F490917

General Info

Members Datasets Scaffolds Average Seq Length
1155 337 1145 127

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10000055|Ga0065714_1000005513
Length 153
Sequence MSDIPADLRFAESHEWARLEADGSVTVGISDHAQEALGDVVFVELTEVGTVFAAGDQSGVVESVKAASDIYSPVAGEVIAINEELSANPELLNSDPYGAWIFKLKPSNAADLDXLLDAAGYXXCHRRIIVALRNLCGSEPARESGVSANSYAN

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
4 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
5 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
6 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
7 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
8 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
9 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
10 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
11 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
69 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
141 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
142 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
143 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
144 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
145 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
174 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
179 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
183 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
184 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
187 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
188 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
189 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
190 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
193 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
194 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
195 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
196 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
197 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
198 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
199 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
200 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
207 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
208 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
209 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
284 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
287 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
318 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
322 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
323 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
324 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
325 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
326 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
332 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
333 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
334 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
335 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
336 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
337 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.26
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 1.04
Rhizoplane 1.13
Rhizosphere 83.12
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_718 2124908027 Bacteria 55855
2 SwRhRL2b_contig_1246565 2162886007 Bacteria 6834
3 SwRhRL2b_contig_1309588 2162886007 Bacteria 1667
4 JGI25154J39366_1011554 3300002738 Bacteria 1006
5 JGI25163J39215_1000135 3300002771 Bacteria 29529
6 JGI25164J39214_1000236 3300002772 Bacteria 42383
7 JGI25165J46597_1000434 3300003214 Bacteria 42383
8 Ga0055538_1000032 3300003751 Bacteria 199718
9 Ga0055539_1000043 3300003752 Bacteria 199718
10 Ga0055533_1000052 3300003756 Bacteria 199718
11 Ga0055532_1000047 3300003758 Bacteria 179201
12 Ga0055525_1000062 3300003759 Bacteria 199718
13 Ga0055535_1011611 3300003761 Bacteria 1382
14 Ga0055536_1000575 3300003781 Bacteria 25049
15 Ga0055536_1001028 3300003781 Bacteria 17628
16 Ga0055530_10000970 3300003791 Bacteria 23230
17 Ga0055530_10006554 3300003791 Bacteria 5167
18 Ga0055540_1000694 3300003792 Bacteria 23230
19 Ga0055540_1001047 3300003792 Bacteria 17603
20 Ga0055531_10000483 3300003794 Bacteria 36666
21 Ga0055541_1000030 3300003841 Bacteria 199616
22 Ga0065714_10000055 3300005288 Bacteria 14101
23 Ga0065714_10002767 3300005288 Bacteria 12068
24 Ga0065714_10003026 3300005288 Bacteria 11893
25 Ga0065714_10170867 3300005288 Bacteria 1002
26 Ga0065714_10292598 3300005288 Bacteria 704
27 Ga0065714_10300516 3300005288 Bacteria 695
28 Ga0065704_10000729 3300005289 Bacteria 13219
29 Ga0065704_10078396 3300005289 Bacteria 4442
30 Ga0065704_10362996 3300005289 Bacteria 795
31 Ga0065704_10576443 3300005289 Bacteria 620
32 Ga0065712_10009759 3300005290 Bacteria 6075
33 Ga0070676_10910298 3300005328 Bacteria 656
34 Ga0070683_101641522 3300005329 Bacteria 618
35 Ga0070670_100003746 3300005331 Bacteria 12657
36 Ga0070661_100000126 3300005344 Bacteria 63357
37 Ga0070669_100184534 3300005353 Bacteria 1634
38 Ga0070669_100484304 3300005353 Bacteria 1024
39 Ga0070675_100319212 3300005354 Bacteria 1372
40 Ga0070714_100157933 3300005435 Bacteria 2049
41 Ga0070714_100236212 3300005435 Bacteria 1686
42 Ga0070713_100334990 3300005436 Bacteria 1401
43 Ga0070711_100446663 3300005439 Bacteria 1058
44 Ga0070662_100000101 3300005457 Bacteria 47097
45 Ga0068867_100268012 3300005459 Bacteria 1395
46 Ga0068853_100000372 3300005539 Bacteria 30828
47 Ga0070696_100708340 3300005546 Bacteria 821
48 Ga0070665_101209081 3300005548 Bacteria 766
49 Ga0068855_100088470 3300005563 Bacteria 3577
50 Ga0068855_102089178 3300005563 Bacteria 571
51 Ga0070664_100000491 3300005564 Bacteria 29927
52 Ga0070664_100007669 3300005564 Bacteria 8715
53 Ga0068854_100000622 3300005578 Bacteria 20954
54 Ga0068851_10000007 3300005834 Bacteria 244101
55 Ga0068858_100027507 3300005842 Bacteria 5282
56 Ga0075364_10006642 3300006051 Bacteria 6816
57 Ga0075364_10025829 3300006051 Bacteria 3742
58 Ga0075364_10033443 3300006051 Bacteria 3311
59 Ga0075364_10094110 3300006051 Bacteria 1990
60 Ga0075364_10146067 3300006051 Bacteria 1592
61 Ga0075364_10315526 3300006051 Bacteria 1064
62 Ga0075364_10459522 3300006051 Bacteria 870
63 Ga0075364_10525549 3300006051 Bacteria 809
64 Ga0075432_10003458 3300006058 Bacteria 5340
65 Ga0075432_10015624 3300006058 Bacteria 2590
66 Ga0075432_10203179 3300006058 Bacteria 785
67 Ga0075432_10254732 3300006058 Bacteria 713
68 Ga0075432_10605387 3300006058 Bacteria 502
69 Ga0075436_100032607 3300006914 Bacteria 3591
70 Ga0075436_100789577 3300006914 Bacteria 706
71 Ga0075436_100998078 3300006914 Bacteria 628
72 Ga0099823_1000043 3300006944 Bacteria 60786
73 Ga0099823_1012472 3300006944 Bacteria 8590
74 Ga0079104_1000424 3300006946 Bacteria 48276
75 Ga0079104_1003320 3300006946 Bacteria 7626
76 Ga0079104_1077095 3300006946 Bacteria 690
77 Ga0099826_10007475 3300006948 Bacteria 8064
78 Ga0105251_10000586 3300009011 Bacteria 33458
79 Ga0105251_10000828 3300009011 Bacteria 27688
80 Ga0105251_10003473 3300009011 Bacteria 11428
81 Ga0105251_10005861 3300009011 Bacteria 7949
82 Ga0105251_10018011 3300009011 Bacteria 3768
83 Ga0105251_10021263 3300009011 Bacteria 3391
84 Ga0105251_10064386 3300009011 Bacteria 1719
85 Ga0105251_10113027 3300009011 Bacteria 1236
86 Ga0105251_10279609 3300009011 Bacteria 754
87 Ga0105251_10463760 3300009011 Bacteria 588
88 Ga0105244_10002385 3300009036 Bacteria 14233
89 Ga0105244_10011211 3300009036 Bacteria 5393
90 Ga0105244_10015983 3300009036 Bacteria 4289
91 Ga0105244_10021130 3300009036 Bacteria 3605
92 Ga0105244_10023014 3300009036 Bacteria 3424
93 Ga0105244_10030018 3300009036 Bacteria 2896
94 Ga0105244_10078308 3300009036 Bacteria 1639
95 Ga0105244_10085949 3300009036 Bacteria 1551
96 Ga0105244_10088903 3300009036 Bacteria 1521
97 Ga0105244_10106507 3300009036 Bacteria 1367
98 Ga0105244_10111011 3300009036 Bacteria 1334
99 Ga0105244_10123445 3300009036 Bacteria 1253
100 Ga0105244_10183032 3300009036 Bacteria 993
101 Ga0105244_10210639 3300009036 Bacteria 914
102 Ga0105244_10220029 3300009036 Bacteria 891
103 Ga0105244_10297773 3300009036 Bacteria 747
104 Ga0105250_10000643 3300009092 Bacteria 22206
105 Ga0105250_10002216 3300009092 Bacteria 9899
106 Ga0105250_10019096 3300009092 Bacteria 2772
107 Ga0105250_10028133 3300009092 Bacteria 2264
108 Ga0105250_10058752 3300009092 Bacteria 1544
109 Ga0105250_10194783 3300009092 Bacteria 854
110 Ga0105250_10233388 3300009092 Bacteria 783
111 Ga0105250_10303678 3300009092 Bacteria 691
112 Ga0105240_10136451 3300009093 Bacteria 2938
113 Ga0111539_11613993 3300009094 Bacteria 752
114 Ga0105247_10581461 3300009101 Bacteria 828
115 Ga0105243_10000418 3300009148 Bacteria 44790
116 Ga0105243_10009342 3300009148 Bacteria 7476
117 Ga0105243_10055831 3300009148 Bacteria 3138
118 Ga0105243_10080419 3300009148 Bacteria 2658
119 Ga0105243_10083948 3300009148 Bacteria 2607
120 Ga0105241_11357086 3300009174 Bacteria 679
121 Ga0105241_12336562 3300009174 Bacteria 533
122 Ga0105242_10001037 3300009176 Bacteria 21828
123 Ga0105242_10001270 3300009176 Bacteria 19937
124 Ga0105242_10129282 3300009176 Bacteria 2178
125 Ga0105242_11358916 3300009176 Bacteria 736
126 Ga0105248_10606351 3300009177 Bacteria 1235
127 Ga0105248_12532969 3300009177 Bacteria 585
128 Ga0105237_10001509 3300009545 Bacteria 30588
129 Ga0105237_10099097 3300009545 Bacteria 2906
130 Ga0105249_10024279 3300009553 Bacteria 5448
131 Ga0105249_10383748 3300009553 Bacteria 1432
132 Ga0105246_10000831 3300011119 Bacteria 17579
133 Ga0105246_10005122 3300011119 Bacteria 7969
134 Ga0157336_1000231 3300012477 Bacteria 2463
135 Ga0157345_1000031 3300012498 Bacteria 35083
136 Ga0157345_1029860 3300012498 Bacteria 605
137 Ga0157373_10001270 3300013100 Bacteria 19284
138 Ga0157373_10004657 3300013100 Bacteria 10323
139 Ga0157373_10007651 3300013100 Bacteria 8028
140 Ga0157373_10022657 3300013100 Bacteria 4556
141 Ga0157373_10099326 3300013100 Bacteria 2048
142 Ga0157373_10616305 3300013100 Bacteria 791
143 Ga0157371_10000609 3300013102 Bacteria 42602
144 Ga0157371_10005676 3300013102 Bacteria 10472
145 Ga0157371_10006894 3300013102 Bacteria 9274
146 Ga0157370_10010793 3300013104 Bacteria 9605
147 Ga0157370_10089048 3300013104 Bacteria 2899
148 Ga0157370_10141562 3300013104 Bacteria 2241
149 Ga0157370_10287729 3300013104 Bacteria 1518
150 Ga0157370_10446715 3300013104 Bacteria 1189
151 Ga0157370_10505182 3300013104 Bacteria 1110
152 Ga0157369_10007915 3300013105 Bacteria 12219
153 Ga0157369_10010950 3300013105 Bacteria 10323
154 Ga0157369_10012831 3300013105 Bacteria 9501
155 Ga0157369_10017743 3300013105 Bacteria 7992
156 Ga0157369_10229920 3300013105 Bacteria 1939
157 Ga0157369_11039791 3300013105 Bacteria 838
158 Ga0163162_10000591 3300013306 Bacteria 33702
159 Ga0163162_10025799 3300013306 Bacteria 5809
160 Ga0163162_12242773 3300013306 Bacteria 627
161 Ga0157372_10003012 3300013307 Bacteria 18164
162 Ga0157372_10066684 3300013307 Bacteria 4044
163 Ga0157372_10081924 3300013307 Bacteria 3653
164 Ga0157372_10130763 3300013307 Bacteria 2888
165 Ga0157372_10648693 3300013307 Bacteria 1229
166 Ga0157375_10007713 3300013308 Bacteria 9417
167 Ga0157375_10009496 3300013308 Bacteria 8540
168 Ga0163163_12520438 3300014325 Bacteria 572
169 Ga0157380_11888557 3300014326 Bacteria 658
170 Ga0182008_10000293 3300014497 Bacteria 39393
171 Ga0182008_10003066 3300014497 Bacteria 10264
172 Ga0182008_10003963 3300014497 Bacteria 8764
173 Ga0182008_10008520 3300014497 Bacteria 5598
174 Ga0182008_10021923 3300014497 Bacteria 3276
175 Ga0157379_10007985 3300014968 Bacteria 9181
176 Ga0182006_1001933 3300015261 Bacteria 11769
177 Ga0182006_1008087 3300015261 Bacteria 4777
178 Ga0182006_1107668 3300015261 Bacteria 981
179 Ga0182006_1198617 3300015261 Bacteria 665
180 Ga0182007_10012173 3300015262 Bacteria 3321
181 Ga0182005_1005566 3300015265 Bacteria 3929
182 Ga0182005_1008727 3300015265 Bacteria 2976
183 Ga0182005_1016310 3300015265 Bacteria 2067
184 Ga0163161_10001503 3300017792 Bacteria 17248
185 Ga0163161_10012953 3300017792 Bacteria 5794
186 Ga0163161_10040548 3300017792 Bacteria 3345
187 Ga0163161_10062502 3300017792 Bacteria 2713
188 Ga0163161_10095791 3300017792 Bacteria 2202
189 Ga0163161_10168186 3300017792 Bacteria 1675
190 Ga0163161_10335345 3300017792 Bacteria 1199
191 Ga0163161_10775278 3300017792 Bacteria 804
192 Ga0163161_11668672 3300017792 Bacteria 564
193 Ga0209435_100485 3300025206 Bacteria 7857
194 Ga0209760_100149 3300025207 Bacteria 43212
195 Ga0209784_100007 3300025224 Bacteria 747715
196 Ga0209566_100009 3300025225 Bacteria 554018
197 Ga0209674_100021 3300025226 Bacteria 629811
198 Ga0209147_100009 3300025229 Bacteria 747409
199 Ga0209563_100018 3300025230 Bacteria 747850
200 Ga0207427_100005 3300025231 Bacteria 797999
201 Ga0209437_100018 3300025233 Bacteria 694400
202 Ga0209258_100169 3300025242 Bacteria 145227
203 Ga0209646_1000184 3300025246 Bacteria 78423
204 Ga0209026_1033009 3300025250 Bacteria 764
205 Ga0209677_100012 3300025253 Bacteria 554018
206 Ga0209759_1003027 3300025256 Bacteria 6933
207 Ga0209233_1000021 3300025261 Bacteria 798078
208 Ga0209130_1032015 3300025284 Bacteria 1075
209 Ga0209676_1000015 3300025292 Bacteria 784458
210 Ga0209676_1000030 3300025292 Bacteria 506421
211 Ga0209676_1000041 3300025292 Bacteria 424583
212 Ga0209676_1001202 3300025292 Bacteria 27702
213 Ga0209676_1006408 3300025292 Bacteria 5819
214 Ga0209050_1000030 3300025298 Bacteria 463381
215 Ga0209050_1000518 3300025298 Bacteria 64332
216 Ga0209050_1000647 3300025298 Bacteria 54000
217 Ga0209051_1000012 3300025303 Bacteria 595474
218 Ga0209051_1000721 3300025303 Bacteria 36119
219 Ga0209051_1002170 3300025303 Bacteria 14543
220 Ga0209257_1001245 3300025304 Bacteria 31476
221 Ga0209257_1114532 3300025304 Bacteria 639
222 Ga0207656_10000006 3300025321 Bacteria 395044
223 Ga0207696_1000031 3300025711 Bacteria 384169
224 Ga0207696_1000357 3300025711 Bacteria 46078
225 Ga0207696_1001095 3300025711 Bacteria 15875
226 Ga0207696_1003677 3300025711 Bacteria 6888
227 Ga0207696_1006219 3300025711 Bacteria 4843
228 Ga0207696_1009749 3300025711 Bacteria 3564
229 Ga0207696_1023826 3300025711 Bacteria 1926
230 Ga0207696_1037253 3300025711 Bacteria 1440
231 Ga0207696_1047034 3300025711 Bacteria 1244
232 Ga0207696_1060998 3300025711 Bacteria 1061
233 Ga0207696_1074144 3300025711 Bacteria 944
234 Ga0207696_1094304 3300025711 Bacteria 819
235 Ga0207655_1000033 3300025728 Bacteria 377066
236 Ga0207655_1000388 3300025728 Bacteria 61513
237 Ga0207655_1000740 3300025728 Bacteria 36777
238 Ga0207655_1001884 3300025728 Bacteria 18021
239 Ga0207655_1002233 3300025728 Bacteria 16042
240 Ga0207655_1009865 3300025728 Bacteria 5876
241 Ga0207655_1013722 3300025728 Bacteria 4627
242 Ga0207655_1017240 3300025728 Bacteria 3903
243 Ga0207655_1020032 3300025728 Bacteria 3464
244 Ga0207655_1026052 3300025728 Bacteria 2818
245 Ga0207655_1026956 3300025728 Bacteria 2748
246 Ga0207655_1032617 3300025728 Bacteria 2377
247 Ga0207655_1055965 3300025728 Bacteria 1558
248 Ga0207655_1067994 3300025728 Bacteria 1338
249 Ga0207655_1091408 3300025728 Bacteria 1070
250 Ga0207655_1112400 3300025728 Bacteria 917
251 Ga0207655_1118031 3300025728 Bacteria 884
252 Ga0207713_1000079 3300025735 Bacteria 172274
253 Ga0207713_1000815 3300025735 Bacteria 28847
254 Ga0207713_1000817 3300025735 Bacteria 28806
255 Ga0207713_1000881 3300025735 Bacteria 27355
256 Ga0207713_1001720 3300025735 Bacteria 16886
257 Ga0207713_1002142 3300025735 Bacteria 14702
