592 Bacteria 1522
1021 Ga0501076_0842771 3300049592 Bacteria 756
1022 Ga0501079_0006818 3300049741 Bacteria 8597
1023 Ga0501080_0000321 3300049742 Bacteria 36637
1024 Ga0501080_0026275 3300049742 Bacteria 5410
1025 Ga0501083_0000284 3300049744 Bacteria 32169
1026 Ga0501035_0001251 3300049822 Bacteria 26410
1027 Ga0501035_0423288 3300049822 Bacteria 1105
1028 Ga0501044_0000274 3300049823 Bacteria 65668
1029 Ga0501044_0144750 3300049823 Bacteria 2363
1030 Ga0501045_0005330 3300049824 Bacteria 8907
1031 nmdc:mga03683_309151_c1 3300050489 Bacteria 742
1032 nmdc:mga03n38_341479_c1 3300050490 Bacteria 813
1033 nmdc:mga00v17_465059_c1 3300050491 Bacteria 821
1034 nmdc:mga00v17_888245_c1 3300050491 Bacteria 565
1035 nmdc:mga0yw44_535895_c1 3300050492 Bacteria 795
1036 nmdc:mga0yw44_706686_c1 3300050492 Bacteria 685
1037 nmdc:mga0yw44_90407_c1 3300050492 Bacteria 1934
1038 nmdc:mga0k408_240358_c1 3300050493 Bacteria 1081
1039 nmdc:mga0k408_97231_c1 3300050493 Bacteria 1734
1040 nmdc:mga06z11_103107_c1 3300050494 Bacteria 1568
1041 nmdc:mga06z11_207023_c1 3300050494 Bacteria 1142
1042 nmdc:mga0qj67_501630_c1 3300050509 Bacteria 975
1043 nmdc:mga08y16_916868_c1 3300050511 Bacteria 861
1044 nmdc:mga0n895_1812074_c1 3300050512 Bacteria 571
1045 nmdc:mga0n895_382114_c1 3300050512 Bacteria 1425
1046 nmdc:mga0rr50_866533_c1 3300050513 Bacteria 770
1047 nmdc:mga0a205_622660_c1 3300050515 Bacteria 931
1048 nmdc:mga0sz30_308756_c1 3300050516 Bacteria 705
1049 nmdc:mga0sz30_78446_c1 3300050516 Bacteria 1126
1050 Ga0495601_0078465 3300053077 Bacteria 2116
1051 Ga0495601_0146773 3300053077 Bacteria 1540
1052 Ga0495601_0252734 3300053077 Bacteria 1151
1053 Ga0495601_0324068 3300053077 Bacteria 1003
1054 Ga0495612_0056240 3300053078 Bacteria 1623
1055 Ga0495612_0175279 3300053078 Bacteria 940
1056 Ga0495612_0240040 3300053078 Bacteria 805
1057 Ga0495612_0332974 3300053078 Bacteria 684
1058 Ga0495655_0068994 3300053083 Bacteria 984
1059 Ga0495655_0092691 3300053083 Bacteria 883
1060 Ga0495595_0026236 3300053084 Bacteria 2588
1061 Ga0495619_0209249 3300053085 Bacteria 1351
1062 Ga0495619_0246095 3300053085 Bacteria 1239
1063 Ga0500643_051619 3300053087 Bacteria 1174
1064 Ga0500646_0022529 3300053090 Bacteria 1685
1065 Ga0500646_0071361 3300053090 Bacteria 1042
1066 Ga0500583_0072009 3300053092 Bacteria 1654
1067 Ga0500583_0333398 3300053092 Bacteria 738
1068 Ga0500651_0670507 3300053093 Bacteria 557
1069 Ga0500566_0000158 3300053094 Bacteria 34495
1070 Ga0500566_0078847 3300053094 Bacteria 1837
1071 Ga0500566_0201394 3300053094 Bacteria 1005
1072 Ga0500640_000568 3300053095 Bacteria 9480
1073 Ga0500641_0008502 3300053096 Bacteria 3666
1074 Ga0500648_057745 3300053097 Bacteria 2201
1075 Ga0500650_0224827 3300053098 Bacteria 848
1076 Ga0500554_007059 3300053102 Bacteria 2562
1077 Ga0500562_063291 3300053108 Bacteria 995
1078 Ga0500569_215176 3300053109 Bacteria 653
1079 Ga0500569_306904 3300053109 Bacteria 533
1080 Ga0500572_000024 3300053111 Bacteria 47391
1081 Ga0500591_078328 3300053115 Bacteria 1477
1082 Ga0500594_0098002 3300053118 Bacteria 899
1083 Ga0500595_001188 3300053119 Bacteria 14372
1084 Ga0500608_001300 3300053122 Bacteria 8888
1085 Ga0500614_001812 3300053123 Bacteria 4949
1086 Ga0500642_0270682 3300053130 Bacteria 775
1087 Ga0500658_0175660 3300053134 Bacteria 974
1088 Ga0500658_0382952 3300053134 Bacteria 644
1089 Ga0500559_0003877 3300053136 Bacteria 7232
1090 Ga0500559_0178998 3300053136 Bacteria 998
1091 Ga0500561_0145643 3300053137 Bacteria 735
1092 Ga0500568_0060565 3300053139 Bacteria 1466
1093 Ga0500573_0032643 3300053140 Bacteria 3003
1094 Ga0500577_0139481 3300053142 Bacteria 1022
1095 Ga0500579_188848 3300053143 Bacteria 791
1096 Ga0500588_0401468 3300053146 Bacteria 522
1097 Ga0500589_025035 3300053147 Bacteria 2761
1098 Ga0500589_313473 3300053147 Bacteria 550
1099 Ga0500590_122838 3300053148 Bacteria 1214
1100 Ga0500590_146250 3300053148 Bacteria 1073
1101 Ga0500603_000465 3300053150 Bacteria 10412
1102 Ga0500603_000801 3300053150 Bacteria 7516
1103 Ga0500603_048017 3300053150 Bacteria 1160
1104 Ga0500603_242973 3300053150 Bacteria 578
1105 Ga0500622_0382782 3300053156 Bacteria 575
1106 Ga0500627_0357681 3300053158 Bacteria 629
1107 Ga0500630_000112 3300053159 Bacteria 26672
1108 Ga0500634_0081721 3300053161 Bacteria 1663
1109 Ga0500638_012135 3300053162 Bacteria 3851
1110 Ga0500638_197823 3300053162 Bacteria 853
