F490899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1154 | 494 | 2308 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10028779|Ga0105241_100287794 |
| Length | 156 |
| Sequence | MMAPTFGRLPFRLTPRTAIGSETAMPHFTIEYSANMDKRVDMAKVVDVVRKAAVETGIFPLGGIRVRAIKCEHYAIADGNPDLGFLSMVLRLGEGRDLAARKKAGEHIFKALSSHLDPVFAQSKFALSFDMQINDKETSWKRNNIHEALKAEAAHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 91 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 92 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 264 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 265 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 266 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 361 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 362 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 363 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 364 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 365 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 371 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 372 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 373 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 420 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 421 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 422 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 423 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 427 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 428 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 429 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 430 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 431 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 433 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 434 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 435 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 436 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 437 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 438 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 440 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 441 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 442 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 443 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 444 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 445 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 446 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 447 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 448 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 450 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 452 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 453 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 454 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 455 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 457 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 458 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 459 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 463 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 464 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 465 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 466 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 467 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 468 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 469 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 470 | 2791355199 | |||
| 471 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 472 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 473 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 474 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 475 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 476 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 477 | 2904699407 | |||
| 478 | 2906610324 | |||
| 479 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 480 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 481 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 482 | 2922425934 | |||
| 483 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 484 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 485 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 486 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 487 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 488 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 489 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 490 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 491 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 492 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 493 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 494 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.04 |
| Metatranscriptomes | 0.43 |
| Isolates | 2.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.23 |
| Nodule | 2.51 |
| Rhizoplane | 5.2 |
| Rhizosphere | 77.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105241_10028779 | 3300009174 | Bacteria | 4140 |
| 2 | JGI25406J46586_10009343 | 3300003203 | Bacteria | 4392 |
| 3 | JGI25165J46597_1011939 | 3300003214 | Bacteria | 1227 |
| 4 | JGI25153J46596_10051467 | 3300003215 | Bacteria | 1179 |
| 5 | JGI25404J52841_10003019 | 3300003659 | Bacteria | 3277 |
| 6 | JGI25404J52841_10010753 | 3300003659 | Bacteria | 1969 |
| 7 | JGI25404J52841_10016744 | 3300003659 | Bacteria | 1590 |
| 8 | JGI25404J52841_10041444 | 3300003659 | Bacteria | 974 |
| 9 | Ga0070658_10150878 | 3300005327 | Bacteria | 1946 |
| 10 | Ga0070658_10362781 | 3300005327 | Bacteria | 1241 |
| 11 | Ga0070676_10668089 | 3300005328 | Bacteria | 756 |
| 12 | Ga0070683_100095571 | 3300005329 | Bacteria | 2794 |
| 13 | Ga0070683_100306288 | 3300005329 | Bacteria | 1511 |
| 14 | Ga0070683_101207674 | 3300005329 | Bacteria | 727 |
| 15 | Ga0070683_101249715 | 3300005329 | Bacteria | 714 |
| 16 | Ga0068869_100283829 | 3300005334 | Bacteria | 1332 |
| 17 | Ga0068869_100411856 | 3300005334 | Bacteria | 1114 |
| 18 | Ga0068869_101378147 | 3300005334 | Bacteria | 624 |
| 19 | Ga0070680_100052018 | 3300005336 | Bacteria | 3343 |
| 20 | Ga0070680_100194884 | 3300005336 | Bacteria | 1708 |
| 21 | Ga0070680_100676728 | 3300005336 | Bacteria | 887 |
| 22 | Ga0070682_100039753 | 3300005337 | Bacteria | 2891 |
| 23 | Ga0070682_100175885 | 3300005337 | Bacteria | 1491 |
| 24 | Ga0070682_100246809 | 3300005337 | Bacteria | 1285 |
| 25 | Ga0070682_100503776 | 3300005337 | Bacteria | 939 |
| 26 | Ga0068868_100034182 | 3300005338 | Bacteria | 3924 |
| 27 | Ga0068868_100389483 | 3300005338 | Bacteria | 1200 |
| 28 | Ga0068868_100548398 | 3300005338 | Bacteria | 1019 |
| 29 | Ga0068868_100560813 | 3300005338 | Bacteria | 1008 |
| 30 | Ga0070660_100051646 | 3300005339 | Bacteria | 3167 |
| 31 | Ga0070687_100299556 | 3300005343 | Bacteria | 1020 |
| 32 | Ga0070661_100328466 | 3300005344 | Bacteria | 1196 |
| 33 | Ga0070661_100395995 | 3300005344 | Bacteria | 1091 |
| 34 | Ga0070661_100556992 | 3300005344 | Bacteria | 923 |
| 35 | Ga0070692_10391666 | 3300005345 | Bacteria | 875 |
| 36 | Ga0070668_100044248 | 3300005347 | Bacteria | 3415 |
| 37 | Ga0070668_100074675 | 3300005347 | Bacteria | 2645 |
| 38 | Ga0070668_100207755 | 3300005347 | Bacteria | 1609 |
| 39 | Ga0070668_100301249 | 3300005347 | Bacteria | 1344 |
| 40 | Ga0070668_100481665 | 3300005347 | Bacteria | 1071 |
| 41 | Ga0070668_100724073 | 3300005347 | Bacteria | 879 |
| 42 | Ga0070669_100068986 | 3300005353 | Bacteria | 2611 |
| 43 | Ga0070671_100342350 | 3300005355 | Bacteria | 1276 |
| 44 | Ga0070671_100383792 | 3300005355 | Bacteria | 1201 |
| 45 | Ga0070671_100708452 | 3300005355 | Bacteria | 873 |
| 46 | Ga0070674_100034692 | 3300005356 | Bacteria | 3372 |
| 47 | Ga0070688_100855168 | 3300005365 | Bacteria | 715 |
| 48 | Ga0070659_100053918 | 3300005366 | Bacteria | 3166 |
| 49 | Ga0070667_100236881 | 3300005367 | Bacteria | 1629 |
| 50 | Ga0070667_100569881 | 3300005367 | Bacteria | 1042 |
| 51 | Ga0070667_100623283 | 3300005367 | Bacteria | 995 |
| 52 | Ga0070667_100797903 | 3300005367 | Bacteria | 876 |
| 53 | Ga0070709_10004227 | 3300005434 | Bacteria | 7743 |
| 54 | Ga0070709_10048345 | 3300005434 | Bacteria | 2654 |
| 55 | Ga0070709_10311929 | 3300005434 | Bacteria | 1152 |
| 56 | Ga0070714_100082971 | 3300005435 | Bacteria | 2793 |
| 57 | Ga0070714_100280905 | 3300005435 | Bacteria | 1547 |
| 58 | Ga0070714_100541466 | 3300005435 | Bacteria | 1114 |
| 59 | Ga0070714_100551108 | 3300005435 | Bacteria | 1104 |
| 60 | Ga0070713_100042275 | 3300005436 | Bacteria | 3719 |
| 61 | Ga0070713_100088760 | 3300005436 | Bacteria | 2654 |
| 62 | Ga0070713_100353933 | 3300005436 | Bacteria | 1363 |
| 63 | Ga0070713_100363813 | 3300005436 | Bacteria | 1344 |
| 64 | Ga0070710_10042080 | 3300005437 | Bacteria | 2524 |
| 65 | Ga0070710_10179435 | 3300005437 | Bacteria | 1325 |
| 66 | Ga0070711_100001730 | 3300005439 | Bacteria | 12117 |
| 67 | Ga0070711_100011938 | 3300005439 | Bacteria | 5407 |
| 68 | Ga0070711_100061879 | 3300005439 | Bacteria | 2607 |
| 69 | Ga0070711_100131145 | 3300005439 | Bacteria | 1867 |
| 70 | Ga0070711_100692074 | 3300005439 | Bacteria | 858 |
| 71 | Ga0070705_100619464 | 3300005440 | Bacteria | 840 |
| 72 | Ga0070700_100046080 | 3300005441 | Bacteria | 2692 |
| 73 | Ga0070700_100755597 | 3300005441 | Bacteria | 778 |
| 74 | Ga0070694_100787580 | 3300005444 | Bacteria | 779 |
| 75 | Ga0070663_100010941 | 3300005455 | Bacteria | 5672 |
| 76 | Ga0070663_100050917 | 3300005455 | Bacteria | 2947 |
| 77 | Ga0070663_100068772 | 3300005455 | Bacteria | 2571 |
| 78 | Ga0070663_100185086 | 3300005455 | Bacteria | 1618 |
| 79 | Ga0070663_100891518 | 3300005455 | Bacteria | 768 |
| 80 | Ga0070678_100010095 | 3300005456 | Bacteria | 5749 |
| 81 | Ga0070678_100529455 | 3300005456 | Bacteria | 1044 |
| 82 | Ga0070678_100647096 | 3300005456 | Bacteria | 948 |
| 83 | Ga0070678_100700015 | 3300005456 | Bacteria | 913 |
| 84 | Ga0070662_100031971 | 3300005457 | Bacteria | 3697 |
| 85 | Ga0070662_100088266 | 3300005457 | Bacteria | 2324 |
| 86 | Ga0070662_100457978 | 3300005457 | Bacteria | 1060 |
| 87 | Ga0070662_100709265 | 3300005457 | Bacteria | 851 |
| 88 | Ga0070681_10003273 | 3300005458 | Bacteria | 15113 |
| 89 | Ga0070681_10025087 | 3300005458 | Bacteria | 6000 |
| 90 | Ga0070681_10056849 | 3300005458 | Bacteria | 3893 |
| 91 | Ga0070681_10065024 | 3300005458 | Bacteria | 3617 |
| 92 | Ga0070681_10341341 | 3300005458 | Bacteria | 1408 |
| 93 | Ga0068867_100250304 | 3300005459 | Bacteria | 1441 |
| 94 | Ga0068867_100424557 | 3300005459 | Bacteria | 1127 |
| 95 | Ga0070685_10729585 | 3300005466 | Bacteria | 725 |
| 96 | Ga0070685_10756908 | 3300005466 | Bacteria | 713 |
| 97 | Ga0070685_10911377 | 3300005466 | Bacteria | 655 |
| 98 | Ga0070698_100536537 | 3300005471 | Bacteria | 1109 |
| 99 | Ga0070698_101485996 | 3300005471 | Bacteria | 629 |
| 100 | Ga0070699_101178226 | 3300005518 | Bacteria | 703 |
| 101 | Ga0070679_100009864 | 3300005530 | Bacteria | 9035 |
| 102 | Ga0070679_100017482 | 3300005530 | Bacteria | 6941 |
| 103 | Ga0070679_100017715 | 3300005530 | Bacteria | 6896 |
| 104 | Ga0070679_100036722 | 3300005530 | Bacteria | 4863 |
| 105 | Ga0070679_100303056 | 3300005530 | Bacteria | 1548 |
| 106 | Ga0070679_100865639 | 3300005530 | Bacteria | 847 |
| 107 | Ga0070684_100013567 | 3300005535 | Bacteria | 6575 |
| 108 | Ga0070684_100231212 | 3300005535 | Bacteria | 1688 |
| 109 | Ga0070684_100338695 | 3300005535 | Bacteria | 1383 |
| 110 | Ga0070684_100481400 | 3300005535 | Bacteria | 1149 |
| 111 | Ga0070697_100328239 | 3300005536 | Bacteria | 1319 |
| 112 | Ga0070697_100350906 | 3300005536 | Bacteria | 1274 |
| 113 | Ga0068853_100040363 | 3300005539 | Bacteria | 3982 |
| 114 | Ga0068853_100130357 | 3300005539 | Bacteria | 2250 |
| 115 | Ga0068853_100286863 | 3300005539 | Bacteria | 1519 |
| 116 | Ga0068853_100372296 | 3300005539 | Bacteria | 1333 |
| 117 | Ga0068853_100411221 | 3300005539 | Bacteria | 1267 |
| 118 | Ga0070672_100191116 | 3300005543 | Bacteria | 1709 |
| 119 | Ga0070672_100191311 | 3300005543 | Bacteria | 1709 |
| 120 | Ga0070672_100431858 | 3300005543 | Bacteria | 1132 |
| 121 | Ga0070672_100895577 | 3300005543 | Bacteria | 784 |
| 122 | Ga0070686_100740264 | 3300005544 | Bacteria | 788 |
| 123 | Ga0070695_100764136 | 3300005545 | Bacteria | 772 |
| 124 | Ga0070696_100760250 | 3300005546 | Bacteria | 795 |
| 125 | Ga0070693_101383201 | 3300005547 | Bacteria | 547 |
| 126 | Ga0070665_100189047 | 3300005548 | Bacteria | 2060 |
| 127 | Ga0070665_100336297 | 3300005548 | Bacteria | 1514 |
| 128 | Ga0070665_100357790 | 3300005548 | Bacteria | 1466 |
| 129 | Ga0070665_101089130 | 3300005548 | Bacteria | 810 |
| 130 | Ga0070665_101216753 | 3300005548 | Bacteria | 764 |
| 131 | Ga0070665_101665143 | 3300005548 | Bacteria | 645 |
| 132 | Ga0070704_100517830 | 3300005549 | Bacteria | 1038 |
| 133 | Ga0068855_100010865 | 3300005563 | Bacteria | 10993 |
| 134 | Ga0068855_100067952 | 3300005563 | Bacteria | 4150 |
| 135 | Ga0068855_100116881 | 3300005563 | Bacteria | 3056 |
| 136 | Ga0068855_100142865 | 3300005563 | Bacteria | 2727 |
| 137 | Ga0070664_100089985 | 3300005564 | Bacteria | 2656 |
| 138 | Ga0070664_100363338 | 3300005564 | Bacteria | 1319 |
| 139 | Ga0068857_100016047 | 3300005577 | Bacteria | 6562 |
| 140 | Ga0068857_100106311 | 3300005577 | Bacteria | 2520 |
| 141 | Ga0068857_101483817 | 3300005577 | Bacteria | 660 |
| 142 | Ga0068857_101752540 | 3300005577 | Bacteria | 607 |
| 143 | Ga0068857_101803285 | 3300005577 | Bacteria | 599 |
| 144 | Ga0068854_100316488 | 3300005578 | Bacteria | 1267 |
| 145 | Ga0068854_100587678 | 3300005578 | Bacteria | 949 |
| 146 | Ga0068856_100731211 | 3300005614 | Bacteria | 1010 |
| 147 | Ga0070702_100130267 | 3300005615 | Bacteria | 1588 |
| 148 | Ga0068852_100036815 | 3300005616 | Bacteria | 4099 |
| 149 | Ga0068852_100249880 | 3300005616 | Bacteria | 1699 |
| 150 | Ga0068852_100254398 | 3300005616 | Bacteria | 1684 |
| 151 | Ga0068852_100477308 | 3300005616 | Bacteria | 1239 |
| 152 | Ga0068852_101247821 | 3300005616 | Bacteria | 765 |
| 153 | Ga0068852_101867233 | 3300005616 | Bacteria | 623 |
| 154 | Ga0068859_100463120 | 3300005617 | Bacteria | 1363 |
| 155 | Ga0068864_100494527 | 3300005618 | Bacteria | 1176 |