258 Ga0207713_1007195 3300025735 Bacteria 6631
259 Ga0207713_1008240 3300025735 Bacteria 6031
260 Ga0207713_1018440 3300025735 Bacteria 3457
261 Ga0207713_1018800 3300025735 Bacteria 3406
262 Ga0207713_1026991 3300025735 Bacteria 2617
263 Ga0207713_1035524 3300025735 Bacteria 2150
264 Ga0207713_1046693 3300025735 Bacteria 1759
265 Ga0207713_1109671 3300025735 Bacteria 940
266 Ga0207713_1155869 3300025735 Bacteria 733
267 Ga0207710_10223765 3300025900 Bacteria 935
268 Ga0207645_10537093 3300025907 Bacteria 793
269 Ga0207705_10363524 3300025909 Bacteria 1116
270 Ga0207671_10000131 3300025914 Bacteria 116866
271 Ga0207671_10059279 3300025914 Bacteria 2838
272 Ga0207663_10562573 3300025916 Bacteria 892
273 Ga0207649_10000012 3300025920 Bacteria 265674
274 Ga0207649_10125406 3300025920 Bacteria 1737
275 Ga0207681_10000099 3300025923 Bacteria 73220
276 Ga0207650_10000518 3300025925 Bacteria 31804
277 Ga0207650_10000571 3300025925 Bacteria 29738
278 Ga0207664_10157828 3300025929 Bacteria 1932
279 Ga0207664_10200192 3300025929 Bacteria 1723
280 Ga0207706_10000580 3300025933 Bacteria 38973
281 Ga0207686_10001527 3300025934 Bacteria 13045
282 Ga0207686_10003056 3300025934 Bacteria 9007
283 Ga0207686_10041667 3300025934 Bacteria 2801
284 Ga0207709_10000337 3300025935 Bacteria 49221
285 Ga0207709_10030471 3300025935 Bacteria 3138
286 Ga0207709_10092399 3300025935 Bacteria 1981
287 Ga0207709_10174208 3300025935 Bacteria 1513
288 Ga0207711_10120944 3300025941 Bacteria 2337
289 Ga0207711_10569138 3300025941 Bacteria 1057
290 Ga0207679_10000015 3300025945 Bacteria 265674
291 Ga0207679_10118289 3300025945 Bacteria 2104
292 Ga0207667_11310925 3300025949 Bacteria 700
293 Ga0207712_10012454 3300025961 Bacteria 5433
294 Ga0207712_10149662 3300025961 Bacteria 1802
295 Ga0207640_10013617 3300025981 Bacteria 4666
296 Ga0207703_10003154 3300026035 Bacteria 13907
297 Ga0207639_10005381 3300026041 Bacteria 8654
298 Ga0207648_10023158 3300026089 Bacteria 5570
299 Ga0209281_1000016 3300027111 Bacteria 588107
300 Ga0209281_1000019 3300027111 Bacteria 576164
301 Ga0209281_1003013 3300027111 Bacteria 5968
302 Ga0209281_1006344 3300027111 Bacteria 3102
303 Ga0209389_1000017 3300027296 Bacteria 180543
304 Ga0209389_1027696 3300027296 Bacteria 4882
305 Ga0209371_1025351 3300027312 Bacteria 1364
306 Ga0209996_1014478 3300027395 Bacteria 1072
307 Ga0209982_1021628 3300027552 Bacteria 991
308 Ga0207428_10021918 3300027907 Bacteria 5401
309 Ga0207428_10034012 3300027907 Bacteria 4180
310 Ga0207428_10058103 3300027907 Bacteria 3070
311 Ga0207428_10158834 3300027907 Bacteria 1718
312 Ga0268266_10028438 3300028379 Bacteria 4752
313 Ga0268266_10047161 3300028379 Bacteria 3690
314 Ga0268266_11401689 3300028379 Bacteria 674
315 Ga0268266_11412765 3300028379 Bacteria 671
316 Ga0268266_11899696 3300028379 Bacteria 569
317 Ga0265323_10023355 3300028653 Bacteria 2358
318 Ga0307517_10076563 3300028786 Bacteria 2920
319 Ga0307517_10173892 3300028786 Bacteria 1408
320 Ga0268256_1020035 3300030500 Bacteria 1815
321 Ga0307511_10107035 3300030521 Bacteria 1802
322 Ga0307511_10238296 3300030521 Bacteria 891
323 Ga0316177_1073679 3300030731 Bacteria 1545
324 Ga0314311_1252767 3300030733 Bacteria 11644
325 Ga0316179_1042459 3300030734 Bacteria 3882
326 Ga0316178_1008333 3300030735 Bacteria 44288
327 Ga0316183_1045013 3300030742 Bacteria 9789
328 Ga0316183_1105198 3300030742 Bacteria 1448
329 Ga0316181_1049959 3300030744 Bacteria 962
330 Ga0316181_1273315 3300030744 Bacteria 3747
331 Ga0265316_10202919 3300031344 Bacteria 1469
332 Ga0307513_10705386 3300031456 Bacteria 715
333 Ga0307509_10067997 3300031507 Bacteria 3729
334 Ga0307408_100002850 3300031548 Bacteria 11988
335 Ga0307408_100003719 3300031548 Bacteria 10390
336 Ga0307408_100031721 3300031548 Bacteria 3680
337 Ga0307408_100224207 3300031548 Bacteria 1535
338 Ga0307408_100290707 3300031548 Bacteria 1364
339 Ga0307408_100391007 3300031548 Bacteria 1191
340 Ga0307408_101052459 3300031548 Bacteria 752
341 Ga0307408_101747392 3300031548 Bacteria 593
342 Ga0316578_10040863 3300031728 Bacteria 2684
343 Ga0307516_10105975 3300031730 Bacteria 2622
344 Ga0307516_10249646 3300031730 Bacteria 1469
345 Ga0307405_10000278 3300031731 Bacteria 18930
346 Ga0307405_10008646 3300031731 Bacteria 5175
347 Ga0307405_10034553 3300031731 Bacteria 3009
348 Ga0307405_10793967 3300031731 Bacteria 792
349 Ga0307413_10211622 3300031824 Bacteria 1408
350 Ga0307410_10312097 3300031852 Bacteria 1245
351 Ga0307406_10004633 3300031901 Bacteria 7487
352 Ga0307406_11632386 3300031901 Bacteria 570
353 Ga0307407_10006433 3300031903 Bacteria 5220
354 Ga0307407_11546063 3300031903 Bacteria 525
355 Ga0307412_10002971 3300031911 Bacteria 9401
356 Ga0307412_10006343 3300031911 Bacteria 6680
357 Ga0307412_10019653 3300031911 Bacteria 4096
358 Ga0307412_10031953 3300031911 Bacteria 3329
359 Ga0307412_10111949 3300031911 Bacteria 1950
360 Ga0307412_10144888 3300031911 Bacteria 1744
361 Ga0307412_10276893 3300031911 Bacteria 1315
362 Ga0307409_100080243 3300031995 Bacteria 2632
363 Ga0307409_101909640 3300031995 Bacteria 623
364 Ga0307416_103204319 3300032002 Bacteria 547
365 Ga0307414_10015690 3300032004 Bacteria 4579
366 Ga0307414_10169789 3300032004 Bacteria 1742
367 Ga0307414_10238626 3300032004 Bacteria 1503
368 Ga0307414_10348954 3300032004 Bacteria 1269
369 Ga0307414_10360022 3300032004 Bacteria 1251
370 Ga0307414_10645561 3300032004 Bacteria 954
371 Ga0307414_11489731 3300032004 Bacteria 630
372 Ga0307414_12123379 3300032004 Bacteria 524
373 Ga0307411_10097247 3300032005 Bacteria 2071
374 Ga0307411_10120407 3300032005 Bacteria 1897
375 Ga0307411_11136787 3300032005 Bacteria 705
376 Ga0307411_11609213 3300032005 Bacteria 599
377 Ga0307415_100628081 3300032126 Bacteria 960
378 Ga0307510_10009038 3300033180 Bacteria 11864
379 Ga0373939_0403808 3300035114 Bacteria 567
380 Ga0316574_0158366 3300035398 Bacteria 1459
381 Ga0373931_0141886 3300035691 Bacteria 1392
382 Ga0373925_0383208 3300037068 Bacteria 1145
383 Ga0439438_000413 3300041405 Bacteria 19264
384 Ga0439438_000628 3300041405 Bacteria 15907
385 Ga0439438_000966 3300041405 Bacteria 12824
386 Ga0439438_003325 3300041405 Bacteria 6533
387 Ga0439438_005222 3300041405 Bacteria 4817
388 Ga0439438_008364 3300041405 Bacteria 3438
389 Ga0439438_009343 3300041405 Bacteria 3180
390 Ga0439438_022150 3300041405 Bacteria 1765
391 Ga0439438_086194 3300041405 Bacteria 768
392 Ga0439447_000886 3300041407 Bacteria 10935
393 Ga0439447_013512 3300041407 Bacteria 2313
394 Ga0439447_029323 3300041407 Bacteria 1393
395 Ga0439447_030179 3300041407 Bacteria 1367
396 Ga0439447_056131 3300041407 Bacteria 932
397 Ga0439447_063638 3300041407 Bacteria 864
398 Ga0439447_064882 3300041407 Bacteria 854
399 Ga0439461_0004120 3300041410 Bacteria 2415
400 Ga0439466_0000628 3300041411 Bacteria 13247
401 Ga0439466_0001811 3300041411 Bacteria 8366
402 Ga0439466_0006300 3300041411 Bacteria 4516
403 Ga0439466_0017391 3300041411 Bacteria 2591
404 Ga0439466_0017508 3300041411 Bacteria 2581
405 Ga0439466_0039697 3300041411 Bacteria 1576
406 Ga0439466_0046470 3300041411 Bacteria 1434
407 Ga0439466_0085986 3300041411 Bacteria 988
408 Ga0439466_0109260 3300041411 Bacteria 858
409 Ga0439466_0111935 3300041411 Bacteria 846
410 Ga0439465_0031302 3300041413 Bacteria 1694
411 Ga0451800_0736224 3300041459 Bacteria 597
412 Ga0451837_1712778 3300041494 Bacteria 623
413 Ga0451841_0906580 3300041498 Bacteria 551
414 Ga0451853_4076545 3300041512 Bacteria 941
415 Ga0439431_0003158 3300041997 Bacteria 3622
416 Ga0439431_0009029 3300041997 Bacteria 2247
417 Ga0439437_003860 3300042000 Bacteria 1622
418 Ga0439442_052282 3300042002 Bacteria 862
419 Ga0439445_0029935 3300042004 Bacteria 1408
420 Ga0439445_0101797 3300042004 Bacteria 815
421 Ga0439432_001522 3300042006 Bacteria 8707
422 Ga0439432_069468 3300042006 Bacteria 1075
423 Ga0439432_119881 3300042006 Bacteria 779
424 Ga0439432_176142 3300042006 Bacteria 623
425 Ga0439432_192899 3300042006 Bacteria 591
426 Ga0439432_229389 3300042006 Bacteria 535
427 Ga0439451_006268 3300042009 Bacteria 2431
428 Ga0439451_014993 3300042009 Bacteria 1562
429 Ga0439451_032070 3300042009 Bacteria 1056
430 Ga0439451_110041 3300042009 Bacteria 558
431 Ga0439452_000354 3300042010 Bacteria 28113
432 Ga0439452_000644 3300042010 Bacteria 17514
433 Ga0439452_000647 3300042010 Bacteria 17391
434 Ga0439452_001312 3300042010 Bacteria 10448
435 Ga0439452_006207 3300042010 Bacteria 3761
436 Ga0439452_008004 3300042010 Bacteria 3200
437 Ga0439452_010287 3300042010 Bacteria 2727
438 Ga0439452_084675 3300042010 Bacteria 688
439 Ga0439456_001975 3300042013 Bacteria 4131
440 Ga0439456_005584 3300042013 Bacteria 2554
441 Ga0439456_008089 3300042013 Bacteria 2171
442 Ga0439456_008953 3300042013 Bacteria 2067
443 Ga0439456_040973 3300042013 Bacteria 1003
444 Ga0439456_067332 3300042013 Bacteria 791
445 Ga0439456_076551 3300042013 Bacteria 744
446 Ga0439456_085187 3300042013 Bacteria 707
447 Ga0439463_000086 3300042016 Bacteria 21870
448 Ga0439463_058443 3300042016 Bacteria 986
449 Ga0439463_097452 3300042016 Bacteria 758
450 Ga0439463_203491 3300042016 Bacteria 514
451 Ga0450911_000024 3300042115 Bacteria 84076
452 Ga0450911_000362 3300042115 Bacteria 15166
453 Ga0450911_002057 3300042115 Bacteria 4144
454 Ga0450911_008786 3300042115 Bacteria 1430
455 Ga0450911_033683 3300042115 Bacteria 664
456 Ga0450914_029355 3300042118 Bacteria 655
457 Ga0450919_007386 3300042121 Bacteria 1284
458 Ga0450921_002208 3300042123 Bacteria 1271
459 Ga0450922_000400 3300042124 Bacteria 4652
460 Ga0450923_007253 3300042125 Bacteria 1867
461 Ga0450900_000937 3300042136 Bacteria 2625
462 Ga0450900_034398 3300042136 Bacteria 744
463 Ga0450902_000569 3300042137 Bacteria 4677
464 Ga0450902_008236 3300042137 Bacteria 1625
465 Ga0450902_028201 3300042137 Bacteria 942
466 Ga0450902_054733 3300042137 Bacteria 686
467 Ga0450903_001618 3300042138 Bacteria 4189
468 Ga0450903_003832 3300042138 Bacteria 2590
469 Ga0450903_016400 3300042138 Bacteria 1162
470 Ga0450903_024116 3300042138 Bacteria 933
471 Ga0450903_030115 3300042138 Bacteria 821
472 Ga0450903_068744 3300042138 Bacteria 511
473 Ga0450904_000070 3300042139 Bacteria 22975
474 Ga0450904_001955 3300042139 Bacteria 2630
475 Ga0450905_000013 3300042142 Bacteria 16288
476 Ga0450905_002872 3300042142 Bacteria 2239
477 Ga0450905_071543 3300042142 Bacteria 592
478 Ga0450905_099455 3300042142 Bacteria 520
479 Ga0450889_008550 3300042144 Bacteria 1042
480 Ga0450906_001514 3300042145 Bacteria 5073
481 Ga0450906_001711 3300042145 Bacteria 4799
482 Ga0450907_000282 3300042146 Bacteria 17206
483 Ga0450907_000330 3300042146 Bacteria 14991
484 Ga0450907_032000 3300042146 Bacteria 895
485 Ga0450910_000242 3300042147 Bacteria 6272
486 Ga0450910_006746 3300042147 Bacteria 1590
487 Ga0450910_016596 3300042147 Bacteria 1091
488 Ga0439446_0002968 3300042156 Bacteria 4151
489 Ga0439446_0045813 3300042156 Bacteria 1297
490 Ga0439446_0171609 3300042156 Bacteria 721
491 Ga0450909_001691 3300042185 Bacteria 3091
492 Ga0450909_029598 3300042185 Bacteria 829
493 Ga0439434_0000230 3300042435 Bacteria 15625
494 Ga0439434_0050779 3300042435 Bacteria 1285
495 Ga0439459_0007632 3300042438 Bacteria 1831
496 Ga0439460_0000561 3300042461 Bacteria 8138
497 Ga0439460_0004030 3300042461 Bacteria 3570
498 Ga0439460_0045057 3300042461 Bacteria 1307
499 Ga0450916_000963 3300042530 Bacteria 2771
500 Ga0450918_009991 3300042531 Bacteria 1658
501 Ga0450893_0016294 3300042532 Bacteria 1257
502 Ga0450893_0059917 3300042532 Bacteria 725
503 Ga0450893_0060706 3300042532 Bacteria 721
504 Ga0450893_0076471 3300042532 Bacteria 656
505 Ga0450901_000235 3300042533 Bacteria 6731
506 Ga0450901_003807 3300042533 Bacteria 1570
507 Ga0451577_0036347 3300042876 Bacteria 4433
508 Ga0451577_0181789 3300042876 Bacteria 1896
509 Ga0439440_0000379 3300042993 Bacteria 7436
510 Ga0439440_0003720 3300042993 Bacteria 2962
511 Ga0453684_0000512 3300044712 Bacteria 150627
512 Ga0451576_0000503 3300045051 Bacteria 85722
513 Ga0451576_0578986 3300045051 Bacteria 1180
514 Ga0451576_2156950 3300045051 Bacteria 572
515 Ga0495617_001282 3300046452 Bacteria 11200
516 Ga0495617_001932 3300046452 Bacteria 8689
517 Ga0495617_015244 3300046452 Bacteria 2606
518 Ga0495617_016921 3300046452 Bacteria 2465
519 Ga0495617_019076 3300046452 Bacteria 2319
520 Ga0495617_023506 3300046452 Bacteria 2083
521 Ga0495617_029650 3300046452 Bacteria 1839
522 Ga0495617_038218 3300046452 Bacteria 1606
523 Ga0495617_059631 3300046452 Bacteria 1263
524 Ga0495617_097950 3300046452 Bacteria 954
525 Ga0495617_141323 3300046452 Bacteria 768
526 Ga0495617_158811 3300046452 Bacteria 717
527 Ga0495627_001049 3300046453 Bacteria 18374
528 Ga0495627_002831 3300046453 Bacteria 8031
529 Ga0495627_005013 3300046453 Bacteria 5421
530 Ga0495627_009431 3300046453 Bacteria 3591
531 Ga0495627_010277 3300046453 Bacteria 3409
532 Ga0495627_017497 3300046453 Bacteria 2434
533 Ga0495627_055430 3300046453 Bacteria 1183
534 Ga0495627_095800 3300046453 Bacteria 850
535 Ga0495627_104941 3300046453 Bacteria 804
536 Ga0495627_112475 3300046453 Bacteria 772
537 Ga0495603_0002845 3300046455 Bacteria 10221
538 Ga0495603_0035392 3300046455 Bacteria 2999
539 Ga0495603_0076791 3300046455 Bacteria 1960
540 Ga0495590_0000558 3300046457 Bacteria 17741
541 Ga0495590_0007795 3300046457 Bacteria 4108
542 Ga0495590_0012761 3300046457 Bacteria 3108
543 Ga0495590_0023488 3300046457 Bacteria 2176
544 Ga0495590_0041534 3300046457 Bacteria 1603
545 Ga0495590_0297686 3300046457 Bacteria 606
546 Ga0495591_000463 3300046458 Bacteria 32629
547 Ga0495591_001156 3300046458 Bacteria 17300
548 Ga0495591_001755 3300046458 Bacteria 12910
549 Ga0495591_001936 3300046458 Bacteria 12131
550 Ga0495591_002997 3300046458 Bacteria 9003
551 Ga0495591_006539 3300046458 Bacteria 5134
552 Ga0495591_007297 3300046458 Bacteria 4725
553 Ga0495591_010916 3300046458 Bacteria 3476
554 Ga0495591_014183 3300046458 Bacteria 2878
555 Ga0495591_017198 3300046458 Bacteria 2492
556 Ga0495591_021261 3300046458 Bacteria 2122
557 Ga0495591_031849 3300046458 Bacteria 1577
558 Ga0495591_034861 3300046458 Bacteria 1477
559 Ga0495591_038998 3300046458 Bacteria 1364
560 Ga0495591_054303 3300046458 Bacteria 1083
561 Ga0495591_065264 3300046458 Bacteria 957
562 Ga0495629_1119107 3300046459 Bacteria 508
563 Ga0495638_0002884 3300046460 Bacteria 13750
564 Ga0495638_0006076 3300046460 Bacteria 8838
565 Ga0495638_0013777 3300046460 Bacteria 5490
566 Ga0495638_0014654 3300046460 Bacteria 5290
567 Ga0495638_0028521 3300046460 Bacteria 3603
568 Ga0495638_0034530 3300046460 Bacteria 3229
569 Ga0495638_0062358 3300046460 Bacteria 2301
570 Ga0495638_0066345 3300046460 Bacteria 2218
571 Ga0495638_0066591 3300046460 Bacteria 2214
572 Ga0495638_0070630 3300046460 Bacteria 2137
573 Ga0495638_0074379 3300046460 Bacteria 2072
574 Ga0495638_0111180 3300046460 Bacteria 1627
575 Ga0495638_0384227 3300046460 Bacteria 732
576 Ga0495638_0545637 3300046460 Bacteria 577
577 Ga0495653_0001669 3300046463 Bacteria 17443
578 Ga0495653_0005073 3300046463 Bacteria 10686
579 Ga0495653_0024603 3300046463 Bacteria 4849
580 Ga0495653_0039989 3300046463 Bacteria 3668
581 Ga0495653_0069450 3300046463 Bacteria 2639
582 Ga0495650_0005353 3300046471 Bacteria 8370
583 Ga0495650_0005933 3300046471 Bacteria 7757
584 Ga0495650_0015241 3300046471 Bacteria 3951
585 Ga0495650_0018262 3300046471 Bacteria 3489
586 Ga0495650_0018353 3300046471 Bacteria 3477
587 Ga0495650_0142786 3300046471 Bacteria 865