1111 Ga0500639_000040 3300053163 Bacteria 63516
1112 Ga0500636_0086872 3300053177 Bacteria 1795
1113 Ga0500636_0184124 3300053177 Bacteria 1118
1114 Ga0500637_0039960 3300053178 Bacteria 2647
1115 Ga0500637_0108912 3300053178 Bacteria 1606
1116 Ga0500609_015774 3300053731 Bacteria 1024
1117 Ga0500596_000794 3300053735 Bacteria 6229
1118 Ga0500596_005461 3300053735 Bacteria 2233
1119 Ga0501084_0007045 3300054114 Bacteria 9269
1120 Ga0587076_056219 3300059645 Bacteria 781
1121 Ga0501082_0026885 3300060353 Bacteria 4957
1122 2509149319 2508501128 Bacteria 8613869
1123 2513654070 2513237096 Bacteria 8722461
1124 2513891271 2513237141 Bacteria 8496279
1125 2513918410 2513237145 Bacteria 8979722
1126 2517891356 2517572143 Bacteria 9484767
1127 2671118864 2667528175 Bacteria 7532676
1128 2728750068 2728368998 Bacteria 8720350
1129 2793066724 2791355197 Bacteria 8420563
1130 2793080652
1131 2876814617 2876808645 Bacteria 8824342
1132 2879114698 2879110137 Bacteria 8907982
1133 2885374989 2885374607 Bacteria 8927485
1134 2889038035 2889033259 Bacteria 9099371
1135 2903755317 2903748898 Bacteria 9972761
1136 2904691224 2904690495 Bacteria 9412302
1137 2904701310
1138 2906616542
1139 2908741710 2908739725 Bacteria 8628932
1140 2908759135 2908756301 Bacteria 8864324
1141 2922387369 2922386360 Bacteria 7017218
1142 2922431438
1143 2935634034 2935630451 Bacteria 8169952
1144 2941510663 2941507105 Bacteria 8166816
1145 2941518047 2941515067 Bacteria 8166720
1146 2941527082 2941523033 Bacteria 8169134
1147 3005481231 3005474847 Bacteria 9259049
1148 8006939478 8006933436 Bacteria 10410654
1149 8006972136 8006964411 Bacteria 8966052
1150 8006979228 8006973647 Bacteria 10679141
1151 8006984409 8006984368 Bacteria 9651211
1152 8019565358 8019555841 Bacteria 9642137
1153 8019575456 8019565922 Bacteria 9639779
1154 8056681087 8056673599 Bacteria 7871253
1155 Ga0105241_10028779
1156 JGI25406J46586_10009343
1157 JGI25165J46597_1011939
1158 JGI25153J46596_10051467
1159 JGI25404J52841_10003019
1160 JGI25404J52841_10010753
1161 JGI25404J52841_10016744
1162 JGI25404J52841_10041444
1163 Ga0070658_10150878
1164 Ga0070658_10362781
1165 Ga0070676_10668089
1166 Ga0070683_100095571
1167 Ga0070683_100306288
1168 Ga0070683_101207674
1169 Ga0070683_101249715
1170 Ga0068869_100283829
1171 Ga0068869_100411856
1172 Ga0068869_101378147
1173 Ga0070680_100052018
1174 Ga0070680_100194884
1175 Ga0070680_100676728
1176 Ga0070682_100039753
1177 Ga0070682_100175885
1178 Ga0070682_100246809
1179 Ga0070682_100503776
1180 Ga0068868_100034182
1181 Ga0068868_100389483
1182 Ga0068868_100548398
1183 Ga0068868_100560813
1184 Ga0070660_100051646
1185 Ga0070687_100299556
1186 Ga0070661_100328466
1187 Ga0070661_100395995
1188 Ga0070661_100556992
1189 Ga0070692_10391666
1190 Ga0070668_100044248
1191 Ga0070668_100074675
1192 Ga0070668_100207755
1193 Ga0070668_100301249
1194 Ga0070668_100481665
1195 Ga0070668_100724073
1196 Ga0070669_100068986
1197 Ga0070671_100342350
1198 Ga0070671_100383792
1199 Ga0070671_100708452
1200 Ga0070674_100034692
1201 Ga0070688_100855168
1202 Ga0070659_100053918
1203 Ga0070667_100236881
1204 Ga0070667_100569881
1205 Ga0070667_100623283
1206 Ga0070667_100797903
1207 Ga0070709_10004227
1208 Ga0070709_10048345
1209 Ga0070709_10311929
1210 Ga0070714_100082971
1211 Ga0070714_100280905
1212 Ga0070714_100541466
1213 Ga0070714_100551108
1214 Ga0070713_100042275
1215 Ga0070713_100088760
1216 Ga0070713_100353933
1217 Ga0070713_100363813
1218 Ga0070710_10042080
1219 Ga0070710_10179435
1220 Ga0070711_100001730
1221 Ga0070711_100011938
1222 Ga0070711_100061879
1223 Ga0070711_100131145
1224 Ga0070711_100692074
1225 Ga0070705_100619464
1226 Ga0070700_100046080
1227 Ga0070700_100755597
1228 Ga0070694_100787580
1229 Ga0070663_100010941
1230 Ga0070663_100050917
1231 Ga0070663_100068772
1232 Ga0070663_100185086
1233 Ga0070663_100891518
1234 Ga0070678_100010095
1235 Ga0070678_100529455
1236 Ga0070678_100647096
1237 Ga0070678_100700015
1238 Ga0070662_100031971
1239 Ga0070662_100088266
1240 Ga0070662_100457978
1241 Ga0070662_100709265
1242 Ga0070681_10003273
1243 Ga0070681_10025087
1244 Ga0070681_10056849
1245 Ga0070681_10065024
1246 Ga0070681_10341341
1247 Ga0068867_100250304
1248 Ga0068867_100424557
1249 Ga0070685_10729585
1250 Ga0070685_10756908
1251 Ga0070685_10911377
1252 Ga0070698_100536537
1253 Ga0070698_101485996
1254 Ga0070699_101178226
