F490903
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1154 | 447 | 2308 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300025230|Ga0209563_108032|Ga0209563_1080322 |
| Length | 264 |
| Sequence | MTTEMNLQNDPLDGVTTRCHRLLLTGAAGNLGKVLRERLPKYADSLRLSDISNLGEARPGEEIAPCNLADAHAVDALVAGTDAIVHLGGVYNLYEAARRHGVRRVVFASSNHTIGFYKQGEVIDSTVPTKPDGYYGLSKVFGEQLASFYFDRYGIETVAIRIGSSFAEAKDRRMLITWLGYDDLEQLVRRALFVPGVGFTVVYGMSNNRDRWWDNRHAAHLGYQPTQTSEIFRAQVEAQPPLPADDPAALYQGGAFVKAGPFGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 37 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 38 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 39 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 42 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 57 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 62 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 94 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 103 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 107 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 108 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 109 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 114 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 118 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 119 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 120 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 121 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 124 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 125 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 126 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 127 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 128 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 130 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 131 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 132 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 133 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 134 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 135 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 136 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 137 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 138 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 139 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 140 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 141 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 142 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 143 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 144 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 145 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 146 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 147 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 148 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 149 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 150 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 151 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 152 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 153 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 154 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 155 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 156 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 157 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 248 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 249 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 250 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 251 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 252 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 253 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 254 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 269 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 270 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 271 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 272 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 273 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 274 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 275 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 276 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 277 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 278 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 279 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 280 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 281 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 282 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 283 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 284 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 285 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 286 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 287 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 288 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 289 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 290 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 291 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 292 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 293 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 294 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 295 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 296 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 297 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 298 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 299 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 300 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 301 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 302 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 303 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 304 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 305 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 306 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 307 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 308 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 309 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 310 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 311 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 312 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 313 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 314 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 315 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 316 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 317 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 318 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 319 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 320 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 321 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 322 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 323 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 324 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 325 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 326 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 327 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 328 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 329 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 330 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 331 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 332 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 333 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 334 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 335 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 336 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 337 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 338 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 339 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 340 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 341 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 342 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 343 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 344 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 345 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 346 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 347 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 348 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 349 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 350 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 351 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 352 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 353 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 354 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 355 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 356 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 357 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 358 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 359 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 360 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 361 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 362 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 363 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 364 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 365 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 366 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 367 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 368 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 369 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 370 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 371 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 372 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 373 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 374 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 375 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 376 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 377 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 378 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 379 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 380 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 381 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 382 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 383 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 384 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 385 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 386 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 387 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 388 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 389 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 390 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 391 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 392 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 393 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 394 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 395 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 396 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 397 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 398 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 399 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 400 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 401 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 402 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 403 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 404 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 405 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 406 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 407 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 408 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 409 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 410 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 411 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 412 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 413 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 414 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 415 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 416 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 417 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 418 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 419 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 420 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 421 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 422 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 423 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 424 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 425 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 426 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 427 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 428 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 429 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 430 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 431 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 432 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 433 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 434 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 435 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 436 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 437 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 438 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 439 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 440 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 441 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 442 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 443 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 444 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 445 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 446 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 447 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.58 |
| Metatranscriptomes | 0.09 |
| Isolates | 15.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 4.59 |
| Nodule | 1.65 |
| Rhizoplane | 4.68 |
| Rhizosphere | 76.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209563_108032 | 3300025230 | Bacteria | 1690 |
| 2 | MRS2a_Contig_32 | 2124908027 | Bacteria | 30020 |
| 3 | SwRhRL2b_contig_2563440 | 2162886007 | Bacteria | 1237 |
| 4 | JGI24741J21665_1006214 | 3300001915 | Bacteria | 2421 |
| 5 | JGI24740J21852_10000535 | 3300001979 | Bacteria | 16218 |
| 6 | JGI25156J39149_1002050 | 3300002705 | Bacteria | 7668 |
| 7 | JGI25154J39366_1000525 | 3300002738 | Bacteria | 19260 |
| 8 | Ga0055538_1003308 | 3300003751 | Bacteria | 2081 |
| 9 | Ga0055538_1003844 | 3300003751 | Bacteria | 1815 |
| 10 | Ga0055539_1000101 | 3300003752 | Bacteria | 99892 |
| 11 | Ga0055533_1000318 | 3300003756 | Bacteria | 22651 |
| 12 | Ga0055532_1000037 | 3300003758 | Bacteria | 205054 |