588 Ga0495582_0002303 3300046473 Bacteria 10693
589 Ga0495605_0001057 3300046474 Bacteria 18361
590 Ga0495605_0006764 3300046474 Bacteria 6552
591 Ga0495605_0017199 3300046474 Bacteria 3897
592 Ga0495605_0025506 3300046474 Bacteria 3080
593 Ga0495605_0086639 3300046474 Bacteria 1457
594 Ga0495605_0096274 3300046474 Bacteria 1365
595 Ga0495605_0160953 3300046474 Bacteria 996
596 Ga0495639_0024400 3300046475 Bacteria 2662
597 Ga0495639_0241546 3300046475 Bacteria 891
598 Ga0495639_0665245 3300046475 Bacteria 537
599 Ga0495664_0229748 3300046477 Bacteria 1123
600 Ga0495584_0003104 3300046491 Bacteria 9234
601 Ga0495584_0007278 3300046491 Bacteria 5773
602 Ga0495584_0011226 3300046491 Bacteria 4588
603 Ga0495584_0020265 3300046491 Bacteria 3379
604 Ga0495584_0036789 3300046491 Bacteria 2472
605 Ga0495584_0044603 3300046491 Bacteria 2237
606 Ga0495584_0049231 3300046491 Bacteria 2123
607 Ga0495584_0049440 3300046491 Bacteria 2118
608 Ga0495584_0123291 3300046491 Bacteria 1312
609 Ga0495584_0265593 3300046491 Bacteria 872
610 Ga0495585_0001709 3300046492 Bacteria 16731
611 Ga0495585_0006323 3300046492 Bacteria 7359
612 Ga0495585_0006623 3300046492 Bacteria 7157
613 Ga0495585_0010925 3300046492 Bacteria 5395
614 Ga0495585_0015085 3300046492 Bacteria 4490
615 Ga0495585_0020349 3300046492 Bacteria 3816
616 Ga0495585_0045766 3300046492 Bacteria 2441
617 Ga0495585_0086823 3300046492 Bacteria 1689
618 Ga0495585_0129961 3300046492 Bacteria 1326
619 Ga0495596_0001193 3300046500 Bacteria 15185
620 Ga0495596_0007104 3300046500 Bacteria 5072
621 Ga0495607_0001745 3300046501 Bacteria 18612
622 Ga0495607_0005815 3300046501 Bacteria 8771
623 Ga0495607_0008132 3300046501 Bacteria 7195
624 Ga0495607_0015568 3300046501 Bacteria 4927
625 Ga0495607_0032749 3300046501 Bacteria 3169
626 Ga0495607_0035198 3300046501 Bacteria 3031
627 Ga0495607_0057253 3300046501 Bacteria 2234
628 Ga0495607_0071538 3300046501 Bacteria 1933
629 Ga0495607_0080734 3300046501 Bacteria 1787
630 Ga0495607_0087872 3300046501 Bacteria 1690
631 Ga0495607_0094595 3300046501 Bacteria 1612
632 Ga0495583_0003362 3300046506 Bacteria 12298
633 Ga0495583_0008670 3300046506 Bacteria 6185
634 Ga0495583_0028914 3300046506 Bacteria 2718
635 Ga0495606_0002681 3300046507 Bacteria 20169
636 Ga0495606_0004539 3300046507 Bacteria 13808
637 Ga0495606_0006769 3300046507 Bacteria 10481
638 Ga0495606_0007198 3300046507 Bacteria 10036
639 Ga0495606_0014260 3300046507 Bacteria 6215
640 Ga0495606_0016737 3300046507 Bacteria 5574
641 Ga0495606_0021713 3300046507 Bacteria 4696
642 Ga0495606_0036845 3300046507 Bacteria 3328
643 Ga0495606_0066107 3300046507 Bacteria 2295
644 Ga0495606_0085307 3300046507 Bacteria 1953
645 Ga0495606_0207498 3300046507 Bacteria 1112
646 Ga0495606_0514902 3300046507 Bacteria 601
647 Ga0495610_0002291 3300046512 Bacteria 16173
648 Ga0495610_0005241 3300046512 Bacteria 9275
649 Ga0495610_0005960 3300046512 Bacteria 8532
650 Ga0495610_0010830 3300046512 Bacteria 5631
651 Ga0495610_0013782 3300046512 Bacteria 4783
652 Ga0495610_0014313 3300046512 Bacteria 4665
653 Ga0495610_0029515 3300046512 Bacteria 2886
654 Ga0495610_0036538 3300046512 Bacteria 2509
655 Ga0495610_0064754 3300046512 Bacteria 1727
656 Ga0495610_0088701 3300046512 Bacteria 1405
657 Ga0495610_0124369 3300046512 Bacteria 1126
658 Ga0495610_0185417 3300046512 Bacteria 862
659 Ga0495610_0270605 3300046512 Bacteria 665
660 Ga0495616_0002868 3300046513 Bacteria 11248
661 Ga0495616_0003320 3300046513 Bacteria 10337
662 Ga0495616_0004395 3300046513 Bacteria 8895
663 Ga0495616_0005435 3300046513 Bacteria 7844
664 Ga0495616_0008635 3300046513 Bacteria 6016
665 Ga0495616_0010609 3300046513 Bacteria 5324
666 Ga0495616_0076551 3300046513 Bacteria 1607
667 Ga0495616_0079156 3300046513 Bacteria 1576
668 Ga0495616_0083265 3300046513 Bacteria 1526
669 Ga0495616_0159046 3300046513 Bacteria 1017
670 Ga0495616_0281669 3300046513 Bacteria 706
671 Ga0495620_0000229 3300046515 Bacteria 41859
672 Ga0495620_0000542 3300046515 Bacteria 24011
673 Ga0495620_0004801 3300046515 Bacteria 7595
674 Ga0495620_0009886 3300046515 Bacteria 5052
675 Ga0495620_0013421 3300046515 Bacteria 4194
676 Ga0495620_0013820 3300046515 Bacteria 4123
677 Ga0495620_0020106 3300046515 Bacteria 3267
678 Ga0495620_0027750 3300046515 Bacteria 2644
679 Ga0495620_0028923 3300046515 Bacteria 2570
680 Ga0495620_0034925 3300046515 Bacteria 2267
681 Ga0495628_0088032 3300046516 Bacteria 2407
682 Ga0495628_0235458 3300046516 Bacteria 1371
683 Ga0495630_0338752 3300046517 Bacteria 1150
684 Ga0495631_0000845 3300046518 Bacteria 19423
685 Ga0495631_0000908 3300046518 Bacteria 18435
686 Ga0495631_0001441 3300046518 Bacteria 14441
687 Ga0495631_0024269 3300046518 Bacteria 2800
688 Ga0495631_0051450 3300046518 Bacteria 1800
689 Ga0495631_0056118 3300046518 Bacteria 1715
690 Ga0495631_0110070 3300046518 Bacteria 1184
691 Ga0495632_0000593 3300046519 Bacteria 33650
692 Ga0495632_0001690 3300046519 Bacteria 18052
693 Ga0495632_0002757 3300046519 Bacteria 13044
694 Ga0495632_0012915 3300046519 Bacteria 4790
695 Ga0495632_0013222 3300046519 Bacteria 4719
696 Ga0495632_0019036 3300046519 Bacteria 3749
697 Ga0495632_0019387 3300046519 Bacteria 3707
698 Ga0495632_0020749 3300046519 Bacteria 3551
699 Ga0495632_0037803 3300046519 Bacteria 2446
700 Ga0495632_0063280 3300046519 Bacteria 1791
701 Ga0495632_0081055 3300046519 Bacteria 1547
702 Ga0495632_0081982 3300046519 Bacteria 1537
703 Ga0495632_0136043 3300046519 Bacteria 1142
704 Ga0495632_0161586 3300046519 Bacteria 1032
705 Ga0495637_0000393 3300046520 Bacteria 32465
706 Ga0495637_0000966 3300046520 Bacteria 18318
707 Ga0495637_0002531 3300046520 Bacteria 10077
708 Ga0495637_0002532 3300046520 Bacteria 10076
709 Ga0495637_0009107 3300046520 Bacteria 4848
710 Ga0495637_0019520 3300046520 Bacteria 3133
711 Ga0495637_0025197 3300046520 Bacteria 2682
712 Ga0495637_0027574 3300046520 Bacteria 2539
713 Ga0495637_0039734 3300046520 Bacteria 2028
714 Ga0495637_0043263 3300046520 Bacteria 1923
715 Ga0495637_0077919 3300046520 Bacteria 1325
716 Ga0495637_0081685 3300046520 Bacteria 1288
717 Ga0495637_0108749 3300046520 Bacteria 1076
718 Ga0495643_0000811 3300046522 Bacteria 34205
719 Ga0495643_0001185 3300046522 Bacteria 25410
720 Ga0495643_0009357 3300046522 Bacteria 6093
721 Ga0495643_0009653 3300046522 Bacteria 5978
722 Ga0495643_0010817 3300046522 Bacteria 5594
723 Ga0495643_0019998 3300046522 Bacteria 3867
724 Ga0495643_0059855 3300046522 Bacteria 2023
725 Ga0495643_0063905 3300046522 Bacteria 1945
726 Ga0495643_0354572 3300046522 Bacteria 656
727 Ga0495644_0002639 3300046523 Bacteria 7125
728 Ga0495644_0003018 3300046523 Bacteria 6664
729 Ga0495644_0006496 3300046523 Bacteria 4530
730 Ga0495644_0008897 3300046523 Bacteria 3861
731 Ga0495644_0019869 3300046523 Bacteria 2564
732 Ga0495644_0215028 3300046523 Bacteria 742
733 Ga0495648_0000960 3300046524 Bacteria 29754
734 Ga0495648_0002115 3300046524 Bacteria 18706
735 Ga0495648_0019207 3300046524 Bacteria 4814
736 Ga0495648_0024362 3300046524 Bacteria 4123
737 Ga0495648_0024642 3300046524 Bacteria 4090
738 Ga0495648_0026855 3300046524 Bacteria 3866
739 Ga0495648_0028461 3300046524 Bacteria 3721
740 Ga0495648_0034617 3300046524 Bacteria 3284
741 Ga0495648_0038545 3300046524 Bacteria 3054
742 Ga0495648_0042856 3300046524 Bacteria 2844
743 Ga0495648_0067478 3300046524 Bacteria 2091
744 Ga0495648_0132198 3300046524 Bacteria 1325
745 Ga0495648_0199551 3300046524 Bacteria 1002
746 Ga0495648_0216870 3300046524 Bacteria 946
747 Ga0495666_0004503 3300046526 Bacteria 7039
748 Ga0495666_0042748 3300046526 Bacteria 2190
749 Ga0495666_0067229 3300046526 Bacteria 1707
750 Ga0495666_0112618 3300046526 Bacteria 1277
751 Ga0495642_0000237 3300046528 Bacteria 31221
752 Ga0495642_0000270 3300046528 Bacteria 29305
753 Ga0495652_0690089 3300046529 Bacteria 688
754 Ga0495654_0001335 3300046530 Bacteria 17179
755 Ga0495654_0001658 3300046530 Bacteria 15077
756 Ga0495654_0002833 3300046530 Bacteria 10895
757 Ga0495654_0004103 3300046530 Bacteria 8737
758 Ga0495654_0004943 3300046530 Bacteria 7838
759 Ga0495654_0006261 3300046530 Bacteria 6777
760 Ga0495654_0008238 3300046530 Bacteria 5768
761 Ga0495654_0024569 3300046530 Bacteria 3111
762 Ga0495654_0026321 3300046530 Bacteria 2990
763 Ga0495654_0028138 3300046530 Bacteria 2875
764 Ga0495654_0029531 3300046530 Bacteria 2795
765 Ga0495654_0030913 3300046530 Bacteria 2720
766 Ga0495654_0041962 3300046530 Bacteria 2273
767 Ga0495654_0051516 3300046530 Bacteria 2008
768 Ga0495654_0052150 3300046530 Bacteria 1993
769 Ga0495654_0086793 3300046530 Bacteria 1457
770 Ga0495654_0089989 3300046530 Bacteria 1426
771 Ga0495654_0224352 3300046530 Bacteria 793
772 Ga0495654_0225025 3300046530 Bacteria 791
773 Ga0495654_0273045 3300046530 Bacteria 697
774 Ga0495654_0392015 3300046530 Bacteria 552
775 Ga0495586_0007882 3300046535 Bacteria 5678
776 Ga0495587_0007457 3300046536 Bacteria 7084
777 Ga0495587_0015450 3300046536 Bacteria 4766
778 Ga0495587_0129790 3300046536 Bacteria 1441
779 Ga0495609_0004586 3300046538 Bacteria 7503
780 Ga0495609_0014282 3300046538 Bacteria 3737
781 Ga0495609_0020526 3300046538 Bacteria 3052
782 Ga0495609_0024489 3300046538 Bacteria 2769
783 Ga0495609_0083066 3300046538 Bacteria 1398
784 Ga0495609_0234415 3300046538 Bacteria 759
785 Ga0495609_0248605 3300046538 Bacteria 732
786 Ga0495609_0327014 3300046538 Bacteria 621
787 Ga0495597_0002250 3300046542 Bacteria 12576
788 Ga0495597_0004422 3300046542 Bacteria 7722
789 Ga0495597_0012239 3300046542 Bacteria 4144
790 Ga0495597_0035478 3300046542 Bacteria 2249
791 Ga0495597_0110687 3300046542 Bacteria 1151
792 Ga0495597_0253125 3300046542 Bacteria 691
793 Ga0495597_0394131 3300046542 Bacteria 527
794 Ga0495645_0056068 3300046543 Bacteria 2861
795 Ga0495645_0645529 3300046543 Bacteria 647
796 Ga0495622_0001569 3300046557 Bacteria 11312
797 Ga0495622_0001935 3300046557 Bacteria 10182
798 Ga0495622_0032513 3300046557 Bacteria 2435
799 Ga0495633_0002259 3300046558 Bacteria 13789
800 Ga0495633_0026675 3300046558 Bacteria 2832
801 Ga0495633_0128814 3300046558 Bacteria 1171
802 Ga0495656_0008776 3300046615 Bacteria 3621
803 Ga0495656_0122621 3300046615 Bacteria 1228
804 Ga0495656_0674544 3300046615 Bacteria 555
805 Ga0495668_0003766 3300046616 Bacteria 11121
806 Ga0495668_0008366 3300046616 Bacteria 6473
807 Ga0495668_0074839 3300046616 Bacteria 1860
808 Ga0495634_0005534 3300046642 Bacteria 9697
809 Ga0495634_0051326 3300046642 Bacteria 2767
810 Ga0495611_0000854 3300046648 Bacteria 16708
811 Ga0495611_0130239 3300046648 Bacteria 1173
812 Ga0495611_0393754 3300046648 Bacteria 633
813 Ga0495625_0006403 3300046660 Bacteria 10495
814 Ga0495625_0008301 3300046660 Bacteria 8874
815 Ga0495625_0013026 3300046660 Bacteria 6706
816 Ga0495625_0034308 3300046660 Bacteria 3746
817 Ga0495625_0035177 3300046660 Bacteria 3693
818 Ga0495625_0035868 3300046660 Bacteria 3651
819 Ga0495625_0054377 3300046660 Bacteria 2859
820 Ga0495625_0061939 3300046660 Bacteria 2645
821 Ga0495625_0079237 3300046660 Bacteria 2291
822 Ga0495625_0683410 3300046660 Bacteria 608
823 Ga0495635_0001542 3300046663 Bacteria 15439
824 Ga0495635_0006306 3300046663 Bacteria 8262
825 Ga0495659_0062240 3300046664 Bacteria 1380
826 Ga0495661_0000036 3300046665 Bacteria 164694
827 Ga0495661_0002885 3300046665 Bacteria 13007
828 Ga0495661_0008604 3300046665 Bacteria 7053
829 Ga0495661_0014221 3300046665 Bacteria 5333
830 Ga0495661_0015679 3300046665 Bacteria 5051
831 Ga0495661_0020440 3300046665 Bacteria 4321
832 Ga0495661_0043416 3300046665 Bacteria 2763
833 Ga0495661_0092734 3300046665 Bacteria 1715
834 Ga0495661_0099133 3300046665 Bacteria 1643
835 Ga0495661_0179918 3300046665 Bacteria 1121
836 Ga0495661_0455019 3300046665 Bacteria 615
837 Ga0495661_0500481 3300046665 Bacteria 579
838 Ga0495588_0021073 3300046674 Bacteria 3208
839 Ga0495588_0120764 3300046674 Bacteria 1381
840 Ga0495588_0264899 3300046674 Bacteria 905
841 Ga0495657_0092391 3300046675 Bacteria 1939
842 Ga0495623_0006872 3300046679 Bacteria 7401
843 Ga0495623_0028923 3300046679 Bacteria 3566
844 Ga0495646_0008020 3300046680 Bacteria 6711
845 Ga0495646_0011734 3300046680 Bacteria 5571
846 Ga0495646_0109203 3300046680 Bacteria 1576
847 Ga0495669_0007378 3300046684 Bacteria 4608
848 Ga0495613_0029770 3300046689 Bacteria 4058
849 Ga0495613_0038441 3300046689 Bacteria 3547
850 Ga0495624_0003010 3300046690 Bacteria 12609
851 Ga0495624_0343122 3300046690 Bacteria 898
852 Ga0495670_0001553 3300046691 Bacteria 11217
853 Ga0495670_0004976 3300046691 Bacteria 6529
854 Ga0495670_0014987 3300046691 Bacteria 3814
855 Ga0495670_0022257 3300046691 Bacteria 3129
856 Ga0495670_0108273 3300046691 Bacteria 1436
857 Ga0495670_0204813 3300046691 Bacteria 1045
858 Ga0495670_0236329 3300046691 Bacteria 972
859 Ga0495670_0375705 3300046691 Bacteria 766
860 Ga0495671_0001962 3300046692 Bacteria 13206
861 Ga0495671_0008692 3300046692 Bacteria 5705
862 Ga0495671_0011834 3300046692 Bacteria 4782
863 Ga0495671_0031304 3300046692 Bacteria 2720
864 Ga0495671_0032184 3300046692 Bacteria 2677
865 Ga0495671_0032366 3300046692 Bacteria 2669
866 Ga0495671_0038346 3300046692 Bacteria 2421
867 Ga0495671_0044333 3300046692 Bacteria 2230
868 Ga0495671_0056272 3300046692 Bacteria 1947
869 Ga0495671_0086312 3300046692 Bacteria 1537
870 Ga0495671_0108366 3300046692 Bacteria 1356
871 Ga0495671_0205308 3300046692 Bacteria 955
872 Ga0495649_0000659 3300046694 Bacteria 28183
873 Ga0495649_0003726 3300046694 Bacteria 10131
874 Ga0495649_0008151 3300046694 Bacteria 6319
875 Ga0495649_0009665 3300046694 Bacteria 5716
876 Ga0495649_0014138 3300046694 Bacteria 4583
877 Ga0495649_0014952 3300046694 Bacteria 4433
878 Ga0495649_0016367 3300046694 Bacteria 4201
879 Ga0495649_0076766 3300046694 Bacteria 1788
880 Ga0495649_0079851 3300046694 Bacteria 1749
881 Ga0495649_0099928 3300046694 Bacteria 1542
882 Ga0495649_0102476 3300046694 Bacteria 1520
883 Ga0495649_0213824 3300046694 Bacteria 998
884 Ga0495649_0597407 3300046694 Bacteria 544
885 Ga0495589_0001163 3300046794 Bacteria 15670
886 Ga0495589_0006337 3300046794 Bacteria 6249
887 Ga0495589_0007623 3300046794 Bacteria 5669
888 Ga0495589_0008589 3300046794 Bacteria 5324
889 Ga0495589_0018841 3300046794 Bacteria 3539
890 Ga0495589_0032537 3300046794 Bacteria 2621
891 Ga0495589_0113864 3300046794 Bacteria 1304
892 Ga0495589_0419603 3300046794 Bacteria 613
893 Ga0495600_0006708 3300046809 Bacteria 7015
894 Ga0495600_0022409 3300046809 Bacteria 4054
895 Ga0495600_0672751 3300046809 Bacteria 624
896 Ga0495660_0003993 3300046810 Bacteria 9000
897 Ga0495660_0004581 3300046810 Bacteria 8344
898 Ga0495660_0006992 3300046810 Bacteria 6651
899 Ga0495660_0016847 3300046810 Bacteria 4210
900 Ga0495660_0016915 3300046810 Bacteria 4200
901 Ga0495660_0017181 3300046810 Bacteria 4166
902 Ga0495660_0018858 3300046810 Bacteria 3961
903 Ga0495660_0030886 3300046810 Bacteria 3015
904 Ga0495660_0038194 3300046810 Bacteria 2670
905 Ga0495660_0047297 3300046810 Bacteria 2356
906 Ga0495660_0056081 3300046810 Bacteria 2130
907 Ga0495660_0121157 3300046810 Bacteria 1323
908 Ga0495660_0129535 3300046810 Bacteria 1267
909 Ga0495660_0146363 3300046810 Bacteria 1170
910 Ga0495660_0361425 3300046810 Bacteria 643
911 Ga0495581_0012340 3300047315 Bacteria 4950
912 Ga0495604_0007867 3300047317 Bacteria 8440
913 Ga0495604_0017446 3300047317 Bacteria 5746
914 Ga0495604_0022790 3300047317 Bacteria 4998
915 Ga0495604_0151882 3300047317 Bacteria 1644
916 Ga0495604_0800815 3300047317 Bacteria 593
917 Ga0495636_0048456 3300047318 Bacteria 1775