1255 Ga0070679_100009864
1256 Ga0070679_100017482
1257 Ga0070679_100017715
1258 Ga0070679_100036722
1259 Ga0070679_100303056
1260 Ga0070679_100865639
1261 Ga0070684_100013567
1262 Ga0070684_100231212
1263 Ga0070684_100338695
1264 Ga0070684_100481400
1265 Ga0070697_100328239
1266 Ga0070697_100350906
1267 Ga0068853_100040363
1268 Ga0068853_100130357
1269 Ga0068853_100286863
1270 Ga0068853_100372296
1271 Ga0068853_100411221
1272 Ga0070672_100191116
1273 Ga0070672_100191311
1274 Ga0070672_100431858
1275 Ga0070672_100895577
1276 Ga0070686_100740264
1277 Ga0070695_100764136
1278 Ga0070696_100760250
1279 Ga0070693_101383201
1280 Ga0070665_100189047
1281 Ga0070665_100336297
1282 Ga0070665_100357790
1283 Ga0070665_101089130
1284 Ga0070665_101216753
1285 Ga0070665_101665143
1286 Ga0070704_100517830
1287 Ga0068855_100010865
1288 Ga0068855_100067952
1289 Ga0068855_100116881
1290 Ga0068855_100142865
1291 Ga0070664_100089985
1292 Ga0070664_100363338
1293 Ga0068857_100016047
1294 Ga0068857_100106311
1295 Ga0068857_101483817
1296 Ga0068857_101752540
1297 Ga0068857_101803285
1298 Ga0068854_100316488
1299 Ga0068854_100587678
1300 Ga0068856_100731211
1301 Ga0070702_100130267
1302 Ga0068852_100036815
1303 Ga0068852_100249880
1304 Ga0068852_100254398
1305 Ga0068852_100477308
1306 Ga0068852_101247821
1307 Ga0068852_101867233
1308 Ga0068859_100463120
1309 Ga0068864_100494527
1310 Ga0068866_10021865
1311 Ga0068866_10509547
1312 Ga0068861_100410264
1313 Ga0068861_100816180
1314 Ga0068861_101639683
1315 Ga0068851_10004825
1316 Ga0068870_10078252
1317 Ga0068863_100655952
1318 Ga0068863_100744625
1319 Ga0068863_100911131
1320 Ga0068863_101044798
1321 Ga0068863_101352280
1322 Ga0068858_100046102
1323 Ga0068858_100074580
1324 Ga0068858_100917487
1325 Ga0068860_100331144
1326 Ga0068860_100352450
1327 Ga0068860_100462292
1328 Ga0068860_100483318
1329 Ga0068860_100499225
1330 Ga0068862_100129799
1331 Ga0068862_100302221
1332 Ga0068862_100414040
1333 Ga0068862_100515000
1334 Ga0068862_100669787
1335 Ga0068862_101682387
1336 Ga0081455_10009971
1337 Ga0081455_10037550
1338 Ga0081455_10087531
1339 Ga0081455_10127583
1340 Ga0081455_10150862
1341 Ga0081540_1006422
1342 Ga0081540_1009663
1343 Ga0081540_1011844
1344 Ga0081540_1012349
1345 Ga0081540_1013491
1346 Ga0081540_1014382
1347 Ga0081540_1018818
1348 Ga0081539_10000768
1349 Ga0081539_10001470
1350 Ga0081539_10004445
1351 Ga0081539_10058092
1352 Ga0070717_10001267
1353 Ga0070717_10017332
1354 Ga0070717_10416085
1355 Ga0070717_10501552
1356 Ga0075365_10083284
1357 Ga0075365_10101356
1358 Ga0075365_10541421
1359 Ga0075365_10770016
1360 Ga0075363_100113059
1361 Ga0075363_100352030
1362 Ga0075363_100407285
1363 Ga0075364_10088472
1364 Ga0075432_10149429
1365 Ga0070716_100107458
1366 Ga0070716_100189057
1367 Ga0070716_100666400
1368 Ga0070716_101690869
1369 Ga0070712_100111079
1370 Ga0070712_100118582
1371 Ga0070712_100905172
1372 Ga0075362_10396330
1373 Ga0075367_10142444
1374 Ga0075369_10127055
1375 Ga0075369_10247272
1376 Ga0075369_10336005
1377 Ga0075366_10239677
1378 Ga0075366_10593436
1379 Ga0075366_10603489
1380 Ga0075366_10853991
1381 Ga0097621_100209156
1382 Ga0097621_101107206
1383 Ga0097621_101274183
1384 Ga0097621_101490690
1385 Ga0075370_10219152
1386 Ga0075370_10380400
1387 Ga0068871_100254458
1388 Ga0068871_100483860
1389 Ga0068871_100802604
1390 Ga0068871_101385620
1391 Ga0075428_100700818
1392 Ga0075433_10677350
1393 Ga0075429_100967043
1394 Ga0068865_100444871
1395 Ga0068865_100647710
1396 Ga0068865_100847786
1397 Ga0068865_101028166
1398 Ga0097620_100463136
1399 Ga0099825_1034140
1400 Ga0099824_1007408
1401 Ga0099822_1006547
1402 Ga0099794_10013294
1403 Ga0099794_10298454
1404 Ga0099794_10419992
1405 Ga0099795_10003875
1406 Ga0099795_10184751
1407 Ga0105251_10576561
1408 Ga0105250_10539583
1409 Ga0105240_10034221
1410 Ga0105240_10058690
1411 Ga0105240_10105395
1412 Ga0105240_10108708
1413 Ga0105240_10522672
1414 Ga0105240_11095681
1415 Ga0105240_11604799
1416 Ga0105240_12534470
1417 Ga0111539_10144248
1418 Ga0111539_11656237
1419 Ga0105245_10105057
1420 Ga0105245_10289341
1421 Ga0105245_10829319
1422 Ga0105245_11842058
1423 Ga0105247_10110567
1424 Ga0105247_10136367
1425 Ga0105247_10155708
1426 Ga0105247_10400587
1427 Ga0114129_10191104
1428 Ga0105243_10078753
1429 Ga0105243_10929161
1430 Ga0105243_11232577
1431 Ga0105243_12506854
1432 Ga0105242_10115715