| 13 | Ga0055525_1000503 | 3300003759 | Bacteria | 19614 |
| 14 | Ga0055527_1001383 | 3300003760 | Bacteria | 5166 |
| 15 | Ga0055535_1000018 | 3300003761 | Bacteria | 243804 |
| 16 | Ga0055529_1000041 | 3300003763 | Bacteria | 226495 |
| 17 | Ga0055536_1000247 | 3300003781 | Bacteria | 42902 |
| 18 | Ga0055536_1000894 | 3300003781 | Bacteria | 19371 |
| 19 | Ga0055530_10000109 | 3300003791 | Bacteria | 71091 |
| 20 | Ga0055530_10001177 | 3300003791 | Bacteria | 20222 |
| 21 | Ga0055540_1000266 | 3300003792 | Bacteria | 47224 |
| 22 | Ga0055540_1005232 | 3300003792 | Bacteria | 5543 |
| 23 | Ga0055531_10000377 | 3300003794 | Bacteria | 43036 |
| 24 | Ga0055541_1000755 | 3300003841 | Bacteria | 8216 |
| 25 | Ga0065714_10000449 | 3300005288 | Bacteria | 4623 |
| 26 | Ga0065714_10004001 | 3300005288 | Bacteria | 7785 |
| 27 | Ga0065714_10006530 | 3300005288 | Bacteria | 4474 |
| 28 | Ga0065714_10011686 | 3300005288 | Bacteria | 2031 |
| 29 | Ga0065714_10066152 | 3300005288 | Bacteria | 7482 |
| 30 | Ga0065714_10066673 | 3300005288 | Bacteria | 6485 |
| 31 | Ga0065714_10067016 | 3300005288 | Bacteria | 5998 |
| 32 | Ga0065714_10072537 | 3300005288 | Bacteria | 3350 |
| 33 | Ga0065714_10073979 | 3300005288 | Bacteria | 3098 |
| 34 | Ga0065714_10076940 | 3300005288 | Bacteria | 2739 |
| 35 | Ga0065712_10006549 | 3300005290 | Bacteria | 2588 |
| 36 | Ga0065712_10068058 | 3300005290 | Bacteria | 15710 |
| 37 | Ga0065715_10016357 | 3300005293 | Bacteria | 3171 |
| 38 | Ga0070670_100000303 | 3300005331 | Bacteria | 42489 |
| 39 | Ga0070661_100001702 | 3300005344 | Bacteria | 15240 |
| 40 | Ga0070669_100000891 | 3300005353 | Bacteria | 21725 |
| 41 | Ga0070669_100125333 | 3300005353 | Bacteria | 1965 |
| 42 | Ga0070663_100000049 | 3300005455 | Bacteria | 52979 |
| 43 | Ga0070662_100129808 | 3300005457 | Bacteria | 1942 |
| 44 | Ga0068867_100350196 | 3300005459 | Bacteria | 1232 |
| 45 | Ga0070665_100037155 | 3300005548 | Bacteria | 4898 |
| 46 | Ga0070664_100000026 | 3300005564 | Bacteria | 92731 |
| 47 | Ga0070664_100572612 | 3300005564 | Bacteria | 1046 |
| 48 | Ga0068857_100024830 | 3300005577 | Bacteria | 5278 |
| 49 | Ga0068854_100000041 | 3300005578 | Bacteria | 93231 |
| 50 | Ga0068854_100067887 | 3300005578 | Bacteria | 2599 |
| 51 | Ga0068856_100000643 | 3300005614 | Bacteria | 37835 |
| 52 | Ga0068851_10000132 | 3300005834 | Bacteria | 40261 |
| 53 | Ga0075432_10000427 | 3300006058 | Bacteria | 12312 |
| 54 | Ga0075432_10019531 | 3300006058 | Bacteria | 2316 |
| 55 | Ga0075432_10035610 | 3300006058 | Bacteria | 1729 |
| 56 | Ga0075362_10011019 | 3300006177 | Bacteria | 3550 |
| 57 | Ga0075436_100090954 | 3300006914 | Bacteria | 2121 |
| 58 | Ga0099823_1003243 | 3300006944 | Bacteria | 15281 |
| 59 | Ga0079104_1000988 | 3300006946 | Bacteria | 22111 |
| 60 | Ga0079104_1001530 | 3300006946 | Bacteria | 15279 |
| 61 | Ga0099826_10050724 | 3300006948 | Bacteria | 2789 |
| 62 | Ga0105251_10000142 | 3300009011 | Bacteria | 73498 |
| 63 | Ga0105251_10000764 | 3300009011 | Bacteria | 29257 |
| 64 | Ga0105251_10001353 | 3300009011 | Bacteria | 21185 |
| 65 | Ga0105251_10001616 | 3300009011 | Bacteria | 19144 |
| 66 | Ga0105251_10004886 | 3300009011 | Bacteria | 8946 |
| 67 | Ga0105251_10005941 | 3300009011 | Bacteria | 7883 |
| 68 | Ga0105251_10006325 | 3300009011 | Bacteria | 7573 |
| 69 | Ga0105251_10015235 | 3300009011 | Bacteria | 4213 |
| 70 | Ga0105251_10017095 | 3300009011 | Bacteria | 3896 |
| 71 | Ga0105251_10034303 | 3300009011 | Bacteria | 2512 |
| 72 | Ga0105251_10157321 | 3300009011 | Bacteria | 1025 |
| 73 | Ga0105244_10002677 | 3300009036 | Bacteria | 13327 |
| 74 | Ga0105244_10005092 | 3300009036 | Bacteria | 8829 |
| 75 | Ga0105244_10007642 | 3300009036 | Bacteria | 6851 |
| 76 | Ga0105244_10041855 | 3300009036 | Bacteria | 2373 |
| 77 | Ga0105244_10041892 | 3300009036 | Bacteria | 2371 |
| 78 | Ga0105244_10062634 | 3300009036 | Bacteria | 1870 |
| 79 | Ga0105244_10113695 | 3300009036 | Bacteria | 1315 |
| 80 | Ga0105244_10199567 | 3300009036 | Bacteria | 943 |
| 81 | Ga0105250_10000222 | 3300009092 | Bacteria | 47479 |
| 82 | Ga0105250_10000591 | 3300009092 | Bacteria | 23712 |
| 83 | Ga0105250_10005506 | 3300009092 | Bacteria | 5670 |
| 84 | Ga0105250_10012609 | 3300009092 | Bacteria | 3486 |
| 85 | Ga0105250_10028150 | 3300009092 | Bacteria | 2263 |
| 86 | Ga0105250_10039270 | 3300009092 | Bacteria | 1898 |
| 87 | Ga0105250_10076759 | 3300009092 | Bacteria | 1352 |
| 88 | Ga0105250_10077354 | 3300009092 | Bacteria | 1347 |
| 89 | Ga0105240_10110436 | 3300009093 | Bacteria | 3328 |
| 90 | Ga0105240_10306171 | 3300009093 | Bacteria | 1816 |
| 91 | Ga0105243_10007662 | 3300009148 | Bacteria | 8295 |
| 92 | Ga0105243_10033843 | 3300009148 | Bacteria | 3952 |
| 93 | Ga0105243_10069274 | 3300009148 | Bacteria | 2845 |
| 94 | Ga0105246_10007319 | 3300011119 | Bacteria | 6762 |
| 95 | Ga0105246_10025303 | 3300011119 | Bacteria | 3868 |
| 96 | Ga0105246_10064538 | 3300011119 | Bacteria | 2558 |
| 97 | Ga0157345_1000073 | 3300012498 | Bacteria | 20810 |
| 98 | Ga0157373_10000784 | 3300013100 | Bacteria | 24454 |
| 99 | Ga0157373_10002739 | 3300013100 | Bacteria | 13345 |
| 100 | Ga0157373_10003218 | 3300013100 | Bacteria | 12353 |
| 101 | Ga0157373_10010953 | 3300013100 | Bacteria | 6676 |
| 102 | Ga0157373_10018633 | 3300013100 | Bacteria | 5052 |
| 103 | Ga0157373_10021507 | 3300013100 | Bacteria | 4685 |
| 104 | Ga0157373_10235796 | 3300013100 | Bacteria | 1293 |
| 105 | Ga0157371_10000045 | 3300013102 | Bacteria | 189065 |
| 106 | Ga0157371_10000179 | 3300013102 | Bacteria | 92737 |
| 107 | Ga0157371_10000771 | 3300013102 | Bacteria | 36847 |
| 108 | Ga0157371_10004944 | 3300013102 | Bacteria | 11447 |
| 109 | Ga0157370_10000138 | 3300013104 | Bacteria | 87858 |
| 110 | Ga0157370_10000739 | 3300013104 | Bacteria | 41080 |
| 111 | Ga0157370_10031156 | 3300013104 | Bacteria | 5219 |
| 112 | Ga0157370_10148876 | 3300013104 | Bacteria | 2179 |
| 113 | Ga0157370_10314431 | 3300013104 | Bacteria | 1445 |
| 114 | Ga0157369_10003070 | 3300013105 | Bacteria | 19938 |
| 115 | Ga0157369_10005262 | 3300013105 | Bacteria | 15083 |
| 116 | Ga0157369_10008823 | 3300013105 | Bacteria | 11550 |
| 117 | Ga0157369_10013465 | 3300013105 | Bacteria | 9244 |
| 118 | Ga0157369_10014027 | 3300013105 | Bacteria | 9052 |
| 119 | Ga0157369_10029097 | 3300013105 | Bacteria | 6107 |
| 120 | Ga0157369_10039474 | 3300013105 | Bacteria | 5158 |
| 121 | Ga0157369_10886012 | 3300013105 | Bacteria | 915 |
| 122 | Ga0163162_10001648 | 3300013306 | Bacteria | 20922 |
| 123 | Ga0163162_10085776 | 3300013306 | Bacteria | 3226 |
| 124 | Ga0163162_10180117 | 3300013306 | Bacteria | 2239 |
| 125 | Ga0157372_10000208 | 3300013307 | Bacteria | 65462 |
| 126 | Ga0157372_10011491 | 3300013307 | Bacteria | 9416 |
| 127 | Ga0157372_10093397 | 3300013307 | Bacteria | 3424 |
| 128 | Ga0157375_10001567 | 3300013308 | Bacteria | 19698 |
| 129 | Ga0157375_10150438 | 3300013308 | Bacteria | 2463 |
| 130 | Ga0157375_10791974 | 3300013308 | Bacteria | 1097 |
| 131 | Ga0182008_10000604 | 3300014497 | Bacteria | 26387 |
| 132 | Ga0182008_10003368 | 3300014497 | Bacteria | 9697 |
| 133 | Ga0182008_10008636 | 3300014497 | Bacteria | 5547 |
| 134 | Ga0182008_10009680 | 3300014497 | Bacteria | 5190 |
| 135 | Ga0182008_10010072 | 3300014497 | Bacteria | 5071 |
| 136 | Ga0182008_10010543 | 3300014497 | Bacteria | 4944 |
| 137 | Ga0182008_10010727 | 3300014497 | Bacteria | 4896 |
| 138 | Ga0182008_10026810 | 3300014497 | Bacteria | 2921 |
| 139 | Ga0182008_10069389 | 3300014497 | Bacteria | 1734 |
| 140 | Ga0182006_1000809 | 3300015261 | Bacteria | 20945 |
| 141 | Ga0182006_1000954 | 3300015261 | Bacteria | 19207 |
| 142 | Ga0182006_1001855 | 3300015261 | Bacteria | 12119 |
| 143 | Ga0182006_1005517 | 3300015261 | Bacteria | 6010 |
| 144 | Ga0182006_1006102 | 3300015261 | Bacteria | 5635 |
| 145 | Ga0182006_1047866 | 3300015261 | Bacteria | 1655 |
| 146 | Ga0182006_1058175 | 3300015261 | Bacteria | 1467 |
| 147 | Ga0182006_1101684 | 3300015261 | Bacteria | 1019 |
| 148 | Ga0182007_10001820 | 3300015262 | Bacteria | 11128 |
| 149 | Ga0182007_10007985 | 3300015262 | Bacteria | 4382 |
| 150 | Ga0182005_1001427 | 3300015265 | Bacteria | 9634 |
| 151 | Ga0182005_1037794 | 3300015265 | Bacteria | 1313 |
| 152 | Ga0182005_1037815 | 3300015265 | Bacteria | 1313 |
| 153 | Ga0163161_10001925 | 3300017792 | Bacteria | 15153 |
| 154 | Ga0163161_10004304 | 3300017792 | Bacteria | 9914 |
| 155 | Ga0163161_10005239 | 3300017792 | Bacteria | 9021 |
| 156 | Ga0163161_10022110 | 3300017792 | Bacteria | 4476 |
| 157 | Ga0163161_10025470 | 3300017792 | Bacteria | 4186 |
| 158 | Ga0163161_10030774 | 3300017792 | Bacteria | 3822 |
| 159 | Ga0163161_10044999 | 3300017792 | Bacteria | 3181 |
| 160 | Ga0163161_10071559 | 3300017792 | Bacteria | 2538 |
| 161 | Ga0163161_10105864 | 3300017792 | Bacteria | 2098 |
| 162 | Ga0154015_1488054 | 3300020610 | Bacteria | 10989 |
| 163 | Ga0209784_100070 | 3300025224 | Bacteria | 152262 |
| 164 | Ga0209784_100427 | 3300025224 | Bacteria | 18383 |
| 165 | Ga0209566_100084 | 3300025225 | Bacteria | 152262 |
| 166 | Ga0209566_100360 | 3300025225 | Bacteria | 38280 |
| 167 | Ga0209566_100933 | 3300025225 | Bacteria | 13366 |
| 168 | Ga0209674_100089 | 3300025226 | Bacteria | 178751 |
| 169 | Ga0209674_100138 | 3300025226 | Bacteria | 110735 |
| 170 | Ga0209672_100184 | 3300025228 | Bacteria | 50560 |
| 171 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 172 | Ga0209563_100102 | 3300025230 | Bacteria | 152262 |
| 173 | Ga0209563_108295 | 3300025230 | Bacteria | 1646 |
| 174 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 175 | Ga0209646_1000065 | 3300025246 | Bacteria | 245452 |
| 176 | Ga0209026_1005899 | 3300025250 | Bacteria | 3146 |
| 177 | Ga0209677_100062 | 3300025253 | Bacteria | 152262 |
| 178 | Ga0209677_104761 | 3300025253 | Bacteria | 3787 |
| 179 | Ga0209148_1000406 | 3300025254 | Bacteria | 49910 |
| 180 | Ga0209759_1001726 | 3300025256 | Bacteria | 11278 |
| 181 | Ga0209759_1004618 | 3300025256 | Bacteria | 5068 |
| 182 | Ga0209759_1006419 | 3300025256 | Bacteria | 3950 |
| 183 | Ga0209759_1019596 | 3300025256 | Bacteria | 1598 |
| 184 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 185 | Ga0209675_1010692 | 3300025291 | Bacteria | 3109 |
| 186 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 187 | Ga0209676_1000154 | 3300025292 | Bacteria | 166013 |
| 188 | Ga0209676_1004916 | 3300025292 | Bacteria | 7194 |
| 189 | Ga0209676_1008386 | 3300025292 | Bacteria | 4618 |
| 190 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 191 | Ga0209050_1000043 | 3300025298 | Bacteria | 398654 |
| 192 | Ga0209050_1000914 | 3300025298 | Bacteria | 38994 |
| 193 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 194 | Ga0209051_1000030 | 3300025303 | Bacteria | 398654 |
| 195 | Ga0209051_1002770 | 3300025303 | Bacteria | 12099 |
| 196 | Ga0209257_1000056 | 3300025304 | Bacteria | 403132 |
| 197 | Ga0209257_1016129 | 3300025304 | Bacteria | 3047 |
| 198 | Ga0207656_10000880 | 3300025321 | Bacteria | 9793 |
| 199 | Ga0207696_1000010 | 3300025711 | Bacteria | 534681 |
| 200 | Ga0207696_1000051 | 3300025711 | Bacteria | 276833 |
| 201 | Ga0207696_1000108 | 3300025711 | Bacteria | 157445 |
| 202 | Ga0207696_1000265 | 3300025711 | Bacteria | 66603 |
| 203 | Ga0207696_1001374 | 3300025711 | Bacteria | 13327 |
| 204 | Ga0207696_1006716 | 3300025711 | Bacteria | 4596 |
| 205 | Ga0207696_1038370 | 3300025711 | Bacteria | 1414 |
| 206 | Ga0207696_1047092 | 3300025711 | Bacteria | 1243 |
| 207 | Ga0207655_1000019 | 3300025728 | Bacteria | 536324 |
| 208 | Ga0207655_1001198 | 3300025728 | Bacteria | 25016 |
| 209 | Ga0207655_1001270 | 3300025728 | Bacteria | 24082 |
| 210 | Ga0207655_1001582 | 3300025728 | Bacteria | 20417 |
| 211 | Ga0207655_1001647 | 3300025728 | Bacteria | 19807 |
| 212 | Ga0207655_1002884 | 3300025728 | Bacteria | 13273 |
| 213 | Ga0207655_1002917 | 3300025728 | Bacteria | 13164 |
| 214 | Ga0207655_1008179 | 3300025728 | Bacteria | 6679 |
| 215 | Ga0207655_1009176 | 3300025728 | Bacteria | 6178 |
| 216 | Ga0207655_1009230 | 3300025728 | Bacteria | 6153 |
| 217 | Ga0207655_1011568 | 3300025728 | Bacteria | 5241 |
| 218 | Ga0207655_1038289 | 3300025728 | Bacteria | 2099 |
| 219 | Ga0207655_1071165 | 3300025728 | Bacteria | 1292 |
| 220 | Ga0207713_1000149 | 3300025735 | Bacteria | 105256 |
| 221 | Ga0207713_1000200 | 3300025735 | Bacteria | 82983 |
| 222 | Ga0207713_1000238 | 3300025735 | Bacteria | 73507 |
| 223 | Ga0207713_1001649 | 3300025735 | Bacteria | 17338 |
| 224 | Ga0207713_1002121 | 3300025735 | Bacteria | 14783 |
| 225 | Ga0207713_1002307 | 3300025735 | Bacteria | 14027 |
| 226 | Ga0207713_1004491 | 3300025735 | Bacteria | 9035 |
| 227 | Ga0207713_1007231 | 3300025735 | Bacteria | 6598 |
| 228 | Ga0207713_1007490 | 3300025735 | Bacteria | 6432 |
| 229 | Ga0207713_1007593 | 3300025735 | Bacteria | 6363 |
| 230 | Ga0207713_1008034 | 3300025735 | Bacteria | 6132 |
| 231 | Ga0207713_1009056 | 3300025735 | Bacteria | 5654 |
| 232 | Ga0207713_1014335 | 3300025735 | Bacteria | 4125 |
| 233 | Ga0207713_1018709 | 3300025735 | Bacteria | 3420 |
| 234 | Ga0207713_1023644 | 3300025735 | Bacteria | 2887 |
| 235 | Ga0207713_1024600 | 3300025735 | Bacteria | 2804 |
| 236 | Ga0207713_1027244 | 3300025735 | Bacteria | 2600 |
| 237 | Ga0207713_1035172 | 3300025735 | Bacteria | 2165 |
| 238 | Ga0207713_1041561 | 3300025735 | Bacteria | 1917 |
| 239 | Ga0207713_1105912 | 3300025735 | Bacteria | 963 |
| 240 | Ga0207695_10001731 | 3300025913 | Bacteria | 34763 |
| 241 | Ga0207649_10000174 | 3300025920 | Bacteria | 52719 |
| 242 | Ga0207681_10004855 | 3300025923 | Bacteria | 8261 |
| 243 | Ga0207681_10043998 | 3300025923 | Bacteria | 2991 |
| 244 | Ga0207681_10091864 | 3300025923 | Bacteria | 2169 |
| 245 | Ga0207650_10000068 | 3300025925 | Bacteria | 139947 |
| 246 | Ga0207709_10016517 | 3300025935 | Bacteria | 4104 |
| 247 | Ga0207709_10043733 | 3300025935 | Bacteria | 2702 |
| 248 | Ga0207709_10044206 | 3300025935 | Bacteria | 2690 |
| 249 | Ga0207709_10083853 | 3300025935 | Bacteria | 2062 |
| 250 | Ga0207679_10000048 | 3300025945 | Bacteria | 119671 |
| 251 | Ga0207679_10295484 | 3300025945 | Bacteria | 1394 |
| 252 | Ga0207640_10000056 | 3300025981 | Bacteria | 94316 |
| 253 | Ga0207678_10000044 | 3300026067 | Bacteria | 92689 |
| 254 | Ga0207702_10000118 | 3300026078 | Bacteria | 92740 |
| 255 | Ga0207674_10048848 | 3300026116 | Bacteria | 4329 |
| 256 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 257 | Ga0209281_1000063 | 3300027111 | Bacteria | 288465 |
| 258 | Ga0209973_1001498 | 3300027252 | Bacteria | 2051 |
| 259 | Ga0209389_1001081 | 3300027296 | Bacteria | 18349 |
| 260 | Ga0209371_1000197 | 3300027312 | Bacteria | 88691 |
| 261 | Ga0209371_1000902 | 3300027312 | Bacteria | 23596 |
| 262 | Ga0209371_1009273 | 3300027312 | Bacteria | 3142 |
| 263 | Ga0209996_1001394 | 3300027395 | Bacteria | 2900 |
| 264 | Ga0209995_1002594 | 3300027471 | Bacteria | 2857 |
| 265 | Ga0209982_1005552 | 3300027552 | Bacteria | 1823 |