| 156 | Ga0068866_10021865 | 3300005718 | Bacteria | 2952 |
| 157 | Ga0068866_10509547 | 3300005718 | Bacteria | 798 |
| 158 | Ga0068861_100410264 | 3300005719 | Bacteria | 1204 |
| 159 | Ga0068861_100816180 | 3300005719 | Bacteria | 877 |
| 160 | Ga0068861_101639683 | 3300005719 | Bacteria | 635 |
| 161 | Ga0068851_10004825 | 3300005834 | Bacteria | 6103 |
| 162 | Ga0068870_10078252 | 3300005840 | Bacteria | 1821 |
| 163 | Ga0068863_100655952 | 3300005841 | Bacteria | 1041 |
| 164 | Ga0068863_100744625 | 3300005841 | Bacteria | 976 |
| 165 | Ga0068863_100911131 | 3300005841 | Bacteria | 880 |
| 166 | Ga0068863_101044798 | 3300005841 | Bacteria | 820 |
| 167 | Ga0068863_101352280 | 3300005841 | Bacteria | 720 |
| 168 | Ga0068858_100046102 | 3300005842 | Bacteria | 4041 |
| 169 | Ga0068858_100074580 | 3300005842 | Bacteria | 3150 |
| 170 | Ga0068858_100917487 | 3300005842 | Bacteria | 857 |
| 171 | Ga0068860_100331144 | 3300005843 | Bacteria | 1496 |
| 172 | Ga0068860_100352450 | 3300005843 | Bacteria | 1449 |
| 173 | Ga0068860_100462292 | 3300005843 | Bacteria | 1263 |
| 174 | Ga0068860_100483318 | 3300005843 | Bacteria | 1235 |
| 175 | Ga0068860_100499225 | 3300005843 | Bacteria | 1215 |
| 176 | Ga0068862_100129799 | 3300005844 | Bacteria | 2228 |
| 177 | Ga0068862_100302221 | 3300005844 | Bacteria | 1472 |
| 178 | Ga0068862_100414040 | 3300005844 | Bacteria | 1263 |
| 179 | Ga0068862_100515000 | 3300005844 | Bacteria | 1137 |
| 180 | Ga0068862_100669787 | 3300005844 | Bacteria | 1002 |
| 181 | Ga0068862_101682387 | 3300005844 | Bacteria | 643 |
| 182 | Ga0081455_10009971 | 3300005937 | Bacteria | 9713 |
| 183 | Ga0081455_10037550 | 3300005937 | Bacteria | 4300 |
| 184 | Ga0081455_10087531 | 3300005937 | Bacteria | 2534 |
| 185 | Ga0081455_10127583 | 3300005937 | Bacteria | 1994 |
| 186 | Ga0081455_10150862 | 3300005937 | Bacteria | 1792 |
| 187 | Ga0081540_1006422 | 3300005983 | Bacteria | 8558 |
| 188 | Ga0081540_1009663 | 3300005983 | Bacteria | 6629 |
| 189 | Ga0081540_1011844 | 3300005983 | Bacteria | 5796 |
| 190 | Ga0081540_1012349 | 3300005983 | Bacteria | 5635 |
| 191 | Ga0081540_1013491 | 3300005983 | Bacteria | 5308 |
| 192 | Ga0081540_1014382 | 3300005983 | Bacteria | 5071 |
| 193 | Ga0081540_1018818 | 3300005983 | Bacteria | 4222 |
| 194 | Ga0081539_10000768 | 3300005985 | Bacteria | 63055 |
| 195 | Ga0081539_10001470 | 3300005985 | Bacteria | 39952 |
| 196 | Ga0081539_10004445 | 3300005985 | Bacteria | 15477 |
| 197 | Ga0081539_10058092 | 3300005985 | Bacteria | 2137 |
| 198 | Ga0070717_10001267 | 3300006028 | Bacteria | 17258 |
| 199 | Ga0070717_10017332 | 3300006028 | Bacteria | 5603 |
| 200 | Ga0070717_10416085 | 3300006028 | Bacteria | 1209 |
| 201 | Ga0070717_10501552 | 3300006028 | Bacteria | 1097 |
| 202 | Ga0075365_10083284 | 3300006038 | Bacteria | 2169 |
| 203 | Ga0075365_10101356 | 3300006038 | Bacteria | 1971 |
| 204 | Ga0075365_10541421 | 3300006038 | Bacteria | 823 |
| 205 | Ga0075365_10770016 | 3300006038 | Bacteria | 679 |
| 206 | Ga0075363_100113059 | 3300006048 | Bacteria | 1510 |
| 207 | Ga0075363_100352030 | 3300006048 | Bacteria | 860 |
| 208 | Ga0075363_100407285 | 3300006048 | Bacteria | 800 |
| 209 | Ga0075364_10088472 | 3300006051 | Bacteria | 2053 |
| 210 | Ga0075432_10149429 | 3300006058 | Bacteria | 897 |
| 211 | Ga0070716_100107458 | 3300006173 | Bacteria | 1723 |
| 212 | Ga0070716_100189057 | 3300006173 | Bacteria | 1359 |
| 213 | Ga0070716_100666400 | 3300006173 | Bacteria | 791 |
| 214 | Ga0070716_101690869 | 3300006173 | Bacteria | 522 |
| 215 | Ga0070712_100111079 | 3300006175 | Bacteria | 2046 |
| 216 | Ga0070712_100118582 | 3300006175 | Bacteria | 1988 |
| 217 | Ga0070712_100905172 | 3300006175 | Bacteria | 761 |
| 218 | Ga0075362_10396330 | 3300006177 | Bacteria | 696 |
| 219 | Ga0075367_10142444 | 3300006178 | Bacteria | 1485 |
| 220 | Ga0075369_10127055 | 3300006186 | Bacteria | 1157 |
| 221 | Ga0075369_10247272 | 3300006186 | Bacteria | 828 |
| 222 | Ga0075369_10336005 | 3300006186 | Bacteria | 708 |
| 223 | Ga0075366_10239677 | 3300006195 | Bacteria | 1106 |
| 224 | Ga0075366_10593436 | 3300006195 | Bacteria | 686 |
| 225 | Ga0075366_10603489 | 3300006195 | Bacteria | 680 |
| 226 | Ga0075366_10853991 | 3300006195 | Bacteria | 567 |
| 227 | Ga0097621_100209156 | 3300006237 | Bacteria | 1697 |
| 228 | Ga0097621_101107206 | 3300006237 | Bacteria | 744 |
| 229 | Ga0097621_101274183 | 3300006237 | Bacteria | 694 |
| 230 | Ga0097621_101490690 | 3300006237 | Bacteria | 642 |
| 231 | Ga0075370_10219152 | 3300006353 | Bacteria | 1124 |
| 232 | Ga0075370_10380400 | 3300006353 | Bacteria | 846 |
| 233 | Ga0068871_100254458 | 3300006358 | Bacteria | 1531 |
| 234 | Ga0068871_100483860 | 3300006358 | Bacteria | 1114 |
| 235 | Ga0068871_100802604 | 3300006358 | Bacteria | 868 |
| 236 | Ga0068871_101385620 | 3300006358 | Bacteria | 663 |
| 237 | Ga0075428_100700818 | 3300006844 | Bacteria | 1079 |
| 238 | Ga0075433_10677350 | 3300006852 | Bacteria | 904 |
| 239 | Ga0075429_100967043 | 3300006880 | Bacteria | 745 |
| 240 | Ga0068865_100444871 | 3300006881 | Bacteria | 1070 |
| 241 | Ga0068865_100647710 | 3300006881 | Bacteria | 898 |
| 242 | Ga0068865_100847786 | 3300006881 | Bacteria | 791 |
| 243 | Ga0068865_101028166 | 3300006881 | Bacteria | 723 |
| 244 | Ga0097620_100463136 | 3300006931 | Bacteria | 1363 |
| 245 | Ga0099825_1034140 | 3300006941 | Bacteria | 1916 |
| 246 | Ga0099824_1007408 | 3300006942 | Bacteria | 14551 |
| 247 | Ga0099822_1006547 | 3300006943 | Bacteria | 15161 |
| 248 | Ga0099794_10013294 | 3300007265 | Bacteria | 3579 |
| 249 | Ga0099794_10298454 | 3300007265 | Bacteria | 834 |
| 250 | Ga0099794_10419992 | 3300007265 | Bacteria | 700 |
| 251 | Ga0099795_10003875 | 3300007788 | Bacteria | 3771 |
| 252 | Ga0099795_10184751 | 3300007788 | Bacteria | 872 |
| 253 | Ga0105251_10576561 | 3300009011 | Bacteria | 532 |
| 254 | Ga0105250_10539583 | 3300009092 | Bacteria | 534 |
| 255 | Ga0105240_10034221 | 3300009093 | Bacteria | 6557 |
| 256 | Ga0105240_10058690 | 3300009093 | Bacteria | 4804 |
| 257 | Ga0105240_10105395 | 3300009093 | Bacteria | 3423 |
| 258 | Ga0105240_10108708 | 3300009093 | Bacteria | 3359 |
| 259 | Ga0105240_10522672 | 3300009093 | Bacteria | 1317 |
| 260 | Ga0105240_11095681 | 3300009093 | Bacteria | 848 |
| 261 | Ga0105240_11604799 | 3300009093 | Bacteria | 680 |
| 262 | Ga0105240_12534470 | 3300009093 | Bacteria | 530 |
| 263 | Ga0111539_10144248 | 3300009094 | Bacteria | 2787 |
| 264 | Ga0111539_11656237 | 3300009094 | Bacteria | 742 |
| 265 | Ga0105245_10105057 | 3300009098 | Bacteria | 2619 |
| 266 | Ga0105245_10289341 | 3300009098 | Bacteria | 1604 |
| 267 | Ga0105245_10829319 | 3300009098 | Bacteria | 964 |
| 268 | Ga0105245_11842058 | 3300009098 | Bacteria | 658 |
| 269 | Ga0105247_10110567 | 3300009101 | Bacteria | 1768 |
| 270 | Ga0105247_10136367 | 3300009101 | Bacteria | 1604 |
| 271 | Ga0105247_10155708 | 3300009101 | Bacteria | 1509 |
| 272 | Ga0105247_10400587 | 3300009101 | Bacteria | 978 |
| 273 | Ga0114129_10191104 | 3300009147 | Bacteria | 2780 |
| 274 | Ga0105243_10078753 | 3300009148 | Bacteria | 2684 |
| 275 | Ga0105243_10929161 | 3300009148 | Bacteria | 867 |
| 276 | Ga0105243_11232577 | 3300009148 | Bacteria | 763 |
| 277 | Ga0105243_12506854 | 3300009148 | Bacteria | 555 |
| 278 | Ga0105242_10115715 | 3300009176 | Bacteria | 2293 |
| 279 | Ga0105242_10131362 | 3300009176 | Bacteria | 2162 |
| 280 | Ga0105242_11576074 | 3300009176 | Bacteria | 690 |
| 281 | Ga0105242_11936273 | 3300009176 | Bacteria | 630 |
| 282 | Ga0105248_10139917 | 3300009177 | Bacteria | 2730 |
| 283 | Ga0105248_10204152 | 3300009177 | Bacteria | 2227 |
| 284 | Ga0105248_10336933 | 3300009177 | Bacteria | 1698 |
| 285 | Ga0105248_10881040 | 3300009177 | Bacteria | 1011 |
| 286 | Ga0105237_10087664 | 3300009545 | Bacteria | 3102 |
| 287 | Ga0105237_10508977 | 3300009545 | Bacteria | 1211 |
| 288 | Ga0105237_10562761 | 3300009545 | Bacteria | 1147 |
| 289 | Ga0105237_10641091 | 3300009545 | Bacteria | 1069 |
| 290 | Ga0105237_10726224 | 3300009545 | Bacteria | 1000 |
| 291 | Ga0105237_10766119 | 3300009545 | Bacteria | 972 |
| 292 | Ga0105237_11358764 | 3300009545 | Bacteria | 717 |
| 293 | Ga0105237_11568743 | 3300009545 | Bacteria | 665 |
| 294 | Ga0105238_10017402 | 3300009551 | Bacteria | 7303 |
| 295 | Ga0105238_10140974 | 3300009551 | Bacteria | 2387 |
| 296 | Ga0105238_10358018 | 3300009551 | Bacteria | 1448 |
| 297 | Ga0105238_10360284 | 3300009551 | Bacteria | 1444 |
| 298 | Ga0105238_10598531 | 3300009551 | Bacteria | 1110 |
| 299 | Ga0105238_11028171 | 3300009551 | Bacteria | 845 |
| 300 | Ga0105249_10080447 | 3300009553 | Bacteria | 3027 |
| 301 | Ga0105249_10645237 | 3300009553 | Bacteria | 1116 |
| 302 | Ga0099796_10459180 | 3300010159 | Bacteria | 567 |
| 303 | Ga0105239_10020324 | 3300010375 | Bacteria | 7325 |
| 304 | Ga0105239_10029566 | 3300010375 | Bacteria | 6024 |
| 305 | Ga0105239_10118154 | 3300010375 | Bacteria | 2943 |
| 306 | Ga0105239_10151085 | 3300010375 | Bacteria | 2592 |
| 307 | Ga0105239_10404892 | 3300010375 | Bacteria | 1544 |
| 308 | Ga0105239_10804993 | 3300010375 | Bacteria | 1077 |
| 309 | Ga0105246_10106488 | 3300011119 | Bacteria | 2051 |
| 310 | Ga0105246_10229454 | 3300011119 | Bacteria | 1461 |
| 311 | Ga0105246_10256365 | 3300011119 | Bacteria | 1391 |
| 312 | Ga0105246_10675292 | 3300011119 | Bacteria | 902 |
| 313 | Ga0105246_11328480 | 3300011119 | Bacteria | 667 |
| 314 | Ga0157338_1036802 | 3300012515 | Bacteria | 649 |
| 315 | Ga0157371_10727887 | 3300013102 | Bacteria | 744 |
| 316 | Ga0157371_11388202 | 3300013102 | Bacteria | 545 |
| 317 | Ga0157370_10014947 | 3300013104 | Bacteria | 7918 |
| 318 | Ga0157370_10025078 | 3300013104 | Bacteria | 5903 |
| 319 | Ga0157370_10071347 | 3300013104 | Bacteria | 3277 |
| 320 | Ga0157370_10296740 | 3300013104 | Bacteria | 1492 |
| 321 | Ga0157370_10862740 | 3300013104 | Bacteria | 822 |
| 322 | Ga0157370_10950068 | 3300013104 | Bacteria | 779 |
| 323 | Ga0157369_10021190 | 3300013105 | Bacteria | 7267 |
| 324 | Ga0157369_10047353 | 3300013105 | Bacteria | 4669 |
| 325 | Ga0157369_10130028 | 3300013105 | Bacteria | 2669 |
| 326 | Ga0157369_10501429 | 3300013105 | Bacteria | 1256 |
| 327 | Ga0157369_10602033 | 3300013105 | Bacteria | 1134 |
| 328 | Ga0157374_10033305 | 3300013296 | Bacteria | 4701 |
| 329 | Ga0157374_10530713 | 3300013296 | Bacteria | 1183 |
| 330 | Ga0157378_10070080 | 3300013297 | Bacteria | 3147 |
| 331 | Ga0157378_10356319 | 3300013297 | Bacteria | 1431 |
| 332 | Ga0157378_10368636 | 3300013297 | Bacteria | 1407 |
| 333 | Ga0157378_11541203 | 3300013297 | Bacteria | 710 |
| 334 | Ga0157378_13043504 | 3300013297 | Bacteria | 520 |
| 335 | Ga0163162_10578216 | 3300013306 | Bacteria | 1250 |
| 336 | Ga0163162_11108831 | 3300013306 | Bacteria | 897 |
| 337 | Ga0163162_11309716 | 3300013306 | Bacteria | 823 |
| 338 | Ga0163162_13152751 | 3300013306 | Bacteria | 529 |
| 339 | Ga0157372_10196832 | 3300013307 | Bacteria | 2334 |
| 340 | Ga0157372_10708827 | 3300013307 | Bacteria | 1171 |
| 341 | Ga0157372_12031415 | 3300013307 | Bacteria | 661 |
| 342 | Ga0157372_12344199 | 3300013307 | Bacteria | 613 |
| 343 | Ga0157375_10009689 | 3300013308 | Bacteria | 8470 |
| 344 | Ga0157375_11105739 | 3300013308 | Bacteria | 928 |
| 345 | Ga0157375_11934839 | 3300013308 | Bacteria | 700 |
| 346 | Ga0157375_12308347 | 3300013308 | Bacteria | 641 |
| 347 | Ga0163163_10159204 | 3300014325 | Bacteria | 2303 |
| 348 | Ga0163163_10453589 | 3300014325 | Bacteria | 1342 |
| 349 | Ga0163163_10571962 | 3300014325 | Bacteria | 1193 |
| 350 | Ga0163163_11094788 | 3300014325 | Bacteria | 860 |
| 351 | Ga0163163_12257726 | 3300014325 | Bacteria | 603 |
| 352 | Ga0157380_10184873 | 3300014326 | Bacteria | 1834 |
| 353 | Ga0157380_10184912 | 3300014326 | Bacteria | 1834 |
| 354 | Ga0157380_10811873 | 3300014326 | Bacteria | 953 |
| 355 | Ga0157380_12152610 | 3300014326 | Bacteria | 621 |
| 356 | Ga0157377_10094953 | 3300014745 | Bacteria | 1767 |
| 357 | Ga0157377_10173047 | 3300014745 | Bacteria | 1352 |
| 358 | Ga0157377_11356277 | 3300014745 | Bacteria | 559 |
| 359 | Ga0157379_10085565 | 3300014968 | Bacteria | 2826 |
| 360 | Ga0157379_10341117 | 3300014968 | Bacteria | 1370 |
| 361 | Ga0157379_10659533 | 3300014968 | Bacteria | 980 |
| 362 | Ga0157376_10092020 | 3300014969 | Bacteria | 2628 |
| 363 | Ga0157376_10557471 | 3300014969 | Bacteria | 1135 |
| 364 | Ga0163161_10128231 | 3300017792 | Bacteria | 1912 |
| 365 | Ga0163161_10232435 | 3300017792 | Bacteria | 1431 |
| 366 | Ga0163161_10303939 | 3300017792 | Bacteria | 1257 |
| 367 | Ga0206356_10766524 | 3300020070 | Bacteria | 821 |
| 368 | Ga0206356_11320371 | 3300020070 | Bacteria | 1449 |
| 369 | Ga0206353_10272000 | 3300020082 | Bacteria | 539 |
| 370 | Ga0213874_10013946 | 3300021377 | Bacteria | 2092 |
| 371 | Ga0213876_10020027 | 3300021384 | Bacteria | 3534 |
| 372 | Ga0213876_10072356 | 3300021384 | Bacteria | 1821 |
| 373 | Ga0209233_1002384 | 3300025261 | Bacteria | 6957 |
| 374 | Ga0209758_1030944 | 3300025297 | Bacteria | 2205 |
| 375 | Ga0209758_1031236 | 3300025297 | Bacteria | 2189 |
| 376 | Ga0209758_1050827 | 3300025297 | Bacteria | 1449 |
| 377 | Ga0209758_1091452 | 3300025297 | Bacteria | 890 |
| 378 | Ga0207697_10085069 | 3300025315 | Bacteria | 1335 |
| 379 | Ga0207656_10034898 | 3300025321 | Bacteria | 2102 |
| 380 | Ga0207682_10212877 | 3300025893 | Bacteria | 892 |
| 381 | Ga0207642_10037371 | 3300025899 | Bacteria | 2092 |
| 382 | Ga0207642_10398319 | 3300025899 | Bacteria | 823 |
| 383 | Ga0207642_10478566 | 3300025899 | Bacteria | 759 |
| 384 | Ga0207642_10583281 | 3300025899 | Bacteria | 694 |
| 385 | Ga0207710_10176392 | 3300025900 | Bacteria | 1047 |
| 386 | Ga0207710_10384506 | 3300025900 | Bacteria | 719 |
| 387 | Ga0207710_10598127 | 3300025900 | Bacteria | 576 |
| 388 | Ga0207688_10215003 | 3300025901 | Bacteria | 1156 |
| 389 | Ga0207688_10282908 | 3300025901 | Bacteria | 1011 |
| 390 | Ga0207688_10421078 | 3300025901 | Bacteria | 830 |
| 391 | Ga0207688_10436633 | 3300025901 | Bacteria | 815 |
| 392 | Ga0207688_10518079 | 3300025901 | Bacteria | 748 |
| 393 | Ga0207680_10591542 | 3300025903 | Bacteria | 793 |