1433 Ga0105242_10131362
1434 Ga0105242_11576074
1435 Ga0105242_11936273
1436 Ga0105248_10139917
1437 Ga0105248_10204152
1438 Ga0105248_10336933
1439 Ga0105248_10881040
1440 Ga0105237_10087664
1441 Ga0105237_10508977
1442 Ga0105237_10562761
1443 Ga0105237_10641091
1444 Ga0105237_10726224
1445 Ga0105237_10766119
1446 Ga0105237_11358764
1447 Ga0105237_11568743
1448 Ga0105238_10017402
1449 Ga0105238_10140974
1450 Ga0105238_10358018
1451 Ga0105238_10360284
1452 Ga0105238_10598531
1453 Ga0105238_11028171
1454 Ga0105249_10080447
1455 Ga0105249_10645237
1456 Ga0099796_10459180
1457 Ga0105239_10020324
1458 Ga0105239_10029566
1459 Ga0105239_10118154
1460 Ga0105239_10151085
1461 Ga0105239_10404892
1462 Ga0105239_10804993
1463 Ga0105246_10106488
1464 Ga0105246_10229454
1465 Ga0105246_10256365
1466 Ga0105246_10675292
1467 Ga0105246_11328480
1468 Ga0157338_1036802
1469 Ga0157371_10727887
1470 Ga0157371_11388202
1471 Ga0157370_10014947
1472 Ga0157370_10025078
1473 Ga0157370_10071347
1474 Ga0157370_10296740
1475 Ga0157370_10862740
1476 Ga0157370_10950068
1477 Ga0157369_10021190
1478 Ga0157369_10047353
1479 Ga0157369_10130028
1480 Ga0157369_10501429
1481 Ga0157369_10602033
1482 Ga0157374_10033305
1483 Ga0157374_10530713
1484 Ga0157378_10070080
1485 Ga0157378_10356319
1486 Ga0157378_10368636
1487 Ga0157378_11541203
1488 Ga0157378_13043504
1489 Ga0163162_10578216
1490 Ga0163162_11108831
1491 Ga0163162_11309716
1492 Ga0163162_13152751
1493 Ga0157372_10196832
1494 Ga0157372_10708827
1495 Ga0157372_12031415
1496 Ga0157372_12344199
1497 Ga0157375_10009689
1498 Ga0157375_11105739
1499 Ga0157375_11934839
1500 Ga0157375_12308347
1501 Ga0163163_10159204
1502 Ga0163163_10453589
1503 Ga0163163_10571962
1504 Ga0163163_11094788
1505 Ga0163163_12257726
1506 Ga0157380_10184873
1507 Ga0157380_10184912
1508 Ga0157380_10811873
1509 Ga0157380_12152610
1510 Ga0157377_10094953
1511 Ga0157377_10173047
1512 Ga0157377_11356277
1513 Ga0157379_10085565
1514 Ga0157379_10341117
1515 Ga0157379_10659533
1516 Ga0157376_10092020
1517 Ga0157376_10557471
1518 Ga0163161_10128231
1519 Ga0163161_10232435
1520 Ga0163161_10303939
1521 Ga0206356_10766524
1522 Ga0206356_11320371
1523 Ga0206353_10272000
1524 Ga0213874_10013946
1525 Ga0213876_10020027
1526 Ga0213876_10072356
1527 Ga0209233_1002384
1528 Ga0209758_1030944
1529 Ga0209758_1031236
1530 Ga0209758_1050827
1531 Ga0209758_1091452
1532 Ga0207697_10085069
1533 Ga0207656_10034898
1534 Ga0207682_10212877
1535 Ga0207642_10037371
1536 Ga0207642_10398319
1537 Ga0207642_10478566
1538 Ga0207642_10583281
1539 Ga0207710_10176392
1540 Ga0207710_10384506
1541 Ga0207710_10598127
1542 Ga0207688_10215003
1543 Ga0207688_10282908
1544 Ga0207688_10421078
1545 Ga0207688_10436633
1546 Ga0207688_10518079
1547 Ga0207680_10591542
1548 Ga0207685_10027483
1549 Ga0207699_10025234
1550 Ga0207699_10156951
1551 Ga0207699_10490158
1552 Ga0207699_10910031
1553 Ga0207645_10058248
1554 Ga0207645_10172342
1555 Ga0207705_10269578
1556 Ga0207705_10295605
1557 Ga0207684_10216101
1558 Ga0207684_10558714
1559 Ga0207684_11207051
1560 Ga0207654_10429061
1561 Ga0207707_10000419
1562 Ga0207707_10002705
1563 Ga0207707_10002868
1564 Ga0207707_10045918
1565 Ga0207707_10135089
1566 Ga0207695_10048124
1567 Ga0207695_10060686
1568 Ga0207695_10140869
1569 Ga0207695_10240619
1570 Ga0207695_10363647
1571 Ga0207671_10061259
1572 Ga0207671_10378725
1573 Ga0207671_10456499
1574 Ga0207671_10485729
1575 Ga0207671_11174057
1576 Ga0207693_10041850
1577 Ga0207693_10071447
1578 Ga0207693_10086606
1579 Ga0207693_10770161
1580 Ga0207663_10007087
1581 Ga0207663_10043021
1582 Ga0207663_10065948
1583 Ga0207663_10116334
1584 Ga0207663_10390605
1585 Ga0207660_10012377
1586 Ga0207660_10048142
1587 Ga0207660_10305114
1588 Ga0207660_10330707
1589 Ga0207662_10113335
1590 Ga0207662_11223767
1591 Ga0207657_10011308
1592 Ga0207657_10420585
1593 Ga0207649_10039488
1594 Ga0207649_10557951
1595 Ga0207652_10001690
1596 Ga0207652_10009155
1597 Ga0207652_10011695
1598 Ga0207652_10047707
1599 Ga0207652_10055058
1600 Ga0207646_10826670
1601 Ga0207681_10039022
1602 Ga0207681_10411264
1603 Ga0207681_10889286
1604 Ga0207694_10027290
1605 Ga0207694_10075966
1606 Ga0207694_10321799
1607 Ga0207694_10731282
1608 Ga0207694_11027946
1609 Ga0207659_10101426
1610 Ga0207687_10157928
1611 Ga0207687_10395148
1612 Ga0207687_10641434
1613 Ga0207700_10005544
1614 Ga0207700_10063406
1615 Ga0207700_10118805