| 266 | Ga0210002_1014919 | 3300027617 | Bacteria | 1222 |
| 267 | Ga0209983_1002786 | 3300027665 | Bacteria | 3784 |
| 268 | Ga0209282_1101942 | 3300027666 | Bacteria | 1476 |
| 269 | Ga0209971_1011095 | 3300027682 | Bacteria | 2133 |
| 270 | Ga0207428_10032617 | 3300027907 | Bacteria | 4282 |
| 271 | Ga0207428_10041705 | 3300027907 | Bacteria | 3714 |
| 272 | Ga0207428_10141486 | 3300027907 | Bacteria | 1836 |
| 273 | Ga0207428_10162073 | 3300027907 | Bacteria | 1698 |
| 274 | Ga0207428_10169050 | 3300027907 | Bacteria | 1657 |
| 275 | Ga0268256_1000147 | 3300030500 | Bacteria | 94888 |
| 276 | Ga0268256_1000787 | 3300030500 | Bacteria | 22884 |
| 277 | Ga0268256_1009813 | 3300030500 | Bacteria | 3142 |
| 278 | Ga0307511_10176658 | 3300030521 | Bacteria | 1160 |
| 279 | Ga0314311_1022032 | 3300030733 | Bacteria | 4470 |
| 280 | Ga0316183_1179864 | 3300030742 | Bacteria | 1458 |
| 281 | Ga0265340_10092417 | 3300031247 | Bacteria | 1413 |
| 282 | Ga0307408_100000047 | 3300031548 | Bacteria | 166310 |
| 283 | Ga0307408_100130226 | 3300031548 | Bacteria | 1961 |
| 284 | Ga0307408_100148058 | 3300031548 | Bacteria | 1850 |
| 285 | Ga0307405_10008864 | 3300031731 | Bacteria | 5128 |
| 286 | Ga0307405_10167451 | 3300031731 | Bacteria | 1563 |
| 287 | Ga0307413_10034348 | 3300031824 | Bacteria | 2897 |
| 288 | Ga0307406_10068256 | 3300031901 | Bacteria | 2320 |
| 289 | Ga0307407_10028595 | 3300031903 | Bacteria | 2982 |
| 290 | Ga0307412_10041266 | 3300031911 | Bacteria | 2989 |
| 291 | Ga0307409_100064165 | 3300031995 | Bacteria | 2884 |
| 292 | Ga0307409_100570942 | 3300031995 | Bacteria | 1113 |
| 293 | Ga0307414_10039706 | 3300032004 | Bacteria | 3172 |
| 294 | Ga0307414_10048973 | 3300032004 | Bacteria | 2919 |
| 295 | Ga0307414_10083382 | 3300032004 | Bacteria | 2347 |
| 296 | Ga0307414_10202898 | 3300032004 | Bacteria | 1614 |
| 297 | Ga0307414_10274990 | 3300032004 | Bacteria | 1412 |
| 298 | Ga0307411_10008071 | 3300032005 | Bacteria | 5425 |
| 299 | Ga0307411_10022756 | 3300032005 | Bacteria | 3697 |
| 300 | Ga0307510_10002555 | 3300033180 | Bacteria | 20744 |
| 301 | Ga0395899_0117586 | 3300037312 | Bacteria | 1907 |
| 302 | Ga0395900_0044647 | 3300037418 | Bacteria | 4565 |
| 303 | Ga0395905_0014134 | 3300037471 | Bacteria | 7628 |
| 304 | Ga0395905_0210485 | 3300037471 | Bacteria | 1822 |
| 305 | Ga0436361_1135527 | 3300039447 | Bacteria | 1099 |
| 306 | Ga0439438_000615 | 3300041405 | Bacteria | 16046 |
| 307 | Ga0439438_000928 | 3300041405 | Bacteria | 13077 |
| 308 | Ga0439438_001187 | 3300041405 | Bacteria | 11574 |
| 309 | Ga0439438_002024 | 3300041405 | Bacteria | 8823 |
| 310 | Ga0439438_004018 | 3300041405 | Bacteria | 5777 |
| 311 | Ga0439438_015509 | 3300041405 | Bacteria | 2240 |
| 312 | Ga0439438_027492 | 3300041405 | Bacteria | 1534 |
| 313 | Ga0439447_001974 | 3300041407 | Bacteria | 7528 |
| 314 | Ga0439447_002212 | 3300041407 | Bacteria | 7135 |
| 315 | Ga0439447_008653 | 3300041407 | Bacteria | 3139 |
| 316 | Ga0439447_020151 | 3300041407 | Bacteria | 1772 |
| 317 | Ga0439466_0002396 | 3300041411 | Bacteria | 7348 |
| 318 | Ga0439466_0007235 | 3300041411 | Bacteria | 4200 |
| 319 | Ga0439466_0010817 | 3300041411 | Bacteria | 3387 |
| 320 | Ga0439466_0015700 | 3300041411 | Bacteria | 2750 |
| 321 | Ga0439466_0025868 | 3300041411 | Bacteria | 2045 |
| 322 | Ga0439466_0029082 | 3300041411 | Bacteria | 1903 |
| 323 | Ga0439466_0047293 | 3300041411 | Bacteria | 1418 |
| 324 | Ga0439465_0020028 | 3300041413 | Bacteria | 2093 |
| 325 | Ga0439465_0057772 | 3300041413 | Bacteria | 1281 |
| 326 | Ga0451807_2340530 | 3300041486 | Bacteria | 1060 |
| 327 | Ga0439431_0034920 | 3300041997 | Bacteria | 1262 |
| 328 | Ga0439437_002809 | 3300042000 | Bacteria | 1871 |
| 329 | Ga0439443_007442 | 3300042003 | Bacteria | 1524 |
| 330 | Ga0439432_001132 | 3300042006 | Bacteria | 10119 |
| 331 | Ga0439432_001155 | 3300042006 | Bacteria | 10004 |
| 332 | Ga0439432_006138 | 3300042006 | Bacteria | 4303 |
| 333 | Ga0439432_007800 | 3300042006 | Bacteria | 3775 |
| 334 | Ga0439432_009132 | 3300042006 | Bacteria | 3462 |
| 335 | Ga0439432_014770 | 3300042006 | Bacteria | 2640 |
| 336 | Ga0439451_005611 | 3300042009 | Bacteria | 2562 |
| 337 | Ga0439451_007418 | 3300042009 | Bacteria | 2236 |
| 338 | Ga0439452_000566 | 3300042010 | Bacteria | 19317 |
| 339 | Ga0439452_000615 | 3300042010 | Bacteria | 18019 |
| 340 | Ga0439452_000627 | 3300042010 | Bacteria | 17820 |
| 341 | Ga0439452_002651 | 3300042010 | Bacteria | 6513 |
| 342 | Ga0439455_0005693 | 3300042012 | Bacteria | 2545 |
| 343 | Ga0439456_005749 | 3300042013 | Bacteria | 2521 |
| 344 | Ga0439456_008546 | 3300042013 | Bacteria | 2115 |
| 345 | Ga0439456_012595 | 3300042013 | Bacteria | 1754 |
| 346 | Ga0439463_000880 | 3300042016 | Bacteria | 8276 |
| 347 | Ga0439463_001779 | 3300042016 | Bacteria | 5607 |
| 348 | Ga0439463_020849 | 3300042016 | Bacteria | 1636 |
| 349 | Ga0450911_000024 | 3300042115 | Bacteria | 84076 |
| 350 | Ga0450911_000304 | 3300042115 | Bacteria | 17754 |
| 351 | Ga0450911_002917 | 3300042115 | Bacteria | 3172 |
| 352 | Ga0450911_003017 | 3300042115 | Bacteria | 3092 |
| 353 | Ga0450911_016993 | 3300042115 | Bacteria | 960 |
| 354 | Ga0450890_002596 | 3300042127 | Bacteria | 2464 |
| 355 | Ga0450900_003696 | 3300042136 | Bacteria | 1713 |
| 356 | Ga0450900_004241 | 3300042136 | Bacteria | 1640 |
| 357 | Ga0450903_002054 | 3300042138 | Bacteria | 3624 |
| 358 | Ga0450903_002641 | 3300042138 | Bacteria | 3159 |
| 359 | Ga0450903_010363 | 3300042138 | Bacteria | 1509 |
| 360 | Ga0450904_003779 | 3300042139 | Bacteria | 1612 |
| 361 | Ga0450905_000822 | 3300042142 | Bacteria | 3855 |
| 362 | Ga0450905_009341 | 3300042142 | Bacteria | 1349 |
| 363 | Ga0450906_005981 | 3300042145 | Bacteria | 2476 |
| 364 | Ga0450907_000140 | 3300042146 | Bacteria | 27596 |
| 365 | Ga0450907_001222 | 3300042146 | Bacteria | 5805 |
| 366 | Ga0439446_0000241 | 3300042156 | Bacteria | 10114 |
| 367 | Ga0439446_0011400 | 3300042156 | Bacteria | 2413 |
| 368 | Ga0439446_0011980 | 3300042156 | Bacteria | 2363 |
| 369 | Ga0439446_0027562 | 3300042156 | Bacteria | 1631 |
| 370 | Ga0450908_004020 | 3300042184 | Bacteria | 2843 |
| 371 | Ga0450909_004719 | 3300042185 | Bacteria | 1948 |
| 372 | Ga0439434_0000827 | 3300042435 | Bacteria | 8916 |
| 373 | Ga0439459_0001076 | 3300042438 | Bacteria | 3913 |
| 374 | Ga0439464_0000759 | 3300042439 | Bacteria | 7009 |
| 375 | Ga0439464_0009730 | 3300042439 | Bacteria | 2533 |
| 376 | Ga0439464_0019554 | 3300042439 | Bacteria | 1849 |
| 377 | Ga0439460_0001121 | 3300042461 | Bacteria | 6271 |
| 378 | Ga0439460_0004872 | 3300042461 | Bacteria | 3279 |
| 379 | Ga0450893_0001853 | 3300042532 | Bacteria | 3267 |
| 380 | Ga0439440_0001496 | 3300042993 | Bacteria | 4275 |
| 381 | Ga0466986_0050870 | 3300044650 | Bacteria | 2862 |
| 382 | Ga0466972_0004019 | 3300044658 | Bacteria | 7331 |
| 383 | Ga0466965_0009444 | 3300044683 | Bacteria | 4534 |
| 384 | Ga0466961_0001037 | 3300044693 | Bacteria | 17158 |
| 385 | Ga0466968_0010508 | 3300044735 | Bacteria | 3591 |
| 386 | Ga0466970_0000782 | 3300044765 | Bacteria | 15364 |
| 387 | Ga0466957_0069500 | 3300044842 | Bacteria | 2175 |
| 388 | Ga0466959_0076435 | 3300045049 | Bacteria | 2417 |
| 389 | Ga0495617_000616 | 3300046452 | Bacteria | 17863 |
| 390 | Ga0495617_000954 | 3300046452 | Bacteria | 13433 |
| 391 | Ga0495617_002643 | 3300046452 | Bacteria | 6984 |
| 392 | Ga0495617_007481 | 3300046452 | Bacteria | 3789 |
| 393 | Ga0495617_011546 | 3300046452 | Bacteria | 3013 |
| 394 | Ga0495617_035466 | 3300046452 | Bacteria | 1675 |
| 395 | Ga0495617_058240 | 3300046452 | Bacteria | 1280 |
| 396 | Ga0495627_000121 | 3300046453 | Bacteria | 95735 |
| 397 | Ga0495627_000322 | 3300046453 | Bacteria | 46778 |
| 398 | Ga0495627_000415 | 3300046453 | Bacteria | 37684 |
| 399 | Ga0495627_001501 | 3300046453 | Bacteria | 13468 |
| 400 | Ga0495627_001674 | 3300046453 | Bacteria | 12228 |
| 401 | Ga0495627_002287 | 3300046453 | Bacteria | 9448 |
| 402 | Ga0495627_005289 | 3300046453 | Bacteria | 5229 |
| 403 | Ga0495627_012620 | 3300046453 | Bacteria | 2992 |
| 404 | Ga0495627_014492 | 3300046453 | Bacteria | 2750 |
| 405 | Ga0495603_0007516 | 3300046455 | Bacteria | 6553 |
| 406 | Ga0495603_0008796 | 3300046455 | Bacteria | 6102 |
| 407 | Ga0495603_0015412 | 3300046455 | Bacteria | 4624 |
| 408 | Ga0495590_0001143 | 3300046457 | Bacteria | 11622 |
| 409 | Ga0495590_0001995 | 3300046457 | Bacteria | 8596 |
| 410 | Ga0495590_0004895 | 3300046457 | Bacteria | 5352 |
| 411 | Ga0495590_0005560 | 3300046457 | Bacteria | 4985 |
| 412 | Ga0495591_000046 | 3300046458 | Bacteria | 141821 |
| 413 | Ga0495591_000453 | 3300046458 | Bacteria | 33315 |
| 414 | Ga0495591_000497 | 3300046458 | Bacteria | 31161 |
| 415 | Ga0495591_000533 | 3300046458 | Bacteria | 29482 |
| 416 | Ga0495591_000845 | 3300046458 | Bacteria | 21535 |
| 417 | Ga0495591_001036 | 3300046458 | Bacteria | 18768 |
| 418 | Ga0495591_001113 | 3300046458 | Bacteria | 17797 |
| 419 | Ga0495591_002186 | 3300046458 | Bacteria | 11168 |
| 420 | Ga0495591_007442 | 3300046458 | Bacteria | 4652 |
| 421 | Ga0495591_010393 | 3300046458 | Bacteria | 3612 |
| 422 | Ga0495591_016732 | 3300046458 | Bacteria | 2540 |
| 423 | Ga0495591_018805 | 3300046458 | Bacteria | 2333 |
| 424 | Ga0495629_0030422 | 3300046459 | Bacteria | 3827 |
| 425 | Ga0495638_0003846 | 3300046460 | Bacteria | 11661 |
| 426 | Ga0495638_0004285 | 3300046460 | Bacteria | 10824 |
| 427 | Ga0495638_0021671 | 3300046460 | Bacteria | 4228 |
| 428 | Ga0495638_0025145 | 3300046460 | Bacteria | 3874 |
| 429 | Ga0495638_0025751 | 3300046460 | Bacteria | 3819 |
| 430 | Ga0495638_0027672 | 3300046460 | Bacteria | 3667 |
| 431 | Ga0495638_0035324 | 3300046460 | Bacteria | 3187 |
| 432 | Ga0495638_0041442 | 3300046460 | Bacteria | 2913 |
| 433 | Ga0495638_0045282 | 3300046460 | Bacteria | 2768 |
| 434 | Ga0495638_0048482 | 3300046460 | Bacteria | 2658 |
| 435 | Ga0495638_0054129 | 3300046460 | Bacteria | 2495 |
| 436 | Ga0495638_0081219 | 3300046460 | Bacteria | 1968 |
| 437 | Ga0495638_0168222 | 3300046460 | Bacteria | 1259 |
| 438 | Ga0495638_0219254 | 3300046460 | Bacteria | 1064 |
| 439 | Ga0495653_0036306 | 3300046463 | Bacteria | 3882 |
| 440 | Ga0495653_0048718 | 3300046463 | Bacteria | 3269 |
| 441 | Ga0495653_0150355 | 3300046463 | Bacteria | 1627 |
| 442 | Ga0495650_0000354 | 3300046471 | Bacteria | 81084 |
| 443 | Ga0495650_0003370 | 3300046471 | Bacteria | 11708 |
| 444 | Ga0495650_0004035 | 3300046471 | Bacteria | 10288 |
| 445 | Ga0495650_0007460 | 3300046471 | Bacteria | 6564 |
| 446 | Ga0495650_0010744 | 3300046471 | Bacteria | 5086 |
| 447 | Ga0495650_0018075 | 3300046471 | Bacteria | 3515 |
| 448 | Ga0495650_0019361 | 3300046471 | Bacteria | 3353 |
| 449 | Ga0495650_0033348 | 3300046471 | Bacteria | 2292 |
| 450 | Ga0495650_0069294 | 3300046471 | Bacteria | 1388 |
| 451 | Ga0495582_0106260 | 3300046473 | Bacteria | 1574 |
| 452 | Ga0495605_0000032 | 3300046474 | Bacteria | 210550 |
| 453 | Ga0495605_0000167 | 3300046474 | Bacteria | 83036 |
| 454 | Ga0495605_0000285 | 3300046474 | Bacteria | 56059 |
| 455 | Ga0495605_0000447 | 3300046474 | Bacteria | 37007 |
| 456 | Ga0495605_0000997 | 3300046474 | Bacteria | 19165 |
| 457 | Ga0495605_0003338 | 3300046474 | Bacteria | 9598 |
| 458 | Ga0495605_0003424 | 3300046474 | Bacteria | 9441 |
| 459 | Ga0495605_0008822 | 3300046474 | Bacteria | 5685 |
| 460 | Ga0495605_0009407 | 3300046474 | Bacteria | 5489 |
| 461 | Ga0495605_0017155 | 3300046474 | Bacteria | 3905 |
| 462 | Ga0495605_0019997 | 3300046474 | Bacteria | 3563 |
| 463 | Ga0495605_0021447 | 3300046474 | Bacteria | 3421 |
| 464 | Ga0495605_0027244 | 3300046474 | Bacteria | 2962 |
| 465 | Ga0495605_0033851 | 3300046474 | Bacteria | 2591 |
| 466 | Ga0495639_0050206 | 3300046475 | Bacteria | 1894 |
| 467 | Ga0495664_0118498 | 3300046477 | Bacteria | 1601 |
| 468 | Ga0495584_0000595 | 3300046491 | Bacteria | 24380 |
| 469 | Ga0495584_0001259 | 3300046491 | Bacteria | 15455 |
| 470 | Ga0495584_0001699 | 3300046491 | Bacteria | 12900 |
| 471 | Ga0495584_0002065 | 3300046491 | Bacteria | 11525 |
| 472 | Ga0495584_0004158 | 3300046491 | Bacteria | 7813 |
| 473 | Ga0495584_0012342 | 3300046491 | Bacteria | 4360 |
| 474 | Ga0495584_0038041 | 3300046491 | Bacteria | 2432 |
| 475 | Ga0495584_0039034 | 3300046491 | Bacteria | 2399 |
| 476 | Ga0495584_0083007 | 3300046491 | Bacteria | 1613 |
| 477 | Ga0495585_0003473 | 3300046492 | Bacteria | 10640 |
| 478 | Ga0495585_0003983 | 3300046492 | Bacteria | 9739 |
| 479 | Ga0495585_0005149 | 3300046492 | Bacteria | 8302 |
| 480 | Ga0495585_0009135 | 3300046492 | Bacteria | 5967 |
| 481 | Ga0495585_0009721 | 3300046492 | Bacteria | 5755 |
| 482 | Ga0495585_0035148 | 3300046492 | Bacteria | 2833 |
| 483 | Ga0495585_0076537 | 3300046492 | Bacteria | 1817 |
| 484 | Ga0495594_0008081 | 3300046499 | Bacteria | 5409 |
| 485 | Ga0495594_0063674 | 3300046499 | Bacteria | 2043 |
| 486 | Ga0495594_0081811 | 3300046499 | Bacteria | 1803 |
| 487 | Ga0495596_0001522 | 3300046500 | Bacteria | 13225 |
| 488 | Ga0495596_0002325 | 3300046500 | Bacteria | 10325 |
| 489 | Ga0495596_0006689 | 3300046500 | Bacteria | 5276 |
| 490 | Ga0495607_0000102 | 3300046501 | Bacteria | 90447 |
| 491 | Ga0495607_0000242 | 3300046501 | Bacteria | 58464 |
| 492 | Ga0495607_0000737 | 3300046501 | Bacteria | 31411 |
| 493 | Ga0495607_0001738 | 3300046501 | Bacteria | 18658 |
| 494 | Ga0495607_0001923 | 3300046501 | Bacteria | 17555 |
| 495 | Ga0495607_0002240 | 3300046501 | Bacteria | 15979 |
| 496 | Ga0495607_0003760 | 3300046501 | Bacteria | 11473 |
| 497 | Ga0495607_0006495 | 3300046501 | Bacteria | 8222 |
| 498 | Ga0495607_0007369 | 3300046501 | Bacteria | 7617 |
| 499 | Ga0495607_0010802 | 3300046501 | Bacteria | 6110 |
| 500 | Ga0495607_0012362 | 3300046501 | Bacteria | 5641 |
| 501 | Ga0495607_0020962 | 3300046501 | Bacteria | 4117 |
| 502 | Ga0495607_0023780 | 3300046501 | Bacteria | 3829 |
| 503 | Ga0495607_0024528 | 3300046501 | Bacteria | 3758 |
| 504 | Ga0495607_0036402 | 3300046501 | Bacteria | 2965 |
| 505 | Ga0495607_0038674 | 3300046501 | Bacteria | 2856 |
| 506 | Ga0495607_0042101 | 3300046501 | Bacteria | 2709 |
| 507 | Ga0495607_0042153 | 3300046501 | Bacteria | 2707 |
| 508 | Ga0495607_0047338 | 3300046501 | Bacteria | 2520 |
| 509 | Ga0495607_0055297 | 3300046501 | Bacteria | 2283 |
| 510 | Ga0495607_0197718 | 3300046501 | Bacteria | 997 |
| 511 | Ga0495583_0000052 | 3300046506 | Bacteria | 211902 |
| 512 | Ga0495583_0000813 | 3300046506 | Bacteria | 38429 |
| 513 | Ga0495583_0001116 | 3300046506 | Bacteria | 29673 |
| 514 | Ga0495583_0002139 | 3300046506 | Bacteria | 17651 |
| 515 | Ga0495583_0003186 | 3300046506 | Bacteria | 12870 |
| 516 | Ga0495583_0003865 | 3300046506 | Bacteria | 11098 |
| 517 | Ga0495583_0005055 | 3300046506 | Bacteria | 9110 |
| 518 | Ga0495583_0023815 | 3300046506 | Bacteria | 3088 |
| 519 | Ga0495583_0032802 | 3300046506 | Bacteria | 2504 |
| 520 | Ga0495606_0000313 | 3300046507 | Bacteria | 83765 |