918 Ga0495674_0024005 3300047319 Bacteria 5610
919 Ga0495672_0002056 3300047320 Bacteria 18905
920 Ga0495672_0002477 3300047320 Bacteria 16960
921 Ga0495672_0003645 3300047320 Bacteria 13037
922 Ga0495672_0004950 3300047320 Bacteria 10699
923 Ga0495672_0013720 3300047320 Bacteria 5575
924 Ga0495672_0015111 3300047320 Bacteria 5254
925 Ga0495672_0016471 3300047320 Bacteria 4978
926 Ga0495672_0016472 3300047320 Bacteria 4978
927 Ga0495672_0046420 3300047320 Bacteria 2590
928 Ga0495672_0048945 3300047320 Bacteria 2504
929 Ga0495672_0214337 3300047320 Bacteria 954
930 Ga0495672_0427610 3300047320 Bacteria 601
931 Ga0495676_0007211 3300047321 Bacteria 10196
932 Ga0495676_0042540 3300047321 Bacteria 3727
933 Ga0495676_0063102 3300047321 Bacteria 2890
934 Ga0495680_0002075 3300047322 Bacteria 20874
935 Ga0495680_0008556 3300047322 Bacteria 9290
936 Ga0495680_0031339 3300047322 Bacteria 4329
937 Ga0495680_0060774 3300047322 Bacteria 2910
938 Ga0495683_0000028 3300047323 Bacteria 153672
939 Ga0495683_0000898 3300047323 Bacteria 21004
940 Ga0495683_0001259 3300047323 Bacteria 17187
941 Ga0495683_0006272 3300047323 Bacteria 6507
942 Ga0495683_0012253 3300047323 Bacteria 4504
943 Ga0495683_0025975 3300047323 Bacteria 2999
944 Ga0495683_0038435 3300047323 Bacteria 2423
945 Ga0495683_0058833 3300047323 Bacteria 1907
946 Ga0495683_0058858 3300047323 Bacteria 1907
947 Ga0495683_0074726 3300047323 Bacteria 1660
948 Ga0495683_0200472 3300047323 Bacteria 900
949 Ga0495687_021589 3300047443 Bacteria 3110
950 Ga0495675_0018038 3300047444 Bacteria 4474
951 Ga0495675_0145591 3300047444 Bacteria 1466
952 Ga0495677_0000871 3300047445 Bacteria 12187
953 Ga0495677_0211838 3300047445 Bacteria 754
954 Ga0495679_002397 3300047446 Bacteria 9579
955 Ga0495679_009349 3300047446 Bacteria 3928
956 Ga0495679_011920 3300047446 Bacteria 3336
957 Ga0495679_030389 3300047446 Bacteria 1754
958 Ga0495679_044135 3300047446 Bacteria 1366
959 Ga0495679_096311 3300047446 Bacteria 825
960 Ga0495679_109798 3300047446 Bacteria 760
961 Ga0495673_0003986 3300047469 Bacteria 9432
962 Ga0495673_0004046 3300047469 Bacteria 9344
963 Ga0495673_0004341 3300047469 Bacteria 8913
964 Ga0495673_0004580 3300047469 Bacteria 8616
965 Ga0495673_0004868 3300047469 Bacteria 8296
966 Ga0495673_0012366 3300047469 Bacteria 4535
967 Ga0495673_0027383 3300047469 Bacteria 2714
968 Ga0495673_0029531 3300047469 Bacteria 2586
969 Ga0495673_0035010 3300047469 Bacteria 2317
970 Ga0495673_0042892 3300047469 Bacteria 2027
971 Ga0495673_0043631 3300047469 Bacteria 2005
972 Ga0495673_0058971 3300047469 Bacteria 1651
973 Ga0495673_0061789 3300047469 Bacteria 1602
974 Ga0495673_0071261 3300047469 Bacteria 1461
975 Ga0495673_0099634 3300047469 Bacteria 1176
976 Ga0495681_0000746 3300047470 Bacteria 25078
977 Ga0495681_0001398 3300047470 Bacteria 18179
978 Ga0495681_0001745 3300047470 Bacteria 16058
979 Ga0495681_0002503 3300047470 Bacteria 13092
980 Ga0495681_0004347 3300047470 Bacteria 9690
981 Ga0495681_0007249 3300047470 Bacteria 7126
982 Ga0495681_0010541 3300047470 Bacteria 5591
983 Ga0495681_0013379 3300047470 Bacteria 4763
984 Ga0495681_0048322 3300047470 Bacteria 2017
985 Ga0495681_0058514 3300047470 Bacteria 1785
986 Ga0495681_0063197 3300047470 Bacteria 1699
987 Ga0495681_0082421 3300047470 Bacteria 1433
988 Ga0495681_0172024 3300047470 Bacteria 895
989 Ga0495681_0411842 3300047470 Bacteria 503
990 Ga0495684_0019087 3300047471 Bacteria 5280
991 Ga0495684_0025807 3300047471 Bacteria 4515
992 Ga0495686_0007782 3300047472 Bacteria 7974
993 Ga0495686_0034044 3300047472 Bacteria 3284
994 Ga0495686_0073994 3300047472 Bacteria 2091
995 Ga0495686_0091987 3300047472 Bacteria 1840
996 Ga0495686_0670961 3300047472 Bacteria 531
997 Ga0495593_0012485 3300047673 Bacteria 4855
998 Ga0495593_0018481 3300047673 Bacteria 3915
999 Ga0495602_0017986 3300048088 Bacteria 7071
1000 Ga0495614_0242067 3300048089 Bacteria 824
1001 Ga0495626_0000678 3300048091 Bacteria 32578
1002 Ga0495626_0000783 3300048091 Bacteria 28914
1003 Ga0495626_0001422 3300048091 Bacteria 19066
1004 Ga0495626_0001640 3300048091 Bacteria 17349
1005 Ga0495626_0007365 3300048091 Bacteria 6129
1006 Ga0495626_0020323 3300048091 Bacteria 3310
1007 Ga0495626_0059349 3300048091 Bacteria 1745
1008 Ga0495626_0118695 3300048091 Bacteria 1139
1009 Ga0496100_0365126 3300048903 Bacteria 1093
1010 Ga0496102_0001294 3300048905 Bacteria 22507
1011 Ga0496103_0035041 3300048906 Bacteria 3071
1012 Ga0496110_0177059 3300048913 Bacteria 1936
1013 Ga0496111_0116063 3300048914 Bacteria 1974
1014 Ga0496111_0318500 3300048914 Bacteria 1152
1015 Ga0496112_0957490 3300048915 Bacteria 777
1016 Ga0496114_0007214 3300048917 Bacteria 8777
1017 Ga0496114_0040426 3300048917 Bacteria 3861
1018 Ga0496115_0272950 3300048918 Bacteria 1389
1019 Ga0496116_0000670 3300048919 Bacteria 44682
1020 Ga0496116_0002721 3300048919 Bacteria 18191
1021 Ga0496116_0006222 3300048919 Bacteria 10898
1022 Ga0496116_0006711 3300048919 Bacteria 10368
1023 Ga0496116_0024991 3300048919 Bacteria 4401
1024 Ga0496116_0045492 3300048919 Bacteria 2970
1025 Ga0496116_0464146 3300048919 Bacteria 538
1026 Ga0496117_0001364 3300048920 Bacteria 35606
1027 Ga0496117_0001531 3300048920 Bacteria 33002
1028 Ga0496117_0002217 3300048920 Bacteria 25149
1029 Ga0496117_0012525 3300048920 Bacteria 7467
1030 Ga0496117_0024834 3300048920 Bacteria 4724
1031 Ga0496117_0027661 3300048920 Bacteria 4410
1032 Ga0496117_0055087 3300048920 Bacteria 2781
1033 Ga0496117_0077360 3300048920 Bacteria 2202
1034 Ga0496117_0268896 3300048920 Bacteria 919
1035 Ga0496117_0438254 3300048920 Bacteria 649
1036 Ga0496117_0564255 3300048920 Bacteria 539
1037 Ga0496118_0001596 3300048921 Bacteria 33532
1038 Ga0496118_0013557 3300048921 Bacteria 7695
1039 Ga0496118_0031073 3300048921 Bacteria 4438
1040 Ga0496118_0035292 3300048921 Bacteria 4063
1041 Ga0496118_0038357 3300048921 Bacteria 3841
1042 Ga0496118_0094674 3300048921 Bacteria 2041
1043 Ga0496118_0103103 3300048921 Bacteria 1920
1044 Ga0496118_0115629 3300048921 Bacteria 1765
1045 Ga0496118_0298687 3300048921 Bacteria 885
1046 Ga0496119_0004034 3300048922 Bacteria 14828
1047 Ga0496119_0026956 3300048922 Bacteria 3967
1048 Ga0496119_0200981 3300048922 Bacteria 1031
1049 Ga0496119_0214297 3300048922 Bacteria 989
1050 Ga0496120_0003087 3300048923 Bacteria 15701
1051 Ga0496120_0006118 3300048923 Bacteria 9330
1052 Ga0496120_0154005 3300048923 Bacteria 1152
1053 Ga0496121_0001246 3300048924 Bacteria 44184
1054 Ga0496121_0051766 3300048924 Bacteria 3455
1055 Ga0496121_0054501 3300048924 Bacteria 3340
1056 Ga0496121_0079190 3300048924 Bacteria 2609
1057 Ga0496121_0092511 3300048924 Bacteria 2357
1058 Ga0496122_0000398 3300048925 Bacteria 92491
1059 Ga0496122_0002086 3300048925 Bacteria 29621
1060 Ga0496122_0006633 3300048925 Bacteria 13200
1061 Ga0496122_0048950 3300048925 Bacteria 3244
1062 Ga0496122_0052963 3300048925 Bacteria 3064
1063 Ga0496122_0053994 3300048925 Bacteria 3023
1064 Ga0496122_0057451 3300048925 Bacteria 2889
1065 Ga0496122_0139964 3300048925 Bacteria 1516
1066 Ga0496122_0389215 3300048925 Bacteria 712
1067 Ga0496122_0402143 3300048925 Bacteria 695
1068 Ga0496123_0000178 3300048926 Bacteria 128587
1069 Ga0496123_0000302 3300048926 Bacteria 95750
1070 Ga0496123_0002164 3300048926 Bacteria 25080
1071 Ga0496123_0032441 3300048926 Bacteria 3781
1072 Ga0496123_0035669 3300048926 Bacteria 3540
1073 Ga0496123_0038238 3300048926 Bacteria 3376
1074 Ga0496123_0066006 3300048926 Bacteria 2295
1075 Ga0496123_0136922 3300048926 Bacteria 1346
1076 Ga0496124_0002969 3300048927 Bacteria 21267
1077 Ga0496124_0004019 3300048927 Bacteria 17511
1078 Ga0496124_0006247 3300048927 Bacteria 13051
1079 Ga0496124_0010717 3300048927 Bacteria 9246
1080 Ga0496124_0012209 3300048927 Bacteria 8497
1081 Ga0496124_0031270 3300048927 Bacteria 4713
1082 Ga0496124_0046634 3300048927 Bacteria 3710
1083 Ga0496124_0051932 3300048927 Bacteria 3485
1084 Ga0496124_0064357 3300048927 Bacteria 3061
1085 Ga0496124_0076989 3300048927 Bacteria 2752
1086 Ga0496124_0110381 3300048927 Bacteria 2214
1087 Ga0496124_0150093 3300048927 Bacteria 1829
1088 Ga0496124_0238505 3300048927 Bacteria 1354
1089 Ga0496124_0561228 3300048927 Bacteria 751
1090 Ga0496125_0003933 3300048928 Bacteria 17526
1091 Ga0496125_0006758 3300048928 Bacteria 12323
1092 Ga0496125_0014752 3300048928 Bacteria 7590
1093 Ga0496125_0020480 3300048928 Bacteria 6207
1094 Ga0496125_0027497 3300048928 Bacteria 5154
1095 Ga0496125_0036851 3300048928 Bacteria 4260
1096 Ga0496125_0051859 3300048928 Bacteria 3379
1097 Ga0496125_0064164 3300048928 Bacteria 2921
1098 Ga0496125_0070320 3300048928 Bacteria 2741
1099 Ga0496125_0647886 3300048928 Bacteria 569
1100 Ga0496126_0009693 3300048929 Bacteria 10201
1101 Ga0496126_0090604 3300048929 Bacteria 2690
1102 Ga0496126_0269729 3300048929 Bacteria 1412
1103 Ga0496126_0589016 3300048929 Bacteria 877
1104 Ga0496126_0778775 3300048929 Bacteria 736
1105 Ga0501308_037983 3300049128 Bacteria 669
1106 Ga0495678_001198 3300049459 Bacteria 21337
1107 Ga0495678_003432 3300049459 Bacteria 9823
1108 Ga0495678_013127 3300049459 Bacteria 3900
1109 Ga0495678_014798 3300049459 Bacteria 3614
1110 Ga0495678_025053 3300049459 Bacteria 2567
1111 Ga0495678_026859 3300049459 Bacteria 2450
1112 Ga0495678_028133 3300049459 Bacteria 2376
1113 Ga0495678_038201 3300049459 Bacteria 1945
1114 Ga0495678_060505 3300049459 Bacteria 1424
1115 Ga0495678_099242 3300049459 Bacteria 1011
1116 Ga0495678_135526 3300049459 Bacteria 811
1117 Ga0495682_0001449 3300049460 Bacteria 12822
1118 Ga0495682_0012178 3300049460 Bacteria 3301
1119 Ga0495682_0018021 3300049460 Bacteria 2659
1120 Ga0495682_0026902 3300049460 Bacteria 2134
1121 Ga0495682_0088276 3300049460 Bacteria 1114
1122 Ga0501314_011131 3300049530 Bacteria 846
1123 Ga0501315_054101 3300049531 Bacteria 636
1124 Ga0501034_0000143 3300049571 Bacteria 133317
1125 Ga0501222_018685 3300049662 Bacteria 923
1126 Ga0501227_061635 3300049665 Bacteria 962
1127 Ga0501240_001908 3300049673 Bacteria 2122
1128 Ga0501245_114848 3300049708 Unclassified 561
1129 Ga0501241_001000 3300049758 Bacteria 5953
1130 Ga0501226_000001 3300049853 Bacteria 432595
1131 nmdc:mga03683_207476_c1 3300050489 Bacteria 901
1132 nmdc:mga03683_49414_c1 3300050489 Bacteria 1751
1133 nmdc:mga00v17_336831_c1 3300050491 Bacteria 981
1134 nmdc:mga00v17_387897_c1 3300050491 Bacteria 908
1135 nmdc:mga0k408_518329_c1 3300050493 Bacteria 706
1136 nmdc:mga08x19_180272_c1 3300050514 Bacteria 1442
1137 nmdc:mga08x19_216267_c1 3300050514 Bacteria 1316
1138 nmdc:mga08x19_844824_c1 3300050514 Bacteria 650
1139 nmdc:mga0sz30_463256_c1 3300050516 Bacteria 569
1140 Ga0500572_004557 3300053111 Bacteria 3146
1141 Ga0500618_002286 3300053125 Bacteria 7385
1142 Ga0500659_0003926 3300053135 Bacteria 8594
1143 Ga0500586_188611 3300053145 Bacteria 683
1144 Ga0500586_257529 3300053145 Bacteria 544
1145 Ga0500634_0043183 3300053161 Bacteria 2444

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100268012 Ga0068867_1002680121 123
2 iso_pu_bacteria 2651869719 2652545906 123
3 iso_pu_bacteria 2687453129 2687579295 123
4 iso_pu_bacteria 2808606373 2808905675 123
5 iso_pu_bacteria 2823421272 2823425729 123
6 iso_pu_bacteria 2826581358 2826581888 123
7 iso_pu_bacteria 2842815866 2842816858 123
8 iso_pu_bacteria 2842849001 2842853928 123
9 iso_pu_bacteria 2913036834 2913042543 123
10 iso_pu_bacteria 8034962539 8034965058 123
11 3300005329 Ga0070683_101641522 Ga0070683_1016415222 124
12 3300025909 Ga0207705_10363524 Ga0207705_103635242 124
13 3300026089 Ga0207648_10023158 Ga0207648_100231582 124
14 3300005354 Ga0070675_100319212 Ga0070675_1003192122 125
15 3300005435 Ga0070714_100157933 Ga0070714_1001579332 125
16 3300005435 Ga0070714_100236212 Ga0070714_1002362122 125
17 3300005436 Ga0070713_100334990 Ga0070713_1003349902 125
18 3300005439 Ga0070711_100446663 Ga0070711_1004466632 125
19 3300005546 Ga0070696_100708340 Ga0070696_1007083402 125
20 3300005563 Ga0068855_100088470 Ga0068855_1000884702 125
21 3300005563 Ga0068855_102089178 Ga0068855_1020891782 125
22 3300005842 Ga0068858_100027507 Ga0068858_1000275072 125
23 3300009093 Ga0105240_10136451 Ga0105240_101364512 125
24 3300009094 Ga0111539_11613993 Ga0111539_116139932 125
25 3300009174 Ga0105241_12336562 Ga0105241_123365622 125
26 3300009176 Ga0105242_10001270 Ga0105242_100012707 125
27 3300009177 Ga0105248_12532969 Ga0105248_125329692 125
28 3300009553 Ga0105249_10383748 Ga0105249_103837482 125
29 3300013104 Ga0157370_10446715 Ga0157370_104467152 125
30 3300013307 Ga0157372_10066684 Ga0157372_100666843 125
31 3300014326 Ga0157380_11888557 Ga0157380_118885572 125
32 3300014968 Ga0157379_10007985 Ga0157379_100079852 125
33 3300025916 Ga0207663_10562573 Ga0207663_105625732 125
34 3300025929 Ga0207664_10157828 Ga0207664_101578282 125
35 3300025929 Ga0207664_10200192 Ga0207664_102001922 125
36 3300025934 Ga0207686_10003056 Ga0207686_100030562 125
37 3300025941 Ga0207711_10569138 Ga0207711_105691382 125
38 3300025949 Ga0207667_11310925 Ga0207667_113109251 125
39 3300025961 Ga0207712_10149662 Ga0207712_101496622 125
40 3300026035 Ga0207703_10003154 Ga0207703_100031548 125
41 3300028653 Ga0265323_10023355 Ga0265323_100233552 125
42 3300032004 Ga0307414_11489731 Ga0307414_114897312 125
43 3300032126 Ga0307415_100628081 Ga0307415_1006280812 125
44 3300035114 Ga0373939_0403808 Ga0373939_0403808_67_447 125
45 3300035691 Ga0373931_0141886 Ga0373931_0141886_598_978 125
46 3300041512 Ga0451853_4076545 Ga0451853_4076545_131_511 125
47 3300045051 Ga0451576_0578986 Ga0451576_0578986_264_644 125
48 3300047317 Ga0495604_0800815 Ga0495604_0800815_36_416 125
49 3300050493 nmdc:mga0k408_518329_c1 nmdc:mga0k408_518329_c1_308_688 125
50 3300027395 Ga0209996_1014478 Ga0209996_10144782 126
51 3300037068 Ga0373925_0383208 Ga0373925_0383208_675_1058 126
52 3300041459 Ga0451800_0736224 Ga0451800_0736224_134_517 126
53 3300042876 Ga0451577_0181789 Ga0451577_0181789_36_419 126
54 3300044712 Ga0453684_0000512 Ga0453684_0000512_107646_108029 126
55 3300045051 Ga0451576_0000503 Ga0451576_0000503_78921_79304 126
56 3300045051 Ga0451576_2156950 Ga0451576_2156950_139_522 126
57 2124908027 MRS2a_Contig_718 MRS2a_00574100 127
58 2162886007 SwRhRL2b_contig_1246565 SwRhRL2b_0416.00005990 127
59 2162886007 SwRhRL2b_contig_1309588 SwRhRL2b_0715.00002630 127
60 3300002738 JGI25154J39366_1011554 JGI25154J39366_10115541 127
61 3300002771 JGI25163J39215_1000135 JGI25163J39215_100013511 127
62 3300002772 JGI25164J39214_1000236 JGI25164J39214_100023632 127
63 3300003214 JGI25165J46597_1000434 JGI25165J46597_100043432 127
64 3300003751 Ga0055538_1000032 Ga0055538_1000032149 127
65 3300003752 Ga0055539_1000043 Ga0055539_1000043149 127
66 3300003756 Ga0055533_1000052 Ga0055533_1000052149 127
67 3300003758 Ga0055532_1000047 Ga0055532_1000047129 127
68 3300003759 Ga0055525_1000062 Ga0055525_1000062149 127
69 3300003761 Ga0055535_1011611 Ga0055535_10116112 127
70 3300003781 Ga0055536_1000575 Ga0055536_100057513 127
71 3300003781 Ga0055536_1001028 Ga0055536_10010287 127
72 3300003791 Ga0055530_10000970 Ga0055530_1000097013 127
73 3300003791 Ga0055530_10006554 Ga0055530_100065542 127
74 3300003792 Ga0055540_1000694 Ga0055540_100069413 127
75 3300003792 Ga0055540_1001047 Ga0055540_10010477 127
76 3300003794 Ga0055531_10000483 Ga0055531_1000048321 127
77 3300003841 Ga0055541_1000030 Ga0055541_1000030149 127
78 3300005288 Ga0065714_10000055 Ga0065714_1000005513 127
79 3300005288 Ga0065714_10002767 Ga0065714_100027672 127