| 394 | Ga0207685_10027483 | 3300025905 | Bacteria | 1991 |
| 395 | Ga0207699_10025234 | 3300025906 | Bacteria | 3260 |
| 396 | Ga0207699_10156951 | 3300025906 | Bacteria | 1511 |
| 397 | Ga0207699_10490158 | 3300025906 | Bacteria | 886 |
| 398 | Ga0207699_10910031 | 3300025906 | Bacteria | 649 |
| 399 | Ga0207645_10058248 | 3300025907 | Bacteria | 2466 |
| 400 | Ga0207645_10172342 | 3300025907 | Bacteria | 1419 |
| 401 | Ga0207705_10269578 | 3300025909 | Bacteria | 1302 |
| 402 | Ga0207705_10295605 | 3300025909 | Bacteria | 1241 |
| 403 | Ga0207684_10216101 | 3300025910 | Bacteria | 1654 |
| 404 | Ga0207684_10558714 | 3300025910 | Bacteria | 979 |
| 405 | Ga0207684_11207051 | 3300025910 | Bacteria | 626 |
| 406 | Ga0207654_10429061 | 3300025911 | Bacteria | 924 |
| 407 | Ga0207707_10000419 | 3300025912 | Bacteria | 44410 |
| 408 | Ga0207707_10002705 | 3300025912 | Bacteria | 15850 |
| 409 | Ga0207707_10002868 | 3300025912 | Bacteria | 15401 |
| 410 | Ga0207707_10045918 | 3300025912 | Bacteria | 3804 |
| 411 | Ga0207707_10135089 | 3300025912 | Bacteria | 2156 |
| 412 | Ga0207695_10048124 | 3300025913 | Bacteria | 4506 |
| 413 | Ga0207695_10060686 | 3300025913 | Bacteria | 3913 |
| 414 | Ga0207695_10140869 | 3300025913 | Bacteria | 2360 |
| 415 | Ga0207695_10240619 | 3300025913 | Bacteria | 1711 |
| 416 | Ga0207695_10363647 | 3300025913 | Bacteria | 1333 |
| 417 | Ga0207671_10061259 | 3300025914 | Bacteria | 2792 |
| 418 | Ga0207671_10378725 | 3300025914 | Bacteria | 1124 |
| 419 | Ga0207671_10456499 | 3300025914 | Bacteria | 1018 |
| 420 | Ga0207671_10485729 | 3300025914 | Bacteria | 984 |
| 421 | Ga0207671_11174057 | 3300025914 | Bacteria | 601 |
| 422 | Ga0207693_10041850 | 3300025915 | Bacteria | 3606 |
| 423 | Ga0207693_10071447 | 3300025915 | Bacteria | 2716 |
| 424 | Ga0207693_10086606 | 3300025915 | Bacteria | 2455 |
| 425 | Ga0207693_10770161 | 3300025915 | Bacteria | 743 |
| 426 | Ga0207663_10007087 | 3300025916 | Bacteria | 5789 |
| 427 | Ga0207663_10043021 | 3300025916 | Bacteria | 2763 |
| 428 | Ga0207663_10065948 | 3300025916 | Bacteria | 2316 |
| 429 | Ga0207663_10116334 | 3300025916 | Bacteria | 1823 |
| 430 | Ga0207663_10390605 | 3300025916 | Bacteria | 1062 |
| 431 | Ga0207660_10012377 | 3300025917 | Bacteria | 5581 |
| 432 | Ga0207660_10048142 | 3300025917 | Bacteria | 3017 |
| 433 | Ga0207660_10305114 | 3300025917 | Bacteria | 1268 |
| 434 | Ga0207660_10330707 | 3300025917 | Bacteria | 1218 |
| 435 | Ga0207662_10113335 | 3300025918 | Bacteria | 1693 |
| 436 | Ga0207662_11223767 | 3300025918 | Bacteria | 534 |
| 437 | Ga0207657_10011308 | 3300025919 | Bacteria | 8865 |
| 438 | Ga0207657_10420585 | 3300025919 | Bacteria | 1050 |
| 439 | Ga0207649_10039488 | 3300025920 | Bacteria | 2862 |
| 440 | Ga0207649_10557951 | 3300025920 | Bacteria | 877 |
| 441 | Ga0207652_10001690 | 3300025921 | Bacteria | 19300 |
| 442 | Ga0207652_10009155 | 3300025921 | Bacteria | 7969 |
| 443 | Ga0207652_10011695 | 3300025921 | Bacteria | 7082 |
| 444 | Ga0207652_10047707 | 3300025921 | Bacteria | 3659 |
| 445 | Ga0207652_10055058 | 3300025921 | Bacteria | 3420 |
| 446 | Ga0207646_10826670 | 3300025922 | Bacteria | 824 |
| 447 | Ga0207681_10039022 | 3300025923 | Bacteria | 3150 |
| 448 | Ga0207681_10411264 | 3300025923 | Bacteria | 1094 |
| 449 | Ga0207681_10889286 | 3300025923 | Bacteria | 746 |
| 450 | Ga0207694_10027290 | 3300025924 | Bacteria | 4347 |
| 451 | Ga0207694_10075966 | 3300025924 | Bacteria | 2631 |
| 452 | Ga0207694_10321799 | 3300025924 | Bacteria | 1276 |
| 453 | Ga0207694_10731282 | 3300025924 | Bacteria | 835 |
| 454 | Ga0207694_11027946 | 3300025924 | Bacteria | 697 |
| 455 | Ga0207659_10101426 | 3300025926 | Bacteria | 2171 |
| 456 | Ga0207687_10157928 | 3300025927 | Bacteria | 1737 |
| 457 | Ga0207687_10395148 | 3300025927 | Bacteria | 1136 |
| 458 | Ga0207687_10641434 | 3300025927 | Bacteria | 898 |
| 459 | Ga0207700_10005544 | 3300025928 | Bacteria | 7569 |
| 460 | Ga0207700_10063406 | 3300025928 | Bacteria | 2811 |
| 461 | Ga0207700_10118805 | 3300025928 | Bacteria | 2140 |
| 462 | Ga0207700_10120991 | 3300025928 | Bacteria | 2123 |
| 463 | Ga0207700_10183800 | 3300025928 | Bacteria | 1752 |
| 464 | Ga0207700_11162919 | 3300025928 | Bacteria | 689 |
| 465 | Ga0207664_10042851 | 3300025929 | Bacteria | 3536 |
| 466 | Ga0207664_10150641 | 3300025929 | Bacteria | 1976 |
| 467 | Ga0207664_10229936 | 3300025929 | Bacteria | 1612 |
| 468 | Ga0207664_10489807 | 3300025929 | Bacteria | 1100 |
| 469 | Ga0207644_10234854 | 3300025931 | Bacteria | 1458 |
| 470 | Ga0207644_11082889 | 3300025931 | Bacteria | 673 |
| 471 | Ga0207644_11312479 | 3300025931 | Bacteria | 608 |
| 472 | Ga0207644_11400987 | 3300025931 | Bacteria | 587 |
| 473 | Ga0207690_10587430 | 3300025932 | Bacteria | 908 |
| 474 | Ga0207706_10015272 | 3300025933 | Bacteria | 6945 |
| 475 | Ga0207706_10225273 | 3300025933 | Bacteria | 1641 |
| 476 | Ga0207706_10408965 | 3300025933 | Bacteria | 1176 |
| 477 | Ga0207709_10358165 | 3300025935 | Bacteria | 1104 |
| 478 | Ga0207709_10503061 | 3300025935 | Bacteria | 946 |
| 479 | Ga0207709_10528054 | 3300025935 | Bacteria | 925 |
| 480 | Ga0207709_10862442 | 3300025935 | Bacteria | 734 |
| 481 | Ga0207709_10893438 | 3300025935 | Bacteria | 722 |
| 482 | Ga0207669_10095367 | 3300025937 | Bacteria | 1950 |
| 483 | Ga0207669_10718476 | 3300025937 | Bacteria | 822 |
| 484 | Ga0207669_11091687 | 3300025937 | Bacteria | 673 |
| 485 | Ga0207704_10666308 | 3300025938 | Bacteria | 858 |
| 486 | Ga0207704_11179898 | 3300025938 | Bacteria | 652 |
| 487 | Ga0207665_10036449 | 3300025939 | Bacteria | 3271 |
| 488 | Ga0207665_10088797 | 3300025939 | Bacteria | 2139 |
| 489 | Ga0207665_10195726 | 3300025939 | Bacteria | 1471 |
| 490 | Ga0207665_10253201 | 3300025939 | Bacteria | 1302 |
| 491 | Ga0207665_10611246 | 3300025939 | Bacteria | 852 |
| 492 | Ga0207665_10847064 | 3300025939 | Bacteria | 724 |
| 493 | Ga0207691_10054640 | 3300025940 | Bacteria | 3642 |
| 494 | Ga0207691_10168119 | 3300025940 | Bacteria | 1921 |
| 495 | Ga0207691_10426374 | 3300025940 | Bacteria | 1130 |
| 496 | Ga0207691_10505181 | 3300025940 | Bacteria | 1026 |
| 497 | Ga0207691_10765507 | 3300025940 | Bacteria | 812 |
| 498 | Ga0207711_10284242 | 3300025941 | Bacteria | 1524 |
| 499 | Ga0207689_10011785 | 3300025942 | Bacteria | 7491 |
| 500 | Ga0207689_10125319 | 3300025942 | Bacteria | 2113 |
| 501 | Ga0207689_10326522 | 3300025942 | Bacteria | 1274 |
| 502 | Ga0207661_10001270 | 3300025944 | Bacteria | 16867 |
| 503 | Ga0207661_10008213 | 3300025944 | Bacteria | 7451 |
| 504 | Ga0207661_10021058 | 3300025944 | Bacteria | 4883 |
| 505 | Ga0207679_10069235 | 3300025945 | Bacteria | 2654 |
| 506 | Ga0207679_10271615 | 3300025945 | Bacteria | 1450 |
| 507 | Ga0207679_10377220 | 3300025945 | Bacteria | 1242 |
| 508 | Ga0207679_10916061 | 3300025945 | Bacteria | 802 |
| 509 | Ga0207667_10002017 | 3300025949 | Bacteria | 25487 |
| 510 | Ga0207667_10145129 | 3300025949 | Bacteria | 2443 |
| 511 | Ga0207667_10201639 | 3300025949 | Bacteria | 2041 |
| 512 | Ga0207667_10510487 | 3300025949 | Bacteria | 1218 |
| 513 | Ga0207667_11719651 | 3300025949 | Bacteria | 593 |
| 514 | Ga0207651_10112506 | 3300025960 | Bacteria | 2047 |
| 515 | Ga0207651_10603500 | 3300025960 | Bacteria | 960 |
| 516 | Ga0207712_10128621 | 3300025961 | Bacteria | 1927 |
| 517 | Ga0207668_10150043 | 3300025972 | Bacteria | 1803 |
| 518 | Ga0207668_10241238 | 3300025972 | Bacteria | 1462 |
| 519 | Ga0207668_10335998 | 3300025972 | Bacteria | 1258 |
| 520 | Ga0207668_10471341 | 3300025972 | Bacteria | 1075 |
| 521 | Ga0207668_10481127 | 3300025972 | Bacteria | 1065 |
| 522 | Ga0207668_10558761 | 3300025972 | Bacteria | 992 |
| 523 | Ga0207640_10214238 | 3300025981 | Bacteria | 1470 |
| 524 | Ga0207640_10407822 | 3300025981 | Bacteria | 1108 |
| 525 | Ga0207640_10539537 | 3300025981 | Bacteria | 978 |
| 526 | Ga0207658_10132641 | 3300025986 | Bacteria | 2004 |
| 527 | Ga0207658_10375592 | 3300025986 | Bacteria | 1244 |
| 528 | Ga0207658_11256020 | 3300025986 | Bacteria | 677 |
| 529 | Ga0207658_11567847 | 3300025986 | Bacteria | 602 |
| 530 | Ga0207677_10005891 | 3300026023 | Bacteria | 6669 |
| 531 | Ga0207677_10532795 | 3300026023 | Bacteria | 1021 |
| 532 | Ga0207703_10394218 | 3300026035 | Bacteria | 1283 |
| 533 | Ga0207703_10999855 | 3300026035 | Bacteria | 802 |
| 534 | Ga0207703_11300422 | 3300026035 | Bacteria | 699 |
| 535 | Ga0207639_10173169 | 3300026041 | Bacteria | 1830 |
| 536 | Ga0207639_10837909 | 3300026041 | Bacteria | 858 |
| 537 | Ga0207639_10970591 | 3300026041 | Bacteria | 795 |
| 538 | Ga0207639_12227199 | 3300026041 | Bacteria | 509 |
| 539 | Ga0207678_10006479 | 3300026067 | Bacteria | 10385 |
| 540 | Ga0207678_10044766 | 3300026067 | Bacteria | 3828 |
| 541 | Ga0207678_10061454 | 3300026067 | Bacteria | 3231 |
| 542 | Ga0207678_10196905 | 3300026067 | Bacteria | 1722 |
| 543 | Ga0207678_10628445 | 3300026067 | Bacteria | 942 |
| 544 | Ga0207678_10860880 | 3300026067 | Bacteria | 801 |
| 545 | Ga0207678_11372541 | 3300026067 | Bacteria | 625 |
| 546 | Ga0207678_11916079 | 3300026067 | Bacteria | 517 |
| 547 | Ga0207708_10158521 | 3300026075 | Bacteria | 1786 |
| 548 | Ga0207708_10981793 | 3300026075 | Bacteria | 733 |
| 549 | Ga0207702_10273884 | 3300026078 | Bacteria | 1593 |
| 550 | Ga0207702_10875316 | 3300026078 | Bacteria | 890 |
| 551 | Ga0207702_10903267 | 3300026078 | Bacteria | 875 |
| 552 | Ga0207641_10606623 | 3300026088 | Bacteria | 1072 |
| 553 | Ga0207641_11251741 | 3300026088 | Bacteria | 742 |
| 554 | Ga0207641_11833036 | 3300026088 | Bacteria | 608 |
| 555 | Ga0207648_10797285 | 3300026089 | Bacteria | 879 |
| 556 | Ga0207648_10821718 | 3300026089 | Bacteria | 866 |
| 557 | Ga0207648_10936444 | 3300026089 | Bacteria | 810 |
| 558 | Ga0207676_10069328 | 3300026095 | Bacteria | 2823 |
| 559 | Ga0207674_10010575 | 3300026116 | Bacteria | 10440 |
| 560 | Ga0207674_10113295 | 3300026116 | Bacteria | 2685 |
| 561 | Ga0207674_10242397 | 3300026116 | Bacteria | 1750 |
| 562 | Ga0207674_10457616 | 3300026116 | Bacteria | 1233 |
| 563 | Ga0207674_10594400 | 3300026116 | Bacteria | 1069 |
| 564 | Ga0207674_11383866 | 3300026116 | Bacteria | 673 |
| 565 | Ga0207674_11674039 | 3300026116 | Bacteria | 604 |
| 566 | Ga0207675_100031334 | 3300026118 | Bacteria | 4954 |
| 567 | Ga0207675_100064640 | 3300026118 | Bacteria | 3420 |
| 568 | Ga0207675_100274434 | 3300026118 | Bacteria | 1637 |
| 569 | Ga0207675_100422111 | 3300026118 | Bacteria | 1317 |
| 570 | Ga0207675_101532037 | 3300026118 | Bacteria | 687 |
| 571 | Ga0207675_101742728 | 3300026118 | Bacteria | 642 |
| 572 | Ga0207675_101791882 | 3300026118 | Bacteria | 633 |
| 573 | Ga0207683_10021694 | 3300026121 | Bacteria | 5504 |
| 574 | Ga0207683_10197482 | 3300026121 | Bacteria | 1828 |
| 575 | Ga0207683_10648249 | 3300026121 | Bacteria | 978 |
| 576 | Ga0207683_10766064 | 3300026121 | Bacteria | 895 |
| 577 | Ga0207698_10226900 | 3300026142 | Bacteria | 1692 |
| 578 | Ga0207698_10295269 | 3300026142 | Bacteria | 1506 |
| 579 | Ga0207698_10317285 | 3300026142 | Bacteria | 1458 |
| 580 | Ga0207698_10501287 | 3300026142 | Bacteria | 1181 |
| 581 | Ga0207698_11430873 | 3300026142 | Bacteria | 706 |
| 582 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 583 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 584 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 585 | Ga0209179_1012641 | 3300027512 | Bacteria | 1520 |
| 586 | Ga0209179_1048167 | 3300027512 | Bacteria | 909 |
| 587 | Ga0209588_1002539 | 3300027671 | Bacteria | 4953 |
| 588 | Ga0268266_10147257 | 3300028379 | Bacteria | 2118 |
| 589 | Ga0268266_10201322 | 3300028379 | Bacteria | 1822 |
| 590 | Ga0268266_10391978 | 3300028379 | Bacteria | 1312 |
| 591 | Ga0268266_10570437 | 3300028379 | Bacteria | 1085 |
| 592 | Ga0268266_11270396 | 3300028379 | Bacteria | 711 |
| 593 | Ga0268265_10198420 | 3300028380 | Bacteria | 1738 |
| 594 | Ga0268265_10268121 | 3300028380 | Bacteria | 1521 |
| 595 | Ga0268265_10304954 | 3300028380 | Bacteria | 1435 |
| 596 | Ga0268265_10753171 | 3300028380 | Bacteria | 945 |
| 597 | Ga0268265_11590458 | 3300028380 | Bacteria | 658 |
| 598 | Ga0268265_11681054 | 3300028380 | Bacteria | 640 |
| 599 | Ga0268265_11964165 | 3300028380 | Bacteria | 592 |
| 600 | Ga0268265_12483165 | 3300028380 | Bacteria | 524 |
| 601 | Ga0268264_10055549 | 3300028381 | Bacteria | 3309 |
| 602 | Ga0268264_10292401 | 3300028381 | Bacteria | 1530 |
| 603 | Ga0268264_10568056 | 3300028381 | Bacteria | 1114 |
| 604 | Ga0268264_10893234 | 3300028381 | Bacteria | 891 |
| 605 | Ga0268264_11123623 | 3300028381 | Bacteria | 794 |
| 606 | Ga0268264_11758227 | 3300028381 | Bacteria | 630 |
| 607 | Ga0265337_1007001 | 3300028556 | Bacteria | 4268 |
| 608 | Ga0265326_10065353 | 3300028558 | Bacteria | 1028 |
| 609 | Ga0265319_1006536 | 3300028563 | Bacteria | 5385 |
| 610 | Ga0265334_10001696 | 3300028573 | Bacteria | 10529 |
| 611 | Ga0265318_10008197 | 3300028577 | Bacteria | 4667 |
| 612 | Ga0265323_10001106 | 3300028653 | Bacteria | 13928 |
| 613 | Ga0265322_10001590 | 3300028654 | Bacteria | 7289 |
| 614 | Ga0265336_10000135 | 3300028666 | Bacteria | 52478 |
| 615 | Ga0307517_10000634 | 3300028786 | Bacteria | 60194 |
| 616 | Ga0307517_10039620 | 3300028786 | Bacteria | 5167 |
| 617 | Ga0307517_10324896 | 3300028786 | Bacteria | 849 |
| 618 | Ga0307517_10594244 | 3300028786 | Bacteria | 546 |
| 619 | Ga0307515_10006012 | 3300028794 | Bacteria | 24419 |
| 620 | Ga0307515_10512273 | 3300028794 | Bacteria | 810 |
| 621 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 622 | Ga0265338_10361635 | 3300028800 | Bacteria | 1041 |
| 623 | Ga0265324_10001466 | 3300029957 | Bacteria | 13424 |
| 624 | Ga0265324_10156835 | 3300029957 | Bacteria | 773 |
| 625 | Ga0307511_10024264 | 3300030521 | Bacteria | 5626 |
| 626 | Ga0265332_10013209 | 3300031238 | Bacteria | 3662 |
| 627 | Ga0307513_10125438 | 3300031456 | Bacteria | 2524 |
| 628 | Ga0307513_10444506 | 3300031456 | Bacteria | 1022 |
| 629 | Ga0307513_10645174 | 3300031456 | Bacteria | 766 |
| 630 | Ga0307509_10132445 | 3300031507 | Bacteria | 2445 |
| 631 | Ga0307509_10826352 | 3300031507 | Bacteria | 591 |