| 521 | Ga0495606_0000334 | 3300046507 | Bacteria | 81008 |
| 522 | Ga0495606_0000613 | 3300046507 | Bacteria | 56133 |
| 523 | Ga0495606_0003409 | 3300046507 | Bacteria | 16880 |
| 524 | Ga0495606_0005514 | 3300046507 | Bacteria | 12092 |
| 525 | Ga0495606_0006668 | 3300046507 | Bacteria | 10586 |
| 526 | Ga0495606_0008724 | 3300046507 | Bacteria | 8726 |
| 527 | Ga0495606_0010535 | 3300046507 | Bacteria | 7656 |
| 528 | Ga0495606_0014568 | 3300046507 | Bacteria | 6121 |
| 529 | Ga0495606_0024619 | 3300046507 | Bacteria | 4331 |
| 530 | Ga0495606_0035775 | 3300046507 | Bacteria | 3390 |
| 531 | Ga0495606_0082837 | 3300046507 | Bacteria | 1990 |
| 532 | Ga0495606_0140996 | 3300046507 | Bacteria | 1423 |
| 533 | Ga0495606_0191890 | 3300046507 | Bacteria | 1170 |
| 534 | Ga0495610_0002525 | 3300046512 | Bacteria | 15271 |
| 535 | Ga0495610_0004046 | 3300046512 | Bacteria | 11025 |
| 536 | Ga0495610_0008962 | 3300046512 | Bacteria | 6398 |
| 537 | Ga0495610_0011091 | 3300046512 | Bacteria | 5534 |
| 538 | Ga0495610_0013686 | 3300046512 | Bacteria | 4807 |
| 539 | Ga0495610_0022364 | 3300046512 | Bacteria | 3461 |
| 540 | Ga0495610_0026713 | 3300046512 | Bacteria | 3078 |
| 541 | Ga0495610_0029528 | 3300046512 | Bacteria | 2885 |
| 542 | Ga0495610_0034280 | 3300046512 | Bacteria | 2615 |
| 543 | Ga0495610_0034977 | 3300046512 | Bacteria | 2583 |
| 544 | Ga0495610_0036167 | 3300046512 | Bacteria | 2526 |
| 545 | Ga0495610_0037992 | 3300046512 | Bacteria | 2445 |
| 546 | Ga0495616_0001028 | 3300046513 | Bacteria | 19984 |
| 547 | Ga0495616_0003271 | 3300046513 | Bacteria | 10422 |
| 548 | Ga0495616_0006422 | 3300046513 | Bacteria | 7108 |
| 549 | Ga0495616_0006466 | 3300046513 | Bacteria | 7087 |
| 550 | Ga0495616_0007579 | 3300046513 | Bacteria | 6495 |
| 551 | Ga0495616_0010273 | 3300046513 | Bacteria | 5426 |
| 552 | Ga0495616_0011121 | 3300046513 | Bacteria | 5168 |
| 553 | Ga0495616_0043031 | 3300046513 | Bacteria | 2295 |
| 554 | Ga0495616_0072586 | 3300046513 | Bacteria | 1662 |
| 555 | Ga0495620_0000019 | 3300046515 | Bacteria | 150014 |
| 556 | Ga0495620_0000231 | 3300046515 | Bacteria | 41704 |
| 557 | Ga0495620_0000771 | 3300046515 | Bacteria | 19651 |
| 558 | Ga0495620_0000823 | 3300046515 | Bacteria | 19138 |
| 559 | Ga0495620_0001116 | 3300046515 | Bacteria | 16373 |
| 560 | Ga0495620_0006294 | 3300046515 | Bacteria | 6531 |
| 561 | Ga0495620_0014004 | 3300046515 | Bacteria | 4089 |
| 562 | Ga0495620_0028027 | 3300046515 | Bacteria | 2625 |
| 563 | Ga0495620_0035317 | 3300046515 | Bacteria | 2249 |
| 564 | Ga0495620_0058531 | 3300046515 | Bacteria | 1612 |
| 565 | Ga0495628_0172821 | 3300046516 | Bacteria | 1638 |
| 566 | Ga0495631_0000275 | 3300046518 | Bacteria | 35971 |
| 567 | Ga0495631_0001351 | 3300046518 | Bacteria | 14999 |
| 568 | Ga0495631_0002056 | 3300046518 | Bacteria | 11724 |
| 569 | Ga0495631_0022501 | 3300046518 | Bacteria | 2930 |
| 570 | Ga0495631_0035596 | 3300046518 | Bacteria | 2226 |
| 571 | Ga0495632_0001540 | 3300046519 | Bacteria | 19055 |
| 572 | Ga0495632_0002549 | 3300046519 | Bacteria | 13805 |
| 573 | Ga0495632_0003418 | 3300046519 | Bacteria | 11286 |
| 574 | Ga0495632_0003446 | 3300046519 | Bacteria | 11219 |
| 575 | Ga0495632_0003919 | 3300046519 | Bacteria | 10335 |
| 576 | Ga0495632_0009814 | 3300046519 | Bacteria | 5730 |
| 577 | Ga0495632_0013087 | 3300046519 | Bacteria | 4750 |
| 578 | Ga0495632_0013809 | 3300046519 | Bacteria | 4593 |
| 579 | Ga0495632_0022113 | 3300046519 | Bacteria | 3414 |
| 580 | Ga0495632_0033843 | 3300046519 | Bacteria | 2620 |
| 581 | Ga0495632_0043390 | 3300046519 | Bacteria | 2247 |
| 582 | Ga0495632_0056937 | 3300046519 | Bacteria | 1909 |
| 583 | Ga0495632_0078651 | 3300046519 | Bacteria | 1575 |
| 584 | Ga0495632_0080047 | 3300046519 | Bacteria | 1559 |
| 585 | Ga0495637_0000059 | 3300046520 | Bacteria | 96238 |
| 586 | Ga0495637_0000632 | 3300046520 | Bacteria | 24749 |
| 587 | Ga0495637_0001134 | 3300046520 | Bacteria | 16307 |
| 588 | Ga0495637_0002657 | 3300046520 | Bacteria | 9779 |
| 589 | Ga0495637_0005855 | 3300046520 | Bacteria | 6218 |
| 590 | Ga0495637_0009101 | 3300046520 | Bacteria | 4850 |
| 591 | Ga0495637_0010040 | 3300046520 | Bacteria | 4598 |
| 592 | Ga0495637_0010277 | 3300046520 | Bacteria | 4534 |
| 593 | Ga0495637_0016626 | 3300046520 | Bacteria | 3437 |
| 594 | Ga0495637_0021282 | 3300046520 | Bacteria | 2975 |
| 595 | Ga0495637_0047446 | 3300046520 | Bacteria | 1812 |
| 596 | Ga0495637_0087377 | 3300046520 | Bacteria | 1234 |
| 597 | Ga0495643_0000266 | 3300046522 | Bacteria | 75924 |
| 598 | Ga0495643_0001693 | 3300046522 | Bacteria | 19200 |
| 599 | Ga0495643_0008638 | 3300046522 | Bacteria | 6428 |
| 600 | Ga0495643_0012053 | 3300046522 | Bacteria | 5229 |
| 601 | Ga0495643_0014085 | 3300046522 | Bacteria | 4768 |
| 602 | Ga0495643_0040884 | 3300046522 | Bacteria | 2530 |
| 603 | Ga0495643_0046470 | 3300046522 | Bacteria | 2353 |
| 604 | Ga0495643_0054454 | 3300046522 | Bacteria | 2141 |
| 605 | Ga0495643_0068727 | 3300046522 | Bacteria | 1864 |
| 606 | Ga0495644_0000680 | 3300046523 | Bacteria | 14125 |
| 607 | Ga0495644_0005037 | 3300046523 | Bacteria | 5167 |
| 608 | Ga0495648_0000438 | 3300046524 | Bacteria | 45257 |
| 609 | Ga0495648_0002771 | 3300046524 | Bacteria | 15805 |
| 610 | Ga0495648_0003911 | 3300046524 | Bacteria | 12903 |
| 611 | Ga0495648_0004312 | 3300046524 | Bacteria | 12188 |
| 612 | Ga0495648_0006250 | 3300046524 | Bacteria | 9745 |
| 613 | Ga0495648_0007279 | 3300046524 | Bacteria | 8879 |
| 614 | Ga0495648_0008832 | 3300046524 | Bacteria | 7885 |
| 615 | Ga0495648_0009796 | 3300046524 | Bacteria | 7372 |
| 616 | Ga0495648_0009996 | 3300046524 | Bacteria | 7277 |
| 617 | Ga0495648_0019206 | 3300046524 | Bacteria | 4814 |
| 618 | Ga0495648_0019267 | 3300046524 | Bacteria | 4804 |
| 619 | Ga0495648_0020310 | 3300046524 | Bacteria | 4635 |
| 620 | Ga0495648_0042543 | 3300046524 | Bacteria | 2856 |
| 621 | Ga0495648_0057529 | 3300046524 | Bacteria | 2331 |
| 622 | Ga0495648_0071215 | 3300046524 | Bacteria | 2016 |
| 623 | Ga0495648_0164654 | 3300046524 | Bacteria | 1142 |
| 624 | Ga0495666_0049656 | 3300046526 | Bacteria | 2018 |
| 625 | Ga0495642_0000067 | 3300046528 | Bacteria | 61823 |
| 626 | Ga0495642_0000334 | 3300046528 | Bacteria | 25618 |
| 627 | Ga0495652_0117871 | 3300046529 | Bacteria | 2123 |
| 628 | Ga0495652_0459552 | 3300046529 | Bacteria | 890 |
| 629 | Ga0495654_0001493 | 3300046530 | Bacteria | 16005 |
| 630 | Ga0495654_0001753 | 3300046530 | Bacteria | 14526 |
| 631 | Ga0495654_0001799 | 3300046530 | Bacteria | 14279 |
| 632 | Ga0495654_0003078 | 3300046530 | Bacteria | 10379 |
| 633 | Ga0495654_0004696 | 3300046530 | Bacteria | 8048 |
| 634 | Ga0495654_0006822 | 3300046530 | Bacteria | 6445 |
| 635 | Ga0495654_0007263 | 3300046530 | Bacteria | 6206 |
| 636 | Ga0495654_0009895 | 3300046530 | Bacteria | 5211 |
| 637 | Ga0495654_0016050 | 3300046530 | Bacteria | 3967 |
| 638 | Ga0495654_0024505 | 3300046530 | Bacteria | 3115 |
| 639 | Ga0495654_0026652 | 3300046530 | Bacteria | 2969 |
| 640 | Ga0495654_0035101 | 3300046530 | Bacteria | 2527 |
| 641 | Ga0495654_0046777 | 3300046530 | Bacteria | 2129 |
| 642 | Ga0495654_0059187 | 3300046530 | Bacteria | 1846 |
| 643 | Ga0495654_0170601 | 3300046530 | Bacteria | 948 |
| 644 | Ga0495586_0093540 | 3300046535 | Bacteria | 1662 |
| 645 | Ga0495587_0004111 | 3300046536 | Bacteria | 9626 |
| 646 | Ga0495587_0004543 | 3300046536 | Bacteria | 9119 |
| 647 | Ga0495609_0000032 | 3300046538 | Bacteria | 211021 |
| 648 | Ga0495609_0000123 | 3300046538 | Bacteria | 86194 |
| 649 | Ga0495609_0000149 | 3300046538 | Bacteria | 72309 |
| 650 | Ga0495609_0002647 | 3300046538 | Bacteria | 10855 |
| 651 | Ga0495609_0003002 | 3300046538 | Bacteria | 9952 |
| 652 | Ga0495609_0003293 | 3300046538 | Bacteria | 9317 |
| 653 | Ga0495609_0005452 | 3300046538 | Bacteria | 6675 |
| 654 | Ga0495609_0024696 | 3300046538 | Bacteria | 2755 |
| 655 | Ga0495609_0063389 | 3300046538 | Bacteria | 1631 |
| 656 | Ga0495609_0080169 | 3300046538 | Bacteria | 1427 |
| 657 | Ga0495597_0000079 | 3300046542 | Bacteria | 84631 |
| 658 | Ga0495597_0002348 | 3300046542 | Bacteria | 12200 |
| 659 | Ga0495597_0003816 | 3300046542 | Bacteria | 8570 |
| 660 | Ga0495597_0006047 | 3300046542 | Bacteria | 6303 |
| 661 | Ga0495597_0013155 | 3300046542 | Bacteria | 3971 |
| 662 | Ga0495597_0013458 | 3300046542 | Bacteria | 3917 |
| 663 | Ga0495597_0021446 | 3300046542 | Bacteria | 3003 |
| 664 | Ga0495597_0024942 | 3300046542 | Bacteria | 2756 |
| 665 | Ga0495597_0026576 | 3300046542 | Bacteria | 2658 |
| 666 | Ga0495645_0146338 | 3300046543 | Bacteria | 1645 |
| 667 | Ga0495622_0004962 | 3300046557 | Bacteria | 6162 |
| 668 | Ga0495622_0007287 | 3300046557 | Bacteria | 5135 |
| 669 | Ga0495622_0021658 | 3300046557 | Bacteria | 2992 |
| 670 | Ga0495622_0023225 | 3300046557 | Bacteria | 2891 |
| 671 | Ga0495622_0094209 | 3300046557 | Bacteria | 1375 |
| 672 | Ga0495622_0149743 | 3300046557 | Bacteria | 1056 |
| 673 | Ga0495633_0000040 | 3300046558 | Bacteria | 177876 |
| 674 | Ga0495633_0003145 | 3300046558 | Bacteria | 11175 |
| 675 | Ga0495633_0003537 | 3300046558 | Bacteria | 10344 |
| 676 | Ga0495656_0002252 | 3300046615 | Bacteria | 6377 |
| 677 | Ga0495656_0093944 | 3300046615 | Bacteria | 1376 |
| 678 | Ga0495668_0002597 | 3300046616 | Bacteria | 14638 |
| 679 | Ga0495668_0002653 | 3300046616 | Bacteria | 14376 |
| 680 | Ga0495668_0004541 | 3300046616 | Bacteria | 9793 |
| 681 | Ga0495668_0031582 | 3300046616 | Bacteria | 2984 |
| 682 | Ga0495634_0010691 | 3300046642 | Bacteria | 6718 |
| 683 | Ga0495611_0000609 | 3300046648 | Bacteria | 20642 |
| 684 | Ga0495611_0000776 | 3300046648 | Bacteria | 17755 |
| 685 | Ga0495611_0000840 | 3300046648 | Bacteria | 16852 |
| 686 | Ga0495611_0017655 | 3300046648 | Bacteria | 3055 |
| 687 | Ga0495611_0039236 | 3300046648 | Bacteria | 2108 |
| 688 | Ga0495625_0000202 | 3300046660 | Bacteria | 94655 |
| 689 | Ga0495625_0002362 | 3300046660 | Bacteria | 20555 |
| 690 | Ga0495625_0003196 | 3300046660 | Bacteria | 16639 |
| 691 | Ga0495625_0003348 | 3300046660 | Bacteria | 16135 |
| 692 | Ga0495625_0009932 | 3300046660 | Bacteria | 7914 |
| 693 | Ga0495625_0016538 | 3300046660 | Bacteria | 5801 |
| 694 | Ga0495625_0043847 | 3300046660 | Bacteria | 3241 |
| 695 | Ga0495625_0053105 | 3300046660 | Bacteria | 2900 |
| 696 | Ga0495625_0054905 | 3300046660 | Bacteria | 2843 |
| 697 | Ga0495625_0073803 | 3300046660 | Bacteria | 2391 |
| 698 | Ga0495635_0005376 | 3300046663 | Bacteria | 8915 |
| 699 | Ga0495635_0044237 | 3300046663 | Bacteria | 3072 |
| 700 | Ga0495659_0017868 | 3300046664 | Bacteria | 2356 |
| 701 | Ga0495661_0000037 | 3300046665 | Bacteria | 164234 |
| 702 | Ga0495661_0000133 | 3300046665 | Bacteria | 88428 |
| 703 | Ga0495661_0001162 | 3300046665 | Bacteria | 22969 |
| 704 | Ga0495661_0008184 | 3300046665 | Bacteria | 7249 |
| 705 | Ga0495661_0021817 | 3300046665 | Bacteria | 4169 |
| 706 | Ga0495661_0025296 | 3300046665 | Bacteria | 3835 |
| 707 | Ga0495661_0065424 | 3300046665 | Bacteria | 2142 |
| 708 | Ga0495588_0038216 | 3300046674 | Bacteria | 2441 |
| 709 | Ga0495588_0038364 | 3300046674 | Bacteria | 2436 |
| 710 | Ga0495657_0066123 | 3300046675 | Bacteria | 2376 |
| 711 | Ga0495623_0006054 | 3300046679 | Bacteria | 7864 |
| 712 | Ga0495623_0023457 | 3300046679 | Bacteria | 3982 |
| 713 | Ga0495623_0166986 | 3300046679 | Bacteria | 1289 |
| 714 | Ga0495646_0012609 | 3300046680 | Bacteria | 5372 |
| 715 | Ga0495646_0084923 | 3300046680 | Bacteria | 1837 |
| 716 | Ga0495669_0005517 | 3300046684 | Bacteria | 5279 |
| 717 | Ga0495669_0074545 | 3300046684 | Bacteria | 1551 |
| 718 | Ga0495613_0014714 | 3300046689 | Bacteria | 5807 |
| 719 | Ga0495670_0000412 | 3300046691 | Bacteria | 20502 |
| 720 | Ga0495670_0000415 | 3300046691 | Bacteria | 20485 |
| 721 | Ga0495670_0008074 | 3300046691 | Bacteria | 5176 |
| 722 | Ga0495670_0101960 | 3300046691 | Bacteria | 1478 |
| 723 | Ga0495670_0106313 | 3300046691 | Bacteria | 1449 |
| 724 | Ga0495670_0140789 | 3300046691 | Bacteria | 1261 |
| 725 | Ga0495671_0000395 | 3300046692 | Bacteria | 35847 |
| 726 | Ga0495671_0000934 | 3300046692 | Bacteria | 20641 |
| 727 | Ga0495671_0001028 | 3300046692 | Bacteria | 19413 |
| 728 | Ga0495671_0002817 | 3300046692 | Bacteria | 10875 |
| 729 | Ga0495671_0004652 | 3300046692 | Bacteria | 8129 |
| 730 | Ga0495671_0006752 | 3300046692 | Bacteria | 6606 |
| 731 | Ga0495671_0010184 | 3300046692 | Bacteria | 5222 |
| 732 | Ga0495671_0010384 | 3300046692 | Bacteria | 5160 |
| 733 | Ga0495671_0011748 | 3300046692 | Bacteria | 4802 |
| 734 | Ga0495671_0012595 | 3300046692 | Bacteria | 4613 |
| 735 | Ga0495671_0015553 | 3300046692 | Bacteria | 4074 |
| 736 | Ga0495671_0022874 | 3300046692 | Bacteria | 3269 |
| 737 | Ga0495671_0035745 | 3300046692 | Bacteria | 2521 |
| 738 | Ga0495671_0073728 | 3300046692 | Bacteria | 1675 |
| 739 | Ga0495671_0100579 | 3300046692 | Bacteria | 1413 |
| 740 | Ga0495649_0002744 | 3300046694 | Bacteria | 12254 |
| 741 | Ga0495649_0004453 | 3300046694 | Bacteria | 9152 |
| 742 | Ga0495649_0008523 | 3300046694 | Bacteria | 6162 |
| 743 | Ga0495649_0021334 | 3300046694 | Bacteria | 3629 |
| 744 | Ga0495649_0025661 | 3300046694 | Bacteria | 3281 |
| 745 | Ga0495649_0025800 | 3300046694 | Bacteria | 3272 |
| 746 | Ga0495649_0040856 | 3300046694 | Bacteria | 2537 |
| 747 | Ga0495649_0069933 | 3300046694 | Bacteria | 1882 |
| 748 | Ga0495649_0073964 | 3300046694 | Bacteria | 1825 |
| 749 | Ga0495649_0135942 | 3300046694 | Bacteria | 1295 |
| 750 | Ga0495589_0000220 | 3300046794 | Bacteria | 48490 |
| 751 | Ga0495589_0000394 | 3300046794 | Bacteria | 33438 |
| 752 | Ga0495589_0001105 | 3300046794 | Bacteria | 16081 |
| 753 | Ga0495589_0005175 | 3300046794 | Bacteria | 6895 |
| 754 | Ga0495589_0006484 | 3300046794 | Bacteria | 6169 |
| 755 | Ga0495589_0008900 | 3300046794 | Bacteria | 5224 |
| 756 | Ga0495589_0028770 | 3300046794 | Bacteria | 2803 |
| 757 | Ga0495589_0030734 | 3300046794 | Bacteria | 2704 |
| 758 | Ga0495589_0035766 | 3300046794 | Bacteria | 2489 |
| 759 | Ga0495589_0042933 | 3300046794 | Bacteria | 2252 |
| 760 | Ga0495589_0048948 | 3300046794 | Bacteria | 2091 |
| 761 | Ga0495600_0061681 | 3300046809 | Bacteria | 2449 |
| 762 | Ga0495600_0192110 | 3300046809 | Bacteria | 1312 |
| 763 | Ga0495660_0000049 | 3300046810 | Bacteria | 142727 |
| 764 | Ga0495660_0000571 | 3300046810 | Bacteria | 29780 |
| 765 | Ga0495660_0001266 | 3300046810 | Bacteria | 17581 |
| 766 | Ga0495660_0003854 | 3300046810 | Bacteria | 9173 |
| 767 | Ga0495660_0005982 | 3300046810 | Bacteria | 7237 |
| 768 | Ga0495660_0010021 | 3300046810 | Bacteria | 5512 |
| 769 | Ga0495660_0015392 | 3300046810 | Bacteria | 4419 |
| 770 | Ga0495660_0017024 | 3300046810 | Bacteria | 4186 |
| 771 | Ga0495660_0026147 | 3300046810 | Bacteria | 3310 |
| 772 | Ga0495660_0028669 | 3300046810 | Bacteria | 3143 |
| 773 | Ga0495660_0030889 | 3300046810 | Bacteria | 3015 |
| 774 | Ga0495660_0044155 | 3300046810 | Bacteria | 2453 |