80 3300005288 Ga0065714_10003026 Ga0065714_1000302610 127
81 3300005288 Ga0065714_10170867 Ga0065714_101708672 127
82 3300005288 Ga0065714_10292598 Ga0065714_102925981 127
83 3300005288 Ga0065714_10300516 Ga0065714_103005161 127
84 3300005289 Ga0065704_10000729 Ga0065704_100007294 127
85 3300005289 Ga0065704_10078396 Ga0065704_100783965 127
86 3300005289 Ga0065704_10362996 Ga0065704_103629961 127
87 3300005289 Ga0065704_10576443 Ga0065704_105764431 127
88 3300005290 Ga0065712_10009759 Ga0065712_100097593 127
89 3300005328 Ga0070676_10910298 Ga0070676_109102982 127
90 3300005331 Ga0070670_100003746 Ga0070670_10000374610 127
91 3300005344 Ga0070661_100000126 Ga0070661_10000012622 127
92 3300005353 Ga0070669_100184534 Ga0070669_1001845342 127
93 3300005353 Ga0070669_100484304 Ga0070669_1004843042 127
94 3300005457 Ga0070662_100000101 Ga0070662_10000010126 127
95 3300005539 Ga0068853_100000372 Ga0068853_10000037226 127
96 3300005548 Ga0070665_101209081 Ga0070665_1012090812 127
97 3300005564 Ga0070664_100000491 Ga0070664_10000049110 127
98 3300005564 Ga0070664_100007669 Ga0070664_1000076699 127
99 3300005578 Ga0068854_100000622 Ga0068854_1000006226 127
100 3300005834 Ga0068851_10000007 Ga0068851_1000000752 127
101 3300006051 Ga0075364_10006642 Ga0075364_100066423 127
102 3300006051 Ga0075364_10025829 Ga0075364_100258292 127
103 3300006051 Ga0075364_10033443 Ga0075364_100334432 127
104 3300006051 Ga0075364_10094110 Ga0075364_100941102 127
105 3300006051 Ga0075364_10146067 Ga0075364_101460672 127
106 3300006051 Ga0075364_10315526 Ga0075364_103155262 127
107 3300006051 Ga0075364_10459522 Ga0075364_104595222 127
108 3300006051 Ga0075364_10525549 Ga0075364_105255492 127
109 3300006058 Ga0075432_10003458 Ga0075432_100034581 127
110 3300006058 Ga0075432_10015624 Ga0075432_100156242 127
111 3300006058 Ga0075432_10203179 Ga0075432_102031791 127
112 3300006058 Ga0075432_10254732 Ga0075432_102547322 127
113 3300006058 Ga0075432_10605387 Ga0075432_106053872 127
114 3300006914 Ga0075436_100032607 Ga0075436_1000326072 127
115 3300006914 Ga0075436_100789577 Ga0075436_1007895772 127
116 3300006914 Ga0075436_100998078 Ga0075436_1009980782 127
117 3300006944 Ga0099823_1000043 Ga0099823_100004346 127
118 3300006944 Ga0099823_1012472 Ga0099823_10124722 127
119 3300006946 Ga0079104_1000424 Ga0079104_100042422 127
120 3300006946 Ga0079104_1003320 Ga0079104_10033202 127
121 3300006946 Ga0079104_1077095 Ga0079104_10770952 127
122 3300006948 Ga0099826_10007475 Ga0099826_100074755 127
123 3300009011 Ga0105251_10000586 Ga0105251_1000058622 127
124 3300009011 Ga0105251_10000828 Ga0105251_1000082821 127
125 3300009011 Ga0105251_10003473 Ga0105251_100034734 127
126 3300009011 Ga0105251_10005861 Ga0105251_100058612 127
127 3300009011 Ga0105251_10018011 Ga0105251_100180112 127
128 3300009011 Ga0105251_10021263 Ga0105251_100212632 127
129 3300009011 Ga0105251_10064386 Ga0105251_100643862 127
130 3300009011 Ga0105251_10113027 Ga0105251_101130271 127
131 3300009011 Ga0105251_10279609 Ga0105251_102796092 127
132 3300009011 Ga0105251_10463760 Ga0105251_104637601 127
133 3300009036 Ga0105244_10002385 Ga0105244_1000238511 127
134 3300009036 Ga0105244_10011211 Ga0105244_100112112 127
135 3300009036 Ga0105244_10015983 Ga0105244_100159833 127
136 3300009036 Ga0105244_10021130 Ga0105244_100211302 127
137 3300009036 Ga0105244_10023014 Ga0105244_100230142 127
138 3300009036 Ga0105244_10030018 Ga0105244_100300182 127
139 3300009036 Ga0105244_10078308 Ga0105244_100783082 127
140 3300009036 Ga0105244_10085949 Ga0105244_100859492 127
141 3300009036 Ga0105244_10088903 Ga0105244_100889032 127
142 3300009036 Ga0105244_10106507 Ga0105244_101065072 127
143 3300009036 Ga0105244_10111011 Ga0105244_101110112 127
144 3300009036 Ga0105244_10123445 Ga0105244_101234452 127
145 3300009036 Ga0105244_10183032 Ga0105244_101830322 127
146 3300009036 Ga0105244_10210639 Ga0105244_102106392 127
147 3300009036 Ga0105244_10220029 Ga0105244_102200292 127
148 3300009036 Ga0105244_10297773 Ga0105244_102977732 127
149 3300009092 Ga0105250_10000643 Ga0105250_100006439 127
150 3300009092 Ga0105250_10002216 Ga0105250_100022162 127
151 3300009092 Ga0105250_10019096 Ga0105250_100190962 127
152 3300009092 Ga0105250_10028133 Ga0105250_100281332 127
153 3300009092 Ga0105250_10058752 Ga0105250_100587521 127
154 3300009092 Ga0105250_10194783 Ga0105250_101947832 127
155 3300009092 Ga0105250_10233388 Ga0105250_102333882 127
156 3300009092 Ga0105250_10303678 Ga0105250_103036782 127
157 3300009101 Ga0105247_10581461 Ga0105247_105814611 127
158 3300009148 Ga0105243_10000418 Ga0105243_1000041833 127
159 3300009148 Ga0105243_10009342 Ga0105243_100093422 127
160 3300009148 Ga0105243_10055831 Ga0105243_100558313 127
161 3300009148 Ga0105243_10080419 Ga0105243_100804192 127
162 3300009148 Ga0105243_10083948 Ga0105243_100839483 127
163 3300009174 Ga0105241_11357086 Ga0105241_113570861 127
164 3300009176 Ga0105242_10001037 Ga0105242_1000103713 127
165 3300009176 Ga0105242_10129282 Ga0105242_101292822 127
166 3300009176 Ga0105242_11358916 Ga0105242_113589161 127
167 3300009177 Ga0105248_10606351 Ga0105248_106063512 127
168 3300009545 Ga0105237_10001509 Ga0105237_1000150910 127
169 3300009545 Ga0105237_10099097 Ga0105237_100990972 127
170 3300009553 Ga0105249_10024279 Ga0105249_100242792 127
171 3300011119 Ga0105246_10000831 Ga0105246_1000083110 127
172 3300011119 Ga0105246_10005122 Ga0105246_100051225 127
173 3300012477 Ga0157336_1000231 Ga0157336_10002312 127
174 3300012498 Ga0157345_1000031 Ga0157345_100003116 127
175 3300012498 Ga0157345_1029860 Ga0157345_10298602 127
176 3300013100 Ga0157373_10001270 Ga0157373_1000127014 127
177 3300013100 Ga0157373_10004657 Ga0157373_100046572 127
178 3300013100 Ga0157373_10007651 Ga0157373_100076519 127
179 3300013100 Ga0157373_10022657 Ga0157373_100226572 127
180 3300013100 Ga0157373_10099326 Ga0157373_100993263 127
181 3300013100 Ga0157373_10616305 Ga0157373_106163051 127
182 3300013102 Ga0157371_10000609 Ga0157371_100006098 127
183 3300013102 Ga0157371_10005676 Ga0157371_100056768 127
184 3300013102 Ga0157371_10006894 Ga0157371_100068947 127
185 3300013104 Ga0157370_10010793 Ga0157370_100107938 127
186 3300013104 Ga0157370_10089048 Ga0157370_100890482 127
187 3300013104 Ga0157370_10141562 Ga0157370_101415622 127
188 3300013104 Ga0157370_10287729 Ga0157370_102877292 127
189 3300013104 Ga0157370_10505182 Ga0157370_105051822 127
190 3300013105 Ga0157369_10007915 Ga0157369_100079153 127
191 3300013105 Ga0157369_10010950 Ga0157369_100109508 127
192 3300013105 Ga0157369_10012831 Ga0157369_1001283110 127
193 3300013105 Ga0157369_10017743 Ga0157369_100177437 127
194 3300013105 Ga0157369_10229920 Ga0157369_102299201 127
195 3300013105 Ga0157369_11039791 Ga0157369_110397912 127
196 3300013306 Ga0163162_10000591 Ga0163162_1000059120 127
197 3300013306 Ga0163162_10025799 Ga0163162_100257997 127
198 3300013306 Ga0163162_12242773 Ga0163162_122427731 127
199 3300013307 Ga0157372_10003012 Ga0157372_1000301220 127
200 3300013307 Ga0157372_10081924 Ga0157372_100819243 127
201 3300013307 Ga0157372_10130763 Ga0157372_101307632 127
202 3300013307 Ga0157372_10648693 Ga0157372_106486932 127
203 3300013308 Ga0157375_10007713 Ga0157375_1000771310 127
204 3300013308 Ga0157375_10009496 Ga0157375_1000949612 127
205 3300014325 Ga0163163_12520438 Ga0163163_125204381 127
206 3300014497 Ga0182008_10000293 Ga0182008_1000029310 127
207 3300014497 Ga0182008_10003066 Ga0182008_100030662 127
208 3300014497 Ga0182008_10003963 Ga0182008_100039639 127
209 3300014497 Ga0182008_10008520 Ga0182008_100085202 127
210 3300014497 Ga0182008_10021923 Ga0182008_100219232 127
211 3300015261 Ga0182006_1001933 Ga0182006_10019334 127
212 3300015261 Ga0182006_1008087 Ga0182006_10080873 127
213 3300015261 Ga0182006_1107668 Ga0182006_11076682 127
214 3300015261 Ga0182006_1198617 Ga0182006_11986171 127
215 3300015262 Ga0182007_10012173 Ga0182007_100121734 127
216 3300015265 Ga0182005_1005566 Ga0182005_10055662 127
217 3300015265 Ga0182005_1008727 Ga0182005_10087273 127
218 3300015265 Ga0182005_1016310 Ga0182005_10163102 127
219 3300017792 Ga0163161_10001503 Ga0163161_1000150310 127
220 3300017792 Ga0163161_10012953 Ga0163161_100129533 127
221 3300017792 Ga0163161_10040548 Ga0163161_100405485 127
222 3300017792 Ga0163161_10062502 Ga0163161_100625022 127
223 3300017792 Ga0163161_10095791 Ga0163161_100957912 127
224 3300017792 Ga0163161_10168186 Ga0163161_101681862 127
225 3300017792 Ga0163161_10335345 Ga0163161_103353452 127
226 3300017792 Ga0163161_10775278 Ga0163161_107752782 127
227 3300017792 Ga0163161_11668672 Ga0163161_116686721 127
228 3300025206 Ga0209435_100485 Ga0209435_1004853 127
229 3300025207 Ga0209760_100149 Ga0209760_10014910 127
230 3300025224 Ga0209784_100007 Ga0209784_100007367 127
231 3300025225 Ga0209566_100009 Ga0209566_100009367 127
232 3300025226 Ga0209674_100021 Ga0209674_100021367 127
233 3300025229 Ga0209147_100009 Ga0209147_100009367 127
234 3300025230 Ga0209563_100018 Ga0209563_100018367 127
235 3300025231 Ga0207427_100005 Ga0207427_100005354 127
236 3300025233 Ga0209437_100018 Ga0209437_100018264 127
237 3300025242 Ga0209258_100169 Ga0209258_100169116 127
238 3300025246 Ga0209646_1000184 Ga0209646_100018432 127
239 3300025250 Ga0209026_1033009 Ga0209026_10330092 127
240 3300025253 Ga0209677_100012 Ga0209677_100012367 127
241 3300025256 Ga0209759_1003027 Ga0209759_10030273 127
242 3300025261 Ga0209233_1000021 Ga0209233_1000021354 127
243 3300025284 Ga0209130_1032015 Ga0209130_10320152 127
244 3300025292 Ga0209676_1000015 Ga0209676_1000015399 127
245 3300025292 Ga0209676_1000030 Ga0209676_1000030284 127
246 3300025292 Ga0209676_1000041 Ga0209676_1000041160 127
247 3300025292 Ga0209676_1001202 Ga0209676_100120217 127
248 3300025292 Ga0209676_1006408 Ga0209676_10064085 127
249 3300025298 Ga0209050_1000030 Ga0209050_100003039 127
250 3300025298 Ga0209050_1000518 Ga0209050_100051820 127
251 3300025298 Ga0209050_1000647 Ga0209050_100064741 127
252 3300025303 Ga0209051_1000012 Ga0209051_1000012281 127
253 3300025303 Ga0209051_1000721 Ga0209051_100072124 127
254 3300025303 Ga0209051_1002170 Ga0209051_100217012 127
255 3300025304 Ga0209257_1001245 Ga0209257_100124511 127
256 3300025304 Ga0209257_1114532 Ga0209257_11145321 127
257 3300025321 Ga0207656_10000006 Ga0207656_1000000650 127
258 3300025711 Ga0207696_1000031 Ga0207696_1000031245 127
259 3300025711 Ga0207696_1000357 Ga0207696_100035725 127
260 3300025711 Ga0207696_1001095 Ga0207696_100109512 127
261 3300025711 Ga0207696_1003677 Ga0207696_10036772 127
262 3300025711 Ga0207696_1006219 Ga0207696_10062192 127
263 3300025711 Ga0207696_1009749 Ga0207696_10097495 127
264 3300025711 Ga0207696_1023826 Ga0207696_10238262 127
265 3300025711 Ga0207696_1037253 Ga0207696_10372532 127
266 3300025711 Ga0207696_1047034 Ga0207696_10470342 127
267 3300025711 Ga0207696_1060998 Ga0207696_10609982 127
268 3300025711 Ga0207696_1074144 Ga0207696_10741442 127
269 3300025711 Ga0207696_1094304 Ga0207696_10943041 127
270 3300025728 Ga0207655_1000033 Ga0207655_100003372 127
271 3300025728 Ga0207655_1000388 Ga0207655_100038827 127
272 3300025728 Ga0207655_1000740 Ga0207655_100074026 127
273 3300025728 Ga0207655_1001884 Ga0207655_100188411 127
274 3300025728 Ga0207655_1002233 Ga0207655_100223311 127
275 3300025728 Ga0207655_1009865 Ga0207655_10098653 127
276 3300025728 Ga0207655_1013722 Ga0207655_10137222 127
277 3300025728 Ga0207655_1017240 Ga0207655_10172402 127
278 3300025728 Ga0207655_1020032 Ga0207655_10200323 127
279 3300025728 Ga0207655_1026052 Ga0207655_10260522 127
280 3300025728 Ga0207655_1026956 Ga0207655_10269562 127
281 3300025728 Ga0207655_1032617 Ga0207655_10326171 127
282 3300025728 Ga0207655_1055965 Ga0207655_10559652 127
283 3300025728 Ga0207655_1067994 Ga0207655_10679941 127
284 3300025728 Ga0207655_1091408 Ga0207655_10914081 127
285 3300025728 Ga0207655_1112400 Ga0207655_11124001 127
286 3300025728 Ga0207655_1118031 Ga0207655_11180312 127
287 3300025735 Ga0207713_1000079 Ga0207713_1000079137 127
288 3300025735 Ga0207713_1000815 Ga0207713_100081523 127
289 3300025735 Ga0207713_1000817 Ga0207713_100081718 127
290 3300025735 Ga0207713_1000881 Ga0207713_100088123 127
291 3300025735 Ga0207713_1001720 Ga0207713_10017205 127
292 3300025735 Ga0207713_1002142 Ga0207713_10021425 127
293 3300025735 Ga0207713_1007195 Ga0207713_10071952 127
294 3300025735 Ga0207713_1008240 Ga0207713_10082402 127
295 3300025735 Ga0207713_1018440 Ga0207713_10184401 127
296 3300025735 Ga0207713_1018800 Ga0207713_10188002 127
297 3300025735 Ga0207713_1026991 Ga0207713_10269912 127
298 3300025735 Ga0207713_1035524 Ga0207713_10355242 127
299 3300025735 Ga0207713_1046693 Ga0207713_10466932 127
300 3300025735 Ga0207713_1109671 Ga0207713_11096712 127
301 3300025735 Ga0207713_1155869 Ga0207713_11558692 127
302 3300025900 Ga0207710_10223765 Ga0207710_102237651 127
303 3300025907 Ga0207645_10537093 Ga0207645_105370931 127
304 3300025914 Ga0207671_10000131 Ga0207671_1000013154 127
305 3300025914 Ga0207671_10059279 Ga0207671_100592793 127
306 3300025920 Ga0207649_10000012 Ga0207649_10000012119 127
307 3300025920 Ga0207649_10125406 Ga0207649_101254062 127
308 3300025923 Ga0207681_10000099 Ga0207681_1000009922 127
309 3300025925 Ga0207650_10000518 Ga0207650_1000051823 127
310 3300025925 Ga0207650_10000571 Ga0207650_1000057110 127
311 3300025933 Ga0207706_10000580 Ga0207706_1000058019 127
312 3300025934 Ga0207686_10001527 Ga0207686_1000152711 127
313 3300025934 Ga0207686_10041667 Ga0207686_100416673 127
314 3300025935 Ga0207709_10000337 Ga0207709_100003377 127
315 3300025935 Ga0207709_10030471 Ga0207709_100304713 127
316 3300025935 Ga0207709_10092399 Ga0207709_100923992 127
317 3300025935 Ga0207709_10174208 Ga0207709_101742082 127
318 3300025941 Ga0207711_10120944 Ga0207711_101209443 127
319 3300025945 Ga0207679_10000015 Ga0207679_10000015119 127
320 3300025945 Ga0207679_10118289 Ga0207679_101182892 127
321 3300025961 Ga0207712_10012454 Ga0207712_100124542 127
322 3300025981 Ga0207640_10013617 Ga0207640_100136172 127
323 3300026041 Ga0207639_10005381 Ga0207639_100053815 127
324 3300027111 Ga0209281_1000016 Ga0209281_1000016328 127
325 3300027111 Ga0209281_1000019 Ga0209281_1000019209 127
326 3300027111 Ga0209281_1003013 Ga0209281_10030132 127
327 3300027111 Ga0209281_1006344 Ga0209281_10063442 127
328 3300027296 Ga0209389_1000017 Ga0209389_100001743 127
329 3300027296 Ga0209389_1027696 Ga0209389_10276962 127
330 3300027312 Ga0209371_1025351 Ga0209371_10253512 127
331 3300027552 Ga0209982_1021628 Ga0209982_10216282 127
332 3300027907 Ga0207428_10021918 Ga0207428_100219184 127
333 3300027907 Ga0207428_10034012 Ga0207428_100340123 127
334 3300027907 Ga0207428_10058103 Ga0207428_100581032 127
335 3300027907 Ga0207428_10158834 Ga0207428_101588342 127
336 3300028379 Ga0268266_10028438 Ga0268266_100284382 127
337 3300028379 Ga0268266_10047161 Ga0268266_100471612 127
338 3300028379 Ga0268266_11401689 Ga0268266_114016892 127
339 3300028379 Ga0268266_11412765 Ga0268266_114127651 127
340 3300028379 Ga0268266_11899696 Ga0268266_118996961 127
341 3300028786 Ga0307517_10076563 Ga0307517_100765631 127
342 3300028786 Ga0307517_10173892 Ga0307517_101738922 127
343 3300030500 Ga0268256_1020035 Ga0268256_10200351 127
344 3300030521 Ga0307511_10107035 Ga0307511_101070352 127
345 3300030521 Ga0307511_10238296 Ga0307511_102382962 127
346 3300030731 Ga0316177_1073679 Ga0316177_10736792 127
347 3300030733 Ga0314311_1252767 Ga0314311_12527676 127
348 3300030734 Ga0316179_1042459 Ga0316179_10424594 127