| 632 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 633 | Ga0307508_10022899 | 3300031616 | Bacteria | 5677 |
| 634 | Ga0307508_10139265 | 3300031616 | Bacteria | 2030 |
| 635 | Ga0307508_10715631 | 3300031616 | Bacteria | 612 |
| 636 | Ga0265314_10195305 | 3300031711 | Bacteria | 1201 |
| 637 | Ga0307516_10005934 | 3300031730 | Bacteria | 14450 |
| 638 | Ga0307516_10039539 | 3300031730 | Bacteria | 4700 |
| 639 | Ga0307516_10300751 | 3300031730 | Bacteria | 1280 |
| 640 | Ga0307405_10879540 | 3300031731 | Bacteria | 756 |
| 641 | Ga0307413_10061917 | 3300031824 | Bacteria | 2312 |
| 642 | Ga0307413_10440005 | 3300031824 | Bacteria | 1032 |
| 643 | Ga0307410_10143713 | 3300031852 | Bacteria | 1768 |
| 644 | Ga0307406_10896882 | 3300031901 | Bacteria | 754 |
| 645 | Ga0307407_10186122 | 3300031903 | Bacteria | 1380 |
| 646 | Ga0307412_10093307 | 3300031911 | Bacteria | 2111 |
| 647 | Ga0307412_11811460 | 3300031911 | Bacteria | 562 |
| 648 | Ga0307416_100738479 | 3300032002 | Bacteria | 1076 |
| 649 | Ga0307411_10300285 | 3300032005 | Bacteria | 1287 |
| 650 | Ga0307415_100094054 | 3300032126 | Bacteria | 2178 |
| 651 | Ga0307415_100687932 | 3300032126 | Bacteria | 921 |
| 652 | Ga0307507_10011278 | 3300033179 | Bacteria | 11327 |
| 653 | Ga0307510_10016157 | 3300033180 | Bacteria | 8816 |
| 654 | Ga0307510_10091519 | 3300033180 | Bacteria | 2883 |
| 655 | Ga0373930_0001351 | 3300034816 | Bacteria | 3619 |
| 656 | Ga0373959_0055718 | 3300034820 | Bacteria | 864 |
| 657 | Ga0373926_0007554 | 3300035083 | Bacteria | 3620 |
| 658 | Ga0373934_0187215 | 3300035086 | Bacteria | 851 |
| 659 | Ga0373951_0013653 | 3300035091 | Bacteria | 1825 |
| 660 | Ga0373952_0108085 | 3300035092 | Bacteria | 741 |
| 661 | Ga0373923_0061471 | 3300035111 | Bacteria | 1596 |
| 662 | Ga0373923_0236904 | 3300035111 | Bacteria | 852 |
| 663 | Ga0373936_0061479 | 3300035113 | Bacteria | 1534 |
| 664 | Ga0373936_0068996 | 3300035113 | Bacteria | 1454 |
| 665 | Ga0373939_0227291 | 3300035114 | Bacteria | 717 |
| 666 | Ga0373939_0489452 | 3300035114 | Bacteria | 523 |
| 667 | Ga0373954_0081500 | 3300035118 | Bacteria | 1546 |
| 668 | Ga0373954_0166773 | 3300035118 | Bacteria | 1078 |
| 669 | Ga0373956_0304788 | 3300035119 | Bacteria | 759 |
| 670 | Ga0373956_0407056 | 3300035119 | Bacteria | 649 |
| 671 | Ga0373943_0083782 | 3300035170 | Bacteria | 1639 |
| 672 | Ga0373946_0026464 | 3300035171 | Bacteria | 2289 |
| 673 | Ga0373946_0058279 | 3300035171 | Bacteria | 1635 |
| 674 | Ga0373955_0040395 | 3300035172 | Bacteria | 2495 |
| 675 | Ga0373955_0058451 | 3300035172 | Bacteria | 2122 |
| 676 | Ga0373955_0880774 | 3300035172 | Bacteria | 551 |
| 677 | Ga0373924_0017175 | 3300035410 | Bacteria | 2772 |
| 678 | Ga0373931_0002187 | 3300035691 | Bacteria | 8629 |
| 679 | Ga0373931_0384182 | 3300035691 | Bacteria | 886 |
| 680 | Ga0373931_0390676 | 3300035691 | Bacteria | 879 |
| 681 | Ga0373931_0434475 | 3300035691 | Bacteria | 837 |
| 682 | Ga0373931_1246755 | 3300035691 | Bacteria | 510 |
| 683 | Ga0373935_0012923 | 3300035692 | Bacteria | 5031 |
| 684 | Ga0373935_0032924 | 3300035692 | Bacteria | 3223 |
| 685 | Ga0373935_0063455 | 3300035692 | Bacteria | 2368 |
| 686 | Ga0373935_0069468 | 3300035692 | Bacteria | 2269 |
| 687 | Ga0373935_0324990 | 3300035692 | Bacteria | 1092 |
| 688 | Ga0373935_0607081 | 3300035692 | Bacteria | 800 |
| 689 | Ga0373927_0014717 | 3300035695 | Bacteria | 5172 |
| 690 | Ga0373927_0015621 | 3300035695 | Bacteria | 5014 |
| 691 | Ga0373927_0044610 | 3300035695 | Bacteria | 2868 |
| 692 | Ga0373927_0060854 | 3300035695 | Bacteria | 2443 |
| 693 | Ga0373927_0169814 | 3300035695 | Bacteria | 1429 |
| 694 | Ga0373927_0523744 | 3300035695 | Bacteria | 783 |
| 695 | Ga0373927_0605220 | 3300035695 | Bacteria | 724 |
| 696 | Ga0373927_0732936 | 3300035695 | Bacteria | 653 |
| 697 | Ga0373933_0000182 | 3300035724 | Bacteria | 41434 |
| 698 | Ga0373933_0219645 | 3300035724 | Bacteria | 1219 |
| 699 | Ga0373933_1055597 | 3300035724 | Bacteria | 535 |
| 700 | Ga0373947_0025925 | 3300035725 | Bacteria | 3420 |
| 701 | Ga0373947_0028707 | 3300035725 | Bacteria | 3263 |
| 702 | Ga0373947_0076608 | 3300035725 | Bacteria | 2061 |
| 703 | Ga0373937_0399859 | 3300036401 | Bacteria | 1303 |
| 704 | Ga0372808_009572 | 3300036459 | Bacteria | 1355 |
| 705 | Ga0373925_0025108 | 3300037068 | Bacteria | 4351 |
| 706 | Ga0373925_0054383 | 3300037068 | Bacteria | 2994 |
| 707 | Ga0373925_0102550 | 3300037068 | Bacteria | 2201 |
| 708 | Ga0373925_0125508 | 3300037068 | Bacteria | 1996 |
| 709 | Ga0373925_0453465 | 3300037068 | Bacteria | 1050 |
| 710 | Ga0373925_0589940 | 3300037068 | Bacteria | 915 |
| 711 | Ga0395900_0017080 | 3300037418 | Bacteria | 7408 |
| 712 | Ga0395900_0082779 | 3300037418 | Bacteria | 3297 |
| 713 | Ga0395900_0200935 | 3300037418 | Bacteria | 2017 |
| 714 | Ga0395898_0099842 | 3300037466 | Bacteria | 2788 |
| 715 | Ga0395905_0996464 | 3300037471 | Bacteria | 741 |
| 716 | Ga0395901_0044477 | 3300038443 | Bacteria | 4606 |
| 717 | Ga0395901_0153963 | 3300038443 | Bacteria | 2415 |
| 718 | Ga0395901_0251715 | 3300038443 | Bacteria | 1840 |
| 719 | Ga0436365_0229539 | 3300039437 | Bacteria | 3406 |
| 720 | Ga0436365_0585470 | 3300039437 | Bacteria | 722 |
| 721 | Ga0436365_0644236 | 3300039437 | Bacteria | 1141 |
| 722 | Ga0436365_1524424 | 3300039437 | Bacteria | 1377 |
| 723 | Ga0436365_1891875 | 3300039437 | Bacteria | 1374 |
| 724 | Ga0436363_0130820 | 3300039450 | Bacteria | 640 |
| 725 | Ga0436363_0194304 | 3300039450 | Bacteria | 1684 |
| 726 | Ga0436363_0749925 | 3300039450 | Bacteria | 610 |
| 727 | Ga0436363_1284900 | 3300039450 | Bacteria | 4856 |
| 728 | Ga0439465_0026133 | 3300041413 | Bacteria | 1845 |
| 729 | Ga0451793_1610473 | 3300041452 | Bacteria | 1027 |
| 730 | Ga0451807_0104523 | 3300041486 | Bacteria | 1009 |
| 731 | Ga0451851_0290019 | 3300041507 | Bacteria | 631 |
| 732 | Ga0451855_0070536 | 3300041511 | Bacteria | 865 |
| 733 | Ga0451853_1007521 | 3300041512 | Bacteria | 854 |
| 734 | Ga0439459_0016118 | 3300042438 | Bacteria | 1378 |
| 735 | Ga0466961_0065107 | 3300044693 | Bacteria | 2316 |
| 736 | Ga0466964_0154855 | 3300044706 | Bacteria | 1066 |
| 737 | Ga0466971_0518372 | 3300044719 | Bacteria | 589 |
| 738 | Ga0466970_0232843 | 3300044765 | Bacteria | 1030 |
| 739 | Ga0466959_0778571 | 3300045049 | Bacteria | 640 |
| 740 | Ga0466967_0285270 | 3300045976 | Bacteria | 1585 |
| 741 | Ga0466967_0306657 | 3300045976 | Bacteria | 1528 |
| 742 | Ga0466967_0347873 | 3300045976 | Bacteria | 1434 |
| 743 | Ga0466967_0392747 | 3300045976 | Bacteria | 1349 |
| 744 | Ga0495617_013046 | 3300046452 | Bacteria | 2830 |
| 745 | Ga0495617_155269 | 3300046452 | Bacteria | 727 |
| 746 | Ga0495592_0022948 | 3300046454 | Bacteria | 4748 |
| 747 | Ga0495592_0068249 | 3300046454 | Bacteria | 2596 |
| 748 | Ga0495603_0003836 | 3300046455 | Bacteria | 8949 |
| 749 | Ga0495603_0023547 | 3300046455 | Bacteria | 3724 |
| 750 | Ga0495603_0043708 | 3300046455 | Bacteria | 2674 |
| 751 | Ga0495603_0080616 | 3300046455 | Bacteria | 1907 |
| 752 | Ga0495603_0622622 | 3300046455 | Bacteria | 618 |
| 753 | Ga0495629_0000862 | 3300046459 | Bacteria | 24478 |
| 754 | Ga0495629_0091399 | 3300046459 | Bacteria | 2124 |
| 755 | Ga0495629_0406317 | 3300046459 | Bacteria | 925 |
| 756 | Ga0495638_0019608 | 3300046460 | Bacteria | 4473 |
| 757 | Ga0495638_0148689 | 3300046460 | Bacteria | 1360 |
| 758 | Ga0495638_0200917 | 3300046460 | Bacteria | 1125 |
| 759 | Ga0495641_0348703 | 3300046461 | Bacteria | 669 |
| 760 | Ga0495651_0267567 | 3300046462 | Bacteria | 1160 |
| 761 | Ga0495653_0373644 | 3300046463 | Bacteria | 912 |
| 762 | Ga0495580_0010268 | 3300046472 | Bacteria | 7303 |
| 763 | Ga0495580_0037193 | 3300046472 | Bacteria | 3495 |
| 764 | Ga0495580_0059540 | 3300046472 | Bacteria | 2684 |
| 765 | Ga0495582_0006572 | 3300046473 | Bacteria | 6452 |
| 766 | Ga0495582_0025793 | 3300046473 | Bacteria | 3220 |
| 767 | Ga0495582_0107941 | 3300046473 | Bacteria | 1563 |
| 768 | Ga0495582_0187308 | 3300046473 | Bacteria | 1180 |
| 769 | Ga0495605_0194958 | 3300046474 | Bacteria | 885 |
| 770 | Ga0495639_0000544 | 3300046475 | Bacteria | 17562 |
| 771 | Ga0495639_0703245 | 3300046475 | Bacteria | 522 |
| 772 | Ga0495662_0042974 | 3300046476 | Bacteria | 2181 |
| 773 | Ga0495664_0063932 | 3300046477 | Bacteria | 2193 |
| 774 | Ga0495664_0077097 | 3300046477 | Bacteria | 1996 |
| 775 | Ga0495585_0032350 | 3300046492 | Bacteria | 2963 |
| 776 | Ga0495585_0037849 | 3300046492 | Bacteria | 2716 |
| 777 | Ga0495585_0341597 | 3300046492 | Bacteria | 729 |
| 778 | Ga0495585_0355030 | 3300046492 | Bacteria | 712 |
| 779 | Ga0495585_0388404 | 3300046492 | Bacteria | 673 |
| 780 | Ga0495594_0026789 | 3300046499 | Bacteria | 3103 |
| 781 | Ga0495594_0154774 | 3300046499 | Bacteria | 1302 |
| 782 | Ga0495594_0198833 | 3300046499 | Bacteria | 1142 |
| 783 | Ga0495596_0066425 | 3300046500 | Bacteria | 1402 |
| 784 | Ga0495606_0253460 | 3300046507 | Bacteria | 975 |
| 785 | Ga0495606_0551029 | 3300046507 | Bacteria | 574 |
| 786 | Ga0495608_0143484 | 3300046511 | Bacteria | 1523 |
| 787 | Ga0495610_0144252 | 3300046512 | Bacteria | 1022 |
| 788 | Ga0495610_0249092 | 3300046512 | Bacteria | 705 |
| 789 | Ga0495610_0337008 | 3300046512 | Bacteria | 571 |
| 790 | Ga0495616_0269497 | 3300046513 | Bacteria | 726 |
| 791 | Ga0495618_0430387 | 3300046514 | Bacteria | 803 |
| 792 | Ga0495620_0088969 | 3300046515 | Bacteria | 1240 |
| 793 | Ga0495630_0026624 | 3300046517 | Bacteria | 4283 |
| 794 | Ga0495630_0029536 | 3300046517 | Bacteria | 4075 |
| 795 | Ga0495631_0067517 | 3300046518 | Bacteria | 1547 |
| 796 | Ga0495631_0191757 | 3300046518 | Bacteria | 875 |
| 797 | Ga0495631_0215006 | 3300046518 | Bacteria | 821 |
| 798 | Ga0495631_0284483 | 3300046518 | Bacteria | 704 |
| 799 | Ga0495631_0307965 | 3300046518 | Bacteria | 674 |
| 800 | Ga0495632_0136433 | 3300046519 | Bacteria | 1140 |
| 801 | Ga0495632_0227779 | 3300046519 | Bacteria | 841 |
| 802 | Ga0495644_0073339 | 3300046523 | Bacteria | 1287 |
| 803 | Ga0495663_0081096 | 3300046525 | Bacteria | 1045 |
| 804 | Ga0495666_0051203 | 3300046526 | Bacteria | 1984 |
| 805 | Ga0495666_0502043 | 3300046526 | Bacteria | 542 |
| 806 | Ga0495652_0111297 | 3300046529 | Bacteria | 2202 |
| 807 | Ga0495652_0465025 | 3300046529 | Bacteria | 883 |
| 808 | Ga0495665_0007397 | 3300046531 | Bacteria | 5938 |
| 809 | Ga0495665_0155014 | 3300046531 | Bacteria | 1195 |
| 810 | Ga0495665_0208083 | 3300046531 | Bacteria | 1013 |
| 811 | Ga0495640_0002595 | 3300046533 | Bacteria | 14526 |
| 812 | Ga0495640_0853911 | 3300046533 | Bacteria | 541 |
| 813 | Ga0495586_0111796 | 3300046535 | Bacteria | 1521 |
| 814 | Ga0495587_0035087 | 3300046536 | Bacteria | 3022 |
| 815 | Ga0495598_0383886 | 3300046537 | Bacteria | 546 |
| 816 | Ga0495609_0135061 | 3300046538 | Bacteria | 1055 |
| 817 | Ga0495609_0318243 | 3300046538 | Bacteria | 631 |
| 818 | Ga0495597_0086925 | 3300046542 | Bacteria | 1331 |
| 819 | Ga0495645_0228866 | 3300046543 | Bacteria | 1246 |
| 820 | Ga0495645_0466904 | 3300046543 | Bacteria | 794 |
| 821 | Ga0495645_0617971 | 3300046543 | Bacteria | 665 |
| 822 | Ga0495645_0750689 | 3300046543 | Bacteria | 589 |
| 823 | Ga0495622_0012042 | 3300046557 | Bacteria | 3999 |
| 824 | Ga0495622_0064031 | 3300046557 | Bacteria | 1701 |
| 825 | Ga0495633_0267211 | 3300046558 | Bacteria | 779 |
| 826 | Ga0495667_0154776 | 3300046559 | Bacteria | 1475 |
| 827 | Ga0495667_0785131 | 3300046559 | Bacteria | 588 |
| 828 | Ga0495656_0026839 | 3300046615 | Bacteria | 2296 |
| 829 | Ga0495656_0052703 | 3300046615 | Bacteria | 1745 |
| 830 | Ga0495656_0179193 | 3300046615 | Bacteria | 1041 |
| 831 | Ga0495668_0077670 | 3300046616 | Bacteria | 1823 |
| 832 | Ga0495668_0085192 | 3300046616 | Bacteria | 1733 |
| 833 | Ga0495668_0249305 | 3300046616 | Bacteria | 972 |
| 834 | Ga0495668_0255578 | 3300046616 | Bacteria | 959 |
| 835 | Ga0495668_0282838 | 3300046616 | Bacteria | 909 |
| 836 | Ga0495634_0290709 | 3300046642 | Bacteria | 990 |
| 837 | Ga0495611_0072829 | 3300046648 | Bacteria | 1572 |
| 838 | Ga0495611_0121136 | 3300046648 | Bacteria | 1220 |
| 839 | Ga0495611_0316384 | 3300046648 | Bacteria | 718 |
| 840 | Ga0495625_0183777 | 3300046660 | Bacteria | 1388 |
| 841 | Ga0495625_0433421 | 3300046660 | Bacteria | 815 |
| 842 | Ga0495625_0484986 | 3300046660 | Bacteria | 758 |
| 843 | Ga0495625_0590184 | 3300046660 | Bacteria | 668 |
| 844 | Ga0495635_0000436 | 3300046663 | Bacteria | 26341 |
| 845 | Ga0495635_0070320 | 3300046663 | Bacteria | 2399 |
| 846 | Ga0495635_0402096 | 3300046663 | Bacteria | 910 |
| 847 | Ga0495659_0060867 | 3300046664 | Bacteria | 1394 |
| 848 | Ga0495661_0085330 | 3300046665 | Bacteria | 1810 |
| 849 | Ga0495661_0326307 | 3300046665 | Bacteria | 762 |
| 850 | Ga0495588_0013756 | 3300046674 | Bacteria | 3860 |
| 851 | Ga0495657_0827946 | 3300046675 | Bacteria | 528 |
| 852 | Ga0495599_0138845 | 3300046678 | Bacteria | 1508 |
| 853 | Ga0495599_0400473 | 3300046678 | Bacteria | 818 |
| 854 | Ga0495599_0891822 | 3300046678 | Bacteria | 504 |
| 855 | Ga0495623_0599247 | 3300046679 | Bacteria | 572 |
| 856 | Ga0495646_0078212 | 3300046680 | Bacteria | 1933 |
| 857 | Ga0495647_0474697 | 3300046681 | Bacteria | 580 |
| 858 | Ga0495658_0375563 | 3300046683 | Bacteria | 905 |
| 859 | Ga0495669_0000650 | 3300046684 | Bacteria | 15146 |
| 860 | Ga0495669_0125391 | 3300046684 | Bacteria | 1206 |
| 861 | Ga0495669_0252889 | 3300046684 | Bacteria | 846 |
| 862 | Ga0495669_0608343 | 3300046684 | Bacteria | 532 |
| 863 | Ga0495613_0013842 | 3300046689 | Bacteria | 5984 |
| 864 | Ga0495624_0023168 | 3300046690 | Bacteria | 4096 |
| 865 | Ga0495624_0044261 | 3300046690 | Bacteria | 2838 |
| 866 | Ga0495624_0312140 | 3300046690 | Bacteria | 947 |
| 867 | Ga0495670_0044258 | 3300046691 | Bacteria | 2222 |
| 868 | Ga0495670_0187388 | 3300046691 | Bacteria | 1094 |
| 869 | Ga0495670_0245510 | 3300046691 | Bacteria | 954 |
| 870 | Ga0495670_0341585 | 3300046691 | Bacteria | 805 |
| 871 | Ga0495649_0070708 | 3300046694 | Bacteria | 1871 |
| 872 | Ga0495649_0220052 | 3300046694 | Bacteria | 982 |
| 873 | Ga0495649_0505208 | 3300046694 | Bacteria | 601 |
| 874 | Ga0495649_0565877 | 3300046694 | Bacteria | 562 |