1616 Ga0207700_10120991
1617 Ga0207700_10183800
1618 Ga0207700_11162919
1619 Ga0207664_10042851
1620 Ga0207664_10150641
1621 Ga0207664_10229936
1622 Ga0207664_10489807
1623 Ga0207644_10234854
1624 Ga0207644_11082889
1625 Ga0207644_11312479
1626 Ga0207644_11400987
1627 Ga0207690_10587430
1628 Ga0207706_10015272
1629 Ga0207706_10225273
1630 Ga0207706_10408965
1631 Ga0207709_10358165
1632 Ga0207709_10503061
1633 Ga0207709_10528054
1634 Ga0207709_10862442
1635 Ga0207709_10893438
1636 Ga0207669_10095367
1637 Ga0207669_10718476
1638 Ga0207669_11091687
1639 Ga0207704_10666308
1640 Ga0207704_11179898
1641 Ga0207665_10036449
1642 Ga0207665_10088797
1643 Ga0207665_10195726
1644 Ga0207665_10253201
1645 Ga0207665_10611246
1646 Ga0207665_10847064
1647 Ga0207691_10054640
1648 Ga0207691_10168119
1649 Ga0207691_10426374
1650 Ga0207691_10505181
1651 Ga0207691_10765507
1652 Ga0207711_10284242
1653 Ga0207689_10011785
1654 Ga0207689_10125319
1655 Ga0207689_10326522
1656 Ga0207661_10001270
1657 Ga0207661_10008213
1658 Ga0207661_10021058
1659 Ga0207679_10069235
1660 Ga0207679_10271615
1661 Ga0207679_10377220
1662 Ga0207679_10916061
1663 Ga0207667_10002017
1664 Ga0207667_10145129
1665 Ga0207667_10201639
1666 Ga0207667_10510487
1667 Ga0207667_11719651
1668 Ga0207651_10112506
1669 Ga0207651_10603500
1670 Ga0207712_10128621
1671 Ga0207668_10150043
1672 Ga0207668_10241238
1673 Ga0207668_10335998
1674 Ga0207668_10471341
1675 Ga0207668_10481127
1676 Ga0207668_10558761
1677 Ga0207640_10214238
1678 Ga0207640_10407822
1679 Ga0207640_10539537
1680 Ga0207658_10132641
1681 Ga0207658_10375592
1682 Ga0207658_11256020
1683 Ga0207658_11567847
1684 Ga0207677_10005891
1685 Ga0207677_10532795
1686 Ga0207703_10394218
1687 Ga0207703_10999855
1688 Ga0207703_11300422
1689 Ga0207639_10173169
1690 Ga0207639_10837909
1691 Ga0207639_10970591
1692 Ga0207639_12227199
1693 Ga0207678_10006479
1694 Ga0207678_10044766
1695 Ga0207678_10061454
1696 Ga0207678_10196905
1697 Ga0207678_10628445
1698 Ga0207678_10860880
1699 Ga0207678_11372541
1700 Ga0207678_11916079
1701 Ga0207708_10158521
1702 Ga0207708_10981793
1703 Ga0207702_10273884
1704 Ga0207702_10875316
1705 Ga0207702_10903267
1706 Ga0207641_10606623
1707 Ga0207641_11251741
1708 Ga0207641_11833036
1709 Ga0207648_10797285
1710 Ga0207648_10821718
1711 Ga0207648_10936444
1712 Ga0207676_10069328
1713 Ga0207674_10010575
1714 Ga0207674_10113295
1715 Ga0207674_10242397
1716 Ga0207674_10457616
1717 Ga0207674_10594400
1718 Ga0207674_11383866
1719 Ga0207674_11674039
1720 Ga0207675_100031334
1721 Ga0207675_100064640
1722 Ga0207675_100274434
1723 Ga0207675_100422111
1724 Ga0207675_101532037
1725 Ga0207675_101742728
1726 Ga0207675_101791882
1727 Ga0207683_10021694
1728 Ga0207683_10197482
1729 Ga0207683_10648249
1730 Ga0207683_10766064
1731 Ga0207698_10226900
1732 Ga0207698_10295269
1733 Ga0207698_10317285
1734 Ga0207698_10501287
1735 Ga0207698_11430873
1736 Ga0209589_1000014
1737 Ga0209489_100014
1738 Ga0209700_100024
1739 Ga0209179_1012641
1740 Ga0209179_1048167
1741 Ga0209588_1002539
1742 Ga0268266_10147257
1743 Ga0268266_10201322
1744 Ga0268266_10391978
1745 Ga0268266_10570437
1746 Ga0268266_11270396
1747 Ga0268265_10198420
1748 Ga0268265_10268121
1749 Ga0268265_10304954
1750 Ga0268265_10753171
1751 Ga0268265_11590458
1752 Ga0268265_11681054
1753 Ga0268265_11964165
1754 Ga0268265_12483165
1755 Ga0268264_10055549
1756 Ga0268264_10292401
1757 Ga0268264_10568056
1758 Ga0268264_10893234
1759 Ga0268264_11123623
1760 Ga0268264_11758227
1761 Ga0265337_1007001
1762 Ga0265326_10065353
1763 Ga0265319_1006536
1764 Ga0265334_10001696
1765 Ga0265318_10008197
1766 Ga0265323_10001106
1767 Ga0265322_10001590
1768 Ga0265336_10000135
1769 Ga0307517_10000634
1770 Ga0307517_10039620
1771 Ga0307517_10324896
1772 Ga0307517_10594244
1773 Ga0307515_10006012
1774 Ga0307515_10512273
1775 Ga0265338_10000034
1776 Ga0265338_10361635
1777 Ga0265324_10001466
1778 Ga0265324_10156835
1779 Ga0307511_10024264
1780 Ga0265332_10013209
1781 Ga0307513_10125438
1782 Ga0307513_10444506
1783 Ga0307513_10645174
1784 Ga0307509_10132445
1785 Ga0307509_10826352
1786 Ga0307508_10000032
1787 Ga0307508_10022899
1788 Ga0307508_10139265
1789 Ga0307508_10715631
1790 Ga0265314_10195305
1791 Ga0307516_10005934
1792 Ga0307516_10039539
1793 Ga0307516_10300751
1794 Ga0307405_10879540
1795 Ga0307413_10061917
1796 Ga0307413_10440005
1797 Ga0307410_10143713
1798 Ga0307406_10896882