| 775 | Ga0495660_0068260 | 3300046810 | Bacteria | 1892 |
| 776 | Ga0495660_0080607 | 3300046810 | Bacteria | 1707 |
| 777 | Ga0495581_0095476 | 3300047315 | Bacteria | 1726 |
| 778 | Ga0495604_0005618 | 3300047317 | Bacteria | 9944 |
| 779 | Ga0495604_0031122 | 3300047317 | Bacteria | 4234 |
| 780 | Ga0495636_0000393 | 3300047318 | Bacteria | 16400 |
| 781 | Ga0495636_0121775 | 3300047318 | Bacteria | 1154 |
| 782 | Ga0495674_0111519 | 3300047319 | Bacteria | 2318 |
| 783 | Ga0495672_0000553 | 3300047320 | Bacteria | 42512 |
| 784 | Ga0495672_0003277 | 3300047320 | Bacteria | 14018 |
| 785 | Ga0495672_0004855 | 3300047320 | Bacteria | 10825 |
| 786 | Ga0495672_0008336 | 3300047320 | Bacteria | 7665 |
| 787 | Ga0495672_0015612 | 3300047320 | Bacteria | 5148 |
| 788 | Ga0495672_0024473 | 3300047320 | Bacteria | 3887 |
| 789 | Ga0495672_0031484 | 3300047320 | Bacteria | 3311 |
| 790 | Ga0495672_0036586 | 3300047320 | Bacteria | 3013 |
| 791 | Ga0495672_0042742 | 3300047320 | Bacteria | 2730 |
| 792 | Ga0495672_0091317 | 3300047320 | Bacteria | 1671 |
| 793 | Ga0495672_0192326 | 3300047320 | Bacteria | 1025 |
| 794 | Ga0495676_0000053 | 3300047321 | Bacteria | 95693 |
| 795 | Ga0495676_0006328 | 3300047321 | Bacteria | 10901 |
| 796 | Ga0495680_0017495 | 3300047322 | Bacteria | 6118 |
| 797 | Ga0495680_0037393 | 3300047322 | Bacteria | 3888 |
| 798 | Ga0495680_0047703 | 3300047322 | Bacteria | 3367 |
| 799 | Ga0495683_0000011 | 3300047323 | Bacteria | 212053 |
| 800 | Ga0495683_0000382 | 3300047323 | Bacteria | 36179 |
| 801 | Ga0495683_0003385 | 3300047323 | Bacteria | 9315 |
| 802 | Ga0495683_0007951 | 3300047323 | Bacteria | 5692 |
| 803 | Ga0495683_0009285 | 3300047323 | Bacteria | 5238 |
| 804 | Ga0495683_0014610 | 3300047323 | Bacteria | 4091 |
| 805 | Ga0495683_0038986 | 3300047323 | Bacteria | 2402 |
| 806 | Ga0495683_0041716 | 3300047323 | Bacteria | 2314 |
| 807 | Ga0495683_0042335 | 3300047323 | Bacteria | 2296 |
| 808 | Ga0495683_0106804 | 3300047323 | Bacteria | 1340 |
| 809 | Ga0495687_002144 | 3300047443 | Bacteria | 16474 |
| 810 | Ga0495675_0051723 | 3300047444 | Bacteria | 2608 |
| 811 | Ga0495677_0004123 | 3300047445 | Bacteria | 5611 |
| 812 | Ga0495679_000168 | 3300047446 | Bacteria | 59413 |
| 813 | Ga0495679_000192 | 3300047446 | Bacteria | 54152 |
| 814 | Ga0495679_005475 | 3300047446 | Bacteria | 5624 |
| 815 | Ga0495679_006333 | 3300047446 | Bacteria | 5113 |
| 816 | Ga0495679_008363 | 3300047446 | Bacteria | 4213 |
| 817 | Ga0495679_008759 | 3300047446 | Bacteria | 4091 |
| 818 | Ga0495673_0000116 | 3300047469 | Bacteria | 154310 |
| 819 | Ga0495673_0000602 | 3300047469 | Bacteria | 35831 |
| 820 | Ga0495673_0001458 | 3300047469 | Bacteria | 18788 |
| 821 | Ga0495673_0001830 | 3300047469 | Bacteria | 16045 |
| 822 | Ga0495673_0002071 | 3300047469 | Bacteria | 14668 |
| 823 | Ga0495673_0006244 | 3300047469 | Bacteria | 7044 |
| 824 | Ga0495673_0010644 | 3300047469 | Bacteria | 4990 |
| 825 | Ga0495673_0012913 | 3300047469 | Bacteria | 4404 |
| 826 | Ga0495673_0014111 | 3300047469 | Bacteria | 4164 |
| 827 | Ga0495673_0024292 | 3300047469 | Bacteria | 2931 |
| 828 | Ga0495673_0025772 | 3300047469 | Bacteria | 2818 |
| 829 | Ga0495673_0034447 | 3300047469 | Bacteria | 2340 |
| 830 | Ga0495673_0041664 | 3300047469 | Bacteria | 2065 |
| 831 | Ga0495673_0066371 | 3300047469 | Bacteria | 1530 |
| 832 | Ga0495681_0001694 | 3300047470 | Bacteria | 16333 |
| 833 | Ga0495681_0003057 | 3300047470 | Bacteria | 11743 |
| 834 | Ga0495681_0003153 | 3300047470 | Bacteria | 11547 |
| 835 | Ga0495681_0008851 | 3300047470 | Bacteria | 6257 |
| 836 | Ga0495681_0012897 | 3300047470 | Bacteria | 4885 |
| 837 | Ga0495681_0013047 | 3300047470 | Bacteria | 4849 |
| 838 | Ga0495681_0013713 | 3300047470 | Bacteria | 4687 |
| 839 | Ga0495681_0019018 | 3300047470 | Bacteria | 3764 |
| 840 | Ga0495681_0020303 | 3300047470 | Bacteria | 3607 |
| 841 | Ga0495681_0020718 | 3300047470 | Bacteria | 3559 |
| 842 | Ga0495681_0021070 | 3300047470 | Bacteria | 3520 |
| 843 | Ga0495681_0022114 | 3300047470 | Bacteria | 3411 |
| 844 | Ga0495681_0030514 | 3300047470 | Bacteria | 2743 |
| 845 | Ga0495681_0030622 | 3300047470 | Bacteria | 2736 |
| 846 | Ga0495681_0039246 | 3300047470 | Bacteria | 2315 |
| 847 | Ga0495681_0079372 | 3300047470 | Bacteria | 1468 |
| 848 | Ga0495684_0081946 | 3300047471 | Bacteria | 2448 |
| 849 | Ga0495686_0004749 | 3300047472 | Bacteria | 10994 |
| 850 | Ga0495686_0014110 | 3300047472 | Bacteria | 5514 |
| 851 | Ga0495686_0015613 | 3300047472 | Bacteria | 5179 |
| 852 | Ga0495686_0095024 | 3300047472 | Bacteria | 1805 |
| 853 | Ga0495686_0106964 | 3300047472 | Bacteria | 1681 |
| 854 | Ga0495686_0112063 | 3300047472 | Bacteria | 1635 |
| 855 | Ga0495593_0007329 | 3300047673 | Bacteria | 6462 |
| 856 | Ga0495593_0041429 | 3300047673 | Bacteria | 2475 |
| 857 | Ga0495593_0194613 | 3300047673 | Bacteria | 1019 |
| 858 | Ga0495626_0000647 | 3300048091 | Bacteria | 33586 |
| 859 | Ga0495626_0000727 | 3300048091 | Bacteria | 30796 |
| 860 | Ga0495626_0000769 | 3300048091 | Bacteria | 29387 |
| 861 | Ga0495626_0001353 | 3300048091 | Bacteria | 19805 |
| 862 | Ga0495626_0002545 | 3300048091 | Bacteria | 12517 |
| 863 | Ga0495626_0003906 | 3300048091 | Bacteria | 9338 |
| 864 | Ga0495626_0004193 | 3300048091 | Bacteria | 8932 |
| 865 | Ga0495626_0038475 | 3300048091 | Bacteria | 2267 |
| 866 | Ga0495626_0038987 | 3300048091 | Bacteria | 2249 |
| 867 | Ga0495626_0042892 | 3300048091 | Bacteria | 2124 |
| 868 | Ga0496100_0197004 | 3300048903 | Bacteria | 1466 |
| 869 | Ga0496101_0403784 | 3300048904 | Bacteria | 1076 |
| 870 | Ga0496102_0000073 | 3300048905 | Bacteria | 149887 |
| 871 | Ga0496103_0052152 | 3300048906 | Bacteria | 2533 |
| 872 | Ga0496114_0308166 | 3300048917 | Bacteria | 1398 |
| 873 | Ga0496116_0002389 | 3300048919 | Bacteria | 19786 |
| 874 | Ga0496116_0004332 | 3300048919 | Bacteria | 13576 |
| 875 | Ga0496116_0067270 | 3300048919 | Bacteria | 2289 |
| 876 | Ga0496117_0002335 | 3300048920 | Bacteria | 24274 |
| 877 | Ga0496117_0002605 | 3300048920 | Bacteria | 22421 |
| 878 | Ga0496117_0007749 | 3300048920 | Bacteria | 10371 |
| 879 | Ga0496117_0009691 | 3300048920 | Bacteria | 8904 |
| 880 | Ga0496117_0014739 | 3300048920 | Bacteria | 6711 |
| 881 | Ga0496117_0016267 | 3300048920 | Bacteria | 6286 |
| 882 | Ga0496117_0025685 | 3300048920 | Bacteria | 4624 |
| 883 | Ga0496117_0039884 | 3300048920 | Bacteria | 3460 |
| 884 | Ga0496117_0048620 | 3300048920 | Bacteria | 3027 |
| 885 | Ga0496117_0067577 | 3300048920 | Bacteria | 2418 |
| 886 | Ga0496117_0080076 | 3300048920 | Bacteria | 2149 |
| 887 | Ga0496117_0136653 | 3300048920 | Bacteria | 1475 |
| 888 | Ga0496118_0008458 | 3300048921 | Bacteria | 10635 |
| 889 | Ga0496118_0016339 | 3300048921 | Bacteria | 6813 |
| 890 | Ga0496118_0024888 | 3300048921 | Bacteria | 5152 |
| 891 | Ga0496118_0025498 | 3300048921 | Bacteria | 5066 |
| 892 | Ga0496118_0036217 | 3300048921 | Bacteria | 3994 |
| 893 | Ga0496118_0066197 | 3300048921 | Bacteria | 2638 |
| 894 | Ga0496118_0160726 | 3300048921 | Bacteria | 1389 |
| 895 | Ga0496119_0011139 | 3300048922 | Bacteria | 7489 |
| 896 | Ga0496119_0018504 | 3300048922 | Bacteria | 5180 |
| 897 | Ga0496119_0186895 | 3300048922 | Bacteria | 1082 |
| 898 | Ga0496120_0006672 | 3300048923 | Bacteria | 8800 |
| 899 | Ga0496120_0015474 | 3300048923 | Bacteria | 5027 |
| 900 | Ga0496121_0002154 | 3300048924 | Bacteria | 30800 |
| 901 | Ga0496121_0003781 | 3300048924 | Bacteria | 21129 |
| 902 | Ga0496121_0006663 | 3300048924 | Bacteria | 14210 |
| 903 | Ga0496121_0070840 | 3300048924 | Bacteria | 2806 |
| 904 | Ga0496121_0073869 | 3300048924 | Bacteria | 2730 |
| 905 | Ga0496121_0116432 | 3300048924 | Bacteria | 2027 |
| 906 | Ga0496121_0155195 | 3300048924 | Bacteria | 1680 |
| 907 | Ga0496122_0001544 | 3300048925 | Bacteria | 36564 |
| 908 | Ga0496122_0007180 | 3300048925 | Bacteria | 12474 |
| 909 | Ga0496122_0007285 | 3300048925 | Bacteria | 12364 |
| 910 | Ga0496122_0007413 | 3300048925 | Bacteria | 12203 |
| 911 | Ga0496122_0010797 | 3300048925 | Bacteria | 9357 |
| 912 | Ga0496122_0067149 | 3300048925 | Bacteria | 2585 |
| 913 | Ga0496122_0097507 | 3300048925 | Bacteria | 1978 |
| 914 | Ga0496123_0000432 | 3300048926 | Bacteria | 75431 |
| 915 | Ga0496123_0007869 | 3300048926 | Bacteria | 9908 |
| 916 | Ga0496123_0014362 | 3300048926 | Bacteria | 6569 |
| 917 | Ga0496123_0024759 | 3300048926 | Bacteria | 4550 |
| 918 | Ga0496123_0032593 | 3300048926 | Bacteria | 3768 |
| 919 | Ga0496123_0041027 | 3300048926 | Bacteria | 3214 |
| 920 | Ga0496123_0083197 | 3300048926 | Bacteria | 1936 |
| 921 | Ga0496123_0115748 | 3300048926 | Bacteria | 1520 |
| 922 | Ga0496124_0002675 | 3300048927 | Bacteria | 22831 |
| 923 | Ga0496124_0006973 | 3300048927 | Bacteria | 12131 |
| 924 | Ga0496124_0009277 | 3300048927 | Bacteria | 10147 |
| 925 | Ga0496124_0012169 | 3300048927 | Bacteria | 8517 |
| 926 | Ga0496124_0013732 | 3300048927 | Bacteria | 7884 |
| 927 | Ga0496124_0023812 | 3300048927 | Bacteria | 5581 |
| 928 | Ga0496124_0024608 | 3300048927 | Bacteria | 5469 |
| 929 | Ga0496124_0038446 | 3300048927 | Bacteria | 4156 |
| 930 | Ga0496124_0052695 | 3300048927 | Bacteria | 3455 |
| 931 | Ga0496124_0084253 | 3300048927 | Bacteria | 2607 |
| 932 | Ga0496124_0088458 | 3300048927 | Bacteria | 2531 |
| 933 | Ga0496124_0143262 | 3300048927 | Bacteria | 1883 |
| 934 | Ga0496124_0183595 | 3300048927 | Bacteria | 1607 |
| 935 | Ga0496124_0224354 | 3300048927 | Bacteria | 1410 |
| 936 | Ga0496124_0236776 | 3300048927 | Bacteria | 1360 |
| 937 | Ga0496125_0000862 | 3300048928 | Bacteria | 48602 |
| 938 | Ga0496125_0002267 | 3300048928 | Bacteria | 25523 |
| 939 | Ga0496125_0002740 | 3300048928 | Bacteria | 22304 |
| 940 | Ga0496125_0005831 | 3300048928 | Bacteria | 13528 |
| 941 | Ga0496125_0027341 | 3300048928 | Bacteria | 5173 |
| 942 | Ga0496125_0034714 | 3300048928 | Bacteria | 4439 |
| 943 | Ga0496125_0035319 | 3300048928 | Bacteria | 4388 |
| 944 | Ga0496125_0050374 | 3300048928 | Bacteria | 3448 |
| 945 | Ga0496125_0083395 | 3300048928 | Bacteria | 2432 |
| 946 | Ga0496125_0292771 | 3300048928 | Bacteria | 1001 |
| 947 | Ga0496126_0032908 | 3300048929 | Bacteria | 4879 |
| 948 | Ga0496126_0108746 | 3300048929 | Bacteria | 2417 |
| 949 | Ga0496126_0115625 | 3300048929 | Bacteria | 2332 |
| 950 | Ga0495678_000033 | 3300049459 | Bacteria | 211804 |
| 951 | Ga0495678_002096 | 3300049459 | Bacteria | 14148 |
| 952 | Ga0495678_002263 | 3300049459 | Bacteria | 13353 |
| 953 | Ga0495678_003691 | 3300049459 | Bacteria | 9267 |
| 954 | Ga0495678_005769 | 3300049459 | Bacteria | 6728 |
| 955 | Ga0495678_007734 | 3300049459 | Bacteria | 5537 |
| 956 | Ga0495678_011241 | 3300049459 | Bacteria | 4297 |
| 957 | Ga0495678_015607 | 3300049459 | Bacteria | 3491 |
| 958 | Ga0495678_019538 | 3300049459 | Bacteria | 3019 |
| 959 | Ga0495678_027580 | 3300049459 | Bacteria | 2408 |
| 960 | Ga0495678_038545 | 3300049459 | Bacteria | 1932 |
| 961 | Ga0495678_073739 | 3300049459 | Bacteria | 1243 |
| 962 | Ga0495682_0000048 | 3300049460 | Bacteria | 111881 |
| 963 | Ga0495682_0000559 | 3300049460 | Bacteria | 25481 |
| 964 | Ga0495682_0001792 | 3300049460 | Bacteria | 10836 |
| 965 | Ga0495682_0007021 | 3300049460 | Bacteria | 4512 |
| 966 | Ga0495682_0008428 | 3300049460 | Bacteria | 4059 |
| 967 | Ga0501034_0000364 | 3300049571 | Bacteria | 77230 |
| 968 | Ga0501037_0045872 | 3300049573 | Bacteria | 3207 |
| 969 | Ga0501039_0200697 | 3300049575 | Bacteria | 1568 |
| 970 | Ga0501241_000490 | 3300049758 | Bacteria | 8546 |
| 971 | nmdc:mga00v17_93484_c1 | 3300050491 | Bacteria | 1891 |
| 972 | nmdc:mga08x19_201104_c1 | 3300050514 | Bacteria | 1366 |
| 973 | nmdc:mga0sz30_16158_c1 | 3300050516 | Bacteria | 2958 |
| 974 | Ga0500572_000990 | 3300053111 | Bacteria | 8601 |
| 975 | Ga0500659_0016952 | 3300053135 | Bacteria | 3971 |
| 976 | Ga0500634_0003362 | 3300053161 | Bacteria | 7087 |
| 977 | Ga0466962_0024940 | 3300061719 | Bacteria | 2871 |
| 978 | 2510283107 | 2510065053 | Bacteria | 5005518 |
| 979 | 2510293781 | 2510065055 | Bacteria | 5037935 |
| 980 | 2510310613 | 2510065058 | Bacteria | 5005894 |
| 981 | 2511254869 | 2511231004 | Bacteria | 6669789 |
| 982 | 2511280858 | 2511231008 | Bacteria | 6624100 |
| 983 | 2511300328 | 2511231012 | Bacteria | 6738011 |
| 984 | 2511326368 | 2511231016 | Bacteria | 6704427 |
| 985 | 2511336167 | 2511231018 | Bacteria | 6436256 |
| 986 | 2511342248 | 2511231019 | Bacteria | 6520662 |
| 987 | 2511356573 | 2511231021 | Bacteria | 7302637 |
| 988 | 2511362717 | 2511231022 | Bacteria | 6719296 |
| 989 | 2511371902 | 2511231023 | Bacteria | 6808468 |
| 990 | 2511414044 | 2511231031 | Bacteria | 6558529 |
| 991 | 2511824344 | 2511231156 | Bacteria | 6845832 |
| 992 | 2597030574 | 2596583598 | Bacteria | 5251611 |
| 993 | 2599328008 | 2599185155 | Bacteria | 5827168 |
| 994 | 2599397850 | 2599185167 | Bacteria | 6353609 |
| 995 | 2599447909 | 2599185178 | Bacteria | 5365746 |
| 996 | 2599452297 | 2599185179 | Bacteria | 6611171 |
| 997 | 2599502179 | 2599185188 | Bacteria | 6164180 |
| 998 | 2599513324 | 2599185190 | Bacteria | 6285678 |
| 999 | 2599518176 | 2599185191 | Bacteria | 6297582 |
| 1000 | 2599611069 | 2599185212 | Bacteria | 6765997 |
| 1001 | 2599770111 | 2599185248 | Bacteria | 6696816 |
| 1002 | 2599877968 | 2599185288 | Bacteria | 6666191 |
| 1003 | 2599887433 | 2599185289 | Bacteria | 6778765 |
| 1004 | 2599892000 | 2599185290 | Bacteria | 6289611 |
| 1005 | 2599896716 | 2599185291 | Bacteria | 6775623 |
| 1006 | 2599932761 | 2599185300 | Bacteria | 6062622 |
| 1007 | 2599946361 | 2599185302 | Bacteria | 5954930 |
| 1008 | 2599952224 | 2599185303 | Bacteria | 6512725 |
| 1009 | 2599957598 | 2599185304 | Bacteria | 5951361 |
| 1010 | 2599958830 | 2599185305 | Bacteria | 6748700 |
| 1011 | 2599965516 | 2599185306 | Bacteria | 6637356 |
| 1012 | 2599972909 | 2599185307 | Bacteria | 6194719 |
| 1013 | 2599981394 | 2599185308 | Bacteria | 6621546 |
| 1014 | 2599986672 | 2599185309 | Bacteria | 5969593 |
| 1015 | 2599992138 | 2599185310 | Bacteria | 6014457 |
| 1016 | 2599997510 | 2599185311 | Bacteria | 6354990 |
| 1017 | 2600003200 | 2599185312 | Bacteria | 5912071 |
| 1018 | 2600006145 | 2599185313 | Bacteria | 6658188 |
| 1019 | 2600015230 | 2599185314 | Bacteria | 6621749 |
| 1020 | 2600017295 | 2599185315 | Bacteria | 6771107 |
| 1021 | 2600023333 | 2599185316 | Bacteria | 6320029 |
| 1022 | 2600028246 | 2599185317 | Bacteria | 6435722 |
| 1023 | 2600035753 | 2599185318 | Bacteria | 6961590 |
| 1024 | 2600045094 | 2599185319 | Bacteria | 6637840 |
| 1025 | 2600050588 | 2599185320 | Bacteria | 5963263 |
| 1026 | 2600052118 | 2599185321 | Bacteria | 6764560 |
| 1027 | 2600057006 | 2599185322 | Bacteria | 6763055 |
| 1028 | 2600066833 | 2599185323 | Bacteria | 6688755 |
| 1029 | 2600069664 | 2599185324 | Bacteria | 6590677 |
| 1030 | 2600077510 | 2599185325 | Bacteria | 6324919 |
| 1031 | 2600357305 | 2600254930 | Bacteria | 6431253 |
| 1032 | 2600446957 | 2600254954 | Bacteria | 5100516 |