| 875 | Ga0495589_0051689 | 3300046794 | Bacteria | 2031 |
| 876 | Ga0495589_0116759 | 3300046794 | Bacteria | 1286 |
| 877 | Ga0495589_0258396 | 3300046794 | Bacteria | 813 |
| 878 | Ga0495581_0282336 | 3300047315 | Bacteria | 970 |
| 879 | Ga0495604_0323740 | 3300047317 | Bacteria | 1030 |
| 880 | Ga0495636_0041720 | 3300047318 | Bacteria | 1905 |
| 881 | Ga0495674_0008459 | 3300047319 | Bacteria | 9804 |
| 882 | Ga0495674_0213064 | 3300047319 | Bacteria | 1599 |
| 883 | Ga0495674_1290039 | 3300047319 | Bacteria | 548 |
| 884 | Ga0495672_0043612 | 3300047320 | Bacteria | 2696 |
| 885 | Ga0495672_0079874 | 3300047320 | Bacteria | 1826 |
| 886 | Ga0495672_0516335 | 3300047320 | Bacteria | 529 |
| 887 | Ga0495676_0192322 | 3300047321 | Bacteria | 1423 |
| 888 | Ga0495676_0210521 | 3300047321 | Bacteria | 1345 |
| 889 | Ga0495676_0306496 | 3300047321 | Bacteria | 1070 |
| 890 | Ga0495683_0402623 | 3300047323 | Bacteria | 569 |
| 891 | Ga0495685_145900 | 3300047447 | Bacteria | 770 |
| 892 | Ga0495685_292251 | 3300047447 | Bacteria | 513 |
| 893 | Ga0495673_0116317 | 3300047469 | Bacteria | 1063 |
| 894 | Ga0495681_0098221 | 3300047470 | Bacteria | 1284 |
| 895 | Ga0495684_0028441 | 3300047471 | Bacteria | 4292 |
| 896 | Ga0495686_0026279 | 3300047472 | Bacteria | 3810 |
| 897 | Ga0495686_0693037 | 3300047472 | Bacteria | 520 |
| 898 | Ga0495593_0021586 | 3300047673 | Bacteria | 3593 |
| 899 | Ga0495593_0133176 | 3300047673 | Bacteria | 1261 |
| 900 | Ga0495593_0522266 | 3300047673 | Bacteria | 595 |
| 901 | Ga0495614_0032035 | 3300048089 | Bacteria | 2263 |
| 902 | Ga0495615_0137137 | 3300048090 | Bacteria | 719 |
| 903 | Ga0496100_0131977 | 3300048903 | Bacteria | 1760 |
| 904 | Ga0496100_0506484 | 3300048903 | Bacteria | 931 |
| 905 | Ga0496100_1029391 | 3300048903 | Bacteria | 648 |
| 906 | Ga0496100_1096012 | 3300048903 | Bacteria | 627 |
| 907 | Ga0496101_0002052 | 3300048904 | Bacteria | 12255 |
| 908 | Ga0496101_0177563 | 3300048904 | Bacteria | 1639 |
| 909 | Ga0496101_0590416 | 3300048904 | Bacteria | 878 |
| 910 | Ga0496101_0601141 | 3300048904 | Bacteria | 869 |
| 911 | Ga0496102_0001771 | 3300048905 | Bacteria | 18745 |
| 912 | Ga0496102_0028325 | 3300048905 | Bacteria | 5002 |
| 913 | Ga0496102_0228574 | 3300048905 | Bacteria | 1754 |
| 914 | Ga0496102_0789710 | 3300048905 | Bacteria | 872 |
| 915 | Ga0496102_1180376 | 3300048905 | Bacteria | 685 |
| 916 | Ga0496102_1421870 | 3300048905 | Bacteria | 613 |
| 917 | Ga0496103_0005699 | 3300048906 | Bacteria | 7445 |
| 918 | Ga0496103_0103765 | 3300048906 | Bacteria | 1801 |
| 919 | Ga0496103_0345511 | 3300048906 | Bacteria | 957 |
| 920 | Ga0496104_0074499 | 3300048907 | Bacteria | 3231 |
| 921 | Ga0496105_0042375 | 3300048908 | Bacteria | 3752 |
| 922 | Ga0496105_0085872 | 3300048908 | Bacteria | 2600 |
| 923 | Ga0496106_0002858 | 3300048909 | Bacteria | 12824 |
| 924 | Ga0496106_0009997 | 3300048909 | Bacteria | 7007 |
| 925 | Ga0496106_0041953 | 3300048909 | Bacteria | 3430 |
| 926 | Ga0496107_0002387 | 3300048910 | Bacteria | 12152 |
| 927 | Ga0496107_0009519 | 3300048910 | Bacteria | 6741 |
| 928 | Ga0496107_0051319 | 3300048910 | Bacteria | 2975 |
| 929 | Ga0496107_0713590 | 3300048910 | Bacteria | 737 |
| 930 | Ga0496108_0016020 | 3300048911 | Bacteria | 6111 |
| 931 | Ga0496108_0524321 | 3300048911 | Bacteria | 1034 |
| 932 | Ga0496108_0735223 | 3300048911 | Bacteria | 854 |
| 933 | Ga0496108_0781677 | 3300048911 | Bacteria | 824 |
| 934 | Ga0496109_0007060 | 3300048912 | Bacteria | 9476 |
| 935 | Ga0496109_0197825 | 3300048912 | Bacteria | 1890 |
| 936 | Ga0496109_0971871 | 3300048912 | Bacteria | 787 |
| 937 | Ga0496110_0004493 | 3300048913 | Bacteria | 10817 |
| 938 | Ga0496110_0015025 | 3300048913 | Bacteria | 6438 |
| 939 | Ga0496110_0119761 | 3300048913 | Bacteria | 2371 |
| 940 | Ga0496110_0153298 | 3300048913 | Bacteria | 2087 |
| 941 | Ga0496110_0188337 | 3300048913 | Bacteria | 1874 |
| 942 | Ga0496110_0291341 | 3300048913 | Bacteria | 1487 |
| 943 | Ga0496110_0608064 | 3300048913 | Bacteria | 991 |
| 944 | Ga0496111_0117480 | 3300048914 | Bacteria | 1962 |
| 945 | Ga0496111_0459520 | 3300048914 | Bacteria | 939 |
| 946 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 947 | Ga0496112_0013582 | 3300048915 | Bacteria | 7524 |
| 948 | Ga0496112_0105142 | 3300048915 | Bacteria | 2793 |
| 949 | Ga0496112_0157337 | 3300048915 | Bacteria | 2239 |
| 950 | Ga0496112_0172126 | 3300048915 | Bacteria | 2130 |
| 951 | Ga0496112_0423891 | 3300048915 | Bacteria | 1269 |
| 952 | Ga0496113_0031143 | 3300048916 | Bacteria | 3868 |
| 953 | Ga0496113_0048870 | 3300048916 | Bacteria | 3148 |
| 954 | Ga0496114_0011547 | 3300048917 | Bacteria | 7058 |
| 955 | Ga0496114_0062101 | 3300048917 | Bacteria | 3126 |
| 956 | Ga0496114_0254127 | 3300048917 | Bacteria | 1547 |
| 957 | Ga0496115_0000535 | 3300048918 | Bacteria | 29580 |
| 958 | Ga0496115_0492551 | 3300048918 | Bacteria | 986 |
| 959 | Ga0496115_1352674 | 3300048918 | Bacteria | 528 |
| 960 | Ga0496117_0129636 | 3300048920 | Bacteria | 1531 |
| 961 | Ga0496117_0608009 | 3300048920 | Bacteria | 510 |
| 962 | Ga0496118_0003407 | 3300048921 | Bacteria | 20095 |
| 963 | Ga0496119_0269894 | 3300048922 | Bacteria | 850 |
| 964 | Ga0496119_0291385 | 3300048922 | Bacteria | 808 |
| 965 | Ga0496121_0045020 | 3300048924 | Bacteria | 3798 |
| 966 | Ga0496121_0054677 | 3300048924 | Bacteria | 3333 |
| 967 | Ga0496121_0129108 | 3300048924 | Bacteria | 1895 |
| 968 | Ga0496121_0224635 | 3300048924 | Bacteria | 1320 |
| 969 | Ga0496121_0291596 | 3300048924 | Bacteria | 1111 |
| 970 | Ga0496121_0322012 | 3300048924 | Bacteria | 1040 |
| 971 | Ga0496121_0327432 | 3300048924 | Bacteria | 1029 |
| 972 | Ga0496121_0578250 | 3300048924 | Bacteria | 697 |
| 973 | Ga0496124_0026548 | 3300048927 | Bacteria | 5219 |
| 974 | Ga0496124_0178729 | 3300048927 | Bacteria | 1635 |
| 975 | Ga0496124_0273454 | 3300048927 | Bacteria | 1236 |
| 976 | Ga0496124_0404719 | 3300048927 | Bacteria | 946 |
| 977 | Ga0496125_0051831 | 3300048928 | Bacteria | 3380 |
| 978 | Ga0496125_0265018 | 3300048928 | Bacteria | 1074 |
| 979 | Ga0496125_0303374 | 3300048928 | Bacteria | 977 |
| 980 | Ga0496126_0002483 | 3300048929 | Bacteria | 24817 |
| 981 | Ga0496126_0092604 | 3300048929 | Bacteria | 2655 |
| 982 | Ga0496126_0149771 | 3300048929 | Bacteria | 2001 |
| 983 | Ga0496126_0176947 | 3300048929 | Bacteria | 1814 |
| 984 | Ga0496126_0212828 | 3300048929 | Bacteria | 1626 |
| 985 | Ga0496126_0407184 | 3300048929 | Bacteria | 1102 |
| 986 | Ga0496126_0494497 | 3300048929 | Bacteria | 978 |
| 987 | Ga0496126_0572690 | 3300048929 | Bacteria | 893 |
| 988 | Ga0496126_0645808 | 3300048929 | Bacteria | 828 |
| 989 | Ga0496126_0758943 | 3300048929 | Bacteria | 748 |
| 990 | Ga0495678_115396 | 3300049459 | Bacteria | 910 |
| 991 | Ga0501031_0008184 | 3300049568 | Bacteria | 6805 |
| 992 | Ga0501032_0000704 | 3300049569 | Bacteria | 27243 |
| 993 | Ga0501033_0000311 | 3300049570 | Bacteria | 46039 |
| 994 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 995 | Ga0501036_0000127 | 3300049572 | Bacteria | 48559 |
| 996 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 997 | Ga0501038_0000342 | 3300049574 | Bacteria | 40148 |
| 998 | Ga0501039_0000840 | 3300049575 | Bacteria | 22181 |
| 999 | Ga0501042_0026448 | 3300049578 | Bacteria | 4078 |
| 1000 | Ga0501043_0000120 | 3300049579 | Bacteria | 72670 |
| 1001 | Ga0501046_0000359 | 3300049580 | Bacteria | 45929 |
| 1002 | Ga0501046_0048465 | 3300049580 | Bacteria | 3364 |
| 1003 | Ga0501047_0000379 | 3300049581 | Bacteria | 50147 |
| 1004 | Ga0501047_0084770 | 3300049581 | Bacteria | 3045 |
| 1005 | Ga0501047_1343705 | 3300049581 | Bacteria | 529 |
| 1006 | Ga0501048_0000352 | 3300049582 | Bacteria | 31854 |
| 1007 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 1008 | Ga0501068_0001230 | 3300049584 | Bacteria | 13601 |
| 1009 | Ga0501069_0007011 | 3300049585 | Bacteria | 5899 |
| 1010 | Ga0501069_0175721 | 3300049585 | Bacteria | 1237 |
| 1011 | Ga0501070_0002185 | 3300049586 | Bacteria | 17207 |
| 1012 | Ga0501070_0042781 | 3300049586 | Bacteria | 3772 |
| 1013 | Ga0501071_0244492 | 3300049587 | Bacteria | 1353 |
| 1014 | Ga0501072_0002767 | 3300049588 | Bacteria | 13186 |
| 1015 | Ga0501072_0624932 | 3300049588 | Bacteria | 849 |
| 1016 | Ga0501073_0000091 | 3300049589 | Bacteria | 57029 |
| 1017 | Ga0501073_0258618 | 3300049589 | Bacteria | 1201 |
| 1018 | Ga0501074_0000489 | 3300049590 | Bacteria | 24170 |
| 1019 | Ga0501074_0025368 | 3300049590 | Bacteria | 4305 |
| 1020 | Ga0501076_0228198 | 3300049592 | Bacteria | 1522 |
| 1021 | Ga0501076_0842771 | 3300049592 | Bacteria | 756 |
| 1022 | Ga0501079_0006818 | 3300049741 | Bacteria | 8597 |
| 1023 | Ga0501080_0000321 | 3300049742 | Bacteria | 36637 |
| 1024 | Ga0501080_0026275 | 3300049742 | Bacteria | 5410 |
| 1025 | Ga0501083_0000284 | 3300049744 | Bacteria | 32169 |
| 1026 | Ga0501035_0001251 | 3300049822 | Bacteria | 26410 |
| 1027 | Ga0501035_0423288 | 3300049822 | Bacteria | 1105 |
| 1028 | Ga0501044_0000274 | 3300049823 | Bacteria | 65668 |
| 1029 | Ga0501044_0144750 | 3300049823 | Bacteria | 2363 |
| 1030 | Ga0501045_0005330 | 3300049824 | Bacteria | 8907 |
| 1031 | nmdc:mga03683_309151_c1 | 3300050489 | Bacteria | 742 |
| 1032 | nmdc:mga03n38_341479_c1 | 3300050490 | Bacteria | 813 |
| 1033 | nmdc:mga00v17_465059_c1 | 3300050491 | Bacteria | 821 |
| 1034 | nmdc:mga00v17_888245_c1 | 3300050491 | Bacteria | 565 |
| 1035 | nmdc:mga0yw44_535895_c1 | 3300050492 | Bacteria | 795 |
| 1036 | nmdc:mga0yw44_706686_c1 | 3300050492 | Bacteria | 685 |
| 1037 | nmdc:mga0yw44_90407_c1 | 3300050492 | Bacteria | 1934 |
| 1038 | nmdc:mga0k408_240358_c1 | 3300050493 | Bacteria | 1081 |
| 1039 | nmdc:mga0k408_97231_c1 | 3300050493 | Bacteria | 1734 |
| 1040 | nmdc:mga06z11_103107_c1 | 3300050494 | Bacteria | 1568 |
| 1041 | nmdc:mga06z11_207023_c1 | 3300050494 | Bacteria | 1142 |
| 1042 | nmdc:mga0qj67_501630_c1 | 3300050509 | Bacteria | 975 |
| 1043 | nmdc:mga08y16_916868_c1 | 3300050511 | Bacteria | 861 |
| 1044 | nmdc:mga0n895_1812074_c1 | 3300050512 | Bacteria | 571 |
| 1045 | nmdc:mga0n895_382114_c1 | 3300050512 | Bacteria | 1425 |
| 1046 | nmdc:mga0rr50_866533_c1 | 3300050513 | Bacteria | 770 |
| 1047 | nmdc:mga0a205_622660_c1 | 3300050515 | Bacteria | 931 |
| 1048 | nmdc:mga0sz30_308756_c1 | 3300050516 | Bacteria | 705 |
| 1049 | nmdc:mga0sz30_78446_c1 | 3300050516 | Bacteria | 1126 |
| 1050 | Ga0495601_0078465 | 3300053077 | Bacteria | 2116 |
| 1051 | Ga0495601_0146773 | 3300053077 | Bacteria | 1540 |
| 1052 | Ga0495601_0252734 | 3300053077 | Bacteria | 1151 |
| 1053 | Ga0495601_0324068 | 3300053077 | Bacteria | 1003 |
| 1054 | Ga0495612_0056240 | 3300053078 | Bacteria | 1623 |
| 1055 | Ga0495612_0175279 | 3300053078 | Bacteria | 940 |
| 1056 | Ga0495612_0240040 | 3300053078 | Bacteria | 805 |
| 1057 | Ga0495612_0332974 | 3300053078 | Bacteria | 684 |
| 1058 | Ga0495655_0068994 | 3300053083 | Bacteria | 984 |
| 1059 | Ga0495655_0092691 | 3300053083 | Bacteria | 883 |
| 1060 | Ga0495595_0026236 | 3300053084 | Bacteria | 2588 |
| 1061 | Ga0495619_0209249 | 3300053085 | Bacteria | 1351 |
| 1062 | Ga0495619_0246095 | 3300053085 | Bacteria | 1239 |
| 1063 | Ga0500643_051619 | 3300053087 | Bacteria | 1174 |
| 1064 | Ga0500646_0022529 | 3300053090 | Bacteria | 1685 |
| 1065 | Ga0500646_0071361 | 3300053090 | Bacteria | 1042 |
| 1066 | Ga0500583_0072009 | 3300053092 | Bacteria | 1654 |
| 1067 | Ga0500583_0333398 | 3300053092 | Bacteria | 738 |
| 1068 | Ga0500651_0670507 | 3300053093 | Bacteria | 557 |
| 1069 | Ga0500566_0000158 | 3300053094 | Bacteria | 34495 |
| 1070 | Ga0500566_0078847 | 3300053094 | Bacteria | 1837 |
| 1071 | Ga0500566_0201394 | 3300053094 | Bacteria | 1005 |
| 1072 | Ga0500640_000568 | 3300053095 | Bacteria | 9480 |
| 1073 | Ga0500641_0008502 | 3300053096 | Bacteria | 3666 |
| 1074 | Ga0500648_057745 | 3300053097 | Bacteria | 2201 |
| 1075 | Ga0500650_0224827 | 3300053098 | Bacteria | 848 |
| 1076 | Ga0500554_007059 | 3300053102 | Bacteria | 2562 |
| 1077 | Ga0500562_063291 | 3300053108 | Bacteria | 995 |
| 1078 | Ga0500569_215176 | 3300053109 | Bacteria | 653 |
| 1079 | Ga0500569_306904 | 3300053109 | Bacteria | 533 |
| 1080 | Ga0500572_000024 | 3300053111 | Bacteria | 47391 |
| 1081 | Ga0500591_078328 | 3300053115 | Bacteria | 1477 |
| 1082 | Ga0500594_0098002 | 3300053118 | Bacteria | 899 |
| 1083 | Ga0500595_001188 | 3300053119 | Bacteria | 14372 |
| 1084 | Ga0500608_001300 | 3300053122 | Bacteria | 8888 |
| 1085 | Ga0500614_001812 | 3300053123 | Bacteria | 4949 |
| 1086 | Ga0500642_0270682 | 3300053130 | Bacteria | 775 |
| 1087 | Ga0500658_0175660 | 3300053134 | Bacteria | 974 |
| 1088 | Ga0500658_0382952 | 3300053134 | Bacteria | 644 |
| 1089 | Ga0500559_0003877 | 3300053136 | Bacteria | 7232 |
| 1090 | Ga0500559_0178998 | 3300053136 | Bacteria | 998 |
| 1091 | Ga0500561_0145643 | 3300053137 | Bacteria | 735 |
| 1092 | Ga0500568_0060565 | 3300053139 | Bacteria | 1466 |
| 1093 | Ga0500573_0032643 | 3300053140 | Bacteria | 3003 |
| 1094 | Ga0500577_0139481 | 3300053142 | Bacteria | 1022 |
| 1095 | Ga0500579_188848 | 3300053143 | Bacteria | 791 |
| 1096 | Ga0500588_0401468 | 3300053146 | Bacteria | 522 |
| 1097 | Ga0500589_025035 | 3300053147 | Bacteria | 2761 |
| 1098 | Ga0500589_313473 | 3300053147 | Bacteria | 550 |
| 1099 | Ga0500590_122838 | 3300053148 | Bacteria | 1214 |
| 1100 | Ga0500590_146250 | 3300053148 | Bacteria | 1073 |
| 1101 | Ga0500603_000465 | 3300053150 | Bacteria | 10412 |
| 1102 | Ga0500603_000801 | 3300053150 | Bacteria | 7516 |
| 1103 | Ga0500603_048017 | 3300053150 | Bacteria | 1160 |
| 1104 | Ga0500603_242973 | 3300053150 | Bacteria | 578 |
| 1105 | Ga0500622_0382782 | 3300053156 | Bacteria | 575 |
| 1106 | Ga0500627_0357681 | 3300053158 | Bacteria | 629 |
| 1107 | Ga0500630_000112 | 3300053159 | Bacteria | 26672 |
| 1108 | Ga0500634_0081721 | 3300053161 | Bacteria | 1663 |
| 1109 | Ga0500638_012135 | 3300053162 | Bacteria | 3851 |
| 1110 | Ga0500638_197823 | 3300053162 | Bacteria | 853 |
| 1111 | Ga0500639_000040 | 3300053163 | Bacteria | 63516 |
| 1112 | Ga0500636_0086872 | 3300053177 | Bacteria | 1795 |