349 3300030735 Ga0316178_1008333 Ga0316178_100833329 127
350 3300030742 Ga0316183_1045013 Ga0316183_10450139 127
351 3300030742 Ga0316183_1105198 Ga0316183_11051982 127
352 3300030744 Ga0316181_1049959 Ga0316181_10499592 127
353 3300030744 Ga0316181_1273315 Ga0316181_12733153 127
354 3300031344 Ga0265316_10202919 Ga0265316_102029192 127
355 3300031456 Ga0307513_10705386 Ga0307513_107053862 127
356 3300031507 Ga0307509_10067997 Ga0307509_100679972 127
357 3300031548 Ga0307408_100002850 Ga0307408_10000285011 127
358 3300031548 Ga0307408_100003719 Ga0307408_1000037192 127
359 3300031548 Ga0307408_100031721 Ga0307408_1000317212 127
360 3300031548 Ga0307408_100224207 Ga0307408_1002242072 127
361 3300031548 Ga0307408_100290707 Ga0307408_1002907072 127
362 3300031548 Ga0307408_100391007 Ga0307408_1003910072 127
363 3300031548 Ga0307408_101052459 Ga0307408_1010524592 127
364 3300031548 Ga0307408_101747392 Ga0307408_1017473921 127
365 3300031728 Ga0316578_10040863 Ga0316578_100408632 127
366 3300031730 Ga0307516_10105975 Ga0307516_101059753 127
367 3300031730 Ga0307516_10249646 Ga0307516_102496461 127
368 3300031731 Ga0307405_10000278 Ga0307405_1000027810 127
369 3300031731 Ga0307405_10008646 Ga0307405_100086462 127
370 3300031731 Ga0307405_10034553 Ga0307405_100345534 127
371 3300031731 Ga0307405_10793967 Ga0307405_107939672 127
372 3300031824 Ga0307413_10211622 Ga0307413_102116222 127
373 3300031852 Ga0307410_10312097 Ga0307410_103120972 127
374 3300031901 Ga0307406_10004633 Ga0307406_100046337 127
375 3300031901 Ga0307406_11632386 Ga0307406_116323861 127
376 3300031903 Ga0307407_10006433 Ga0307407_100064335 127
377 3300031903 Ga0307407_11546063 Ga0307407_115460631 127
378 3300031911 Ga0307412_10002971 Ga0307412_100029718 127
379 3300031911 Ga0307412_10006343 Ga0307412_100063432 127
380 3300031911 Ga0307412_10019653 Ga0307412_100196532 127
381 3300031911 Ga0307412_10031953 Ga0307412_100319534 127
382 3300031911 Ga0307412_10111949 Ga0307412_101119492 127
383 3300031911 Ga0307412_10144888 Ga0307412_101448882 127
384 3300031911 Ga0307412_10276893 Ga0307412_102768932 127
385 3300031995 Ga0307409_100080243 Ga0307409_1000802433 127
386 3300031995 Ga0307409_101909640 Ga0307409_1019096401 127
387 3300032002 Ga0307416_103204319 Ga0307416_1032043191 127
388 3300032004 Ga0307414_10015690 Ga0307414_100156901 127
389 3300032004 Ga0307414_10169789 Ga0307414_101697892 127
390 3300032004 Ga0307414_10238626 Ga0307414_102386261 127
391 3300032004 Ga0307414_10348954 Ga0307414_103489541 127
392 3300032004 Ga0307414_10360022 Ga0307414_103600222 127
393 3300032004 Ga0307414_10645561 Ga0307414_106455612 127
394 3300032004 Ga0307414_12123379 Ga0307414_121233791 127
395 3300032005 Ga0307411_10097247 Ga0307411_100972472 127
396 3300032005 Ga0307411_10120407 Ga0307411_101204071 127
397 3300032005 Ga0307411_11136787 Ga0307411_111367872 127
398 3300032005 Ga0307411_11609213 Ga0307411_116092131 127
399 3300033180 Ga0307510_10009038 Ga0307510_100090383 127
400 3300035398 Ga0316574_0158366 Ga0316574_0158366_674_1066 127
401 3300041405 Ga0439438_000413 Ga0439438_000413_2869_3252 127
402 3300041405 Ga0439438_000628 Ga0439438_000628_7428_7811 127
403 3300041405 Ga0439438_000966 Ga0439438_000966_4837_5220 127
404 3300041405 Ga0439438_003325 Ga0439438_003325_5105_5488 127
405 3300041405 Ga0439438_005222 Ga0439438_005222_3552_3935 127
406 3300041405 Ga0439438_008364 Ga0439438_008364_1115_1498 127
407 3300041405 Ga0439438_009343 Ga0439438_009343_1058_1441 127
408 3300041405 Ga0439438_022150 Ga0439438_022150_821_1204 127
409 3300041405 Ga0439438_086194 Ga0439438_086194_12_395 127
410 3300041407 Ga0439447_000886 Ga0439447_000886_3050_3433 127
411 3300041407 Ga0439447_013512 Ga0439447_013512_1106_1489 127
412 3300041407 Ga0439447_029323 Ga0439447_029323_742_1125 127
413 3300041407 Ga0439447_030179 Ga0439447_030179_76_459 127
414 3300041407 Ga0439447_056131 Ga0439447_056131_67_450 127
415 3300041407 Ga0439447_063638 Ga0439447_063638_306_689 127
416 3300041407 Ga0439447_064882 Ga0439447_064882_30_413 127
417 3300041410 Ga0439461_0004120 Ga0439461_0004120_530_919 127
418 3300041411 Ga0439466_0000628 Ga0439466_0000628_3912_4295 127
419 3300041411 Ga0439466_0001811 Ga0439466_0001811_4410_4793 127
420 3300041411 Ga0439466_0006300 Ga0439466_0006300_101_484 127
421 3300041411 Ga0439466_0017391 Ga0439466_0017391_1428_1811 127
422 3300041411 Ga0439466_0017508 Ga0439466_0017508_894_1277 127
423 3300041411 Ga0439466_0039697 Ga0439466_0039697_393_776 127
424 3300041411 Ga0439466_0046470 Ga0439466_0046470_1017_1400 127
425 3300041411 Ga0439466_0085986 Ga0439466_0085986_252_635 127
426 3300041411 Ga0439466_0109260 Ga0439466_0109260_319_702 127
427 3300041411 Ga0439466_0111935 Ga0439466_0111935_44_427 127
428 3300041413 Ga0439465_0031302 Ga0439465_0031302_999_1382 127
429 3300041494 Ga0451837_1712778 Ga0451837_1712778_64_447 127
430 3300041498 Ga0451841_0906580 Ga0451841_0906580_21_404 127
431 3300041997 Ga0439431_0003158 Ga0439431_0003158_2772_3161 127
432 3300041997 Ga0439431_0009029 Ga0439431_0009029_1540_1923 127
433 3300042000 Ga0439437_003860 Ga0439437_003860_24_413 127
434 3300042002 Ga0439442_052282 Ga0439442_052282_412_795 127
435 3300042004 Ga0439445_0029935 Ga0439445_0029935_269_652 127
436 3300042004 Ga0439445_0101797 Ga0439445_0101797_85_468 127
437 3300042006 Ga0439432_001522 Ga0439432_001522_922_1305 127
438 3300042006 Ga0439432_069468 Ga0439432_069468_629_1012 127
439 3300042006 Ga0439432_119881 Ga0439432_119881_358_741 127
440 3300042006 Ga0439432_176142 Ga0439432_176142_139_522 127
441 3300042006 Ga0439432_192899 Ga0439432_192899_141_524 127
442 3300042006 Ga0439432_229389 Ga0439432_229389_42_425 127
443 3300042009 Ga0439451_006268 Ga0439451_006268_627_1010 127
444 3300042009 Ga0439451_014993 Ga0439451_014993_301_684 127
445 3300042009 Ga0439451_032070 Ga0439451_032070_609_1025 127
446 3300042009 Ga0439451_110041 Ga0439451_110041_57_440 127
447 3300042010 Ga0439452_000354 Ga0439452_000354_9772_10155 127
448 3300042010 Ga0439452_000644 Ga0439452_000644_7967_8350 127
449 3300042010 Ga0439452_000647 Ga0439452_000647_9335_9718 127
450 3300042010 Ga0439452_001312 Ga0439452_001312_9122_9505 127
451 3300042010 Ga0439452_006207 Ga0439452_006207_578_961 127
452 3300042010 Ga0439452_008004 Ga0439452_008004_2492_2875 127
453 3300042010 Ga0439452_010287 Ga0439452_010287_755_1138 127
454 3300042010 Ga0439452_084675 Ga0439452_084675_36_419 127
455 3300042013 Ga0439456_001975 Ga0439456_001975_3502_3885 127
456 3300042013 Ga0439456_005584 Ga0439456_005584_23_412 127
457 3300042013 Ga0439456_008089 Ga0439456_008089_170_553 127
458 3300042013 Ga0439456_008953 Ga0439456_008953_949_1332 127
459 3300042013 Ga0439456_040973 Ga0439456_040973_148_531 127
460 3300042013 Ga0439456_067332 Ga0439456_067332_348_731 127
461 3300042013 Ga0439456_076551 Ga0439456_076551_265_648 127
462 3300042013 Ga0439456_085187 Ga0439456_085187_196_579 127
463 3300042016 Ga0439463_000086 Ga0439463_000086_14039_14422 127
464 3300042016 Ga0439463_058443 Ga0439463_058443_77_460 127
465 3300042016 Ga0439463_097452 Ga0439463_097452_102_485 127
466 3300042016 Ga0439463_203491 Ga0439463_203491_99_482 127
467 3300042115 Ga0450911_000024 Ga0450911_000024_43593_43982 127
468 3300042115 Ga0450911_000362 Ga0450911_000362_7315_7698 127
469 3300042115 Ga0450911_002057 Ga0450911_002057_1399_1782 127
470 3300042115 Ga0450911_008786 Ga0450911_008786_716_1099 127
471 3300042115 Ga0450911_033683 Ga0450911_033683_237_620 127
472 3300042118 Ga0450914_029355 Ga0450914_029355_183_572 127
473 3300042121 Ga0450919_007386 Ga0450919_007386_752_1168 127
474 3300042123 Ga0450921_002208 Ga0450921_002208_424_840 127
475 3300042124 Ga0450922_000400 Ga0450922_000400_3541_3957 127
476 3300042125 Ga0450923_007253 Ga0450923_007253_733_1149 127
477 3300042136 Ga0450900_000937 Ga0450900_000937_180_563 127
478 3300042136 Ga0450900_034398 Ga0450900_034398_84_467 127
479 3300042137 Ga0450902_000569 Ga0450902_000569_801_1184 127
480 3300042137 Ga0450902_008236 Ga0450902_008236_658_1041 127
481 3300042137 Ga0450902_028201 Ga0450902_028201_302_691 127
482 3300042137 Ga0450902_054733 Ga0450902_054733_112_495 127
483 3300042138 Ga0450903_001618 Ga0450903_001618_503_886 127
484 3300042138 Ga0450903_003832 Ga0450903_003832_1089_1472 127
485 3300042138 Ga0450903_016400 Ga0450903_016400_749_1138 127
486 3300042138 Ga0450903_024116 Ga0450903_024116_276_659 127
487 3300042138 Ga0450903_030115 Ga0450903_030115_101_484 127
488 3300042138 Ga0450903_068744 Ga0450903_068744_87_476 127
489 3300042139 Ga0450904_000070 Ga0450904_000070_16877_17266 127
490 3300042139 Ga0450904_001955 Ga0450904_001955_1080_1463 127
491 3300042142 Ga0450905_000013 Ga0450905_000013_15454_15837 127
492 3300042142 Ga0450905_002872 Ga0450905_002872_1842_2225 127
493 3300042142 Ga0450905_071543 Ga0450905_071543_133_516 127
494 3300042142 Ga0450905_099455 Ga0450905_099455_67_450 127
495 3300042144 Ga0450889_008550 Ga0450889_008550_304_693 127
496 3300042145 Ga0450906_001514 Ga0450906_001514_1737_2153 127
497 3300042145 Ga0450906_001711 Ga0450906_001711_2647_3030 127
498 3300042146 Ga0450907_000282 Ga0450907_000282_7507_7890 127
499 3300042146 Ga0450907_000330 Ga0450907_000330_7946_8362 127
500 3300042146 Ga0450907_032000 Ga0450907_032000_387_770 127
501 3300042147 Ga0450910_000242 Ga0450910_000242_5746_6162 127
502 3300042147 Ga0450910_006746 Ga0450910_006746_354_737 127
503 3300042147 Ga0450910_016596 Ga0450910_016596_274_657 127
504 3300042156 Ga0439446_0002968 Ga0439446_0002968_3682_4071 127
505 3300042156 Ga0439446_0045813 Ga0439446_0045813_74_457 127
506 3300042156 Ga0439446_0171609 Ga0439446_0171609_296_679 127
507 3300042185 Ga0450909_001691 Ga0450909_001691_1673_2056 127
508 3300042185 Ga0450909_029598 Ga0450909_029598_96_479 127
509 3300042435 Ga0439434_0000230 Ga0439434_0000230_6642_7025 127
510 3300042435 Ga0439434_0050779 Ga0439434_0050779_227_616 127
511 3300042438 Ga0439459_0007632 Ga0439459_0007632_1211_1600 127
512 3300042461 Ga0439460_0000561 Ga0439460_0000561_4492_4875 127
513 3300042461 Ga0439460_0004030 Ga0439460_0004030_755_1138 127
514 3300042461 Ga0439460_0045057 Ga0439460_0045057_817_1200 127
515 3300042530 Ga0450916_000963 Ga0450916_000963_2142_2582 127
516 3300042531 Ga0450918_009991 Ga0450918_009991_527_943 127
517 3300042532 Ga0450893_0016294 Ga0450893_0016294_367_756 127
518 3300042532 Ga0450893_0059917 Ga0450893_0059917_165_548 127
519 3300042532 Ga0450893_0060706 Ga0450893_0060706_270_653 127
520 3300042532 Ga0450893_0076471 Ga0450893_0076471_14_397 127
521 3300042533 Ga0450901_000235 Ga0450901_000235_4550_4933 127
522 3300042533 Ga0450901_003807 Ga0450901_003807_938_1321 127
523 3300042876 Ga0451577_0036347 Ga0451577_0036347_30_413 127
524 3300042993 Ga0439440_0000379 Ga0439440_0000379_6534_6917 127
525 3300042993 Ga0439440_0003720 Ga0439440_0003720_2425_2808 127
526 3300046452 Ga0495617_001282 Ga0495617_001282_3280_3663 127
527 3300046452 Ga0495617_001932 Ga0495617_001932_7871_8254 127
528 3300046452 Ga0495617_015244 Ga0495617_015244_302_685 127
529 3300046452 Ga0495617_016921 Ga0495617_016921_1377_1760 127
530 3300046452 Ga0495617_019076 Ga0495617_019076_1423_1806 127
531 3300046452 Ga0495617_023506 Ga0495617_023506_698_1081 127
532 3300046452 Ga0495617_029650 Ga0495617_029650_1413_1796 127
533 3300046452 Ga0495617_038218 Ga0495617_038218_948_1331 127
534 3300046452 Ga0495617_059631 Ga0495617_059631_704_1087 127
535 3300046452 Ga0495617_097950 Ga0495617_097950_256_639 127
536 3300046452 Ga0495617_141323 Ga0495617_141323_112_495 127
537 3300046452 Ga0495617_158811 Ga0495617_158811_70_453 127
538 3300046453 Ga0495627_001049 Ga0495627_001049_5615_5998 127
539 3300046453 Ga0495627_002831 Ga0495627_002831_4022_4405 127
540 3300046453 Ga0495627_005013 Ga0495627_005013_4941_5324 127
541 3300046453 Ga0495627_009431 Ga0495627_009431_1520_1906 127
542 3300046453 Ga0495627_010277 Ga0495627_010277_480_863 127
543 3300046453 Ga0495627_017497 Ga0495627_017497_624_1007 127
544 3300046453 Ga0495627_055430 Ga0495627_055430_25_408 127
545 3300046453 Ga0495627_095800 Ga0495627_095800_145_528 127
546 3300046453 Ga0495627_104941 Ga0495627_104941_140_523 127
547 3300046453 Ga0495627_112475 Ga0495627_112475_120_503 127
548 3300046455 Ga0495603_0002845 Ga0495603_0002845_6155_6538 127
549 3300046455 Ga0495603_0035392 Ga0495603_0035392_909_1292 127
550 3300046455 Ga0495603_0076791 Ga0495603_0076791_79_462 127
551 3300046457 Ga0495590_0000558 Ga0495590_0000558_7795_8178 127
552 3300046457 Ga0495590_0007795 Ga0495590_0007795_832_1215 127
553 3300046457 Ga0495590_0012761 Ga0495590_0012761_1634_2017 127
554 3300046457 Ga0495590_0023488 Ga0495590_0023488_1426_1809 127
555 3300046457 Ga0495590_0041534 Ga0495590_0041534_681_1064 127
556 3300046457 Ga0495590_0297686 Ga0495590_0297686_71_454 127
557 3300046458 Ga0495591_000463 Ga0495591_000463_9399_9782 127
558 3300046458 Ga0495591_001156 Ga0495591_001156_11133_11519 127
559 3300046458 Ga0495591_001755 Ga0495591_001755_3764_4147 127
560 3300046458 Ga0495591_001936 Ga0495591_001936_8048_8431 127
561 3300046458 Ga0495591_002997 Ga0495591_002997_4380_4763 127
562 3300046458 Ga0495591_006539 Ga0495591_006539_3554_3937 127
563 3300046458 Ga0495591_007297 Ga0495591_007297_1546_1929 127
564 3300046458 Ga0495591_010916 Ga0495591_010916_140_523 127
565 3300046458 Ga0495591_014183 Ga0495591_014183_2337_2720 127
566 3300046458 Ga0495591_017198 Ga0495591_017198_1842_2225 127
567 3300046458 Ga0495591_021261 Ga0495591_021261_1375_1758 127
568 3300046458 Ga0495591_031849 Ga0495591_031849_229_612 127
569 3300046458 Ga0495591_034861 Ga0495591_034861_885_1268 127
570 3300046458 Ga0495591_038998 Ga0495591_038998_867_1250 127
571 3300046458 Ga0495591_054303 Ga0495591_054303_93_476 127
572 3300046458 Ga0495591_065264 Ga0495591_065264_156_539 127
573 3300046459 Ga0495629_1119107 Ga0495629_1119107_60_443 127
574 3300046460 Ga0495638_0002884 Ga0495638_0002884_9416_9799 127
575 3300046460 Ga0495638_0006076 Ga0495638_0006076_3795_4178 127
576 3300046460 Ga0495638_0013777 Ga0495638_0013777_1052_1435 127
577 3300046460 Ga0495638_0014654 Ga0495638_0014654_1277_1660 127
578 3300046460 Ga0495638_0028521 Ga0495638_0028521_1882_2298 127
579 3300046460 Ga0495638_0034530 Ga0495638_0034530_1874_2257 127
580 3300046460 Ga0495638_0062358 Ga0495638_0062358_1067_1450 127
581 3300046460 Ga0495638_0066345 Ga0495638_0066345_345_728 127
582 3300046460 Ga0495638_0066591 Ga0495638_0066591_68_451 127
583 3300046460 Ga0495638_0070630 Ga0495638_0070630_744_1127 127
584 3300046460 Ga0495638_0074379 Ga0495638_0074379_1539_1922 127
585 3300046460 Ga0495638_0111180 Ga0495638_0111180_308_691 127
586 3300046460 Ga0495638_0384227 Ga0495638_0384227_65_448 127
587 3300046460 Ga0495638_0545637 Ga0495638_0545637_63_446 127
588 3300046463 Ga0495653_0001669 Ga0495653_0001669_15383_15766 127
589 3300046463 Ga0495653_0005073 Ga0495653_0005073_5880_6263 127
590 3300046463 Ga0495653_0024603 Ga0495653_0024603_1212_1595 127
591 3300046463 Ga0495653_0039989 Ga0495653_0039989_2648_3031 127
592 3300046463 Ga0495653_0069450 Ga0495653_0069450_1765_2148 127
593 3300046471 Ga0495650_0005353 Ga0495650_0005353_2980_3363 127
594 3300046471 Ga0495650_0005933 Ga0495650_0005933_2534_2917 127
595 3300046471 Ga0495650_0015241 Ga0495650_0015241_257_640 127
596 3300046471 Ga0495650_0018262 Ga0495650_0018262_229_612 127
597 3300046471 Ga0495650_0018353 Ga0495650_0018353_2016_2399 127
598 3300046471 Ga0495650_0142786 Ga0495650_0142786_100_483 127
599 3300046473 Ga0495582_0002303 Ga0495582_0002303_3565_3948 127