| 1033 | 2601626762 | 2600255283 | Bacteria | 6061572 |
| 1034 | 2601797096 | 2600255318 | Bacteria | 6383414 |
| 1035 | 2602010155 | 2600255389 | Bacteria | 5275336 |
| 1036 | 2606076173 | 2603880185 | Bacteria | 6379190 |
| 1037 | 2606131083 | 2603880199 | Bacteria | 6377649 |
| 1038 | 2621298807 | 2619619299 | Bacteria | 6649820 |
| 1039 | 2624481369 | 2623620443 | Bacteria | 6427864 |
| 1040 | 2643841639 | 2643221565 | Bacteria | 6216018 |
| 1041 | 2643956954 | 2643221589 | Bacteria | 6250934 |
| 1042 | 2644024877 | 2643221602 | Bacteria | 6249926 |
| 1043 | 2644186771 | 2643221633 | Bacteria | 6733554 |
| 1044 | 2644285644 | 2643221650 | Bacteria | 7029547 |
| 1045 | 2652546570 | 2651869719 | Bacteria | 6047974 |
| 1046 | 2671090894 | 2667528170 | Bacteria | 6786960 |
| 1047 | 2671124793 | 2667528176 | Bacteria | 6724917 |
| 1048 | 2678263913 | 2675903515 | Bacteria | 6580491 |
| 1049 | 2715753459 | 2713897148 | Bacteria | 5883533 |
| 1050 | 2715755889 | 2713897149 | Bacteria | 6506249 |
| 1051 | 2718634642 | 2718217725 | Bacteria | 5758958 |
| 1052 | 2738672055 | 2738541265 | Bacteria | 6594665 |
| 1053 | 2738687219 | 2738541271 | Bacteria | 5657310 |
| 1054 | 2738750448 | 2738541282 | Bacteria | 6593925 |
| 1055 | 2738810048 | 2738541294 | Bacteria | 6925949 |
| 1056 | 2738859489 | 2738541303 | Bacteria | 6591772 |
| 1057 | 2738897408 | 2738541309 | Bacteria | 6926455 |
| 1058 | 2739197669 | 2738543004 | Bacteria | 6381073 |
| 1059 | 2739262840 | 2738543016 | Bacteria | 5657564 |
| 1060 | 2739287715 | 2738543020 | Bacteria | 5718238 |
| 1061 | 2739293027 | 2738543021 | Bacteria | 5718241 |
| 1062 | 2739316245 | 2738543025 | Bacteria | 6600348 |
| 1063 | 2745004365 | 2744054620 | Bacteria | 6551379 |
| 1064 | 2765585564 | 2765235841 | Bacteria | 6137024 |
| 1065 | 2774123252 | 2773857670 | Bacteria | 6407454 |
| 1066 | 2774131194 | 2773857672 | Bacteria | 4993178 |
| 1067 | 2774137922 | 2773857673 | Bacteria | 6513460 |
| 1068 | 2784265026 | 2784132063 | Bacteria | 6262788 |
| 1069 | 2784315776 | 2784132072 | Bacteria | 6596533 |
| 1070 | 2794597807 | 2791355520 | Bacteria | 5948615 |
| 1071 | 2808854872 | 2808606361 | Bacteria | 6136259 |
| 1072 | 2808926346 | 2808606376 | Bacteria | 6248667 |
| 1073 | 2808932991 | 2808606377 | Bacteria | 6646337 |
| 1074 | 2808934933 | 2808606378 | Bacteria | 6177535 |
| 1075 | 2808948447 | 2808606380 | Bacteria | 6248705 |
| 1076 | 2808955110 | 2808606381 | Bacteria | 6646461 |
| 1077 | 2808958323 | 2808606382 | Bacteria | 6841132 |
| 1078 | 2808963330 | 2808606383 | Bacteria | 6138645 |
| 1079 | 2808976983 | 2808606385 | Bacteria | 6711065 |
| 1080 | 2808992138 | 2808606388 | Bacteria | 6706662 |
| 1081 | 2808998265 | 2808606389 | Bacteria | 6138126 |
| 1082 | 2809214480 | 2808606445 | Bacteria | 6057339 |
| 1083 | 2817492032 | 2816332298 | Bacteria | 6852809 |
| 1084 | 2819656750 | 2818991456 | Bacteria | 6123676 |
| 1085 | 2823422650 | 2823421272 | Bacteria | 5372474 |
| 1086 | 2825657306 | 2825651385 | Bacteria | 6715909 |
| 1087 | 2826582688 | 2826581358 | Bacteria | 5963467 |
| 1088 | 2834032842 | 2834028612 | Bacteria | 6354979 |
| 1089 | 2842806272 | 2842805378 | Bacteria | 5385175 |
| 1090 | 2842819280 | 2842815866 | Bacteria | 5947510 |
| 1091 | 2842836220 | 2842832357 | Bacteria | 5959113 |
| 1092 | 2842844081 | 2842843487 | Bacteria | 6004777 |
| 1093 | 2842852606 | 2842849001 | Bacteria | 5924277 |
| 1094 | 2852613683 | 2852612431 | Bacteria | 6885235 |
| 1095 | 2852659533 | 2852657418 | Bacteria | 6472974 |
| 1096 | 2852668581 | 2852667396 | Bacteria | 6885555 |
| 1097 | 2860342327 | 2860339153 | Bacteria | 6846989 |
| 1098 | 2860871176 | 2860867994 | Bacteria | 5645326 |
| 1099 | 2878033343 | 2878029506 | Bacteria | 6418441 |
| 1100 | 2880232937 | 2880230671 | Bacteria | 6140320 |
| 1101 | 2885270536 | 2885266251 | Bacteria | 4796748 |
| 1102 | 2904520330 | 2904518522 | Bacteria | 6068986 |
| 1103 | 2908450522 | 2908446538 | Bacteria | 6829095 |
| 1104 | 2913039265 | 2913036834 | Bacteria | 6704877 |
| 1105 | 2919066955 | 2919063839 | Bacteria | 6302690 |
| 1106 | 2919387523 | 2919385768 | Bacteria | 5897293 |
| 1107 | 2919459009 | 2919456309 | Bacteria | 6586567 |
| 1108 | 2919485267 | 2919481497 | Bacteria | 6907839 |
| 1109 | 2919492178 | 2919487758 | Bacteria | 5929766 |
| 1110 | 2919504911 | 2919501602 | Bacteria | 5286340 |
| 1111 | 2923586608 | 2923586266 | Bacteria | 6565975 |
| 1112 | 2926066588 | 2926063275 | Bacteria | 5285848 |
| 1113 | 2928058905 | 2928058823 | Bacteria | 5520022 |
| 1114 | 2929146515 | 2929144301 | Bacteria | 6622272 |
| 1115 | 2929193247 | 2929189879 | Bacteria | 5930554 |
| 1116 | 2931369772 | 2931369376 | Bacteria | 6847892 |
| 1117 | 2931394525 | 2931390751 | Bacteria | 6273349 |
| 1118 | 2931402410 | 2931396565 | Bacteria | 7251677 |
| 1119 | 2945934214 | 2945928738 | Bacteria | 6053221 |
| 1120 | 2945964834 | 2945961074 | Bacteria | 7342064 |
| 1121 | 2946008993 | 2946006987 | Bacteria | 6705746 |
| 1122 | 2946031528 | 2946027586 | Bacteria | 6049274 |
| 1123 | 2969308106 | 2969304461 | Bacteria | 6601805 |
| 1124 | 2974290407 | 2974289157 | Bacteria | 6080362 |
| 1125 | 2974302737 | 2974298342 | Bacteria | 4840922 |
| 1126 | 2984499677 | 2984499530 | Bacteria | 5020881 |
| 1127 | 2988729487 | 2988728565 | Bacteria | 6124362 |
| 1128 | 2998143444 | 2998139840 | Bacteria | 6073514 |
| 1129 | 3007255981 | 3007252601 | Bacteria | 4559114 |
| 1130 | 3007319945 | 3007315729 | Bacteria | 5076637 |
| 1131 | 3007421295 | 3007419365 | Bacteria | 7026924 |
| 1132 | 3007514608 | 3007511990 | Bacteria | 6481491 |
| 1133 | 3007616775 | 3007614139 | Bacteria | 6053559 |
| 1134 | 3007621839 | 3007619802 | Bacteria | 6411688 |
| 1135 | 3007808180 | 3007803356 | Bacteria | 5931491 |
| 1136 | 3007857947 | 3007855910 | Bacteria | 5637581 |
| 1137 | 3007861582 | 3007861166 | Bacteria | 6045338 |
| 1138 | 3007869859 | 3007866637 | Bacteria | 5899198 |
| 1139 | 3007873126 | 3007872151 | Bacteria | 5268868 |
| 1140 | 651177883 | 651053060 | Bacteria | 4689946 |
| 1141 | 8029997375 | 8029995093 | Bacteria | 5990776 |
| 1142 | 8034966181 | 8034962539 | Bacteria | 4884839 |
| 1143 | 8052498760 | 8052494512 | Bacteria | 5765634 |
| 1144 | 8054507037 | 8054503363 | Bacteria | 6101651 |
| 1145 | 8054929876 | 8054929484 | Bacteria | 5599761 |
| 1146 | 8055821994 | 8055817908 | Bacteria | 6609162 |
| 1147 | 8056129287 | 8056125926 | Bacteria | 6228218 |
| 1148 | 8056135468 | 8056131705 | Bacteria | 6107031 |
| 1149 | 8056143004 | 8056137416 | Bacteria | 6147080 |
| 1150 | 8056157637 | 8056155041 | Bacteria | 6486948 |
| 1151 | 8056165266 | 8056161164 | Bacteria | 6106669 |
| 1152 | 8056167767 | 8056166840 | Bacteria | 5820959 |
| 1153 | 8056178524 | 8056177738 | Bacteria | 6748268 |
| 1154 | 8056574171 | 8056569372 | Bacteria | 5997322 |
| 1155 | Ga0209563_108032 | |||
| 1156 | MRS2a_Contig_32 | |||
| 1157 | SwRhRL2b_contig_2563440 | |||
| 1158 | JGI24741J21665_1006214 | |||
| 1159 | JGI24740J21852_10000535 | |||
| 1160 | JGI25156J39149_1002050 | |||
| 1161 | JGI25154J39366_1000525 | |||
| 1162 | Ga0055538_1003308 | |||
| 1163 | Ga0055538_1003844 | |||
| 1164 | Ga0055539_1000101 | |||
| 1165 | Ga0055533_1000318 | |||
| 1166 | Ga0055532_1000037 | |||
| 1167 | Ga0055525_1000503 | |||
| 1168 | Ga0055527_1001383 | |||
| 1169 | Ga0055535_1000018 | |||
| 1170 | Ga0055529_1000041 | |||
| 1171 | Ga0055536_1000247 | |||
| 1172 | Ga0055536_1000894 | |||
| 1173 | Ga0055530_10000109 | |||
| 1174 | Ga0055530_10001177 | |||
| 1175 | Ga0055540_1000266 | |||
| 1176 | Ga0055540_1005232 | |||
| 1177 | Ga0055531_10000377 | |||
| 1178 | Ga0055541_1000755 | |||
| 1179 | Ga0065714_10000449 | |||
| 1180 | Ga0065714_10004001 | |||
| 1181 | Ga0065714_10006530 | |||
| 1182 | Ga0065714_10011686 | |||
| 1183 | Ga0065714_10066152 | |||
| 1184 | Ga0065714_10066673 | |||
| 1185 | Ga0065714_10067016 | |||
| 1186 | Ga0065714_10072537 | |||
| 1187 | Ga0065714_10073979 | |||
| 1188 | Ga0065714_10076940 | |||
| 1189 | Ga0065712_10006549 | |||
| 1190 | Ga0065712_10068058 | |||
| 1191 | Ga0065715_10016357 | |||
| 1192 | Ga0070670_100000303 | |||
| 1193 | Ga0070661_100001702 | |||
| 1194 | Ga0070669_100000891 | |||
| 1195 | Ga0070669_100125333 | |||
| 1196 | Ga0070663_100000049 | |||
| 1197 | Ga0070662_100129808 | |||
| 1198 | Ga0068867_100350196 | |||
| 1199 | Ga0070665_100037155 | |||
| 1200 | Ga0070664_100000026 | |||
| 1201 | Ga0070664_100572612 | |||
| 1202 | Ga0068857_100024830 | |||
| 1203 | Ga0068854_100000041 | |||
| 1204 | Ga0068854_100067887 | |||
| 1205 | Ga0068856_100000643 | |||
| 1206 | Ga0068851_10000132 | |||
| 1207 | Ga0075432_10000427 | |||
| 1208 | Ga0075432_10019531 | |||
| 1209 | Ga0075432_10035610 | |||
| 1210 | Ga0075362_10011019 | |||
| 1211 | Ga0075436_100090954 | |||
| 1212 | Ga0099823_1003243 | |||
| 1213 | Ga0079104_1000988 | |||
| 1214 | Ga0079104_1001530 | |||
| 1215 | Ga0099826_10050724 | |||
| 1216 | Ga0105251_10000142 | |||
| 1217 | Ga0105251_10000764 | |||
| 1218 | Ga0105251_10001353 | |||
| 1219 | Ga0105251_10001616 | |||
| 1220 | Ga0105251_10004886 | |||
| 1221 | Ga0105251_10005941 | |||
| 1222 | Ga0105251_10006325 | |||
| 1223 | Ga0105251_10015235 | |||
| 1224 | Ga0105251_10017095 | |||
| 1225 | Ga0105251_10034303 | |||
| 1226 | Ga0105251_10157321 | |||
| 1227 | Ga0105244_10002677 | |||
| 1228 | Ga0105244_10005092 | |||
| 1229 | Ga0105244_10007642 | |||
| 1230 | Ga0105244_10041855 | |||
| 1231 | Ga0105244_10041892 | |||
| 1232 | Ga0105244_10062634 | |||
| 1233 | Ga0105244_10113695 | |||
| 1234 | Ga0105244_10199567 | |||
| 1235 | Ga0105250_10000222 | |||
| 1236 | Ga0105250_10000591 | |||
| 1237 | Ga0105250_10005506 | |||
| 1238 | Ga0105250_10012609 | |||
| 1239 | Ga0105250_10028150 | |||
| 1240 | Ga0105250_10039270 | |||
| 1241 | Ga0105250_10076759 | |||
| 1242 | Ga0105250_10077354 | |||
| 1243 | Ga0105240_10110436 | |||
| 1244 | Ga0105240_10306171 | |||
| 1245 | Ga0105243_10007662 | |||
| 1246 | Ga0105243_10033843 | |||
| 1247 | Ga0105243_10069274 | |||
| 1248 | Ga0105246_10007319 | |||
| 1249 | Ga0105246_10025303 | |||
| 1250 | Ga0105246_10064538 | |||
| 1251 | Ga0157345_1000073 | |||
| 1252 | Ga0157373_10000784 | |||
| 1253 | Ga0157373_10002739 | |||
| 1254 | Ga0157373_10003218 | |||
| 1255 | Ga0157373_10010953 | |||
| 1256 | Ga0157373_10018633 | |||
| 1257 | Ga0157373_10021507 | |||
| 1258 | Ga0157373_10235796 | |||
| 1259 | Ga0157371_10000045 | |||
| 1260 | Ga0157371_10000179 | |||
| 1261 | Ga0157371_10000771 | |||
| 1262 | Ga0157371_10004944 | |||
| 1263 | Ga0157370_10000138 | |||
| 1264 | Ga0157370_10000739 | |||
| 1265 | Ga0157370_10031156 | |||
| 1266 | Ga0157370_10148876 | |||
| 1267 | Ga0157370_10314431 | |||
| 1268 | Ga0157369_10003070 | |||
| 1269 | Ga0157369_10005262 | |||
| 1270 | Ga0157369_10008823 | |||
| 1271 | Ga0157369_10013465 | |||
| 1272 | Ga0157369_10014027 | |||
| 1273 | Ga0157369_10029097 | |||
| 1274 | Ga0157369_10039474 | |||
| 1275 | Ga0157369_10886012 | |||
| 1276 | Ga0163162_10001648 | |||
| 1277 | Ga0163162_10085776 | |||
| 1278 | Ga0163162_10180117 | |||
| 1279 | Ga0157372_10000208 | |||
| 1280 | Ga0157372_10011491 | |||
| 1281 | Ga0157372_10093397 | |||
| 1282 | Ga0157375_10001567 | |||
| 1283 | Ga0157375_10150438 | |||
| 1284 | Ga0157375_10791974 | |||
| 1285 | Ga0182008_10000604 | |||
| 1286 | Ga0182008_10003368 | |||
| 1287 | Ga0182008_10008636 | |||
| 1288 | Ga0182008_10009680 | |||
| 1289 | Ga0182008_10010072 | |||
| 1290 | Ga0182008_10010543 | |||
| 1291 | Ga0182008_10010727 | |||
| 1292 | Ga0182008_10026810 | |||
| 1293 | Ga0182008_10069389 | |||
| 1294 | Ga0182006_1000809 | |||
| 1295 | Ga0182006_1000954 | |||
| 1296 | Ga0182006_1001855 | |||
| 1297 | Ga0182006_1005517 | |||
| 1298 | Ga0182006_1006102 | |||
| 1299 | Ga0182006_1047866 | |||
| 1300 | Ga0182006_1058175 | |||
| 1301 | Ga0182006_1101684 | |||
| 1302 | Ga0182007_10001820 | |||
| 1303 | Ga0182007_10007985 | |||
| 1304 | Ga0182005_1001427 | |||
| 1305 | Ga0182005_1037794 | |||
| 1306 | Ga0182005_1037815 | |||
| 1307 | Ga0163161_10001925 | |||
| 1308 | Ga0163161_10004304 | |||
| 1309 | Ga0163161_10005239 | |||
| 1310 | Ga0163161_10022110 | |||
| 1311 | Ga0163161_10025470 | |||
| 1312 | Ga0163161_10030774 | |||
| 1313 | Ga0163161_10044999 | |||
| 1314 | Ga0163161_10071559 | |||
| 1315 | Ga0163161_10105864 | |||
| 1316 | Ga0154015_1488054 | |||
| 1317 | Ga0209784_100070 | |||
| 1318 | Ga0209784_100427 | |||
| 1319 | Ga0209566_100084 | |||
| 1320 | Ga0209566_100360 | |||
| 1321 | Ga0209566_100933 | |||
| 1322 | Ga0209674_100089 | |||
| 1323 | Ga0209674_100138 | |||
| 1324 | Ga0209672_100184 | |||
| 1325 | Ga0209147_100005 | |||
| 1326 | Ga0209563_100102 | |||
| 1327 | Ga0209563_108295 | |||
| 1328 | Ga0209258_100007 | |||
| 1329 | Ga0209646_1000065 | |||
| 1330 | Ga0209026_1005899 | |||
| 1331 | Ga0209677_100062 | |||
| 1332 | Ga0209677_104761 | |||
| 1333 | Ga0209148_1000406 | |||
| 1334 | Ga0209759_1001726 | |||
| 1335 | Ga0209759_1004618 | |||
| 1336 | Ga0209759_1006419 | |||
| 1337 | Ga0209759_1019596 | |||
| 1338 | Ga0209455_1000011 | |||
| 1339 | Ga0209675_1010692 | |||
| 1340 | Ga0209676_1000002 | |||
| 1341 | Ga0209676_1000154 | |||
| 1342 | Ga0209676_1004916 | |||
| 1343 | Ga0209676_1008386 | |||
| 1344 | Ga0209050_1000006 | |||
| 1345 | Ga0209050_1000043 | |||
| 1346 | Ga0209050_1000914 | |||
| 1347 | Ga0209051_1000001 | |||
| 1348 | Ga0209051_1000030 | |||
| 1349 | Ga0209051_1002770 | |||
| 1350 | Ga0209257_1000056 | |||
| 1351 | Ga0209257_1016129 | |||
| 1352 | Ga0207656_10000880 | |||
| 1353 | Ga0207696_1000010 | |||
| 1354 | Ga0207696_1000051 | |||
| 1355 | Ga0207696_1000108 | |||
| 1356 | Ga0207696_1000265 | |||
| 1357 | Ga0207696_1001374 | |||
| 1358 | Ga0207696_1006716 | |||
| 1359 | Ga0207696_1038370 | |||
| 1360 | Ga0207696_1047092 | |||
| 1361 | Ga0207655_1000019 | |||
| 1362 | Ga0207655_1001198 | |||
| 1363 | Ga0207655_1001270 | |||
| 1364 | Ga0207655_1001582 | |||
| 1365 | Ga0207655_1001647 | |||
| 1366 | Ga0207655_1002884 | |||
| 1367 | Ga0207655_1002917 | |||
| 1368 | Ga0207655_1008179 | |||
| 1369 | Ga0207655_1009176 | |||
| 1370 | Ga0207655_1009230 | |||
| 1371 | Ga0207655_1011568 | |||
| 1372 | Ga0207655_1038289 | |||
| 1373 | Ga0207655_1071165 | |||
| 1374 | Ga0207713_1000149 | |||
| 1375 | Ga0207713_1000200 | |||
| 1376 | Ga0207713_1000238 | |||
| 1377 | Ga0207713_1001649 | |||
| 1378 | Ga0207713_1002121 | |||
| 1379 | Ga0207713_1002307 | |||
| 1380 | Ga0207713_1004491 | |||
| 1381 | Ga0207713_1007231 | |||
| 1382 | Ga0207713_1007490 | |||
| 1383 | Ga0207713_1007593 | |||
| 1384 | Ga0207713_1008034 | |||
| 1385 | Ga0207713_1009056 | |||
| 1386 | Ga0207713_1014335 | |||
| 1387 | Ga0207713_1018709 | |||
| 1388 | Ga0207713_1023644 | |||
| 1389 | Ga0207713_1024600 | |||
| 1390 | Ga0207713_1027244 | |||
| 1391 | Ga0207713_1035172 | |||
| 1392 | Ga0207713_1041561 | |||
| 1393 | Ga0207713_1105912 | |||
| 1394 | Ga0207695_10001731 | |||
| 1395 | Ga0207649_10000174 | |||
| 1396 | Ga0207681_10004855 | |||
| 1397 | Ga0207681_10043998 | |||
| 1398 | Ga0207681_10091864 | |||
| 1399 | Ga0207650_10000068 | |||