| 1113 | Ga0500636_0184124 | 3300053177 | Bacteria | 1118 |
| 1114 | Ga0500637_0039960 | 3300053178 | Bacteria | 2647 |
| 1115 | Ga0500637_0108912 | 3300053178 | Bacteria | 1606 |
| 1116 | Ga0500609_015774 | 3300053731 | Bacteria | 1024 |
| 1117 | Ga0500596_000794 | 3300053735 | Bacteria | 6229 |
| 1118 | Ga0500596_005461 | 3300053735 | Bacteria | 2233 |
| 1119 | Ga0501084_0007045 | 3300054114 | Bacteria | 9269 |
| 1120 | Ga0587076_056219 | 3300059645 | Bacteria | 781 |
| 1121 | Ga0501082_0026885 | 3300060353 | Bacteria | 4957 |
| 1122 | 2509149319 | 2508501128 | Bacteria | 8613869 |
| 1123 | 2513654070 | 2513237096 | Bacteria | 8722461 |
| 1124 | 2513891271 | 2513237141 | Bacteria | 8496279 |
| 1125 | 2513918410 | 2513237145 | Bacteria | 8979722 |
| 1126 | 2517891356 | 2517572143 | Bacteria | 9484767 |
| 1127 | 2671118864 | 2667528175 | Bacteria | 7532676 |
| 1128 | 2728750068 | 2728368998 | Bacteria | 8720350 |
| 1129 | 2793066724 | 2791355197 | Bacteria | 8420563 |
| 1130 | 2793080652 | |||
| 1131 | 2876814617 | 2876808645 | Bacteria | 8824342 |
| 1132 | 2879114698 | 2879110137 | Bacteria | 8907982 |
| 1133 | 2885374989 | 2885374607 | Bacteria | 8927485 |
| 1134 | 2889038035 | 2889033259 | Bacteria | 9099371 |
| 1135 | 2903755317 | 2903748898 | Bacteria | 9972761 |
| 1136 | 2904691224 | 2904690495 | Bacteria | 9412302 |
| 1137 | 2904701310 | |||
| 1138 | 2906616542 | |||
| 1139 | 2908741710 | 2908739725 | Bacteria | 8628932 |
| 1140 | 2908759135 | 2908756301 | Bacteria | 8864324 |
| 1141 | 2922387369 | 2922386360 | Bacteria | 7017218 |
| 1142 | 2922431438 | |||
| 1143 | 2935634034 | 2935630451 | Bacteria | 8169952 |
| 1144 | 2941510663 | 2941507105 | Bacteria | 8166816 |
| 1145 | 2941518047 | 2941515067 | Bacteria | 8166720 |
| 1146 | 2941527082 | 2941523033 | Bacteria | 8169134 |
| 1147 | 3005481231 | 3005474847 | Bacteria | 9259049 |
| 1148 | 8006939478 | 8006933436 | Bacteria | 10410654 |
| 1149 | 8006972136 | 8006964411 | Bacteria | 8966052 |
| 1150 | 8006979228 | 8006973647 | Bacteria | 10679141 |
| 1151 | 8006984409 | 8006984368 | Bacteria | 9651211 |
| 1152 | 8019565358 | 8019555841 | Bacteria | 9642137 |
| 1153 | 8019575456 | 8019565922 | Bacteria | 9639779 |
| 1154 | 8056681087 | 8056673599 | Bacteria | 7871253 |
| 1155 | Ga0105241_10028779 | |||
| 1156 | JGI25406J46586_10009343 | |||
| 1157 | JGI25165J46597_1011939 | |||
| 1158 | JGI25153J46596_10051467 | |||
| 1159 | JGI25404J52841_10003019 | |||
| 1160 | JGI25404J52841_10010753 | |||
| 1161 | JGI25404J52841_10016744 | |||
| 1162 | JGI25404J52841_10041444 | |||
| 1163 | Ga0070658_10150878 | |||
| 1164 | Ga0070658_10362781 | |||
| 1165 | Ga0070676_10668089 | |||
| 1166 | Ga0070683_100095571 | |||
| 1167 | Ga0070683_100306288 | |||
| 1168 | Ga0070683_101207674 | |||
| 1169 | Ga0070683_101249715 | |||
| 1170 | Ga0068869_100283829 | |||
| 1171 | Ga0068869_100411856 | |||
| 1172 | Ga0068869_101378147 | |||
| 1173 | Ga0070680_100052018 | |||
| 1174 | Ga0070680_100194884 | |||
| 1175 | Ga0070680_100676728 | |||
| 1176 | Ga0070682_100039753 | |||
| 1177 | Ga0070682_100175885 | |||
| 1178 | Ga0070682_100246809 | |||
| 1179 | Ga0070682_100503776 | |||
| 1180 | Ga0068868_100034182 | |||
| 1181 | Ga0068868_100389483 | |||
| 1182 | Ga0068868_100548398 | |||
| 1183 | Ga0068868_100560813 | |||
| 1184 | Ga0070660_100051646 | |||
| 1185 | Ga0070687_100299556 | |||
| 1186 | Ga0070661_100328466 | |||
| 1187 | Ga0070661_100395995 | |||
| 1188 | Ga0070661_100556992 | |||
| 1189 | Ga0070692_10391666 | |||
| 1190 | Ga0070668_100044248 | |||
| 1191 | Ga0070668_100074675 | |||
| 1192 | Ga0070668_100207755 | |||
| 1193 | Ga0070668_100301249 | |||
| 1194 | Ga0070668_100481665 | |||
| 1195 | Ga0070668_100724073 | |||
| 1196 | Ga0070669_100068986 | |||
| 1197 | Ga0070671_100342350 | |||
| 1198 | Ga0070671_100383792 | |||
| 1199 | Ga0070671_100708452 | |||
| 1200 | Ga0070674_100034692 | |||
| 1201 | Ga0070688_100855168 | |||
| 1202 | Ga0070659_100053918 | |||
| 1203 | Ga0070667_100236881 | |||
| 1204 | Ga0070667_100569881 | |||
| 1205 | Ga0070667_100623283 | |||
| 1206 | Ga0070667_100797903 | |||
| 1207 | Ga0070709_10004227 | |||
| 1208 | Ga0070709_10048345 | |||
| 1209 | Ga0070709_10311929 | |||
| 1210 | Ga0070714_100082971 | |||
| 1211 | Ga0070714_100280905 | |||
| 1212 | Ga0070714_100541466 | |||
| 1213 | Ga0070714_100551108 | |||
| 1214 | Ga0070713_100042275 | |||
| 1215 | Ga0070713_100088760 | |||
| 1216 | Ga0070713_100353933 | |||
| 1217 | Ga0070713_100363813 | |||
| 1218 | Ga0070710_10042080 | |||
| 1219 | Ga0070710_10179435 | |||
| 1220 | Ga0070711_100001730 | |||
| 1221 | Ga0070711_100011938 | |||
| 1222 | Ga0070711_100061879 | |||
| 1223 | Ga0070711_100131145 | |||
| 1224 | Ga0070711_100692074 | |||
| 1225 | Ga0070705_100619464 | |||
| 1226 | Ga0070700_100046080 | |||
| 1227 | Ga0070700_100755597 | |||
| 1228 | Ga0070694_100787580 | |||
| 1229 | Ga0070663_100010941 | |||
| 1230 | Ga0070663_100050917 | |||
| 1231 | Ga0070663_100068772 | |||
| 1232 | Ga0070663_100185086 | |||
| 1233 | Ga0070663_100891518 | |||
| 1234 | Ga0070678_100010095 | |||
| 1235 | Ga0070678_100529455 | |||
| 1236 | Ga0070678_100647096 | |||
| 1237 | Ga0070678_100700015 | |||
| 1238 | Ga0070662_100031971 | |||
| 1239 | Ga0070662_100088266 | |||
| 1240 | Ga0070662_100457978 | |||
| 1241 | Ga0070662_100709265 | |||
| 1242 | Ga0070681_10003273 | |||
| 1243 | Ga0070681_10025087 | |||
| 1244 | Ga0070681_10056849 | |||
| 1245 | Ga0070681_10065024 | |||
| 1246 | Ga0070681_10341341 | |||
| 1247 | Ga0068867_100250304 | |||
| 1248 | Ga0068867_100424557 | |||
| 1249 | Ga0070685_10729585 | |||
| 1250 | Ga0070685_10756908 | |||
| 1251 | Ga0070685_10911377 | |||
| 1252 | Ga0070698_100536537 | |||
| 1253 | Ga0070698_101485996 | |||
| 1254 | Ga0070699_101178226 | |||
| 1255 | Ga0070679_100009864 | |||
| 1256 | Ga0070679_100017482 | |||
| 1257 | Ga0070679_100017715 | |||
| 1258 | Ga0070679_100036722 | |||
| 1259 | Ga0070679_100303056 | |||
| 1260 | Ga0070679_100865639 | |||
| 1261 | Ga0070684_100013567 | |||
| 1262 | Ga0070684_100231212 | |||
| 1263 | Ga0070684_100338695 | |||
| 1264 | Ga0070684_100481400 | |||
| 1265 | Ga0070697_100328239 | |||
| 1266 | Ga0070697_100350906 | |||
| 1267 | Ga0068853_100040363 | |||
| 1268 | Ga0068853_100130357 | |||
| 1269 | Ga0068853_100286863 | |||
| 1270 | Ga0068853_100372296 | |||
| 1271 | Ga0068853_100411221 | |||
| 1272 | Ga0070672_100191116 | |||
| 1273 | Ga0070672_100191311 | |||
| 1274 | Ga0070672_100431858 | |||
| 1275 | Ga0070672_100895577 | |||
| 1276 | Ga0070686_100740264 | |||
| 1277 | Ga0070695_100764136 | |||
| 1278 | Ga0070696_100760250 | |||
| 1279 | Ga0070693_101383201 | |||
| 1280 | Ga0070665_100189047 | |||
| 1281 | Ga0070665_100336297 | |||
| 1282 | Ga0070665_100357790 | |||
| 1283 | Ga0070665_101089130 | |||
| 1284 | Ga0070665_101216753 | |||
| 1285 | Ga0070665_101665143 | |||
| 1286 | Ga0070704_100517830 | |||
| 1287 | Ga0068855_100010865 | |||
| 1288 | Ga0068855_100067952 | |||
| 1289 | Ga0068855_100116881 | |||
| 1290 | Ga0068855_100142865 | |||
| 1291 | Ga0070664_100089985 | |||
| 1292 | Ga0070664_100363338 | |||
| 1293 | Ga0068857_100016047 | |||
| 1294 | Ga0068857_100106311 | |||
| 1295 | Ga0068857_101483817 | |||
| 1296 | Ga0068857_101752540 | |||
| 1297 | Ga0068857_101803285 | |||
| 1298 | Ga0068854_100316488 | |||
| 1299 | Ga0068854_100587678 | |||
| 1300 | Ga0068856_100731211 | |||
| 1301 | Ga0070702_100130267 | |||
| 1302 | Ga0068852_100036815 | |||
| 1303 | Ga0068852_100249880 | |||
| 1304 | Ga0068852_100254398 | |||
| 1305 | Ga0068852_100477308 | |||
| 1306 | Ga0068852_101247821 | |||
| 1307 | Ga0068852_101867233 | |||
| 1308 | Ga0068859_100463120 | |||
| 1309 | Ga0068864_100494527 | |||
| 1310 | Ga0068866_10021865 | |||
| 1311 | Ga0068866_10509547 | |||
| 1312 | Ga0068861_100410264 | |||
| 1313 | Ga0068861_100816180 | |||
| 1314 | Ga0068861_101639683 | |||
| 1315 | Ga0068851_10004825 | |||
| 1316 | Ga0068870_10078252 | |||
| 1317 | Ga0068863_100655952 | |||
| 1318 | Ga0068863_100744625 | |||
| 1319 | Ga0068863_100911131 | |||
| 1320 | Ga0068863_101044798 | |||
| 1321 | Ga0068863_101352280 | |||
| 1322 | Ga0068858_100046102 | |||
| 1323 | Ga0068858_100074580 | |||
| 1324 | Ga0068858_100917487 | |||
| 1325 | Ga0068860_100331144 | |||
| 1326 | Ga0068860_100352450 | |||
| 1327 | Ga0068860_100462292 | |||
| 1328 | Ga0068860_100483318 | |||
| 1329 | Ga0068860_100499225 | |||
| 1330 | Ga0068862_100129799 | |||
| 1331 | Ga0068862_100302221 | |||
| 1332 | Ga0068862_100414040 | |||
| 1333 | Ga0068862_100515000 | |||
| 1334 | Ga0068862_100669787 | |||
| 1335 | Ga0068862_101682387 | |||
| 1336 | Ga0081455_10009971 | |||
| 1337 | Ga0081455_10037550 | |||
| 1338 | Ga0081455_10087531 | |||
| 1339 | Ga0081455_10127583 | |||
| 1340 | Ga0081455_10150862 | |||
| 1341 | Ga0081540_1006422 | |||
| 1342 | Ga0081540_1009663 | |||
| 1343 | Ga0081540_1011844 | |||
| 1344 | Ga0081540_1012349 | |||
| 1345 | Ga0081540_1013491 | |||
| 1346 | Ga0081540_1014382 | |||
| 1347 | Ga0081540_1018818 | |||
| 1348 | Ga0081539_10000768 | |||
| 1349 | Ga0081539_10001470 | |||
| 1350 | Ga0081539_10004445 | |||
| 1351 | Ga0081539_10058092 | |||
| 1352 | Ga0070717_10001267 | |||
| 1353 | Ga0070717_10017332 | |||
| 1354 | Ga0070717_10416085 | |||
| 1355 | Ga0070717_10501552 | |||
| 1356 | Ga0075365_10083284 | |||
| 1357 | Ga0075365_10101356 | |||
| 1358 | Ga0075365_10541421 | |||
| 1359 | Ga0075365_10770016 | |||
| 1360 | Ga0075363_100113059 | |||
| 1361 | Ga0075363_100352030 | |||
| 1362 | Ga0075363_100407285 | |||
| 1363 | Ga0075364_10088472 | |||
| 1364 | Ga0075432_10149429 | |||
| 1365 | Ga0070716_100107458 | |||
| 1366 | Ga0070716_100189057 | |||
| 1367 | Ga0070716_100666400 | |||
| 1368 | Ga0070716_101690869 | |||
| 1369 | Ga0070712_100111079 | |||
| 1370 | Ga0070712_100118582 | |||
| 1371 | Ga0070712_100905172 | |||
| 1372 | Ga0075362_10396330 | |||
| 1373 | Ga0075367_10142444 | |||
| 1374 | Ga0075369_10127055 | |||
| 1375 | Ga0075369_10247272 | |||
| 1376 | Ga0075369_10336005 | |||
| 1377 | Ga0075366_10239677 | |||
| 1378 | Ga0075366_10593436 | |||
| 1379 | Ga0075366_10603489 | |||
| 1380 | Ga0075366_10853991 | |||
| 1381 | Ga0097621_100209156 | |||
| 1382 | Ga0097621_101107206 | |||
| 1383 | Ga0097621_101274183 | |||
| 1384 | Ga0097621_101490690 | |||
| 1385 | Ga0075370_10219152 | |||
| 1386 | Ga0075370_10380400 | |||
| 1387 | Ga0068871_100254458 | |||
| 1388 | Ga0068871_100483860 | |||
| 1389 | Ga0068871_100802604 | |||
| 1390 | Ga0068871_101385620 | |||
| 1391 | Ga0075428_100700818 | |||
| 1392 | Ga0075433_10677350 | |||
| 1393 | Ga0075429_100967043 | |||
| 1394 | Ga0068865_100444871 | |||
| 1395 | Ga0068865_100647710 | |||
| 1396 | Ga0068865_100847786 | |||
| 1397 | Ga0068865_101028166 | |||
| 1398 | Ga0097620_100463136 | |||
| 1399 | Ga0099825_1034140 | |||
| 1400 | Ga0099824_1007408 | |||
| 1401 | Ga0099822_1006547 | |||
| 1402 | Ga0099794_10013294 | |||
| 1403 | Ga0099794_10298454 | |||
| 1404 | Ga0099794_10419992 | |||
| 1405 | Ga0099795_10003875 | |||
| 1406 | Ga0099795_10184751 | |||
| 1407 | Ga0105251_10576561 | |||
| 1408 | Ga0105250_10539583 | |||
| 1409 | Ga0105240_10034221 | |||
| 1410 | Ga0105240_10058690 | |||
| 1411 | Ga0105240_10105395 | |||
| 1412 | Ga0105240_10108708 | |||
| 1413 | Ga0105240_10522672 | |||
| 1414 | Ga0105240_11095681 | |||
| 1415 | Ga0105240_11604799 | |||
| 1416 | Ga0105240_12534470 | |||
| 1417 | Ga0111539_10144248 | |||
| 1418 | Ga0111539_11656237 | |||
| 1419 | Ga0105245_10105057 | |||
| 1420 | Ga0105245_10289341 | |||
| 1421 | Ga0105245_10829319 | |||
| 1422 | Ga0105245_11842058 | |||
| 1423 | Ga0105247_10110567 | |||
| 1424 | Ga0105247_10136367 | |||
| 1425 | Ga0105247_10155708 | |||
| 1426 | Ga0105247_10400587 | |||
| 1427 | Ga0114129_10191104 | |||
| 1428 | Ga0105243_10078753 | |||
| 1429 | Ga0105243_10929161 | |||
| 1430 | Ga0105243_11232577 | |||
| 1431 | Ga0105243_12506854 | |||
| 1432 | Ga0105242_10115715 | |||
| 1433 | Ga0105242_10131362 | |||
| 1434 | Ga0105242_11576074 | |||
| 1435 | Ga0105242_11936273 | |||
| 1436 | Ga0105248_10139917 | |||
| 1437 | Ga0105248_10204152 | |||
| 1438 | Ga0105248_10336933 | |||
| 1439 | Ga0105248_10881040 | |||
| 1440 | Ga0105237_10087664 | |||
| 1441 | Ga0105237_10508977 | |||
| 1442 | Ga0105237_10562761 | |||
| 1443 | Ga0105237_10641091 | |||
| 1444 | Ga0105237_10726224 | |||
| 1445 | Ga0105237_10766119 | |||
| 1446 | Ga0105237_11358764 | |||
| 1447 | Ga0105237_11568743 | |||
| 1448 | Ga0105238_10017402 | |||
| 1449 | Ga0105238_10140974 | |||
| 1450 | Ga0105238_10358018 | |||
| 1451 | Ga0105238_10360284 | |||
| 1452 | Ga0105238_10598531 | |||
| 1453 | Ga0105238_11028171 | |||
| 1454 | Ga0105249_10080447 | |||
| 1455 | Ga0105249_10645237 | |||
| 1456 | Ga0099796_10459180 | |||
| 1457 | Ga0105239_10020324 | |||
| 1458 | Ga0105239_10029566 | |||
| 1459 | Ga0105239_10118154 | |||
| 1460 | Ga0105239_10151085 | |||
| 1461 | Ga0105239_10404892 | |||
| 1462 | Ga0105239_10804993 | |||
| 1463 | Ga0105246_10106488 | |||
| 1464 | Ga0105246_10229454 | |||
| 1465 | Ga0105246_10256365 | |||
| 1466 | Ga0105246_10675292 | |||
| 1467 | Ga0105246_11328480 | |||
| 1468 | Ga0157338_1036802 | |||
| 1469 | Ga0157371_10727887 | |||
| 1470 | Ga0157371_11388202 | |||
| 1471 | Ga0157370_10014947 | |||
| 1472 | Ga0157370_10025078 | |||
| 1473 | Ga0157370_10071347 | |||
| 1474 | Ga0157370_10296740 | |||
| 1475 | Ga0157370_10862740 | |||
| 1476 | Ga0157370_10950068 | |||
| 1477 | Ga0157369_10021190 | |||
| 1478 | Ga0157369_10047353 | |||
| 1479 | Ga0157369_10130028 | |||
| 1480 | Ga0157369_10501429 | |||
| 1481 | Ga0157369_10602033 | |||
| 1482 | Ga0157374_10033305 | |||
| 1483 | Ga0157374_10530713 | |||
| 1484 | Ga0157378_10070080 | |||
| 1485 | Ga0157378_10356319 | |||
| 1486 | Ga0157378_10368636 | |||
| 1487 | Ga0157378_11541203 | |||
| 1488 | Ga0157378_13043504 | |||
| 1489 | Ga0163162_10578216 | |||
| 1490 | Ga0163162_11108831 | |||
| 1491 | Ga0163162_11309716 | |||
| 1492 | Ga0163162_13152751 | |||
| 1493 | Ga0157372_10196832 | |||
| 1494 | Ga0157372_10708827 | |||
| 1495 | Ga0157372_12031415 | |||
| 1496 | Ga0157372_12344199 | |||
| 1497 | Ga0157375_10009689 | |||
| 1498 | Ga0157375_11105739 | |||
| 1499 | Ga0157375_11934839 | |||
| 1500 | Ga0157375_12308347 | |||
| 1501 | Ga0163163_10159204 | |||