1799 Ga0307407_10186122
1800 Ga0307412_10093307
1801 Ga0307412_11811460
1802 Ga0307416_100738479
1803 Ga0307411_10300285
1804 Ga0307415_100094054
1805 Ga0307415_100687932
1806 Ga0307507_10011278
1807 Ga0307510_10016157
1808 Ga0307510_10091519
1809 Ga0373930_0001351
1810 Ga0373959_0055718
1811 Ga0373926_0007554
1812 Ga0373934_0187215
1813 Ga0373951_0013653
1814 Ga0373952_0108085
1815 Ga0373923_0061471
1816 Ga0373923_0236904
1817 Ga0373936_0061479
1818 Ga0373936_0068996
1819 Ga0373939_0227291
1820 Ga0373939_0489452
1821 Ga0373954_0081500
1822 Ga0373954_0166773
1823 Ga0373956_0304788
1824 Ga0373956_0407056
1825 Ga0373943_0083782
1826 Ga0373946_0026464
1827 Ga0373946_0058279
1828 Ga0373955_0040395
1829 Ga0373955_0058451
1830 Ga0373955_0880774
1831 Ga0373924_0017175
1832 Ga0373931_0002187
1833 Ga0373931_0384182
1834 Ga0373931_0390676
1835 Ga0373931_0434475
1836 Ga0373931_1246755
1837 Ga0373935_0012923
1838 Ga0373935_0032924
1839 Ga0373935_0063455
1840 Ga0373935_0069468
1841 Ga0373935_0324990
1842 Ga0373935_0607081
1843 Ga0373927_0014717
1844 Ga0373927_0015621
1845 Ga0373927_0044610
1846 Ga0373927_0060854
1847 Ga0373927_0169814
1848 Ga0373927_0523744
1849 Ga0373927_0605220
1850 Ga0373927_0732936
1851 Ga0373933_0000182
1852 Ga0373933_0219645
1853 Ga0373933_1055597
1854 Ga0373947_0025925
1855 Ga0373947_0028707
1856 Ga0373947_0076608
1857 Ga0373937_0399859
1858 Ga0372808_009572
1859 Ga0373925_0025108
1860 Ga0373925_0054383
1861 Ga0373925_0102550
1862 Ga0373925_0125508
1863 Ga0373925_0453465
1864 Ga0373925_0589940
1865 Ga0395900_0017080
1866 Ga0395900_0082779
1867 Ga0395900_0200935
1868 Ga0395898_0099842
1869 Ga0395905_0996464
1870 Ga0395901_0044477
1871 Ga0395901_0153963
1872 Ga0395901_0251715
1873 Ga0436365_0229539
1874 Ga0436365_0585470
1875 Ga0436365_0644236
1876 Ga0436365_1524424
1877 Ga0436365_1891875
1878 Ga0436363_0130820
1879 Ga0436363_0194304
1880 Ga0436363_0749925
1881 Ga0436363_1284900
1882 Ga0439465_0026133
1883 Ga0451793_1610473
1884 Ga0451807_0104523
1885 Ga0451851_0290019
1886 Ga0451855_0070536
1887 Ga0451853_1007521
1888 Ga0439459_0016118
1889 Ga0466961_0065107
1890 Ga0466964_0154855
1891 Ga0466971_0518372
1892 Ga0466970_0232843
1893 Ga0466959_0778571
1894 Ga0466967_0285270
1895 Ga0466967_0306657
1896 Ga0466967_0347873
1897 Ga0466967_0392747
1898 Ga0495617_013046
1899 Ga0495617_155269
1900 Ga0495592_0022948
1901 Ga0495592_0068249
1902 Ga0495603_0003836
1903 Ga0495603_0023547
1904 Ga0495603_0043708
1905 Ga0495603_0080616
1906 Ga0495603_0622622
1907 Ga0495629_0000862
1908 Ga0495629_0091399
1909 Ga0495629_0406317
1910 Ga0495638_0019608
1911 Ga0495638_0148689
1912 Ga0495638_0200917
1913 Ga0495641_0348703
1914 Ga0495651_0267567
1915 Ga0495653_0373644
1916 Ga0495580_0010268
1917 Ga0495580_0037193
1918 Ga0495580_0059540
1919 Ga0495582_0006572
1920 Ga0495582_0025793
1921 Ga0495582_0107941
1922 Ga0495582_0187308
1923 Ga0495605_0194958
1924 Ga0495639_0000544
1925 Ga0495639_0703245
1926 Ga0495662_0042974
1927 Ga0495664_0063932
1928 Ga0495664_0077097
1929 Ga0495585_0032350
1930 Ga0495585_0037849
1931 Ga0495585_0341597
1932 Ga0495585_0355030
1933 Ga0495585_0388404
1934 Ga0495594_0026789
1935 Ga0495594_0154774
1936 Ga0495594_0198833
1937 Ga0495596_0066425
1938 Ga0495606_0253460
1939 Ga0495606_0551029
1940 Ga0495608_0143484
1941 Ga0495610_0144252
1942 Ga0495610_0249092
1943 Ga0495610_0337008
1944 Ga0495616_0269497
1945 Ga0495618_0430387
1946 Ga0495620_0088969
1947 Ga0495630_0026624
1948 Ga0495630_0029536
1949 Ga0495631_0067517
1950 Ga0495631_0191757
1951 Ga0495631_0215006
1952 Ga0495631_0284483
1953 Ga0495631_0307965
1954 Ga0495632_0136433
1955 Ga0495632_0227779
1956 Ga0495644_0073339
1957 Ga0495663_0081096
1958 Ga0495666_0051203
1959 Ga0495666_0502043
1960 Ga0495652_0111297
1961 Ga0495652_0465025
1962 Ga0495665_0007397
1963 Ga0495665_0155014
1964 Ga0495665_0208083
1965 Ga0495640_0002595
1966 Ga0495640_0853911
1967 Ga0495586_0111796
1968 Ga0495587_0035087
1969 Ga0495598_0383886
1970 Ga0495609_0135061
1971 Ga0495609_0318243
1972 Ga0495597_0086925
1973 Ga0495645_0228866
1974 Ga0495645_0466904
1975 Ga0495645_0617971
1976 Ga0495645_0750689
1977 Ga0495622_0012042
1978 Ga0495622_0064031
1979 Ga0495633_0267211
1980 Ga0495667_0154776
1981 Ga0495667_0785131
1982 Ga0495656_0026839
1983 Ga0495656_0052703
1984 Ga0495656_0179193
1985 Ga0495668_0077670
1986 Ga0495668_0085192
1987 Ga0495668_0249305
1988 Ga0495668_0255578