600 3300046474 Ga0495605_0001057 Ga0495605_0001057_9145_9528 127
601 3300046474 Ga0495605_0006764 Ga0495605_0006764_4342_4725 127
602 3300046474 Ga0495605_0017199 Ga0495605_0017199_2749_3132 127
603 3300046474 Ga0495605_0025506 Ga0495605_0025506_195_578 127
604 3300046474 Ga0495605_0086639 Ga0495605_0086639_956_1339 127
605 3300046474 Ga0495605_0096274 Ga0495605_0096274_115_498 127
606 3300046474 Ga0495605_0160953 Ga0495605_0160953_88_471 127
607 3300046475 Ga0495639_0024400 Ga0495639_0024400_1569_1952 127
608 3300046475 Ga0495639_0241546 Ga0495639_0241546_337_720 127
609 3300046475 Ga0495639_0665245 Ga0495639_0665245_94_477 127
610 3300046477 Ga0495664_0229748 Ga0495664_0229748_43_426 127
611 3300046491 Ga0495584_0003104 Ga0495584_0003104_2070_2453 127
612 3300046491 Ga0495584_0007278 Ga0495584_0007278_2056_2439 127
613 3300046491 Ga0495584_0011226 Ga0495584_0011226_2197_2580 127
614 3300046491 Ga0495584_0020265 Ga0495584_0020265_1054_1437 127
615 3300046491 Ga0495584_0036789 Ga0495584_0036789_1207_1590 127
616 3300046491 Ga0495584_0044603 Ga0495584_0044603_1735_2151 127
617 3300046491 Ga0495584_0049231 Ga0495584_0049231_161_544 127
618 3300046491 Ga0495584_0049440 Ga0495584_0049440_1703_2086 127
619 3300046491 Ga0495584_0123291 Ga0495584_0123291_49_432 127
620 3300046491 Ga0495584_0265593 Ga0495584_0265593_225_608 127
621 3300046492 Ga0495585_0001709 Ga0495585_0001709_9340_9756 127
622 3300046492 Ga0495585_0006323 Ga0495585_0006323_974_1357 127
623 3300046492 Ga0495585_0006623 Ga0495585_0006623_5604_5987 127
624 3300046492 Ga0495585_0010925 Ga0495585_0010925_969_1352 127
625 3300046492 Ga0495585_0015085 Ga0495585_0015085_3223_3606 127
626 3300046492 Ga0495585_0020349 Ga0495585_0020349_1503_1886 127
627 3300046492 Ga0495585_0045766 Ga0495585_0045766_1306_1689 127
628 3300046492 Ga0495585_0086823 Ga0495585_0086823_1169_1552 127
629 3300046492 Ga0495585_0129961 Ga0495585_0129961_918_1301 127
630 3300046500 Ga0495596_0001193 Ga0495596_0001193_10812_11195 127
631 3300046500 Ga0495596_0007104 Ga0495596_0007104_2707_3090 127
632 3300046501 Ga0495607_0001745 Ga0495607_0001745_9137_9520 127
633 3300046501 Ga0495607_0005815 Ga0495607_0005815_4639_5022 127
634 3300046501 Ga0495607_0008132 Ga0495607_0008132_5760_6143 127
635 3300046501 Ga0495607_0015568 Ga0495607_0015568_2805_3188 127
636 3300046501 Ga0495607_0032749 Ga0495607_0032749_1066_1449 127
637 3300046501 Ga0495607_0035198 Ga0495607_0035198_1762_2145 127
638 3300046501 Ga0495607_0057253 Ga0495607_0057253_1303_1686 127
639 3300046501 Ga0495607_0071538 Ga0495607_0071538_103_486 127
640 3300046501 Ga0495607_0080734 Ga0495607_0080734_816_1199 127
641 3300046501 Ga0495607_0087872 Ga0495607_0087872_495_878 127
642 3300046501 Ga0495607_0094595 Ga0495607_0094595_1079_1462 127
643 3300046506 Ga0495583_0003362 Ga0495583_0003362_9154_9537 127
644 3300046506 Ga0495583_0008670 Ga0495583_0008670_2843_3226 127
645 3300046506 Ga0495583_0028914 Ga0495583_0028914_2285_2668 127
646 3300046507 Ga0495606_0002681 Ga0495606_0002681_5628_6011 127
647 3300046507 Ga0495606_0004539 Ga0495606_0004539_8097_8480 127
648 3300046507 Ga0495606_0006769 Ga0495606_0006769_5813_6196 127
649 3300046507 Ga0495606_0007198 Ga0495606_0007198_220_603 127
650 3300046507 Ga0495606_0014260 Ga0495606_0014260_3722_4105 127
651 3300046507 Ga0495606_0016737 Ga0495606_0016737_4208_4591 127
652 3300046507 Ga0495606_0021713 Ga0495606_0021713_500_883 127
653 3300046507 Ga0495606_0036845 Ga0495606_0036845_2805_3188 127
654 3300046507 Ga0495606_0066107 Ga0495606_0066107_1089_1472 127
655 3300046507 Ga0495606_0085307 Ga0495606_0085307_527_910 127
656 3300046507 Ga0495606_0207498 Ga0495606_0207498_227_643 127
657 3300046507 Ga0495606_0514902 Ga0495606_0514902_88_477 127
658 3300046512 Ga0495610_0002291 Ga0495610_0002291_9623_10006 127
659 3300046512 Ga0495610_0005241 Ga0495610_0005241_861_1244 127
660 3300046512 Ga0495610_0005960 Ga0495610_0005960_240_623 127
661 3300046512 Ga0495610_0010830 Ga0495610_0010830_1909_2292 127
662 3300046512 Ga0495610_0013782 Ga0495610_0013782_2313_2696 127
663 3300046512 Ga0495610_0014313 Ga0495610_0014313_2971_3354 127
664 3300046512 Ga0495610_0029515 Ga0495610_0029515_1537_1920 127
665 3300046512 Ga0495610_0036538 Ga0495610_0036538_1072_1455 127
666 3300046512 Ga0495610_0064754 Ga0495610_0064754_161_544 127
667 3300046512 Ga0495610_0088701 Ga0495610_0088701_172_555 127
668 3300046512 Ga0495610_0124369 Ga0495610_0124369_576_959 127
669 3300046512 Ga0495610_0185417 Ga0495610_0185417_125_508 127
670 3300046512 Ga0495610_0270605 Ga0495610_0270605_74_457 127
671 3300046513 Ga0495616_0002868 Ga0495616_0002868_7285_7668 127
672 3300046513 Ga0495616_0003320 Ga0495616_0003320_937_1320 127
673 3300046513 Ga0495616_0004395 Ga0495616_0004395_3629_4012 127
674 3300046513 Ga0495616_0005435 Ga0495616_0005435_6434_6817 127
675 3300046513 Ga0495616_0008635 Ga0495616_0008635_2971_3354 127
676 3300046513 Ga0495616_0010609 Ga0495616_0010609_1873_2256 127
677 3300046513 Ga0495616_0076551 Ga0495616_0076551_728_1111 127
678 3300046513 Ga0495616_0079156 Ga0495616_0079156_823_1239 127
679 3300046513 Ga0495616_0083265 Ga0495616_0083265_661_1044 127
680 3300046513 Ga0495616_0159046 Ga0495616_0159046_273_656 127
681 3300046513 Ga0495616_0281669 Ga0495616_0281669_206_589 127
682 3300046515 Ga0495620_0000229 Ga0495620_0000229_21899_22282 127
683 3300046515 Ga0495620_0000542 Ga0495620_0000542_9466_9849 127
684 3300046515 Ga0495620_0004801 Ga0495620_0004801_3917_4300 127
685 3300046515 Ga0495620_0009886 Ga0495620_0009886_1484_1867 127
686 3300046515 Ga0495620_0013421 Ga0495620_0013421_179_562 127
687 3300046515 Ga0495620_0013820 Ga0495620_0013820_2592_2975 127
688 3300046515 Ga0495620_0020106 Ga0495620_0020106_1114_1497 127
689 3300046515 Ga0495620_0027750 Ga0495620_0027750_1201_1584 127
690 3300046515 Ga0495620_0028923 Ga0495620_0028923_1354_1737 127
691 3300046515 Ga0495620_0034925 Ga0495620_0034925_890_1273 127
692 3300046516 Ga0495628_0088032 Ga0495628_0088032_1793_2176 127
693 3300046516 Ga0495628_0235458 Ga0495628_0235458_958_1341 127
694 3300046517 Ga0495630_0338752 Ga0495630_0338752_246_629 127
695 3300046518 Ga0495631_0000845 Ga0495631_0000845_7388_7771 127
696 3300046518 Ga0495631_0000908 Ga0495631_0000908_8596_8979 127
697 3300046518 Ga0495631_0001441 Ga0495631_0001441_3873_4256 127
698 3300046518 Ga0495631_0024269 Ga0495631_0024269_786_1169 127
699 3300046518 Ga0495631_0051450 Ga0495631_0051450_1355_1738 127
700 3300046518 Ga0495631_0056118 Ga0495631_0056118_791_1174 127
701 3300046518 Ga0495631_0110070 Ga0495631_0110070_49_432 127
702 3300046519 Ga0495632_0000593 Ga0495632_0000593_11635_12018 127
703 3300046519 Ga0495632_0001690 Ga0495632_0001690_14030_14413 127
704 3300046519 Ga0495632_0002757 Ga0495632_0002757_3520_3903 127
705 3300046519 Ga0495632_0012915 Ga0495632_0012915_93_476 127
706 3300046519 Ga0495632_0013222 Ga0495632_0013222_1022_1405 127
707 3300046519 Ga0495632_0019036 Ga0495632_0019036_755_1138 127
708 3300046519 Ga0495632_0019387 Ga0495632_0019387_3078_3461 127
709 3300046519 Ga0495632_0020749 Ga0495632_0020749_524_907 127
710 3300046519 Ga0495632_0037803 Ga0495632_0037803_1154_1537 127
711 3300046519 Ga0495632_0063280 Ga0495632_0063280_87_470 127
712 3300046519 Ga0495632_0081055 Ga0495632_0081055_855_1238 127
713 3300046519 Ga0495632_0081982 Ga0495632_0081982_738_1121 127
714 3300046519 Ga0495632_0136043 Ga0495632_0136043_119_502 127
715 3300046519 Ga0495632_0161586 Ga0495632_0161586_500_883 127
716 3300046520 Ga0495637_0000393 Ga0495637_0000393_22745_23128 127
717 3300046520 Ga0495637_0000966 Ga0495637_0000966_10016_10399 127
718 3300046520 Ga0495637_0002531 Ga0495637_0002531_1436_1819 127
719 3300046520 Ga0495637_0002532 Ga0495637_0002532_3374_3757 127
720 3300046520 Ga0495637_0009107 Ga0495637_0009107_3110_3493 127
721 3300046520 Ga0495637_0019520 Ga0495637_0019520_1001_1384 127
722 3300046520 Ga0495637_0025197 Ga0495637_0025197_1072_1455 127
723 3300046520 Ga0495637_0027574 Ga0495637_0027574_101_484 127
724 3300046520 Ga0495637_0039734 Ga0495637_0039734_1438_1821 127
725 3300046520 Ga0495637_0043263 Ga0495637_0043263_827_1210 127
726 3300046520 Ga0495637_0077919 Ga0495637_0077919_670_1053 127
727 3300046520 Ga0495637_0081685 Ga0495637_0081685_449_832 127
728 3300046520 Ga0495637_0108749 Ga0495637_0108749_307_690 127
729 3300046522 Ga0495643_0000811 Ga0495643_0000811_11866_12249 127
730 3300046522 Ga0495643_0001185 Ga0495643_0001185_5210_5593 127
731 3300046522 Ga0495643_0009357 Ga0495643_0009357_1551_1934 127
732 3300046522 Ga0495643_0009653 Ga0495643_0009653_4535_4918 127
733 3300046522 Ga0495643_0010817 Ga0495643_0010817_4161_4544 127
734 3300046522 Ga0495643_0019998 Ga0495643_0019998_833_1216 127
735 3300046522 Ga0495643_0059855 Ga0495643_0059855_477_860 127
736 3300046522 Ga0495643_0063905 Ga0495643_0063905_658_1041 127
737 3300046522 Ga0495643_0354572 Ga0495643_0354572_209_592 127
738 3300046523 Ga0495644_0002639 Ga0495644_0002639_4783_5166 127
739 3300046523 Ga0495644_0003018 Ga0495644_0003018_5698_6081 127
740 3300046523 Ga0495644_0006496 Ga0495644_0006496_975_1358 127
741 3300046523 Ga0495644_0008897 Ga0495644_0008897_161_544 127
742 3300046523 Ga0495644_0019869 Ga0495644_0019869_270_653 127
743 3300046523 Ga0495644_0215028 Ga0495644_0215028_239_622 127
744 3300046524 Ga0495648_0000960 Ga0495648_0000960_22394_22777 127
745 3300046524 Ga0495648_0002115 Ga0495648_0002115_8008_8391 127
746 3300046524 Ga0495648_0019207 Ga0495648_0019207_3979_4362 127
747 3300046524 Ga0495648_0024362 Ga0495648_0024362_2592_2975 127
748 3300046524 Ga0495648_0024642 Ga0495648_0024642_2083_2466 127
749 3300046524 Ga0495648_0026855 Ga0495648_0026855_3204_3587 127
750 3300046524 Ga0495648_0028461 Ga0495648_0028461_1294_1677 127
751 3300046524 Ga0495648_0034617 Ga0495648_0034617_1604_1987 127
752 3300046524 Ga0495648_0038545 Ga0495648_0038545_1260_1643 127
753 3300046524 Ga0495648_0042856 Ga0495648_0042856_2377_2760 127
754 3300046524 Ga0495648_0067478 Ga0495648_0067478_681_1064 127
755 3300046524 Ga0495648_0132198 Ga0495648_0132198_226_609 127
756 3300046524 Ga0495648_0199551 Ga0495648_0199551_210_593 127
757 3300046524 Ga0495648_0216870 Ga0495648_0216870_60_443 127
758 3300046526 Ga0495666_0004503 Ga0495666_0004503_3009_3392 127
759 3300046526 Ga0495666_0042748 Ga0495666_0042748_166_549 127
760 3300046526 Ga0495666_0067229 Ga0495666_0067229_1033_1416 127
761 3300046526 Ga0495666_0112618 Ga0495666_0112618_626_1009 127
762 3300046528 Ga0495642_0000237 Ga0495642_0000237_23205_23588 127
763 3300046528 Ga0495642_0000270 Ga0495642_0000270_9176_9559 127
764 3300046529 Ga0495652_0690089 Ga0495652_0690089_287_670 127
765 3300046530 Ga0495654_0001335 Ga0495654_0001335_7358_7741 127
766 3300046530 Ga0495654_0001658 Ga0495654_0001658_9004_9387 127
767 3300046530 Ga0495654_0002833 Ga0495654_0002833_1057_1440 127
768 3300046530 Ga0495654_0004103 Ga0495654_0004103_7310_7693 127
769 3300046530 Ga0495654_0004943 Ga0495654_0004943_4158_4541 127
770 3300046530 Ga0495654_0006261 Ga0495654_0006261_975_1391 127
771 3300046530 Ga0495654_0008238 Ga0495654_0008238_3562_3945 127
772 3300046530 Ga0495654_0024569 Ga0495654_0024569_1169_1552 127
773 3300046530 Ga0495654_0026321 Ga0495654_0026321_1042_1425 127
774 3300046530 Ga0495654_0028138 Ga0495654_0028138_1629_2012 127
775 3300046530 Ga0495654_0029531 Ga0495654_0029531_1468_1851 127
776 3300046530 Ga0495654_0030913 Ga0495654_0030913_282_665 127
777 3300046530 Ga0495654_0041962 Ga0495654_0041962_1029_1412 127
778 3300046530 Ga0495654_0051516 Ga0495654_0051516_233_616 127
779 3300046530 Ga0495654_0052150 Ga0495654_0052150_1302_1685 127
780 3300046530 Ga0495654_0086793 Ga0495654_0086793_600_983 127
781 3300046530 Ga0495654_0089989 Ga0495654_0089989_176_559 127
782 3300046530 Ga0495654_0224352 Ga0495654_0224352_70_453 127
783 3300046530 Ga0495654_0225025 Ga0495654_0225025_360_743 127
784 3300046530 Ga0495654_0273045 Ga0495654_0273045_180_563 127
785 3300046530 Ga0495654_0392015 Ga0495654_0392015_86_475 127
786 3300046535 Ga0495586_0007882 Ga0495586_0007882_2571_2954 127
787 3300046536 Ga0495587_0007457 Ga0495587_0007457_5380_5763 127
788 3300046536 Ga0495587_0015450 Ga0495587_0015450_1073_1456 127
789 3300046536 Ga0495587_0129790 Ga0495587_0129790_904_1287 127
790 3300046538 Ga0495609_0004586 Ga0495609_0004586_4559_4942 127
791 3300046538 Ga0495609_0014282 Ga0495609_0014282_3116_3499 127
792 3300046538 Ga0495609_0020526 Ga0495609_0020526_1719_2102 127
793 3300046538 Ga0495609_0024489 Ga0495609_0024489_789_1172 127
794 3300046538 Ga0495609_0083066 Ga0495609_0083066_162_545 127
795 3300046538 Ga0495609_0234415 Ga0495609_0234415_295_678 127
796 3300046538 Ga0495609_0248605 Ga0495609_0248605_265_648 127
797 3300046538 Ga0495609_0327014 Ga0495609_0327014_196_579 127
798 3300046542 Ga0495597_0002250 Ga0495597_0002250_8477_8860 127
799 3300046542 Ga0495597_0004422 Ga0495597_0004422_3662_4045 127
800 3300046542 Ga0495597_0012239 Ga0495597_0012239_3454_3837 127
801 3300046542 Ga0495597_0035478 Ga0495597_0035478_704_1087 127
802 3300046542 Ga0495597_0110687 Ga0495597_0110687_737_1120 127
803 3300046542 Ga0495597_0253125 Ga0495597_0253125_139_522 127
804 3300046542 Ga0495597_0394131 Ga0495597_0394131_92_475 127
805 3300046543 Ga0495645_0056068 Ga0495645_0056068_714_1097 127
806 3300046543 Ga0495645_0645529 Ga0495645_0645529_32_415 127
807 3300046557 Ga0495622_0001569 Ga0495622_0001569_3686_4069 127
808 3300046557 Ga0495622_0001935 Ga0495622_0001935_5196_5579 127
809 3300046557 Ga0495622_0032513 Ga0495622_0032513_1222_1605 127
810 3300046558 Ga0495633_0002259 Ga0495633_0002259_7230_7613 127
811 3300046558 Ga0495633_0026675 Ga0495633_0026675_568_951 127
812 3300046558 Ga0495633_0128814 Ga0495633_0128814_480_863 127
813 3300046615 Ga0495656_0008776 Ga0495656_0008776_49_432 127
814 3300046615 Ga0495656_0122621 Ga0495656_0122621_271_654 127
815 3300046615 Ga0495656_0674544 Ga0495656_0674544_10_393 127
816 3300046616 Ga0495668_0003766 Ga0495668_0003766_9326_9709 127
817 3300046616 Ga0495668_0008366 Ga0495668_0008366_4681_5064 127
818 3300046616 Ga0495668_0074839 Ga0495668_0074839_516_899 127
819 3300046642 Ga0495634_0005534 Ga0495634_0005534_5995_6378 127
820 3300046642 Ga0495634_0051326 Ga0495634_0051326_687_1070 127
821 3300046648 Ga0495611_0000854 Ga0495611_0000854_3677_4060 127
822 3300046648 Ga0495611_0130239 Ga0495611_0130239_295_678 127
823 3300046648 Ga0495611_0393754 Ga0495611_0393754_125_508 127
824 3300046660 Ga0495625_0006403 Ga0495625_0006403_5777_6160 127
825 3300046660 Ga0495625_0008301 Ga0495625_0008301_1925_2308 127
826 3300046660 Ga0495625_0013026 Ga0495625_0013026_4718_5101 127
827 3300046660 Ga0495625_0034308 Ga0495625_0034308_1848_2231 127
828 3300046660 Ga0495625_0035177 Ga0495625_0035177_1458_1841 127
829 3300046660 Ga0495625_0035868 Ga0495625_0035868_1084_1467 127
830 3300046660 Ga0495625_0054377 Ga0495625_0054377_1707_2090 127
831 3300046660 Ga0495625_0061939 Ga0495625_0061939_2103_2486 127
832 3300046660 Ga0495625_0079237 Ga0495625_0079237_1001_1384 127
833 3300046660 Ga0495625_0683410 Ga0495625_0683410_207_590 127
834 3300046663 Ga0495635_0001542 Ga0495635_0001542_5935_6318 127
835 3300046663 Ga0495635_0006306 Ga0495635_0006306_4321_4704 127
836 3300046664 Ga0495659_0062240 Ga0495659_0062240_653_1036 127
837 3300046665 Ga0495661_0000036 Ga0495661_0000036_67045_67428 127
838 3300046665 Ga0495661_0002885 Ga0495661_0002885_3647_4030 127
839 3300046665 Ga0495661_0008604 Ga0495661_0008604_3962_4345 127
840 3300046665 Ga0495661_0014221 Ga0495661_0014221_1654_2037 127