| 1502 | Ga0163163_10453589 | |||
| 1503 | Ga0163163_10571962 | |||
| 1504 | Ga0163163_11094788 | |||
| 1505 | Ga0163163_12257726 | |||
| 1506 | Ga0157380_10184873 | |||
| 1507 | Ga0157380_10184912 | |||
| 1508 | Ga0157380_10811873 | |||
| 1509 | Ga0157380_12152610 | |||
| 1510 | Ga0157377_10094953 | |||
| 1511 | Ga0157377_10173047 | |||
| 1512 | Ga0157377_11356277 | |||
| 1513 | Ga0157379_10085565 | |||
| 1514 | Ga0157379_10341117 | |||
| 1515 | Ga0157379_10659533 | |||
| 1516 | Ga0157376_10092020 | |||
| 1517 | Ga0157376_10557471 | |||
| 1518 | Ga0163161_10128231 | |||
| 1519 | Ga0163161_10232435 | |||
| 1520 | Ga0163161_10303939 | |||
| 1521 | Ga0206356_10766524 | |||
| 1522 | Ga0206356_11320371 | |||
| 1523 | Ga0206353_10272000 | |||
| 1524 | Ga0213874_10013946 | |||
| 1525 | Ga0213876_10020027 | |||
| 1526 | Ga0213876_10072356 | |||
| 1527 | Ga0209233_1002384 | |||
| 1528 | Ga0209758_1030944 | |||
| 1529 | Ga0209758_1031236 | |||
| 1530 | Ga0209758_1050827 | |||
| 1531 | Ga0209758_1091452 | |||
| 1532 | Ga0207697_10085069 | |||
| 1533 | Ga0207656_10034898 | |||
| 1534 | Ga0207682_10212877 | |||
| 1535 | Ga0207642_10037371 | |||
| 1536 | Ga0207642_10398319 | |||
| 1537 | Ga0207642_10478566 | |||
| 1538 | Ga0207642_10583281 | |||
| 1539 | Ga0207710_10176392 | |||
| 1540 | Ga0207710_10384506 | |||
| 1541 | Ga0207710_10598127 | |||
| 1542 | Ga0207688_10215003 | |||
| 1543 | Ga0207688_10282908 | |||
| 1544 | Ga0207688_10421078 | |||
| 1545 | Ga0207688_10436633 | |||
| 1546 | Ga0207688_10518079 | |||
| 1547 | Ga0207680_10591542 | |||
| 1548 | Ga0207685_10027483 | |||
| 1549 | Ga0207699_10025234 | |||
| 1550 | Ga0207699_10156951 | |||
| 1551 | Ga0207699_10490158 | |||
| 1552 | Ga0207699_10910031 | |||
| 1553 | Ga0207645_10058248 | |||
| 1554 | Ga0207645_10172342 | |||
| 1555 | Ga0207705_10269578 | |||
| 1556 | Ga0207705_10295605 | |||
| 1557 | Ga0207684_10216101 | |||
| 1558 | Ga0207684_10558714 | |||
| 1559 | Ga0207684_11207051 | |||
| 1560 | Ga0207654_10429061 | |||
| 1561 | Ga0207707_10000419 | |||
| 1562 | Ga0207707_10002705 | |||
| 1563 | Ga0207707_10002868 | |||
| 1564 | Ga0207707_10045918 | |||
| 1565 | Ga0207707_10135089 | |||
| 1566 | Ga0207695_10048124 | |||
| 1567 | Ga0207695_10060686 | |||
| 1568 | Ga0207695_10140869 | |||
| 1569 | Ga0207695_10240619 | |||
| 1570 | Ga0207695_10363647 | |||
| 1571 | Ga0207671_10061259 | |||
| 1572 | Ga0207671_10378725 | |||
| 1573 | Ga0207671_10456499 | |||
| 1574 | Ga0207671_10485729 | |||
| 1575 | Ga0207671_11174057 | |||
| 1576 | Ga0207693_10041850 | |||
| 1577 | Ga0207693_10071447 | |||
| 1578 | Ga0207693_10086606 | |||
| 1579 | Ga0207693_10770161 | |||
| 1580 | Ga0207663_10007087 | |||
| 1581 | Ga0207663_10043021 | |||
| 1582 | Ga0207663_10065948 | |||
| 1583 | Ga0207663_10116334 | |||
| 1584 | Ga0207663_10390605 | |||
| 1585 | Ga0207660_10012377 | |||
| 1586 | Ga0207660_10048142 | |||
| 1587 | Ga0207660_10305114 | |||
| 1588 | Ga0207660_10330707 | |||
| 1589 | Ga0207662_10113335 | |||
| 1590 | Ga0207662_11223767 | |||
| 1591 | Ga0207657_10011308 | |||
| 1592 | Ga0207657_10420585 | |||
| 1593 | Ga0207649_10039488 | |||
| 1594 | Ga0207649_10557951 | |||
| 1595 | Ga0207652_10001690 | |||
| 1596 | Ga0207652_10009155 | |||
| 1597 | Ga0207652_10011695 | |||
| 1598 | Ga0207652_10047707 | |||
| 1599 | Ga0207652_10055058 | |||
| 1600 | Ga0207646_10826670 | |||
| 1601 | Ga0207681_10039022 | |||
| 1602 | Ga0207681_10411264 | |||
| 1603 | Ga0207681_10889286 | |||
| 1604 | Ga0207694_10027290 | |||
| 1605 | Ga0207694_10075966 | |||
| 1606 | Ga0207694_10321799 | |||
| 1607 | Ga0207694_10731282 | |||
| 1608 | Ga0207694_11027946 | |||
| 1609 | Ga0207659_10101426 | |||
| 1610 | Ga0207687_10157928 | |||
| 1611 | Ga0207687_10395148 | |||
| 1612 | Ga0207687_10641434 | |||
| 1613 | Ga0207700_10005544 | |||
| 1614 | Ga0207700_10063406 | |||
| 1615 | Ga0207700_10118805 | |||
| 1616 | Ga0207700_10120991 | |||
| 1617 | Ga0207700_10183800 | |||
| 1618 | Ga0207700_11162919 | |||
| 1619 | Ga0207664_10042851 | |||
| 1620 | Ga0207664_10150641 | |||
| 1621 | Ga0207664_10229936 | |||
| 1622 | Ga0207664_10489807 | |||
| 1623 | Ga0207644_10234854 | |||
| 1624 | Ga0207644_11082889 | |||
| 1625 | Ga0207644_11312479 | |||
| 1626 | Ga0207644_11400987 | |||
| 1627 | Ga0207690_10587430 | |||
| 1628 | Ga0207706_10015272 | |||
| 1629 | Ga0207706_10225273 | |||
| 1630 | Ga0207706_10408965 | |||
| 1631 | Ga0207709_10358165 | |||
| 1632 | Ga0207709_10503061 | |||
| 1633 | Ga0207709_10528054 | |||
| 1634 | Ga0207709_10862442 | |||
| 1635 | Ga0207709_10893438 | |||
| 1636 | Ga0207669_10095367 | |||
| 1637 | Ga0207669_10718476 | |||
| 1638 | Ga0207669_11091687 | |||
| 1639 | Ga0207704_10666308 | |||
| 1640 | Ga0207704_11179898 | |||
| 1641 | Ga0207665_10036449 | |||
| 1642 | Ga0207665_10088797 | |||
| 1643 | Ga0207665_10195726 | |||
| 1644 | Ga0207665_10253201 | |||
| 1645 | Ga0207665_10611246 | |||
| 1646 | Ga0207665_10847064 | |||
| 1647 | Ga0207691_10054640 | |||
| 1648 | Ga0207691_10168119 | |||
| 1649 | Ga0207691_10426374 | |||
| 1650 | Ga0207691_10505181 | |||
| 1651 | Ga0207691_10765507 | |||
| 1652 | Ga0207711_10284242 | |||
| 1653 | Ga0207689_10011785 | |||
| 1654 | Ga0207689_10125319 | |||
| 1655 | Ga0207689_10326522 | |||
| 1656 | Ga0207661_10001270 | |||
| 1657 | Ga0207661_10008213 | |||
| 1658 | Ga0207661_10021058 | |||
| 1659 | Ga0207679_10069235 | |||
| 1660 | Ga0207679_10271615 | |||
| 1661 | Ga0207679_10377220 | |||
| 1662 | Ga0207679_10916061 | |||
| 1663 | Ga0207667_10002017 | |||
| 1664 | Ga0207667_10145129 | |||
| 1665 | Ga0207667_10201639 | |||
| 1666 | Ga0207667_10510487 | |||
| 1667 | Ga0207667_11719651 | |||
| 1668 | Ga0207651_10112506 | |||
| 1669 | Ga0207651_10603500 | |||
| 1670 | Ga0207712_10128621 | |||
| 1671 | Ga0207668_10150043 | |||
| 1672 | Ga0207668_10241238 | |||
| 1673 | Ga0207668_10335998 | |||
| 1674 | Ga0207668_10471341 | |||
| 1675 | Ga0207668_10481127 | |||
| 1676 | Ga0207668_10558761 | |||
| 1677 | Ga0207640_10214238 | |||
| 1678 | Ga0207640_10407822 | |||
| 1679 | Ga0207640_10539537 | |||
| 1680 | Ga0207658_10132641 | |||
| 1681 | Ga0207658_10375592 | |||
| 1682 | Ga0207658_11256020 | |||
| 1683 | Ga0207658_11567847 | |||
| 1684 | Ga0207677_10005891 | |||
| 1685 | Ga0207677_10532795 | |||
| 1686 | Ga0207703_10394218 | |||
| 1687 | Ga0207703_10999855 | |||
| 1688 | Ga0207703_11300422 | |||
| 1689 | Ga0207639_10173169 | |||
| 1690 | Ga0207639_10837909 | |||
| 1691 | Ga0207639_10970591 | |||
| 1692 | Ga0207639_12227199 | |||
| 1693 | Ga0207678_10006479 | |||
| 1694 | Ga0207678_10044766 | |||
| 1695 | Ga0207678_10061454 | |||
| 1696 | Ga0207678_10196905 | |||
| 1697 | Ga0207678_10628445 | |||
| 1698 | Ga0207678_10860880 | |||
| 1699 | Ga0207678_11372541 | |||
| 1700 | Ga0207678_11916079 | |||
| 1701 | Ga0207708_10158521 | |||
| 1702 | Ga0207708_10981793 | |||
| 1703 | Ga0207702_10273884 | |||
| 1704 | Ga0207702_10875316 | |||
| 1705 | Ga0207702_10903267 | |||
| 1706 | Ga0207641_10606623 | |||
| 1707 | Ga0207641_11251741 | |||
| 1708 | Ga0207641_11833036 | |||
| 1709 | Ga0207648_10797285 | |||
| 1710 | Ga0207648_10821718 | |||
| 1711 | Ga0207648_10936444 | |||
| 1712 | Ga0207676_10069328 | |||
| 1713 | Ga0207674_10010575 | |||
| 1714 | Ga0207674_10113295 | |||
| 1715 | Ga0207674_10242397 | |||
| 1716 | Ga0207674_10457616 | |||
| 1717 | Ga0207674_10594400 | |||
| 1718 | Ga0207674_11383866 | |||
| 1719 | Ga0207674_11674039 | |||
| 1720 | Ga0207675_100031334 | |||
| 1721 | Ga0207675_100064640 | |||
| 1722 | Ga0207675_100274434 | |||
| 1723 | Ga0207675_100422111 | |||
| 1724 | Ga0207675_101532037 | |||
| 1725 | Ga0207675_101742728 | |||
| 1726 | Ga0207675_101791882 | |||
| 1727 | Ga0207683_10021694 | |||
| 1728 | Ga0207683_10197482 | |||
| 1729 | Ga0207683_10648249 | |||
| 1730 | Ga0207683_10766064 | |||
| 1731 | Ga0207698_10226900 | |||
| 1732 | Ga0207698_10295269 | |||
| 1733 | Ga0207698_10317285 | |||
| 1734 | Ga0207698_10501287 | |||
| 1735 | Ga0207698_11430873 | |||
| 1736 | Ga0209589_1000014 | |||
| 1737 | Ga0209489_100014 | |||
| 1738 | Ga0209700_100024 | |||
| 1739 | Ga0209179_1012641 | |||
| 1740 | Ga0209179_1048167 | |||
| 1741 | Ga0209588_1002539 | |||
| 1742 | Ga0268266_10147257 | |||
| 1743 | Ga0268266_10201322 | |||
| 1744 | Ga0268266_10391978 | |||
| 1745 | Ga0268266_10570437 | |||
| 1746 | Ga0268266_11270396 | |||
| 1747 | Ga0268265_10198420 | |||
| 1748 | Ga0268265_10268121 | |||
| 1749 | Ga0268265_10304954 | |||
| 1750 | Ga0268265_10753171 | |||
| 1751 | Ga0268265_11590458 | |||
| 1752 | Ga0268265_11681054 | |||
| 1753 | Ga0268265_11964165 | |||
| 1754 | Ga0268265_12483165 | |||
| 1755 | Ga0268264_10055549 | |||
| 1756 | Ga0268264_10292401 | |||
| 1757 | Ga0268264_10568056 | |||
| 1758 | Ga0268264_10893234 | |||
| 1759 | Ga0268264_11123623 | |||
| 1760 | Ga0268264_11758227 | |||
| 1761 | Ga0265337_1007001 | |||
| 1762 | Ga0265326_10065353 | |||
| 1763 | Ga0265319_1006536 | |||
| 1764 | Ga0265334_10001696 | |||
| 1765 | Ga0265318_10008197 | |||
| 1766 | Ga0265323_10001106 | |||
| 1767 | Ga0265322_10001590 | |||
| 1768 | Ga0265336_10000135 | |||
| 1769 | Ga0307517_10000634 | |||
| 1770 | Ga0307517_10039620 | |||
| 1771 | Ga0307517_10324896 | |||
| 1772 | Ga0307517_10594244 | |||
| 1773 | Ga0307515_10006012 | |||
| 1774 | Ga0307515_10512273 | |||
| 1775 | Ga0265338_10000034 | |||
| 1776 | Ga0265338_10361635 | |||
| 1777 | Ga0265324_10001466 | |||
| 1778 | Ga0265324_10156835 | |||
| 1779 | Ga0307511_10024264 | |||
| 1780 | Ga0265332_10013209 | |||
| 1781 | Ga0307513_10125438 | |||
| 1782 | Ga0307513_10444506 | |||
| 1783 | Ga0307513_10645174 | |||
| 1784 | Ga0307509_10132445 | |||
| 1785 | Ga0307509_10826352 | |||
| 1786 | Ga0307508_10000032 | |||
| 1787 | Ga0307508_10022899 | |||
| 1788 | Ga0307508_10139265 | |||
| 1789 | Ga0307508_10715631 | |||
| 1790 | Ga0265314_10195305 | |||
| 1791 | Ga0307516_10005934 | |||
| 1792 | Ga0307516_10039539 | |||
| 1793 | Ga0307516_10300751 | |||
| 1794 | Ga0307405_10879540 | |||
| 1795 | Ga0307413_10061917 | |||
| 1796 | Ga0307413_10440005 | |||
| 1797 | Ga0307410_10143713 | |||
| 1798 | Ga0307406_10896882 | |||
| 1799 | Ga0307407_10186122 | |||
| 1800 | Ga0307412_10093307 | |||
| 1801 | Ga0307412_11811460 | |||
| 1802 | Ga0307416_100738479 | |||
| 1803 | Ga0307411_10300285 | |||
| 1804 | Ga0307415_100094054 | |||
| 1805 | Ga0307415_100687932 | |||
| 1806 | Ga0307507_10011278 | |||
| 1807 | Ga0307510_10016157 | |||
| 1808 | Ga0307510_10091519 | |||
| 1809 | Ga0373930_0001351 | |||
| 1810 | Ga0373959_0055718 | |||
| 1811 | Ga0373926_0007554 | |||
| 1812 | Ga0373934_0187215 | |||
| 1813 | Ga0373951_0013653 | |||
| 1814 | Ga0373952_0108085 | |||
| 1815 | Ga0373923_0061471 | |||
| 1816 | Ga0373923_0236904 | |||
| 1817 | Ga0373936_0061479 | |||
| 1818 | Ga0373936_0068996 | |||
| 1819 | Ga0373939_0227291 | |||
| 1820 | Ga0373939_0489452 | |||
| 1821 | Ga0373954_0081500 | |||
| 1822 | Ga0373954_0166773 | |||
| 1823 | Ga0373956_0304788 | |||
| 1824 | Ga0373956_0407056 | |||
| 1825 | Ga0373943_0083782 | |||
| 1826 | Ga0373946_0026464 | |||
| 1827 | Ga0373946_0058279 | |||
| 1828 | Ga0373955_0040395 | |||
| 1829 | Ga0373955_0058451 | |||
| 1830 | Ga0373955_0880774 | |||
| 1831 | Ga0373924_0017175 | |||
| 1832 | Ga0373931_0002187 | |||
| 1833 | Ga0373931_0384182 | |||
| 1834 | Ga0373931_0390676 | |||
| 1835 | Ga0373931_0434475 | |||
| 1836 | Ga0373931_1246755 | |||
| 1837 | Ga0373935_0012923 | |||
| 1838 | Ga0373935_0032924 | |||
| 1839 | Ga0373935_0063455 | |||
| 1840 | Ga0373935_0069468 | |||
| 1841 | Ga0373935_0324990 | |||
| 1842 | Ga0373935_0607081 | |||
| 1843 | Ga0373927_0014717 | |||
| 1844 | Ga0373927_0015621 | |||
| 1845 | Ga0373927_0044610 | |||
| 1846 | Ga0373927_0060854 | |||
| 1847 | Ga0373927_0169814 | |||
| 1848 | Ga0373927_0523744 | |||
| 1849 | Ga0373927_0605220 | |||
| 1850 | Ga0373927_0732936 | |||
| 1851 | Ga0373933_0000182 | |||
| 1852 | Ga0373933_0219645 | |||
| 1853 | Ga0373933_1055597 | |||
| 1854 | Ga0373947_0025925 | |||
| 1855 | Ga0373947_0028707 | |||
| 1856 | Ga0373947_0076608 | |||
| 1857 | Ga0373937_0399859 | |||
| 1858 | Ga0372808_009572 | |||
| 1859 | Ga0373925_0025108 | |||
| 1860 | Ga0373925_0054383 | |||
| 1861 | Ga0373925_0102550 | |||
| 1862 | Ga0373925_0125508 | |||
| 1863 | Ga0373925_0453465 | |||
| 1864 | Ga0373925_0589940 | |||
| 1865 | Ga0395900_0017080 | |||
| 1866 | Ga0395900_0082779 | |||
| 1867 | Ga0395900_0200935 | |||
| 1868 | Ga0395898_0099842 | |||
| 1869 | Ga0395905_0996464 | |||
| 1870 | Ga0395901_0044477 | |||
| 1871 | Ga0395901_0153963 | |||
| 1872 | Ga0395901_0251715 | |||
| 1873 | Ga0436365_0229539 | |||
| 1874 | Ga0436365_0585470 | |||
| 1875 | Ga0436365_0644236 | |||
| 1876 | Ga0436365_1524424 | |||
| 1877 | Ga0436365_1891875 | |||
| 1878 | Ga0436363_0130820 | |||
| 1879 | Ga0436363_0194304 | |||
| 1880 | Ga0436363_0749925 | |||
| 1881 | Ga0436363_1284900 | |||
| 1882 | Ga0439465_0026133 | |||
| 1883 | Ga0451793_1610473 | |||
| 1884 | Ga0451807_0104523 | |||
| 1885 | Ga0451851_0290019 | |||
| 1886 | Ga0451855_0070536 | |||
| 1887 | Ga0451853_1007521 | |||
| 1888 | Ga0439459_0016118 | |||
| 1889 | Ga0466961_0065107 | |||
| 1890 | Ga0466964_0154855 | |||
| 1891 | Ga0466971_0518372 | |||
| 1892 | Ga0466970_0232843 | |||
| 1893 | Ga0466959_0778571 | |||
| 1894 | Ga0466967_0285270 | |||
| 1895 | Ga0466967_0306657 | |||
| 1896 | Ga0466967_0347873 | |||
| 1897 | Ga0466967_0392747 | |||
| 1898 | Ga0495617_013046 | |||
| 1899 | Ga0495617_155269 | |||
| 1900 | Ga0495592_0022948 | |||
| 1901 | Ga0495592_0068249 | |||
| 1902 | Ga0495603_0003836 | |||
| 1903 | Ga0495603_0023547 | |||
| 1904 | Ga0495603_0043708 | |||
| 1905 | Ga0495603_0080616 | |||
| 1906 | Ga0495603_0622622 | |||
| 1907 | Ga0495629_0000862 | |||
| 1908 | Ga0495629_0091399 | |||
| 1909 | Ga0495629_0406317 | |||
| 1910 | Ga0495638_0019608 | |||
| 1911 | Ga0495638_0148689 | |||
| 1912 | Ga0495638_0200917 | |||
| 1913 | Ga0495641_0348703 | |||
| 1914 | Ga0495651_0267567 | |||
| 1915 | Ga0495653_0373644 | |||
| 1916 | Ga0495580_0010268 | |||
| 1917 | Ga0495580_0037193 | |||
| 1918 | Ga0495580_0059540 | |||
| 1919 | Ga0495582_0006572 | |||
| 1920 | Ga0495582_0025793 | |||
| 1921 | Ga0495582_0107941 | |||
| 1922 | Ga0495582_0187308 | |||
| 1923 | Ga0495605_0194958 | |||