1989 Ga0495668_0282838
1990 Ga0495634_0290709
1991 Ga0495611_0072829
1992 Ga0495611_0121136
1993 Ga0495611_0316384
1994 Ga0495625_0183777
1995 Ga0495625_0433421
1996 Ga0495625_0484986
1997 Ga0495625_0590184
1998 Ga0495635_0000436
1999 Ga0495635_0070320
2000 Ga0495635_0402096
2001 Ga0495659_0060867
2002 Ga0495661_0085330
2003 Ga0495661_0326307
2004 Ga0495588_0013756
2005 Ga0495657_0827946
2006 Ga0495599_0138845
2007 Ga0495599_0400473
2008 Ga0495599_0891822
2009 Ga0495623_0599247
2010 Ga0495646_0078212
2011 Ga0495647_0474697
2012 Ga0495658_0375563
2013 Ga0495669_0000650
2014 Ga0495669_0125391
2015 Ga0495669_0252889
2016 Ga0495669_0608343
2017 Ga0495613_0013842
2018 Ga0495624_0023168
2019 Ga0495624_0044261
2020 Ga0495624_0312140
2021 Ga0495670_0044258
2022 Ga0495670_0187388
2023 Ga0495670_0245510
2024 Ga0495670_0341585
2025 Ga0495649_0070708
2026 Ga0495649_0220052
2027 Ga0495649_0505208
2028 Ga0495649_0565877
2029 Ga0495589_0051689
2030 Ga0495589_0116759
2031 Ga0495589_0258396
2032 Ga0495581_0282336
2033 Ga0495604_0323740
2034 Ga0495636_0041720
2035 Ga0495674_0008459
2036 Ga0495674_0213064
2037 Ga0495674_1290039
2038 Ga0495672_0043612
2039 Ga0495672_0079874
2040 Ga0495672_0516335
2041 Ga0495676_0192322
2042 Ga0495676_0210521
2043 Ga0495676_0306496
2044 Ga0495683_0402623
2045 Ga0495685_145900
2046 Ga0495685_292251
2047 Ga0495673_0116317
2048 Ga0495681_0098221
2049 Ga0495684_0028441
2050 Ga0495686_0026279
2051 Ga0495686_0693037
2052 Ga0495593_0021586
2053 Ga0495593_0133176
2054 Ga0495593_0522266
2055 Ga0495614_0032035
2056 Ga0495615_0137137
2057 Ga0496100_0131977
2058 Ga0496100_0506484
2059 Ga0496100_1029391
2060 Ga0496100_1096012
2061 Ga0496101_0002052
2062 Ga0496101_0177563
2063 Ga0496101_0590416
2064 Ga0496101_0601141
2065 Ga0496102_0001771
2066 Ga0496102_0028325
2067 Ga0496102_0228574
2068 Ga0496102_0789710
2069 Ga0496102_1180376
2070 Ga0496102_1421870
2071 Ga0496103_0005699
2072 Ga0496103_0103765
2073 Ga0496103_0345511
2074 Ga0496104_0074499
2075 Ga0496105_0042375
2076 Ga0496105_0085872
2077 Ga0496106_0002858
2078 Ga0496106_0009997
2079 Ga0496106_0041953
2080 Ga0496107_0002387
2081 Ga0496107_0009519
2082 Ga0496107_0051319
2083 Ga0496107_0713590
2084 Ga0496108_0016020
2085 Ga0496108_0524321
2086 Ga0496108_0735223
2087 Ga0496108_0781677
2088 Ga0496109_0007060
2089 Ga0496109_0197825
2090 Ga0496109_0971871
2091 Ga0496110_0004493
2092 Ga0496110_0015025
2093 Ga0496110_0119761
2094 Ga0496110_0153298
2095 Ga0496110_0188337
2096 Ga0496110_0291341
2097 Ga0496110_0608064
2098 Ga0496111_0117480
2099 Ga0496111_0459520
2100 Ga0496112_0000017
2101 Ga0496112_0013582
2102 Ga0496112_0105142
2103 Ga0496112_0157337
2104 Ga0496112_0172126
2105 Ga0496112_0423891
2106 Ga0496113_0031143
2107 Ga0496113_0048870
2108 Ga0496114_0011547
2109 Ga0496114_0062101
2110 Ga0496114_0254127
2111 Ga0496115_0000535
2112 Ga0496115_0492551
2113 Ga0496115_1352674
2114 Ga0496117_0129636
2115 Ga0496117_0608009
2116 Ga0496118_0003407
2117 Ga0496119_0269894
2118 Ga0496119_0291385
2119 Ga0496121_0045020
2120 Ga0496121_0054677
2121 Ga0496121_0129108
2122 Ga0496121_0224635
2123 Ga0496121_0291596
2124 Ga0496121_0322012
2125 Ga0496121_0327432
2126 Ga0496121_0578250
2127 Ga0496124_0026548
2128 Ga0496124_0178729
2129 Ga0496124_0273454
2130 Ga0496124_0404719
2131 Ga0496125_0051831
2132 Ga0496125_0265018
2133 Ga0496125_0303374
2134 Ga0496126_0002483
2135 Ga0496126_0092604
2136 Ga0496126_0149771
2137 Ga0496126_0176947
2138 Ga0496126_0212828
2139 Ga0496126_0407184
2140 Ga0496126_0494497
2141 Ga0496126_0572690
2142 Ga0496126_0645808
2143 Ga0496126_0758943
2144 Ga0495678_115396
2145 Ga0501031_0008184
2146 Ga0501032_0000704
2147 Ga0501033_0000311
2148 Ga0501034_0000039
2149 Ga0501036_0000127
2150 Ga0501037_0000025
2151 Ga0501038_0000342
2152 Ga0501039_0000840
2153 Ga0501042_0026448
2154 Ga0501043_0000120
2155 Ga0501046_0000359
2156 Ga0501046_0048465
2157 Ga0501047_0000379
2158 Ga0501047_0084770
2159 Ga0501047_1343705
2160 Ga0501048_0000352
2161 Ga0501067_0000025
2162 Ga0501068_0001230
2163 Ga0501069_0007011
2164 Ga0501069_0175721
2165 Ga0501070_0002185
2166 Ga0501070_0042781
2167 Ga0501071_0244492
2168 Ga0501072_0002767
2169 Ga0501072_0624932
2170 Ga0501073_0000091
2171 Ga0501073_0258618
2172 Ga0501074_0000489
2173 Ga0501074_0025368
2174 Ga0501076_0228198
2175 Ga0501076_0842771
2176 Ga0501079_0006818
2177 Ga0501080_0000321
2178 Ga0501080_0026275
2179 Ga0501083_0000284