| 1400 | Ga0207709_10016517 | |||
| 1401 | Ga0207709_10043733 | |||
| 1402 | Ga0207709_10044206 | |||
| 1403 | Ga0207709_10083853 | |||
| 1404 | Ga0207679_10000048 | |||
| 1405 | Ga0207679_10295484 | |||
| 1406 | Ga0207640_10000056 | |||
| 1407 | Ga0207678_10000044 | |||
| 1408 | Ga0207702_10000118 | |||
| 1409 | Ga0207674_10048848 | |||
| 1410 | Ga0209281_1000011 | |||
| 1411 | Ga0209281_1000063 | |||
| 1412 | Ga0209973_1001498 | |||
| 1413 | Ga0209389_1001081 | |||
| 1414 | Ga0209371_1000197 | |||
| 1415 | Ga0209371_1000902 | |||
| 1416 | Ga0209371_1009273 | |||
| 1417 | Ga0209996_1001394 | |||
| 1418 | Ga0209995_1002594 | |||
| 1419 | Ga0209982_1005552 | |||
| 1420 | Ga0210002_1014919 | |||
| 1421 | Ga0209983_1002786 | |||
| 1422 | Ga0209282_1101942 | |||
| 1423 | Ga0209971_1011095 | |||
| 1424 | Ga0207428_10032617 | |||
| 1425 | Ga0207428_10041705 | |||
| 1426 | Ga0207428_10141486 | |||
| 1427 | Ga0207428_10162073 | |||
| 1428 | Ga0207428_10169050 | |||
| 1429 | Ga0268256_1000147 | |||
| 1430 | Ga0268256_1000787 | |||
| 1431 | Ga0268256_1009813 | |||
| 1432 | Ga0307511_10176658 | |||
| 1433 | Ga0314311_1022032 | |||
| 1434 | Ga0316183_1179864 | |||
| 1435 | Ga0265340_10092417 | |||
| 1436 | Ga0307408_100000047 | |||
| 1437 | Ga0307408_100130226 | |||
| 1438 | Ga0307408_100148058 | |||
| 1439 | Ga0307405_10008864 | |||
| 1440 | Ga0307405_10167451 | |||
| 1441 | Ga0307413_10034348 | |||
| 1442 | Ga0307406_10068256 | |||
| 1443 | Ga0307407_10028595 | |||
| 1444 | Ga0307412_10041266 | |||
| 1445 | Ga0307409_100064165 | |||
| 1446 | Ga0307409_100570942 | |||
| 1447 | Ga0307414_10039706 | |||
| 1448 | Ga0307414_10048973 | |||
| 1449 | Ga0307414_10083382 | |||
| 1450 | Ga0307414_10202898 | |||
| 1451 | Ga0307414_10274990 | |||
| 1452 | Ga0307411_10008071 | |||
| 1453 | Ga0307411_10022756 | |||
| 1454 | Ga0307510_10002555 | |||
| 1455 | Ga0395899_0117586 | |||
| 1456 | Ga0395900_0044647 | |||
| 1457 | Ga0395905_0014134 | |||
| 1458 | Ga0395905_0210485 | |||
| 1459 | Ga0436361_1135527 | |||
| 1460 | Ga0439438_000615 | |||
| 1461 | Ga0439438_000928 | |||
| 1462 | Ga0439438_001187 | |||
| 1463 | Ga0439438_002024 | |||
| 1464 | Ga0439438_004018 | |||
| 1465 | Ga0439438_015509 | |||
| 1466 | Ga0439438_027492 | |||
| 1467 | Ga0439447_001974 | |||
| 1468 | Ga0439447_002212 | |||
| 1469 | Ga0439447_008653 | |||
| 1470 | Ga0439447_020151 | |||
| 1471 | Ga0439466_0002396 | |||
| 1472 | Ga0439466_0007235 | |||
| 1473 | Ga0439466_0010817 | |||
| 1474 | Ga0439466_0015700 | |||
| 1475 | Ga0439466_0025868 | |||
| 1476 | Ga0439466_0029082 | |||
| 1477 | Ga0439466_0047293 | |||
| 1478 | Ga0439465_0020028 | |||
| 1479 | Ga0439465_0057772 | |||
| 1480 | Ga0451807_2340530 | |||
| 1481 | Ga0439431_0034920 | |||
| 1482 | Ga0439437_002809 | |||
| 1483 | Ga0439443_007442 | |||
| 1484 | Ga0439432_001132 | |||
| 1485 | Ga0439432_001155 | |||
| 1486 | Ga0439432_006138 | |||
| 1487 | Ga0439432_007800 | |||
| 1488 | Ga0439432_009132 | |||
| 1489 | Ga0439432_014770 | |||
| 1490 | Ga0439451_005611 | |||
| 1491 | Ga0439451_007418 | |||
| 1492 | Ga0439452_000566 | |||
| 1493 | Ga0439452_000615 | |||
| 1494 | Ga0439452_000627 | |||
| 1495 | Ga0439452_002651 | |||
| 1496 | Ga0439455_0005693 | |||
| 1497 | Ga0439456_005749 | |||
| 1498 | Ga0439456_008546 | |||
| 1499 | Ga0439456_012595 | |||
| 1500 | Ga0439463_000880 | |||
| 1501 | Ga0439463_001779 | |||
| 1502 | Ga0439463_020849 | |||
| 1503 | Ga0450911_000024 | |||
| 1504 | Ga0450911_000304 | |||
| 1505 | Ga0450911_002917 | |||
| 1506 | Ga0450911_003017 | |||
| 1507 | Ga0450911_016993 | |||
| 1508 | Ga0450890_002596 | |||
| 1509 | Ga0450900_003696 | |||
| 1510 | Ga0450900_004241 | |||
| 1511 | Ga0450903_002054 | |||
| 1512 | Ga0450903_002641 | |||
| 1513 | Ga0450903_010363 | |||
| 1514 | Ga0450904_003779 | |||
| 1515 | Ga0450905_000822 | |||
| 1516 | Ga0450905_009341 | |||
| 1517 | Ga0450906_005981 | |||
| 1518 | Ga0450907_000140 | |||
| 1519 | Ga0450907_001222 | |||
| 1520 | Ga0439446_0000241 | |||
| 1521 | Ga0439446_0011400 | |||
| 1522 | Ga0439446_0011980 | |||
| 1523 | Ga0439446_0027562 | |||
| 1524 | Ga0450908_004020 | |||
| 1525 | Ga0450909_004719 | |||
| 1526 | Ga0439434_0000827 | |||
| 1527 | Ga0439459_0001076 | |||
| 1528 | Ga0439464_0000759 | |||
| 1529 | Ga0439464_0009730 | |||
| 1530 | Ga0439464_0019554 | |||
| 1531 | Ga0439460_0001121 | |||
| 1532 | Ga0439460_0004872 | |||
| 1533 | Ga0450893_0001853 | |||
| 1534 | Ga0439440_0001496 | |||
| 1535 | Ga0466986_0050870 | |||
| 1536 | Ga0466972_0004019 | |||
| 1537 | Ga0466965_0009444 | |||
| 1538 | Ga0466961_0001037 | |||
| 1539 | Ga0466968_0010508 | |||
| 1540 | Ga0466970_0000782 | |||
| 1541 | Ga0466957_0069500 | |||
| 1542 | Ga0466959_0076435 | |||
| 1543 | Ga0495617_000616 | |||
| 1544 | Ga0495617_000954 | |||
| 1545 | Ga0495617_002643 | |||
| 1546 | Ga0495617_007481 | |||
| 1547 | Ga0495617_011546 | |||
| 1548 | Ga0495617_035466 | |||
| 1549 | Ga0495617_058240 | |||
| 1550 | Ga0495627_000121 | |||
| 1551 | Ga0495627_000322 | |||
| 1552 | Ga0495627_000415 | |||
| 1553 | Ga0495627_001501 | |||
| 1554 | Ga0495627_001674 | |||
| 1555 | Ga0495627_002287 | |||
| 1556 | Ga0495627_005289 | |||
| 1557 | Ga0495627_012620 | |||
| 1558 | Ga0495627_014492 | |||
| 1559 | Ga0495603_0007516 | |||
| 1560 | Ga0495603_0008796 | |||
| 1561 | Ga0495603_0015412 | |||
| 1562 | Ga0495590_0001143 | |||
| 1563 | Ga0495590_0001995 | |||
| 1564 | Ga0495590_0004895 | |||
| 1565 | Ga0495590_0005560 | |||
| 1566 | Ga0495591_000046 | |||
| 1567 | Ga0495591_000453 | |||
| 1568 | Ga0495591_000497 | |||
| 1569 | Ga0495591_000533 | |||
| 1570 | Ga0495591_000845 | |||
| 1571 | Ga0495591_001036 | |||
| 1572 | Ga0495591_001113 | |||
| 1573 | Ga0495591_002186 | |||
| 1574 | Ga0495591_007442 | |||
| 1575 | Ga0495591_010393 | |||
| 1576 | Ga0495591_016732 | |||
| 1577 | Ga0495591_018805 | |||
| 1578 | Ga0495629_0030422 | |||
| 1579 | Ga0495638_0003846 | |||
| 1580 | Ga0495638_0004285 | |||
| 1581 | Ga0495638_0021671 | |||
| 1582 | Ga0495638_0025145 | |||
| 1583 | Ga0495638_0025751 | |||
| 1584 | Ga0495638_0027672 | |||
| 1585 | Ga0495638_0035324 | |||
| 1586 | Ga0495638_0041442 | |||
| 1587 | Ga0495638_0045282 | |||
| 1588 | Ga0495638_0048482 | |||
| 1589 | Ga0495638_0054129 | |||
| 1590 | Ga0495638_0081219 | |||
| 1591 | Ga0495638_0168222 | |||
| 1592 | Ga0495638_0219254 | |||
| 1593 | Ga0495653_0036306 | |||
| 1594 | Ga0495653_0048718 | |||
| 1595 | Ga0495653_0150355 | |||
| 1596 | Ga0495650_0000354 | |||
| 1597 | Ga0495650_0003370 | |||
| 1598 | Ga0495650_0004035 | |||
| 1599 | Ga0495650_0007460 | |||
| 1600 | Ga0495650_0010744 | |||
| 1601 | Ga0495650_0018075 | |||
| 1602 | Ga0495650_0019361 | |||
| 1603 | Ga0495650_0033348 | |||
| 1604 | Ga0495650_0069294 | |||
| 1605 | Ga0495582_0106260 | |||
| 1606 | Ga0495605_0000032 | |||
| 1607 | Ga0495605_0000167 | |||
| 1608 | Ga0495605_0000285 | |||
| 1609 | Ga0495605_0000447 | |||
| 1610 | Ga0495605_0000997 | |||
| 1611 | Ga0495605_0003338 | |||
| 1612 | Ga0495605_0003424 | |||
| 1613 | Ga0495605_0008822 | |||
| 1614 | Ga0495605_0009407 | |||
| 1615 | Ga0495605_0017155 | |||
| 1616 | Ga0495605_0019997 | |||
| 1617 | Ga0495605_0021447 | |||
| 1618 | Ga0495605_0027244 | |||
| 1619 | Ga0495605_0033851 | |||
| 1620 | Ga0495639_0050206 | |||
| 1621 | Ga0495664_0118498 | |||
| 1622 | Ga0495584_0000595 | |||
| 1623 | Ga0495584_0001259 | |||
| 1624 | Ga0495584_0001699 | |||
| 1625 | Ga0495584_0002065 | |||
| 1626 | Ga0495584_0004158 | |||
| 1627 | Ga0495584_0012342 | |||
| 1628 | Ga0495584_0038041 | |||
| 1629 | Ga0495584_0039034 | |||
| 1630 | Ga0495584_0083007 | |||
| 1631 | Ga0495585_0003473 | |||
| 1632 | Ga0495585_0003983 | |||
| 1633 | Ga0495585_0005149 | |||
| 1634 | Ga0495585_0009135 | |||
| 1635 | Ga0495585_0009721 | |||
| 1636 | Ga0495585_0035148 | |||
| 1637 | Ga0495585_0076537 | |||
| 1638 | Ga0495594_0008081 | |||
| 1639 | Ga0495594_0063674 | |||
| 1640 | Ga0495594_0081811 | |||
| 1641 | Ga0495596_0001522 | |||
| 1642 | Ga0495596_0002325 | |||
| 1643 | Ga0495596_0006689 | |||
| 1644 | Ga0495607_0000102 | |||
| 1645 | Ga0495607_0000242 | |||
| 1646 | Ga0495607_0000737 | |||
| 1647 | Ga0495607_0001738 | |||
| 1648 | Ga0495607_0001923 | |||
| 1649 | Ga0495607_0002240 | |||
| 1650 | Ga0495607_0003760 | |||
| 1651 | Ga0495607_0006495 | |||
| 1652 | Ga0495607_0007369 | |||
| 1653 | Ga0495607_0010802 | |||
| 1654 | Ga0495607_0012362 | |||
| 1655 | Ga0495607_0020962 | |||
| 1656 | Ga0495607_0023780 | |||
| 1657 | Ga0495607_0024528 | |||
| 1658 | Ga0495607_0036402 | |||
| 1659 | Ga0495607_0038674 | |||
| 1660 | Ga0495607_0042101 | |||
| 1661 | Ga0495607_0042153 | |||
| 1662 | Ga0495607_0047338 | |||
| 1663 | Ga0495607_0055297 | |||
| 1664 | Ga0495607_0197718 | |||
| 1665 | Ga0495583_0000052 | |||
| 1666 | Ga0495583_0000813 | |||
| 1667 | Ga0495583_0001116 | |||
| 1668 | Ga0495583_0002139 | |||
| 1669 | Ga0495583_0003186 | |||
| 1670 | Ga0495583_0003865 | |||
| 1671 | Ga0495583_0005055 | |||
| 1672 | Ga0495583_0023815 | |||
| 1673 | Ga0495583_0032802 | |||
| 1674 | Ga0495606_0000313 | |||
| 1675 | Ga0495606_0000334 | |||
| 1676 | Ga0495606_0000613 | |||
| 1677 | Ga0495606_0003409 | |||
| 1678 | Ga0495606_0005514 | |||
| 1679 | Ga0495606_0006668 | |||
| 1680 | Ga0495606_0008724 | |||
| 1681 | Ga0495606_0010535 | |||
| 1682 | Ga0495606_0014568 | |||
| 1683 | Ga0495606_0024619 | |||
| 1684 | Ga0495606_0035775 | |||
| 1685 | Ga0495606_0082837 | |||
| 1686 | Ga0495606_0140996 | |||
| 1687 | Ga0495606_0191890 | |||
| 1688 | Ga0495610_0002525 | |||
| 1689 | Ga0495610_0004046 | |||
| 1690 | Ga0495610_0008962 | |||
| 1691 | Ga0495610_0011091 | |||
| 1692 | Ga0495610_0013686 | |||
| 1693 | Ga0495610_0022364 | |||
| 1694 | Ga0495610_0026713 | |||
| 1695 | Ga0495610_0029528 | |||
| 1696 | Ga0495610_0034280 | |||
| 1697 | Ga0495610_0034977 | |||
| 1698 | Ga0495610_0036167 | |||
| 1699 | Ga0495610_0037992 | |||
| 1700 | Ga0495616_0001028 | |||
| 1701 | Ga0495616_0003271 | |||
| 1702 | Ga0495616_0006422 | |||
| 1703 | Ga0495616_0006466 | |||
| 1704 | Ga0495616_0007579 | |||
| 1705 | Ga0495616_0010273 | |||
| 1706 | Ga0495616_0011121 | |||
| 1707 | Ga0495616_0043031 | |||
| 1708 | Ga0495616_0072586 | |||
| 1709 | Ga0495620_0000019 | |||
| 1710 | Ga0495620_0000231 | |||
| 1711 | Ga0495620_0000771 | |||
| 1712 | Ga0495620_0000823 | |||
| 1713 | Ga0495620_0001116 | |||
| 1714 | Ga0495620_0006294 | |||
| 1715 | Ga0495620_0014004 | |||
| 1716 | Ga0495620_0028027 | |||
| 1717 | Ga0495620_0035317 | |||
| 1718 | Ga0495620_0058531 | |||
| 1719 | Ga0495628_0172821 | |||
| 1720 | Ga0495631_0000275 | |||
| 1721 | Ga0495631_0001351 | |||
| 1722 | Ga0495631_0002056 | |||
| 1723 | Ga0495631_0022501 | |||
| 1724 | Ga0495631_0035596 | |||
| 1725 | Ga0495632_0001540 | |||
| 1726 | Ga0495632_0002549 | |||
| 1727 | Ga0495632_0003418 | |||
| 1728 | Ga0495632_0003446 | |||
| 1729 | Ga0495632_0003919 | |||
| 1730 | Ga0495632_0009814 | |||
| 1731 | Ga0495632_0013087 | |||
| 1732 | Ga0495632_0013809 | |||
| 1733 | Ga0495632_0022113 | |||
| 1734 | Ga0495632_0033843 | |||
| 1735 | Ga0495632_0043390 | |||
| 1736 | Ga0495632_0056937 | |||
| 1737 | Ga0495632_0078651 | |||
| 1738 | Ga0495632_0080047 | |||
| 1739 | Ga0495637_0000059 | |||
| 1740 | Ga0495637_0000632 | |||
| 1741 | Ga0495637_0001134 | |||
| 1742 | Ga0495637_0002657 | |||
| 1743 | Ga0495637_0005855 | |||
| 1744 | Ga0495637_0009101 | |||
| 1745 | Ga0495637_0010040 | |||
| 1746 | Ga0495637_0010277 | |||
| 1747 | Ga0495637_0016626 | |||
| 1748 | Ga0495637_0021282 | |||
| 1749 | Ga0495637_0047446 | |||
| 1750 | Ga0495637_0087377 | |||
| 1751 | Ga0495643_0000266 | |||
| 1752 | Ga0495643_0001693 | |||
| 1753 | Ga0495643_0008638 | |||
| 1754 | Ga0495643_0012053 | |||
| 1755 | Ga0495643_0014085 | |||
| 1756 | Ga0495643_0040884 | |||
| 1757 | Ga0495643_0046470 | |||
| 1758 | Ga0495643_0054454 | |||
| 1759 | Ga0495643_0068727 | |||
| 1760 | Ga0495644_0000680 | |||
| 1761 | Ga0495644_0005037 | |||
| 1762 | Ga0495648_0000438 | |||
| 1763 | Ga0495648_0002771 | |||
| 1764 | Ga0495648_0003911 | |||
| 1765 | Ga0495648_0004312 | |||
| 1766 | Ga0495648_0006250 | |||
| 1767 | Ga0495648_0007279 | |||
| 1768 | Ga0495648_0008832 | |||
| 1769 | Ga0495648_0009796 | |||
| 1770 | Ga0495648_0009996 | |||
| 1771 | Ga0495648_0019206 | |||
| 1772 | Ga0495648_0019267 | |||
| 1773 | Ga0495648_0020310 | |||
| 1774 | Ga0495648_0042543 | |||
| 1775 | Ga0495648_0057529 | |||
| 1776 | Ga0495648_0071215 | |||
| 1777 | Ga0495648_0164654 | |||
| 1778 | Ga0495666_0049656 | |||
| 1779 | Ga0495642_0000067 | |||
| 1780 | Ga0495642_0000334 | |||
| 1781 | Ga0495652_0117871 | |||
| 1782 | Ga0495652_0459552 | |||
| 1783 | Ga0495654_0001493 | |||
| 1784 | Ga0495654_0001753 | |||
| 1785 | Ga0495654_0001799 | |||
| 1786 | Ga0495654_0003078 | |||
| 1787 | Ga0495654_0004696 | |||
| 1788 | Ga0495654_0006822 | |||
| 1789 | Ga0495654_0007263 | |||
| 1790 | Ga0495654_0009895 | |||
| 1791 | Ga0495654_0016050 | |||
| 1792 | Ga0495654_0024505 | |||
| 1793 | Ga0495654_0026652 | |||
| 1794 | Ga0495654_0035101 | |||
| 1795 | Ga0495654_0046777 | |||
| 1796 | Ga0495654_0059187 | |||
| 1797 | Ga0495654_0170601 | |||
| 1798 | Ga0495586_0093540 | |||
| 1799 | Ga0495587_0004111 | |||
| 1800 | Ga0495587_0004543 | |||
| 1801 | Ga0495609_0000032 | |||
| 1802 | Ga0495609_0000123 | |||
| 1803 | Ga0495609_0000149 | |||
| 1804 | Ga0495609_0002647 | |||
| 1805 | Ga0495609_0003002 | |||
| 1806 | Ga0495609_0003293 | |||
| 1807 | Ga0495609_0005452 | |||
| 1808 | Ga0495609_0024696 | |||
| 1809 | Ga0495609_0063389 | |||
| 1810 | Ga0495609_0080169 | |||
| 1811 | Ga0495597_0000079 | |||
| 1812 | Ga0495597_0002348 | |||
| 1813 | Ga0495597_0003816 | |||
| 1814 | Ga0495597_0006047 | |||
| 1815 | Ga0495597_0013155 | |||
| 1816 | Ga0495597_0013458 | |||
| 1817 | Ga0495597_0021446 | |||
| 1818 | Ga0495597_0024942 | |||
| 1819 | Ga0495597_0026576 | |||
| 1820 | Ga0495645_0146338 | |||
| 1821 | Ga0495622_0004962 | |||
| 1822 | Ga0495622_0007287 | |||
| 1823 | Ga0495622_0021658 | |||
| 1824 | Ga0495622_0023225 | |||
| 1825 | Ga0495622_0094209 | |||
| 1826 | Ga0495622_0149743 | |||
| 1827 | Ga0495633_0000040 | |||
| 1828 | Ga0495633_0003145 | |||
| 1829 | Ga0495633_0003537 | |||
| 1830 | Ga0495656_0002252 | |||
| 1831 | Ga0495656_0093944 | |||
| 1832 | Ga0495668_0002597 | |||
| 1833 | Ga0495668_0002653 | |||
| 1834 | Ga0495668_0004541 | |||
| 1835 | Ga0495668_0031582 | |||
| 1836 | Ga0495634_0010691 | |||
| 1837 | Ga0495611_0000609 | |||
| 1838 | Ga0495611_0000776 | |||
| 1839 | Ga0495611_0000840 | |||
| 1840 | Ga0495611_0017655 | |||
| 1841 | Ga0495611_0039236 | |||
| 1842 | Ga0495625_0000202 | |||
| 1843 | Ga0495625_0002362 | |||
| 1844 | Ga0495625_0003196 | |||
| 1845 | Ga0495625_0003348 | |||
| 1846 | Ga0495625_0009932 | |||
| 1847 | Ga0495625_0016538 | |||
| 1848 | Ga0495625_0043847 | |||
| 1849 | Ga0495625_0053105 | |||
| 1850 | Ga0495625_0054905 | |||
| 1851 | Ga0495625_0073803 | |||
| 1852 | Ga0495635_0005376 | |||
| 1853 | Ga0495635_0044237 | |||
| 1854 | Ga0495659_0017868 | |||
| 1855 | Ga0495661_0000037 | |||
| 1856 | Ga0495661_0000133 | |||
| 1857 | Ga0495661_0001162 | |||