| 1924 | Ga0495639_0000544 | |||
| 1925 | Ga0495639_0703245 | |||
| 1926 | Ga0495662_0042974 | |||
| 1927 | Ga0495664_0063932 | |||
| 1928 | Ga0495664_0077097 | |||
| 1929 | Ga0495585_0032350 | |||
| 1930 | Ga0495585_0037849 | |||
| 1931 | Ga0495585_0341597 | |||
| 1932 | Ga0495585_0355030 | |||
| 1933 | Ga0495585_0388404 | |||
| 1934 | Ga0495594_0026789 | |||
| 1935 | Ga0495594_0154774 | |||
| 1936 | Ga0495594_0198833 | |||
| 1937 | Ga0495596_0066425 | |||
| 1938 | Ga0495606_0253460 | |||
| 1939 | Ga0495606_0551029 | |||
| 1940 | Ga0495608_0143484 | |||
| 1941 | Ga0495610_0144252 | |||
| 1942 | Ga0495610_0249092 | |||
| 1943 | Ga0495610_0337008 | |||
| 1944 | Ga0495616_0269497 | |||
| 1945 | Ga0495618_0430387 | |||
| 1946 | Ga0495620_0088969 | |||
| 1947 | Ga0495630_0026624 | |||
| 1948 | Ga0495630_0029536 | |||
| 1949 | Ga0495631_0067517 | |||
| 1950 | Ga0495631_0191757 | |||
| 1951 | Ga0495631_0215006 | |||
| 1952 | Ga0495631_0284483 | |||
| 1953 | Ga0495631_0307965 | |||
| 1954 | Ga0495632_0136433 | |||
| 1955 | Ga0495632_0227779 | |||
| 1956 | Ga0495644_0073339 | |||
| 1957 | Ga0495663_0081096 | |||
| 1958 | Ga0495666_0051203 | |||
| 1959 | Ga0495666_0502043 | |||
| 1960 | Ga0495652_0111297 | |||
| 1961 | Ga0495652_0465025 | |||
| 1962 | Ga0495665_0007397 | |||
| 1963 | Ga0495665_0155014 | |||
| 1964 | Ga0495665_0208083 | |||
| 1965 | Ga0495640_0002595 | |||
| 1966 | Ga0495640_0853911 | |||
| 1967 | Ga0495586_0111796 | |||
| 1968 | Ga0495587_0035087 | |||
| 1969 | Ga0495598_0383886 | |||
| 1970 | Ga0495609_0135061 | |||
| 1971 | Ga0495609_0318243 | |||
| 1972 | Ga0495597_0086925 | |||
| 1973 | Ga0495645_0228866 | |||
| 1974 | Ga0495645_0466904 | |||
| 1975 | Ga0495645_0617971 | |||
| 1976 | Ga0495645_0750689 | |||
| 1977 | Ga0495622_0012042 | |||
| 1978 | Ga0495622_0064031 | |||
| 1979 | Ga0495633_0267211 | |||
| 1980 | Ga0495667_0154776 | |||
| 1981 | Ga0495667_0785131 | |||
| 1982 | Ga0495656_0026839 | |||
| 1983 | Ga0495656_0052703 | |||
| 1984 | Ga0495656_0179193 | |||
| 1985 | Ga0495668_0077670 | |||
| 1986 | Ga0495668_0085192 | |||
| 1987 | Ga0495668_0249305 | |||
| 1988 | Ga0495668_0255578 | |||
| 1989 | Ga0495668_0282838 | |||
| 1990 | Ga0495634_0290709 | |||
| 1991 | Ga0495611_0072829 | |||
| 1992 | Ga0495611_0121136 | |||
| 1993 | Ga0495611_0316384 | |||
| 1994 | Ga0495625_0183777 | |||
| 1995 | Ga0495625_0433421 | |||
| 1996 | Ga0495625_0484986 | |||
| 1997 | Ga0495625_0590184 | |||
| 1998 | Ga0495635_0000436 | |||
| 1999 | Ga0495635_0070320 | |||
| 2000 | Ga0495635_0402096 | |||
| 2001 | Ga0495659_0060867 | |||
| 2002 | Ga0495661_0085330 | |||
| 2003 | Ga0495661_0326307 | |||
| 2004 | Ga0495588_0013756 | |||
| 2005 | Ga0495657_0827946 | |||
| 2006 | Ga0495599_0138845 | |||
| 2007 | Ga0495599_0400473 | |||
| 2008 | Ga0495599_0891822 | |||
| 2009 | Ga0495623_0599247 | |||
| 2010 | Ga0495646_0078212 | |||
| 2011 | Ga0495647_0474697 | |||
| 2012 | Ga0495658_0375563 | |||
| 2013 | Ga0495669_0000650 | |||
| 2014 | Ga0495669_0125391 | |||
| 2015 | Ga0495669_0252889 | |||
| 2016 | Ga0495669_0608343 | |||
| 2017 | Ga0495613_0013842 | |||
| 2018 | Ga0495624_0023168 | |||
| 2019 | Ga0495624_0044261 | |||
| 2020 | Ga0495624_0312140 | |||
| 2021 | Ga0495670_0044258 | |||
| 2022 | Ga0495670_0187388 | |||
| 2023 | Ga0495670_0245510 | |||
| 2024 | Ga0495670_0341585 | |||
| 2025 | Ga0495649_0070708 | |||
| 2026 | Ga0495649_0220052 | |||
| 2027 | Ga0495649_0505208 | |||
| 2028 | Ga0495649_0565877 | |||
| 2029 | Ga0495589_0051689 | |||
| 2030 | Ga0495589_0116759 | |||
| 2031 | Ga0495589_0258396 | |||
| 2032 | Ga0495581_0282336 | |||
| 2033 | Ga0495604_0323740 | |||
| 2034 | Ga0495636_0041720 | |||
| 2035 | Ga0495674_0008459 | |||
| 2036 | Ga0495674_0213064 | |||
| 2037 | Ga0495674_1290039 | |||
| 2038 | Ga0495672_0043612 | |||
| 2039 | Ga0495672_0079874 | |||
| 2040 | Ga0495672_0516335 | |||
| 2041 | Ga0495676_0192322 | |||
| 2042 | Ga0495676_0210521 | |||
| 2043 | Ga0495676_0306496 | |||
| 2044 | Ga0495683_0402623 | |||
| 2045 | Ga0495685_145900 | |||
| 2046 | Ga0495685_292251 | |||
| 2047 | Ga0495673_0116317 | |||
| 2048 | Ga0495681_0098221 | |||
| 2049 | Ga0495684_0028441 | |||
| 2050 | Ga0495686_0026279 | |||
| 2051 | Ga0495686_0693037 | |||
| 2052 | Ga0495593_0021586 | |||
| 2053 | Ga0495593_0133176 | |||
| 2054 | Ga0495593_0522266 | |||
| 2055 | Ga0495614_0032035 | |||
| 2056 | Ga0495615_0137137 | |||
| 2057 | Ga0496100_0131977 | |||
| 2058 | Ga0496100_0506484 | |||
| 2059 | Ga0496100_1029391 | |||
| 2060 | Ga0496100_1096012 | |||
| 2061 | Ga0496101_0002052 | |||
| 2062 | Ga0496101_0177563 | |||
| 2063 | Ga0496101_0590416 | |||
| 2064 | Ga0496101_0601141 | |||
| 2065 | Ga0496102_0001771 | |||
| 2066 | Ga0496102_0028325 | |||
| 2067 | Ga0496102_0228574 | |||
| 2068 | Ga0496102_0789710 | |||
| 2069 | Ga0496102_1180376 | |||
| 2070 | Ga0496102_1421870 | |||
| 2071 | Ga0496103_0005699 | |||
| 2072 | Ga0496103_0103765 | |||
| 2073 | Ga0496103_0345511 | |||
| 2074 | Ga0496104_0074499 | |||
| 2075 | Ga0496105_0042375 | |||
| 2076 | Ga0496105_0085872 | |||
| 2077 | Ga0496106_0002858 | |||
| 2078 | Ga0496106_0009997 | |||
| 2079 | Ga0496106_0041953 | |||
| 2080 | Ga0496107_0002387 | |||
| 2081 | Ga0496107_0009519 | |||
| 2082 | Ga0496107_0051319 | |||
| 2083 | Ga0496107_0713590 | |||
| 2084 | Ga0496108_0016020 | |||
| 2085 | Ga0496108_0524321 | |||
| 2086 | Ga0496108_0735223 | |||
| 2087 | Ga0496108_0781677 | |||
| 2088 | Ga0496109_0007060 | |||
| 2089 | Ga0496109_0197825 | |||
| 2090 | Ga0496109_0971871 | |||
| 2091 | Ga0496110_0004493 | |||
| 2092 | Ga0496110_0015025 | |||
| 2093 | Ga0496110_0119761 | |||
| 2094 | Ga0496110_0153298 | |||
| 2095 | Ga0496110_0188337 | |||
| 2096 | Ga0496110_0291341 | |||
| 2097 | Ga0496110_0608064 | |||
| 2098 | Ga0496111_0117480 | |||
| 2099 | Ga0496111_0459520 | |||
| 2100 | Ga0496112_0000017 | |||
| 2101 | Ga0496112_0013582 | |||
| 2102 | Ga0496112_0105142 | |||
| 2103 | Ga0496112_0157337 | |||
| 2104 | Ga0496112_0172126 | |||
| 2105 | Ga0496112_0423891 | |||
| 2106 | Ga0496113_0031143 | |||
| 2107 | Ga0496113_0048870 | |||
| 2108 | Ga0496114_0011547 | |||
| 2109 | Ga0496114_0062101 | |||
| 2110 | Ga0496114_0254127 | |||
| 2111 | Ga0496115_0000535 | |||
| 2112 | Ga0496115_0492551 | |||
| 2113 | Ga0496115_1352674 | |||
| 2114 | Ga0496117_0129636 | |||
| 2115 | Ga0496117_0608009 | |||
| 2116 | Ga0496118_0003407 | |||
| 2117 | Ga0496119_0269894 | |||
| 2118 | Ga0496119_0291385 | |||
| 2119 | Ga0496121_0045020 | |||
| 2120 | Ga0496121_0054677 | |||
| 2121 | Ga0496121_0129108 | |||
| 2122 | Ga0496121_0224635 | |||
| 2123 | Ga0496121_0291596 | |||
| 2124 | Ga0496121_0322012 | |||
| 2125 | Ga0496121_0327432 | |||
| 2126 | Ga0496121_0578250 | |||
| 2127 | Ga0496124_0026548 | |||
| 2128 | Ga0496124_0178729 | |||
| 2129 | Ga0496124_0273454 | |||
| 2130 | Ga0496124_0404719 | |||
| 2131 | Ga0496125_0051831 | |||
| 2132 | Ga0496125_0265018 | |||
| 2133 | Ga0496125_0303374 | |||
| 2134 | Ga0496126_0002483 | |||
| 2135 | Ga0496126_0092604 | |||
| 2136 | Ga0496126_0149771 | |||
| 2137 | Ga0496126_0176947 | |||
| 2138 | Ga0496126_0212828 | |||
| 2139 | Ga0496126_0407184 | |||
| 2140 | Ga0496126_0494497 | |||
| 2141 | Ga0496126_0572690 | |||
| 2142 | Ga0496126_0645808 | |||
| 2143 | Ga0496126_0758943 | |||
| 2144 | Ga0495678_115396 | |||
| 2145 | Ga0501031_0008184 | |||
| 2146 | Ga0501032_0000704 | |||
| 2147 | Ga0501033_0000311 | |||
| 2148 | Ga0501034_0000039 | |||
| 2149 | Ga0501036_0000127 | |||
| 2150 | Ga0501037_0000025 | |||
| 2151 | Ga0501038_0000342 | |||
| 2152 | Ga0501039_0000840 | |||
| 2153 | Ga0501042_0026448 | |||
| 2154 | Ga0501043_0000120 | |||
| 2155 | Ga0501046_0000359 | |||
| 2156 | Ga0501046_0048465 | |||
| 2157 | Ga0501047_0000379 | |||
| 2158 | Ga0501047_0084770 | |||
| 2159 | Ga0501047_1343705 | |||
| 2160 | Ga0501048_0000352 | |||
| 2161 | Ga0501067_0000025 | |||
| 2162 | Ga0501068_0001230 | |||
| 2163 | Ga0501069_0007011 | |||
| 2164 | Ga0501069_0175721 | |||
| 2165 | Ga0501070_0002185 | |||
| 2166 | Ga0501070_0042781 | |||
| 2167 | Ga0501071_0244492 | |||
| 2168 | Ga0501072_0002767 | |||
| 2169 | Ga0501072_0624932 | |||
| 2170 | Ga0501073_0000091 | |||
| 2171 | Ga0501073_0258618 | |||
| 2172 | Ga0501074_0000489 | |||
| 2173 | Ga0501074_0025368 | |||
| 2174 | Ga0501076_0228198 | |||
| 2175 | Ga0501076_0842771 | |||
| 2176 | Ga0501079_0006818 | |||
| 2177 | Ga0501080_0000321 | |||
| 2178 | Ga0501080_0026275 | |||
| 2179 | Ga0501083_0000284 | |||
| 2180 | Ga0501035_0001251 | |||
| 2181 | Ga0501035_0423288 | |||
| 2182 | Ga0501044_0000274 | |||
| 2183 | Ga0501044_0144750 | |||
| 2184 | Ga0501045_0005330 | |||
| 2185 | nmdc:mga03683_309151_c1 | |||
| 2186 | nmdc:mga03n38_341479_c1 | |||
| 2187 | nmdc:mga00v17_465059_c1 | |||
| 2188 | nmdc:mga00v17_888245_c1 | |||
| 2189 | nmdc:mga0yw44_535895_c1 | |||
| 2190 | nmdc:mga0yw44_706686_c1 | |||
| 2191 | nmdc:mga0yw44_90407_c1 | |||
| 2192 | nmdc:mga0k408_240358_c1 | |||
| 2193 | nmdc:mga0k408_97231_c1 | |||
| 2194 | nmdc:mga06z11_103107_c1 | |||
| 2195 | nmdc:mga06z11_207023_c1 | |||
| 2196 | nmdc:mga0qj67_501630_c1 | |||
| 2197 | nmdc:mga08y16_916868_c1 | |||
| 2198 | nmdc:mga0n895_1812074_c1 | |||
| 2199 | nmdc:mga0n895_382114_c1 | |||
| 2200 | nmdc:mga0rr50_866533_c1 | |||
| 2201 | nmdc:mga0a205_622660_c1 | |||
| 2202 | nmdc:mga0sz30_308756_c1 | |||
| 2203 | nmdc:mga0sz30_78446_c1 | |||
| 2204 | Ga0495601_0078465 | |||
| 2205 | Ga0495601_0146773 | |||
| 2206 | Ga0495601_0252734 | |||
| 2207 | Ga0495601_0324068 | |||
| 2208 | Ga0495612_0056240 | |||
| 2209 | Ga0495612_0175279 | |||
| 2210 | Ga0495612_0240040 | |||
| 2211 | Ga0495612_0332974 | |||
| 2212 | Ga0495655_0068994 | |||
| 2213 | Ga0495655_0092691 | |||
| 2214 | Ga0495595_0026236 | |||
| 2215 | Ga0495619_0209249 | |||
| 2216 | Ga0495619_0246095 | |||
| 2217 | Ga0500643_051619 | |||
| 2218 | Ga0500646_0022529 | |||
| 2219 | Ga0500646_0071361 | |||
| 2220 | Ga0500583_0072009 | |||
| 2221 | Ga0500583_0333398 | |||
| 2222 | Ga0500651_0670507 | |||
| 2223 | Ga0500566_0000158 | |||
| 2224 | Ga0500566_0078847 | |||
| 2225 | Ga0500566_0201394 | |||
| 2226 | Ga0500640_000568 | |||
| 2227 | Ga0500641_0008502 | |||
| 2228 | Ga0500648_057745 | |||
| 2229 | Ga0500650_0224827 | |||
| 2230 | Ga0500554_007059 | |||
| 2231 | Ga0500562_063291 | |||
| 2232 | Ga0500569_215176 | |||
| 2233 | Ga0500569_306904 | |||
| 2234 | Ga0500572_000024 | |||
| 2235 | Ga0500591_078328 | |||
| 2236 | Ga0500594_0098002 | |||
| 2237 | Ga0500595_001188 | |||
| 2238 | Ga0500608_001300 | |||
| 2239 | Ga0500614_001812 | |||
| 2240 | Ga0500642_0270682 | |||
| 2241 | Ga0500658_0175660 | |||
| 2242 | Ga0500658_0382952 | |||
| 2243 | Ga0500559_0003877 | |||
| 2244 | Ga0500559_0178998 | |||
| 2245 | Ga0500561_0145643 | |||
| 2246 | Ga0500568_0060565 | |||
| 2247 | Ga0500573_0032643 | |||
| 2248 | Ga0500577_0139481 | |||
| 2249 | Ga0500579_188848 | |||
| 2250 | Ga0500588_0401468 | |||
| 2251 | Ga0500589_025035 | |||
| 2252 | Ga0500589_313473 | |||
| 2253 | Ga0500590_122838 | |||
| 2254 | Ga0500590_146250 | |||
| 2255 | Ga0500603_000465 | |||
| 2256 | Ga0500603_000801 | |||
| 2257 | Ga0500603_048017 | |||
| 2258 | Ga0500603_242973 | |||
| 2259 | Ga0500622_0382782 | |||
| 2260 | Ga0500627_0357681 | |||
| 2261 | Ga0500630_000112 | |||
| 2262 | Ga0500634_0081721 | |||
| 2263 | Ga0500638_012135 | |||
| 2264 | Ga0500638_197823 | |||
| 2265 | Ga0500639_000040 | |||
| 2266 | Ga0500636_0086872 | |||
| 2267 | Ga0500636_0184124 | |||
| 2268 | Ga0500637_0039960 | |||
| 2269 | Ga0500637_0108912 | |||
| 2270 | Ga0500609_015774 | |||
| 2271 | Ga0500596_000794 | |||
| 2272 | Ga0500596_005461 | |||
| 2273 | Ga0501084_0007045 | |||
| 2274 | Ga0587076_056219 | |||
| 2275 | Ga0501082_0026885 | |||
| 2276 | 2509149319 | |||
| 2277 | 2513654070 | |||
| 2278 | 2513891271 | |||
| 2279 | 2513918410 | |||
| 2280 | 2517891356 | |||
| 2281 | 2671118864 | |||
| 2282 | 2728750068 | |||
| 2283 | 2793066724 | |||
| 2284 | 2793080652 | |||
| 2285 | 2876814617 | |||
| 2286 | 2879114698 | |||
| 2287 | 2885374989 | |||
| 2288 | 2889038035 | |||
| 2289 | 2903755317 | |||
| 2290 | 2904691224 | |||
| 2291 | 2904701310 | |||
| 2292 | 2906616542 | |||
| 2293 | 2908741710 | |||
| 2294 | 2908759135 | |||
| 2295 | 2922387369 | |||
| 2296 | 2922431438 | |||
| 2297 | 2935634034 | |||
| 2298 | 2941510663 | |||
| 2299 | 2941518047 | |||
| 2300 | 2941527082 | |||
| 2301 | 3005481231 | |||
| 2302 | 8006939478 | |||
| 2303 | 8006972136 | |||
| 2304 | 8006979228 | |||
| 2305 | 8006984409 | |||
| 2306 | 8019565358 | |||
| 2307 | 8019575456 | |||
| 2308 | 8056681087 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1otg-assembly1.cif.gz_C | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.8107 | 3 | 125 |
| 4jj9-assembly1.cif.gz_B | crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase | 0.806 | 1 | 125 |
| 1otg-assembly1.cif.gz_C | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.7933 | 3 | 125 |
| 4jcu-assembly1.cif.gz_A | crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from deinococcus radiodurans r1 | 0.7876 | 2 | 125 |
| 4jj9-assembly1.cif.gz_B | crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase | 0.7616 | 1 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1otgC00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.8107 | 3 | 125 | 3.30.429.10 |
| 1otgC00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.7933 | 3 | 125 | 3.30.429.10 |
| 4jcuB00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.7918 | 2 | 123 | 3.30.429.10 |
| 4jj9C00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.7803 | 2 | 125 | 3.30.429.10 |
| 4jcuB00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.7535 | 2 | 123 | 3.30.429.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1ELA3-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.915 | 1 | 64 |
GO:0008704
GO:0009056 |
| AF-A0A3D0KT17-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.9115 | 1 | 64 |
GO:0008704
GO:0009056 |
| AF-A0A529P083-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.8975 | 1 | 108 |
GO:0008704
GO:0009056 |
| AF-A0A529P563-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.8901 | 1 | 72 |
GO:0008704
GO:0009056 |
| AF-A0A3D1DZK3-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.8858 | 1 | 108 |
GO:0008704
GO:0009056 |