2180 Ga0501035_0001251
2181 Ga0501035_0423288
2182 Ga0501044_0000274
2183 Ga0501044_0144750
2184 Ga0501045_0005330
2185 nmdc:mga03683_309151_c1
2186 nmdc:mga03n38_341479_c1
2187 nmdc:mga00v17_465059_c1
2188 nmdc:mga00v17_888245_c1
2189 nmdc:mga0yw44_535895_c1
2190 nmdc:mga0yw44_706686_c1
2191 nmdc:mga0yw44_90407_c1
2192 nmdc:mga0k408_240358_c1
2193 nmdc:mga0k408_97231_c1
2194 nmdc:mga06z11_103107_c1
2195 nmdc:mga06z11_207023_c1
2196 nmdc:mga0qj67_501630_c1
2197 nmdc:mga08y16_916868_c1
2198 nmdc:mga0n895_1812074_c1
2199 nmdc:mga0n895_382114_c1
2200 nmdc:mga0rr50_866533_c1
2201 nmdc:mga0a205_622660_c1
2202 nmdc:mga0sz30_308756_c1
2203 nmdc:mga0sz30_78446_c1
2204 Ga0495601_0078465
2205 Ga0495601_0146773
2206 Ga0495601_0252734
2207 Ga0495601_0324068
2208 Ga0495612_0056240
2209 Ga0495612_0175279
2210 Ga0495612_0240040
2211 Ga0495612_0332974
2212 Ga0495655_0068994
2213 Ga0495655_0092691
2214 Ga0495595_0026236
2215 Ga0495619_0209249
2216 Ga0495619_0246095
2217 Ga0500643_051619
2218 Ga0500646_0022529
2219 Ga0500646_0071361
2220 Ga0500583_0072009
2221 Ga0500583_0333398
2222 Ga0500651_0670507
2223 Ga0500566_0000158
2224 Ga0500566_0078847
2225 Ga0500566_0201394
2226 Ga0500640_000568
2227 Ga0500641_0008502
2228 Ga0500648_057745
2229 Ga0500650_0224827
2230 Ga0500554_007059
2231 Ga0500562_063291
2232 Ga0500569_215176
2233 Ga0500569_306904
2234 Ga0500572_000024
2235 Ga0500591_078328
2236 Ga0500594_0098002
2237 Ga0500595_001188
2238 Ga0500608_001300
2239 Ga0500614_001812
2240 Ga0500642_0270682
2241 Ga0500658_0175660
2242 Ga0500658_0382952
2243 Ga0500559_0003877
2244 Ga0500559_0178998
2245 Ga0500561_0145643
2246 Ga0500568_0060565
2247 Ga0500573_0032643
2248 Ga0500577_0139481
2249 Ga0500579_188848
2250 Ga0500588_0401468
2251 Ga0500589_025035
2252 Ga0500589_313473
2253 Ga0500590_122838
2254 Ga0500590_146250
2255 Ga0500603_000465
2256 Ga0500603_000801
2257 Ga0500603_048017
2258 Ga0500603_242973
2259 Ga0500622_0382782
2260 Ga0500627_0357681
2261 Ga0500630_000112
2262 Ga0500634_0081721
2263 Ga0500638_012135
2264 Ga0500638_197823
2265 Ga0500639_000040
2266 Ga0500636_0086872
2267 Ga0500636_0184124
2268 Ga0500637_0039960
2269 Ga0500637_0108912
2270 Ga0500609_015774
2271 Ga0500596_000794
2272 Ga0500596_005461
2273 Ga0501084_0007045
2274 Ga0587076_056219
2275 Ga0501082_0026885
2276 2509149319
2277 2513654070
2278 2513891271
2279 2513918410
2280 2517891356
2281 2671118864
2282 2728750068
2283 2793066724
2284 2793080652
2285 2876814617
2286 2879114698
2287 2885374989
2288 2889038035
2289 2903755317
2290 2904691224
2291 2904701310
2292 2906616542
2293 2908741710
2294 2908759135
2295 2922387369
2296 2922431438
2297 2935634034
2298 2941510663
2299 2941518047
2300 2941527082
2301 3005481231
2302 8006939478
2303 8006972136
2304 8006979228
2305 8006984409
2306 8019565358
2307 8019575456
2308 8056681087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02962

CHMI

5-carboxymethyl-2-hydroxymuconate isomerase

26

149

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.8107 3 125
4jj9-assembly1.cif.gz_B crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase 0.806 1 125
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.7933 3 125
4jcu-assembly1.cif.gz_A crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from deinococcus radiodurans r1 0.7876 2 125
4jj9-assembly1.cif.gz_B crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase 0.7616 1 125
ID Description Score Start End Superfamily
1otgC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8107 3 125 3.30.429.10
1otgC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7933 3 125 3.30.429.10
4jcuB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7918 2 123 3.30.429.10
4jj9C00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7803 2 125 3.30.429.10
4jcuB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7535 2 123 3.30.429.10
ID Description Score Start End GO Terms
AF-A0A3S1ELA3-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.915 1 64 GO:0008704
GO:0009056
AF-A0A3D0KT17-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9115 1 64 GO:0008704
GO:0009056
AF-A0A529P083-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.8975 1 108 GO:0008704
GO:0009056
AF-A0A529P563-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.8901 1 72 GO:0008704
GO:0009056
AF-A0A3D1DZK3-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.8858 1 108 GO:0008704
GO:0009056

Map