| 1858 | Ga0495661_0008184 | |||
| 1859 | Ga0495661_0021817 | |||
| 1860 | Ga0495661_0025296 | |||
| 1861 | Ga0495661_0065424 | |||
| 1862 | Ga0495588_0038216 | |||
| 1863 | Ga0495588_0038364 | |||
| 1864 | Ga0495657_0066123 | |||
| 1865 | Ga0495623_0006054 | |||
| 1866 | Ga0495623_0023457 | |||
| 1867 | Ga0495623_0166986 | |||
| 1868 | Ga0495646_0012609 | |||
| 1869 | Ga0495646_0084923 | |||
| 1870 | Ga0495669_0005517 | |||
| 1871 | Ga0495669_0074545 | |||
| 1872 | Ga0495613_0014714 | |||
| 1873 | Ga0495670_0000412 | |||
| 1874 | Ga0495670_0000415 | |||
| 1875 | Ga0495670_0008074 | |||
| 1876 | Ga0495670_0101960 | |||
| 1877 | Ga0495670_0106313 | |||
| 1878 | Ga0495670_0140789 | |||
| 1879 | Ga0495671_0000395 | |||
| 1880 | Ga0495671_0000934 | |||
| 1881 | Ga0495671_0001028 | |||
| 1882 | Ga0495671_0002817 | |||
| 1883 | Ga0495671_0004652 | |||
| 1884 | Ga0495671_0006752 | |||
| 1885 | Ga0495671_0010184 | |||
| 1886 | Ga0495671_0010384 | |||
| 1887 | Ga0495671_0011748 | |||
| 1888 | Ga0495671_0012595 | |||
| 1889 | Ga0495671_0015553 | |||
| 1890 | Ga0495671_0022874 | |||
| 1891 | Ga0495671_0035745 | |||
| 1892 | Ga0495671_0073728 | |||
| 1893 | Ga0495671_0100579 | |||
| 1894 | Ga0495649_0002744 | |||
| 1895 | Ga0495649_0004453 | |||
| 1896 | Ga0495649_0008523 | |||
| 1897 | Ga0495649_0021334 | |||
| 1898 | Ga0495649_0025661 | |||
| 1899 | Ga0495649_0025800 | |||
| 1900 | Ga0495649_0040856 | |||
| 1901 | Ga0495649_0069933 | |||
| 1902 | Ga0495649_0073964 | |||
| 1903 | Ga0495649_0135942 | |||
| 1904 | Ga0495589_0000220 | |||
| 1905 | Ga0495589_0000394 | |||
| 1906 | Ga0495589_0001105 | |||
| 1907 | Ga0495589_0005175 | |||
| 1908 | Ga0495589_0006484 | |||
| 1909 | Ga0495589_0008900 | |||
| 1910 | Ga0495589_0028770 | |||
| 1911 | Ga0495589_0030734 | |||
| 1912 | Ga0495589_0035766 | |||
| 1913 | Ga0495589_0042933 | |||
| 1914 | Ga0495589_0048948 | |||
| 1915 | Ga0495600_0061681 | |||
| 1916 | Ga0495600_0192110 | |||
| 1917 | Ga0495660_0000049 | |||
| 1918 | Ga0495660_0000571 | |||
| 1919 | Ga0495660_0001266 | |||
| 1920 | Ga0495660_0003854 | |||
| 1921 | Ga0495660_0005982 | |||
| 1922 | Ga0495660_0010021 | |||
| 1923 | Ga0495660_0015392 | |||
| 1924 | Ga0495660_0017024 | |||
| 1925 | Ga0495660_0026147 | |||
| 1926 | Ga0495660_0028669 | |||
| 1927 | Ga0495660_0030889 | |||
| 1928 | Ga0495660_0044155 | |||
| 1929 | Ga0495660_0068260 | |||
| 1930 | Ga0495660_0080607 | |||
| 1931 | Ga0495581_0095476 | |||
| 1932 | Ga0495604_0005618 | |||
| 1933 | Ga0495604_0031122 | |||
| 1934 | Ga0495636_0000393 | |||
| 1935 | Ga0495636_0121775 | |||
| 1936 | Ga0495674_0111519 | |||
| 1937 | Ga0495672_0000553 | |||
| 1938 | Ga0495672_0003277 | |||
| 1939 | Ga0495672_0004855 | |||
| 1940 | Ga0495672_0008336 | |||
| 1941 | Ga0495672_0015612 | |||
| 1942 | Ga0495672_0024473 | |||
| 1943 | Ga0495672_0031484 | |||
| 1944 | Ga0495672_0036586 | |||
| 1945 | Ga0495672_0042742 | |||
| 1946 | Ga0495672_0091317 | |||
| 1947 | Ga0495672_0192326 | |||
| 1948 | Ga0495676_0000053 | |||
| 1949 | Ga0495676_0006328 | |||
| 1950 | Ga0495680_0017495 | |||
| 1951 | Ga0495680_0037393 | |||
| 1952 | Ga0495680_0047703 | |||
| 1953 | Ga0495683_0000011 | |||
| 1954 | Ga0495683_0000382 | |||
| 1955 | Ga0495683_0003385 | |||
| 1956 | Ga0495683_0007951 | |||
| 1957 | Ga0495683_0009285 | |||
| 1958 | Ga0495683_0014610 | |||
| 1959 | Ga0495683_0038986 | |||
| 1960 | Ga0495683_0041716 | |||
| 1961 | Ga0495683_0042335 | |||
| 1962 | Ga0495683_0106804 | |||
| 1963 | Ga0495687_002144 | |||
| 1964 | Ga0495675_0051723 | |||
| 1965 | Ga0495677_0004123 | |||
| 1966 | Ga0495679_000168 | |||
| 1967 | Ga0495679_000192 | |||
| 1968 | Ga0495679_005475 | |||
| 1969 | Ga0495679_006333 | |||
| 1970 | Ga0495679_008363 | |||
| 1971 | Ga0495679_008759 | |||
| 1972 | Ga0495673_0000116 | |||
| 1973 | Ga0495673_0000602 | |||
| 1974 | Ga0495673_0001458 | |||
| 1975 | Ga0495673_0001830 | |||
| 1976 | Ga0495673_0002071 | |||
| 1977 | Ga0495673_0006244 | |||
| 1978 | Ga0495673_0010644 | |||
| 1979 | Ga0495673_0012913 | |||
| 1980 | Ga0495673_0014111 | |||
| 1981 | Ga0495673_0024292 | |||
| 1982 | Ga0495673_0025772 | |||
| 1983 | Ga0495673_0034447 | |||
| 1984 | Ga0495673_0041664 | |||
| 1985 | Ga0495673_0066371 | |||
| 1986 | Ga0495681_0001694 | |||
| 1987 | Ga0495681_0003057 | |||
| 1988 | Ga0495681_0003153 | |||
| 1989 | Ga0495681_0008851 | |||
| 1990 | Ga0495681_0012897 | |||
| 1991 | Ga0495681_0013047 | |||
| 1992 | Ga0495681_0013713 | |||
| 1993 | Ga0495681_0019018 | |||
| 1994 | Ga0495681_0020303 | |||
| 1995 | Ga0495681_0020718 | |||
| 1996 | Ga0495681_0021070 | |||
| 1997 | Ga0495681_0022114 | |||
| 1998 | Ga0495681_0030514 | |||
| 1999 | Ga0495681_0030622 | |||
| 2000 | Ga0495681_0039246 | |||
| 2001 | Ga0495681_0079372 | |||
| 2002 | Ga0495684_0081946 | |||
| 2003 | Ga0495686_0004749 | |||
| 2004 | Ga0495686_0014110 | |||
| 2005 | Ga0495686_0015613 | |||
| 2006 | Ga0495686_0095024 | |||
| 2007 | Ga0495686_0106964 | |||
| 2008 | Ga0495686_0112063 | |||
| 2009 | Ga0495593_0007329 | |||
| 2010 | Ga0495593_0041429 | |||
| 2011 | Ga0495593_0194613 | |||
| 2012 | Ga0495626_0000647 | |||
| 2013 | Ga0495626_0000727 | |||
| 2014 | Ga0495626_0000769 | |||
| 2015 | Ga0495626_0001353 | |||
| 2016 | Ga0495626_0002545 | |||
| 2017 | Ga0495626_0003906 | |||
| 2018 | Ga0495626_0004193 | |||
| 2019 | Ga0495626_0038475 | |||
| 2020 | Ga0495626_0038987 | |||
| 2021 | Ga0495626_0042892 | |||
| 2022 | Ga0496100_0197004 | |||
| 2023 | Ga0496101_0403784 | |||
| 2024 | Ga0496102_0000073 | |||
| 2025 | Ga0496103_0052152 | |||
| 2026 | Ga0496114_0308166 | |||
| 2027 | Ga0496116_0002389 | |||
| 2028 | Ga0496116_0004332 | |||
| 2029 | Ga0496116_0067270 | |||
| 2030 | Ga0496117_0002335 | |||
| 2031 | Ga0496117_0002605 | |||
| 2032 | Ga0496117_0007749 | |||
| 2033 | Ga0496117_0009691 | |||
| 2034 | Ga0496117_0014739 | |||
| 2035 | Ga0496117_0016267 | |||
| 2036 | Ga0496117_0025685 | |||
| 2037 | Ga0496117_0039884 | |||
| 2038 | Ga0496117_0048620 | |||
| 2039 | Ga0496117_0067577 | |||
| 2040 | Ga0496117_0080076 | |||
| 2041 | Ga0496117_0136653 | |||
| 2042 | Ga0496118_0008458 | |||
| 2043 | Ga0496118_0016339 | |||
| 2044 | Ga0496118_0024888 | |||
| 2045 | Ga0496118_0025498 | |||
| 2046 | Ga0496118_0036217 | |||
| 2047 | Ga0496118_0066197 | |||
| 2048 | Ga0496118_0160726 | |||
| 2049 | Ga0496119_0011139 | |||
| 2050 | Ga0496119_0018504 | |||
| 2051 | Ga0496119_0186895 | |||
| 2052 | Ga0496120_0006672 | |||
| 2053 | Ga0496120_0015474 | |||
| 2054 | Ga0496121_0002154 | |||
| 2055 | Ga0496121_0003781 | |||
| 2056 | Ga0496121_0006663 | |||
| 2057 | Ga0496121_0070840 | |||
| 2058 | Ga0496121_0073869 | |||
| 2059 | Ga0496121_0116432 | |||
| 2060 | Ga0496121_0155195 | |||
| 2061 | Ga0496122_0001544 | |||
| 2062 | Ga0496122_0007180 | |||
| 2063 | Ga0496122_0007285 | |||
| 2064 | Ga0496122_0007413 | |||
| 2065 | Ga0496122_0010797 | |||
| 2066 | Ga0496122_0067149 | |||
| 2067 | Ga0496122_0097507 | |||
| 2068 | Ga0496123_0000432 | |||
| 2069 | Ga0496123_0007869 | |||
| 2070 | Ga0496123_0014362 | |||
| 2071 | Ga0496123_0024759 | |||
| 2072 | Ga0496123_0032593 | |||
| 2073 | Ga0496123_0041027 | |||
| 2074 | Ga0496123_0083197 | |||
| 2075 | Ga0496123_0115748 | |||
| 2076 | Ga0496124_0002675 | |||
| 2077 | Ga0496124_0006973 | |||
| 2078 | Ga0496124_0009277 | |||
| 2079 | Ga0496124_0012169 | |||
| 2080 | Ga0496124_0013732 | |||
| 2081 | Ga0496124_0023812 | |||
| 2082 | Ga0496124_0024608 | |||
| 2083 | Ga0496124_0038446 | |||
| 2084 | Ga0496124_0052695 | |||
| 2085 | Ga0496124_0084253 | |||
| 2086 | Ga0496124_0088458 | |||
| 2087 | Ga0496124_0143262 | |||
| 2088 | Ga0496124_0183595 | |||
| 2089 | Ga0496124_0224354 | |||
| 2090 | Ga0496124_0236776 | |||
| 2091 | Ga0496125_0000862 | |||
| 2092 | Ga0496125_0002267 | |||
| 2093 | Ga0496125_0002740 | |||
| 2094 | Ga0496125_0005831 | |||
| 2095 | Ga0496125_0027341 | |||
| 2096 | Ga0496125_0034714 | |||
| 2097 | Ga0496125_0035319 | |||
| 2098 | Ga0496125_0050374 | |||
| 2099 | Ga0496125_0083395 | |||
| 2100 | Ga0496125_0292771 | |||
| 2101 | Ga0496126_0032908 | |||
| 2102 | Ga0496126_0108746 | |||
| 2103 | Ga0496126_0115625 | |||
| 2104 | Ga0495678_000033 | |||
| 2105 | Ga0495678_002096 | |||
| 2106 | Ga0495678_002263 | |||
| 2107 | Ga0495678_003691 | |||
| 2108 | Ga0495678_005769 | |||
| 2109 | Ga0495678_007734 | |||
| 2110 | Ga0495678_011241 | |||
| 2111 | Ga0495678_015607 | |||
| 2112 | Ga0495678_019538 | |||
| 2113 | Ga0495678_027580 | |||
| 2114 | Ga0495678_038545 | |||
| 2115 | Ga0495678_073739 | |||
| 2116 | Ga0495682_0000048 | |||
| 2117 | Ga0495682_0000559 | |||
| 2118 | Ga0495682_0001792 | |||
| 2119 | Ga0495682_0007021 | |||
| 2120 | Ga0495682_0008428 | |||
| 2121 | Ga0501034_0000364 | |||
| 2122 | Ga0501037_0045872 | |||
| 2123 | Ga0501039_0200697 | |||
| 2124 | Ga0501241_000490 | |||
| 2125 | nmdc:mga00v17_93484_c1 | |||
| 2126 | nmdc:mga08x19_201104_c1 | |||
| 2127 | nmdc:mga0sz30_16158_c1 | |||
| 2128 | Ga0500572_000990 | |||
| 2129 | Ga0500659_0016952 | |||
| 2130 | Ga0500634_0003362 | |||
| 2131 | Ga0466962_0024940 | |||
| 2132 | 2510283107 | |||
| 2133 | 2510293781 | |||
| 2134 | 2510310613 | |||
| 2135 | 2511254869 | |||
| 2136 | 2511280858 | |||
| 2137 | 2511300328 | |||
| 2138 | 2511326368 | |||
| 2139 | 2511336167 | |||
| 2140 | 2511342248 | |||
| 2141 | 2511356573 | |||
| 2142 | 2511362717 | |||
| 2143 | 2511371902 | |||
| 2144 | 2511414044 | |||
| 2145 | 2511824344 | |||
| 2146 | 2597030574 | |||
| 2147 | 2599328008 | |||
| 2148 | 2599397850 | |||
| 2149 | 2599447909 | |||
| 2150 | 2599452297 | |||
| 2151 | 2599502179 | |||
| 2152 | 2599513324 | |||
| 2153 | 2599518176 | |||
| 2154 | 2599611069 | |||
| 2155 | 2599770111 | |||
| 2156 | 2599877968 | |||
| 2157 | 2599887433 | |||
| 2158 | 2599892000 | |||
| 2159 | 2599896716 | |||
| 2160 | 2599932761 | |||
| 2161 | 2599946361 | |||
| 2162 | 2599952224 | |||
| 2163 | 2599957598 | |||
| 2164 | 2599958830 | |||
| 2165 | 2599965516 | |||
| 2166 | 2599972909 | |||
| 2167 | 2599981394 | |||
| 2168 | 2599986672 | |||
| 2169 | 2599992138 | |||
| 2170 | 2599997510 | |||
| 2171 | 2600003200 | |||
| 2172 | 2600006145 | |||
| 2173 | 2600015230 | |||
| 2174 | 2600017295 | |||
| 2175 | 2600023333 | |||
| 2176 | 2600028246 | |||
| 2177 | 2600035753 | |||
| 2178 | 2600045094 | |||
| 2179 | 2600050588 | |||
| 2180 | 2600052118 | |||
| 2181 | 2600057006 | |||
| 2182 | 2600066833 | |||
| 2183 | 2600069664 | |||
| 2184 | 2600077510 | |||
| 2185 | 2600357305 | |||
| 2186 | 2600446957 | |||
| 2187 | 2601626762 | |||
| 2188 | 2601797096 | |||
| 2189 | 2602010155 | |||
| 2190 | 2606076173 | |||
| 2191 | 2606131083 | |||
| 2192 | 2621298807 | |||
| 2193 | 2624481369 | |||
| 2194 | 2643841639 | |||
| 2195 | 2643956954 | |||
| 2196 | 2644024877 | |||
| 2197 | 2644186771 | |||
| 2198 | 2644285644 | |||
| 2199 | 2652546570 | |||
| 2200 | 2671090894 | |||
| 2201 | 2671124793 | |||
| 2202 | 2678263913 | |||
| 2203 | 2715753459 | |||
| 2204 | 2715755889 | |||
| 2205 | 2718634642 | |||
| 2206 | 2738672055 | |||
| 2207 | 2738687219 | |||
| 2208 | 2738750448 | |||
| 2209 | 2738810048 | |||
| 2210 | 2738859489 | |||
| 2211 | 2738897408 | |||
| 2212 | 2739197669 | |||
| 2213 | 2739262840 | |||
| 2214 | 2739287715 | |||
| 2215 | 2739293027 | |||
| 2216 | 2739316245 | |||
| 2217 | 2745004365 | |||
| 2218 | 2765585564 | |||
| 2219 | 2774123252 | |||
| 2220 | 2774131194 | |||
| 2221 | 2774137922 | |||
| 2222 | 2784265026 | |||
| 2223 | 2784315776 | |||
| 2224 | 2794597807 | |||
| 2225 | 2808854872 | |||
| 2226 | 2808926346 | |||
| 2227 | 2808932991 | |||
| 2228 | 2808934933 | |||
| 2229 | 2808948447 | |||
| 2230 | 2808955110 | |||
| 2231 | 2808958323 | |||
| 2232 | 2808963330 | |||
| 2233 | 2808976983 | |||
| 2234 | 2808992138 | |||
| 2235 | 2808998265 | |||
| 2236 | 2809214480 | |||
| 2237 | 2817492032 | |||
| 2238 | 2819656750 | |||
| 2239 | 2823422650 | |||
| 2240 | 2825657306 | |||
| 2241 | 2826582688 | |||
| 2242 | 2834032842 | |||
| 2243 | 2842806272 | |||
| 2244 | 2842819280 | |||
| 2245 | 2842836220 | |||
| 2246 | 2842844081 | |||
| 2247 | 2842852606 | |||
| 2248 | 2852613683 | |||
| 2249 | 2852659533 | |||
| 2250 | 2852668581 | |||
| 2251 | 2860342327 | |||
| 2252 | 2860871176 | |||
| 2253 | 2878033343 | |||
| 2254 | 2880232937 | |||
| 2255 | 2885270536 | |||
| 2256 | 2904520330 | |||
| 2257 | 2908450522 | |||
| 2258 | 2913039265 | |||
| 2259 | 2919066955 | |||
| 2260 | 2919387523 | |||
| 2261 | 2919459009 | |||
| 2262 | 2919485267 | |||
| 2263 | 2919492178 | |||
| 2264 | 2919504911 | |||
| 2265 | 2923586608 | |||
| 2266 | 2926066588 | |||
| 2267 | 2928058905 | |||
| 2268 | 2929146515 | |||
| 2269 | 2929193247 | |||
| 2270 | 2931369772 | |||
| 2271 | 2931394525 | |||
| 2272 | 2931402410 | |||
| 2273 | 2945934214 | |||
| 2274 | 2945964834 | |||
| 2275 | 2946008993 | |||
| 2276 | 2946031528 | |||
| 2277 | 2969308106 | |||
| 2278 | 2974290407 | |||
| 2279 | 2974302737 | |||
| 2280 | 2984499677 | |||
| 2281 | 2988729487 | |||
| 2282 | 2998143444 | |||
| 2283 | 3007255981 | |||
| 2284 | 3007319945 | |||
| 2285 | 3007421295 | |||
| 2286 | 3007514608 | |||
| 2287 | 3007616775 | |||
| 2288 | 3007621839 | |||
| 2289 | 3007808180 | |||
| 2290 | 3007857947 | |||
| 2291 | 3007861582 | |||
| 2292 | 3007869859 | |||
| 2293 | 3007873126 | |||
| 2294 | 651177883 | |||
| 2295 | 8029997375 | |||
| 2296 | 8034966181 | |||
| 2297 | 8052498760 | |||
| 2298 | 8054507037 | |||
| 2299 | 8054929876 | |||
| 2300 | 8055821994 | |||
| 2301 | 8056129287 | |||
| 2302 | 8056135468 | |||
| 2303 | 8056143004 | |||
| 2304 | 8056157637 | |||
| 2305 | 8056165266 | |||
| 2306 | 8056167767 | |||
| 2307 | 8056178524 | |||
| 2308 | 8056574171 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mfh-assembly1.cif.gz_A | mutated uronate dehydrogenase | 0.9593 | 12 | 266 |
| 3ay3-assembly2.cif.gz_D | crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens | 0.955 | 12 | 266 |
| 3rfx-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad | 0.9496 | 11 | 272 |
| 3rft-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens | 0.949 | 11 | 272 |
| 3rfx-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad | 0.9357 | 11 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rftA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9619 | 11 | 234 | 3.40.50.720 |
| 3rftA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9414 | 11 | 234 | 3.40.50.720 |
| af_E9AHP8_1_313_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8366 | 13 | 178 | 3.40.50.720 |
| af_Q4DUZ8_1_205_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8148 | 13 | 168 | 3.40.50.720 |
| 1bxkA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8137 | 11 | 235 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5HDB7-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9755 | 1 | 272 |
|
| AF-A0A519FP21-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9755 | 11 | 270 |
|
| AF-A0A1C2DL71-F1-model_v4 | deleted | 0.973 | 1 | 270 |
|
| AF-A0A7Y0WHU8-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.972 | 3 | 272 |
|
| AF-A0A6L5HDB7-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.972 | 1 | 272 |
|