841 3300046665 Ga0495661_0015679 Ga0495661_0015679_4577_4960 127
842 3300046665 Ga0495661_0020440 Ga0495661_0020440_2077_2460 127
843 3300046665 Ga0495661_0043416 Ga0495661_0043416_1530_1913 127
844 3300046665 Ga0495661_0092734 Ga0495661_0092734_261_644 127
845 3300046665 Ga0495661_0099133 Ga0495661_0099133_286_669 127
846 3300046665 Ga0495661_0179918 Ga0495661_0179918_549_932 127
847 3300046665 Ga0495661_0455019 Ga0495661_0455019_126_509 127
848 3300046665 Ga0495661_0500481 Ga0495661_0500481_92_475 127
849 3300046674 Ga0495588_0021073 Ga0495588_0021073_979_1362 127
850 3300046674 Ga0495588_0120764 Ga0495588_0120764_915_1298 127
851 3300046674 Ga0495588_0264899 Ga0495588_0264899_84_467 127
852 3300046675 Ga0495657_0092391 Ga0495657_0092391_596_979 127
853 3300046679 Ga0495623_0006872 Ga0495623_0006872_3144_3527 127
854 3300046679 Ga0495623_0028923 Ga0495623_0028923_810_1193 127
855 3300046680 Ga0495646_0008020 Ga0495646_0008020_5872_6255 127
856 3300046680 Ga0495646_0011734 Ga0495646_0011734_3834_4217 127
857 3300046680 Ga0495646_0109203 Ga0495646_0109203_95_478 127
858 3300046684 Ga0495669_0007378 Ga0495669_0007378_49_432 127
859 3300046689 Ga0495613_0029770 Ga0495613_0029770_770_1153 127
860 3300046689 Ga0495613_0038441 Ga0495613_0038441_1495_1878 127
861 3300046690 Ga0495624_0003010 Ga0495624_0003010_3203_3586 127
862 3300046690 Ga0495624_0343122 Ga0495624_0343122_403_786 127
863 3300046691 Ga0495670_0001553 Ga0495670_0001553_7163_7546 127
864 3300046691 Ga0495670_0004976 Ga0495670_0004976_5255_5638 127
865 3300046691 Ga0495670_0014987 Ga0495670_0014987_1444_1827 127
866 3300046691 Ga0495670_0022257 Ga0495670_0022257_2212_2595 127
867 3300046691 Ga0495670_0108273 Ga0495670_0108273_988_1371 127
868 3300046691 Ga0495670_0204813 Ga0495670_0204813_236_619 127
869 3300046691 Ga0495670_0236329 Ga0495670_0236329_437_820 127
870 3300046691 Ga0495670_0375705 Ga0495670_0375705_258_641 127
871 3300046692 Ga0495671_0001962 Ga0495671_0001962_6060_6443 127
872 3300046692 Ga0495671_0008692 Ga0495671_0008692_2926_3309 127
873 3300046692 Ga0495671_0011834 Ga0495671_0011834_271_654 127
874 3300046692 Ga0495671_0031304 Ga0495671_0031304_282_665 127
875 3300046692 Ga0495671_0032184 Ga0495671_0032184_2009_2392 127
876 3300046692 Ga0495671_0032366 Ga0495671_0032366_1122_1505 127
877 3300046692 Ga0495671_0038346 Ga0495671_0038346_1546_1929 127
878 3300046692 Ga0495671_0044333 Ga0495671_0044333_756_1139 127
879 3300046692 Ga0495671_0056272 Ga0495671_0056272_182_565 127
880 3300046692 Ga0495671_0086312 Ga0495671_0086312_1032_1415 127
881 3300046692 Ga0495671_0108366 Ga0495671_0108366_173_556 127
882 3300046692 Ga0495671_0205308 Ga0495671_0205308_489_872 127
883 3300046694 Ga0495649_0000659 Ga0495649_0000659_11847_12230 127
884 3300046694 Ga0495649_0003726 Ga0495649_0003726_2705_3088 127
885 3300046694 Ga0495649_0008151 Ga0495649_0008151_96_479 127
886 3300046694 Ga0495649_0009665 Ga0495649_0009665_1038_1421 127
887 3300046694 Ga0495649_0014138 Ga0495649_0014138_3484_3867 127
888 3300046694 Ga0495649_0014952 Ga0495649_0014952_2663_3046 127
889 3300046694 Ga0495649_0016367 Ga0495649_0016367_3680_4063 127
890 3300046694 Ga0495649_0076766 Ga0495649_0076766_525_908 127
891 3300046694 Ga0495649_0079851 Ga0495649_0079851_1052_1435 127
892 3300046694 Ga0495649_0099928 Ga0495649_0099928_1038_1421 127
893 3300046694 Ga0495649_0102476 Ga0495649_0102476_75_458 127
894 3300046694 Ga0495649_0213824 Ga0495649_0213824_457_840 127
895 3300046694 Ga0495649_0597407 Ga0495649_0597407_88_477 127
896 3300046794 Ga0495589_0001163 Ga0495589_0001163_3657_4040 127
897 3300046794 Ga0495589_0006337 Ga0495589_0006337_257_640 127
898 3300046794 Ga0495589_0007623 Ga0495589_0007623_873_1256 127
899 3300046794 Ga0495589_0008589 Ga0495589_0008589_3404_3787 127
900 3300046794 Ga0495589_0018841 Ga0495589_0018841_955_1338 127
901 3300046794 Ga0495589_0032537 Ga0495589_0032537_1899_2282 127
902 3300046794 Ga0495589_0113864 Ga0495589_0113864_12_395 127
903 3300046794 Ga0495589_0419603 Ga0495589_0419603_140_523 127
904 3300046809 Ga0495600_0006708 Ga0495600_0006708_4774_5157 127
905 3300046809 Ga0495600_0022409 Ga0495600_0022409_770_1153 127
906 3300046809 Ga0495600_0672751 Ga0495600_0672751_14_397 127
907 3300046810 Ga0495660_0003993 Ga0495660_0003993_5602_5985 127
908 3300046810 Ga0495660_0004581 Ga0495660_0004581_5001_5384 127
909 3300046810 Ga0495660_0006992 Ga0495660_0006992_3608_3991 127
910 3300046810 Ga0495660_0016847 Ga0495660_0016847_1694_2077 127
911 3300046810 Ga0495660_0016915 Ga0495660_0016915_3137_3520 127
912 3300046810 Ga0495660_0017181 Ga0495660_0017181_1168_1551 127
913 3300046810 Ga0495660_0018858 Ga0495660_0018858_3165_3548 127
914 3300046810 Ga0495660_0030886 Ga0495660_0030886_1950_2333 127
915 3300046810 Ga0495660_0038194 Ga0495660_0038194_876_1259 127
916 3300046810 Ga0495660_0047297 Ga0495660_0047297_914_1297 127
917 3300046810 Ga0495660_0056081 Ga0495660_0056081_1164_1547 127
918 3300046810 Ga0495660_0121157 Ga0495660_0121157_633_1016 127
919 3300046810 Ga0495660_0129535 Ga0495660_0129535_732_1115 127
920 3300046810 Ga0495660_0146363 Ga0495660_0146363_285_668 127
921 3300046810 Ga0495660_0361425 Ga0495660_0361425_160_543 127
922 3300047315 Ga0495581_0012340 Ga0495581_0012340_998_1381 127
923 3300047317 Ga0495604_0007867 Ga0495604_0007867_3736_4119 127
924 3300047317 Ga0495604_0017446 Ga0495604_0017446_3106_3489 127
925 3300047317 Ga0495604_0022790 Ga0495604_0022790_2199_2582 127
926 3300047317 Ga0495604_0151882 Ga0495604_0151882_577_960 127
927 3300047318 Ga0495636_0048456 Ga0495636_0048456_457_840 127
928 3300047319 Ga0495674_0024005 Ga0495674_0024005_3202_3585 127
929 3300047320 Ga0495672_0002056 Ga0495672_0002056_1092_1475 127
930 3300047320 Ga0495672_0002477 Ga0495672_0002477_14471_14854 127
931 3300047320 Ga0495672_0003645 Ga0495672_0003645_3372_3755 127
932 3300047320 Ga0495672_0004950 Ga0495672_0004950_6404_6787 127
933 3300047320 Ga0495672_0013720 Ga0495672_0013720_137_520 127
934 3300047320 Ga0495672_0015111 Ga0495672_0015111_3560_3943 127
935 3300047320 Ga0495672_0016471 Ga0495672_0016471_4581_4964 127
936 3300047320 Ga0495672_0016472 Ga0495672_0016472_4581_4964 127
937 3300047320 Ga0495672_0046420 Ga0495672_0046420_747_1130 127
938 3300047320 Ga0495672_0048945 Ga0495672_0048945_1029_1412 127
939 3300047320 Ga0495672_0214337 Ga0495672_0214337_441_824 127
940 3300047320 Ga0495672_0427610 Ga0495672_0427610_151_534 127
941 3300047321 Ga0495676_0007211 Ga0495676_0007211_5965_6348 127
942 3300047321 Ga0495676_0042540 Ga0495676_0042540_2555_2938 127
943 3300047321 Ga0495676_0063102 Ga0495676_0063102_1732_2115 127
944 3300047322 Ga0495680_0002075 Ga0495680_0002075_4824_5207 127
945 3300047322 Ga0495680_0008556 Ga0495680_0008556_5543_5926 127
946 3300047322 Ga0495680_0031339 Ga0495680_0031339_655_1038 127
947 3300047322 Ga0495680_0060774 Ga0495680_0060774_1149_1532 127
948 3300047323 Ga0495683_0000028 Ga0495683_0000028_55229_55612 127
949 3300047323 Ga0495683_0000898 Ga0495683_0000898_12228_12611 127
950 3300047323 Ga0495683_0001259 Ga0495683_0001259_9489_9872 127
951 3300047323 Ga0495683_0006272 Ga0495683_0006272_4041_4424 127
952 3300047323 Ga0495683_0012253 Ga0495683_0012253_639_1022 127
953 3300047323 Ga0495683_0025975 Ga0495683_0025975_1706_2089 127
954 3300047323 Ga0495683_0038435 Ga0495683_0038435_1046_1429 127
955 3300047323 Ga0495683_0058833 Ga0495683_0058833_1403_1786 127
956 3300047323 Ga0495683_0058858 Ga0495683_0058858_82_465 127
957 3300047323 Ga0495683_0074726 Ga0495683_0074726_1024_1407 127
958 3300047323 Ga0495683_0200472 Ga0495683_0200472_386_769 127
959 3300047443 Ga0495687_021589 Ga0495687_021589_1078_1461 127
960 3300047444 Ga0495675_0018038 Ga0495675_0018038_1859_2242 127
961 3300047444 Ga0495675_0145591 Ga0495675_0145591_58_441 127
962 3300047445 Ga0495677_0000871 Ga0495677_0000871_5018_5401 127
963 3300047445 Ga0495677_0211838 Ga0495677_0211838_275_658 127
964 3300047446 Ga0495679_002397 Ga0495679_002397_3470_3853 127
965 3300047446 Ga0495679_009349 Ga0495679_009349_3490_3873 127
966 3300047446 Ga0495679_011920 Ga0495679_011920_44_427 127
967 3300047446 Ga0495679_030389 Ga0495679_030389_764_1147 127
968 3300047446 Ga0495679_044135 Ga0495679_044135_135_518 127
969 3300047446 Ga0495679_096311 Ga0495679_096311_76_459 127
970 3300047446 Ga0495679_109798 Ga0495679_109798_275_658 127
971 3300047469 Ga0495673_0003986 Ga0495673_0003986_7778_8161 127
972 3300047469 Ga0495673_0004046 Ga0495673_0004046_7823_8206 127
973 3300047469 Ga0495673_0004341 Ga0495673_0004341_7176_7559 127
974 3300047469 Ga0495673_0004580 Ga0495673_0004580_3875_4258 127
975 3300047469 Ga0495673_0004868 Ga0495673_0004868_4174_4557 127
976 3300047469 Ga0495673_0012366 Ga0495673_0012366_2837_3220 127
977 3300047469 Ga0495673_0027383 Ga0495673_0027383_1304_1687 127
978 3300047469 Ga0495673_0029531 Ga0495673_0029531_1968_2351 127
979 3300047469 Ga0495673_0035010 Ga0495673_0035010_154_537 127
980 3300047469 Ga0495673_0042892 Ga0495673_0042892_1337_1720 127
981 3300047469 Ga0495673_0043631 Ga0495673_0043631_63_446 127
982 3300047469 Ga0495673_0058971 Ga0495673_0058971_243_626 127
983 3300047469 Ga0495673_0061789 Ga0495673_0061789_308_691 127
984 3300047469 Ga0495673_0071261 Ga0495673_0071261_1029_1412 127
985 3300047469 Ga0495673_0099634 Ga0495673_0099634_633_1016 127
986 3300047470 Ga0495681_0000746 Ga0495681_0000746_12658_13041 127
987 3300047470 Ga0495681_0001398 Ga0495681_0001398_16685_17068 127
988 3300047470 Ga0495681_0001745 Ga0495681_0001745_9492_9875 127
989 3300047470 Ga0495681_0002503 Ga0495681_0002503_9079_9462 127
990 3300047470 Ga0495681_0004347 Ga0495681_0004347_254_637 127
991 3300047470 Ga0495681_0007249 Ga0495681_0007249_5963_6346 127
992 3300047470 Ga0495681_0010541 Ga0495681_0010541_1034_1417 127
993 3300047470 Ga0495681_0013379 Ga0495681_0013379_3077_3460 127
994 3300047470 Ga0495681_0048322 Ga0495681_0048322_159_542 127
995 3300047470 Ga0495681_0058514 Ga0495681_0058514_82_465 127
996 3300047470 Ga0495681_0063197 Ga0495681_0063197_260_643 127
997 3300047470 Ga0495681_0082421 Ga0495681_0082421_862_1245 127
998 3300047470 Ga0495681_0172024 Ga0495681_0172024_133_516 127
999 3300047470 Ga0495681_0411842 Ga0495681_0411842_63_446 127
1000 3300047471 Ga0495684_0019087 Ga0495684_0019087_1858_2241 127
1001 3300047471 Ga0495684_0025807 Ga0495684_0025807_1089_1472 127
1002 3300047472 Ga0495686_0007782 Ga0495686_0007782_4110_4493 127
1003 3300047472 Ga0495686_0034044 Ga0495686_0034044_1857_2240 127
1004 3300047472 Ga0495686_0073994 Ga0495686_0073994_347_730 127
1005 3300047472 Ga0495686_0091987 Ga0495686_0091987_509_892 127
1006 3300047472 Ga0495686_0670961 Ga0495686_0670961_48_437 127
1007 3300047673 Ga0495593_0012485 Ga0495593_0012485_3744_4127 127
1008 3300047673 Ga0495593_0018481 Ga0495593_0018481_3096_3479 127
1009 3300048088 Ga0495602_0017986 Ga0495602_0017986_3122_3505 127
1010 3300048089 Ga0495614_0242067 Ga0495614_0242067_12_395 127
1011 3300048091 Ga0495626_0000678 Ga0495626_0000678_9443_9826 127
1012 3300048091 Ga0495626_0000783 Ga0495626_0000783_17973_18356 127
1013 3300048091 Ga0495626_0001422 Ga0495626_0001422_10549_10932 127
1014 3300048091 Ga0495626_0001640 Ga0495626_0001640_9466_9849 127
1015 3300048091 Ga0495626_0007365 Ga0495626_0007365_2210_2593 127
1016 3300048091 Ga0495626_0020323 Ga0495626_0020323_1485_1868 127
1017 3300048091 Ga0495626_0059349 Ga0495626_0059349_312_695 127
1018 3300048091 Ga0495626_0118695 Ga0495626_0118695_113_496 127
1019 3300048903 Ga0496100_0365126 Ga0496100_0365126_371_754 127
1020 3300048905 Ga0496102_0001294 Ga0496102_0001294_5326_5709 127
1021 3300048906 Ga0496103_0035041 Ga0496103_0035041_836_1219 127
1022 3300048913 Ga0496110_0177059 Ga0496110_0177059_64_447 127
1023 3300048914 Ga0496111_0116063 Ga0496111_0116063_1509_1892 127
1024 3300048914 Ga0496111_0318500 Ga0496111_0318500_180_563 127
1025 3300048915 Ga0496112_0957490 Ga0496112_0957490_38_424 127
1026 3300048917 Ga0496114_0007214 Ga0496114_0007214_2947_3330 127
1027 3300048917 Ga0496114_0040426 Ga0496114_0040426_3455_3838 127
1028 3300048918 Ga0496115_0272950 Ga0496115_0272950_214_597 127
1029 3300048919 Ga0496116_0000670 Ga0496116_0000670_34804_35187 127
1030 3300048919 Ga0496116_0002721 Ga0496116_0002721_14152_14535 127
1031 3300048919 Ga0496116_0006222 Ga0496116_0006222_7711_8094 127
1032 3300048919 Ga0496116_0006711 Ga0496116_0006711_6578_6961 127
1033 3300048919 Ga0496116_0024991 Ga0496116_0024991_3074_3457 127
1034 3300048919 Ga0496116_0045492 Ga0496116_0045492_1756_2139 127
1035 3300048919 Ga0496116_0464146 Ga0496116_0464146_122_505 127
1036 3300048920 Ga0496117_0001364 Ga0496117_0001364_26197_26580 127
1037 3300048920 Ga0496117_0001531 Ga0496117_0001531_20694_21077 127
1038 3300048920 Ga0496117_0002217 Ga0496117_0002217_15702_16085 127
1039 3300048920 Ga0496117_0012525 Ga0496117_0012525_6166_6549 127
1040 3300048920 Ga0496117_0024834 Ga0496117_0024834_964_1347 127
1041 3300048920 Ga0496117_0027661 Ga0496117_0027661_3196_3579 127
1042 3300048920 Ga0496117_0055087 Ga0496117_0055087_850_1236 127
1043 3300048920 Ga0496117_0077360 Ga0496117_0077360_844_1227 127
1044 3300048920 Ga0496117_0268896 Ga0496117_0268896_481_864 127
1045 3300048920 Ga0496117_0438254 Ga0496117_0438254_60_443 127
1046 3300048920 Ga0496117_0564255 Ga0496117_0564255_125_508 127
1047 3300048921 Ga0496118_0001596 Ga0496118_0001596_9886_10269 127
1048 3300048921 Ga0496118_0013557 Ga0496118_0013557_949_1332 127
1049 3300048921 Ga0496118_0031073 Ga0496118_0031073_2997_3380 127
1050 3300048921 Ga0496118_0035292 Ga0496118_0035292_1978_2364 127
1051 3300048921 Ga0496118_0038357 Ga0496118_0038357_427_810 127
1052 3300048921 Ga0496118_0094674 Ga0496118_0094674_1304_1687 127
1053 3300048921 Ga0496118_0103103 Ga0496118_0103103_787_1170 127
1054 3300048921 Ga0496118_0115629 Ga0496118_0115629_1308_1691 127
1055 3300048921 Ga0496118_0298687 Ga0496118_0298687_54_437 127
1056 3300048922 Ga0496119_0004034 Ga0496119_0004034_268_651 127
1057 3300048922 Ga0496119_0026956 Ga0496119_0026956_1932_2315 127
1058 3300048922 Ga0496119_0200981 Ga0496119_0200981_146_529 127
1059 3300048922 Ga0496119_0214297 Ga0496119_0214297_538_921 127
1060 3300048923 Ga0496120_0003087 Ga0496120_0003087_8593_8976 127
1061 3300048923 Ga0496120_0006118 Ga0496120_0006118_3549_3932 127
1062 3300048923 Ga0496120_0154005 Ga0496120_0154005_143_526 127
1063 3300048924 Ga0496121_0001246 Ga0496121_0001246_9499_9882 127
1064 3300048924 Ga0496121_0051766 Ga0496121_0051766_54_440 127
1065 3300048924 Ga0496121_0054501 Ga0496121_0054501_1661_2044 127
1066 3300048924 Ga0496121_0079190 Ga0496121_0079190_846_1229 127
1067 3300048924 Ga0496121_0092511 Ga0496121_0092511_1945_2328 127
1068 3300048925 Ga0496122_0000398 Ga0496122_0000398_18365_18751 127
1069 3300048925 Ga0496122_0002086 Ga0496122_0002086_12377_12760 127
1070 3300048925 Ga0496122_0006633 Ga0496122_0006633_9458_9841 127
1071 3300048925 Ga0496122_0048950 Ga0496122_0048950_945_1328 127
1072 3300048925 Ga0496122_0052963 Ga0496122_0052963_1041_1424 127
1073 3300048925 Ga0496122_0053994 Ga0496122_0053994_180_563 127
1074 3300048925 Ga0496122_0057451 Ga0496122_0057451_2475_2858 127
1075 3300048925 Ga0496122_0139964 Ga0496122_0139964_573_956 127
1076 3300048925 Ga0496122_0389215 Ga0496122_0389215_61_444 127
1077 3300048925 Ga0496122_0402143 Ga0496122_0402143_188_571 127
1078 3300048926 Ga0496123_0000178 Ga0496123_0000178_20721_21104 127
1079 3300048926 Ga0496123_0000302 Ga0496123_0000302_18259_18645 127
1080 3300048926 Ga0496123_0002164 Ga0496123_0002164_20692_21075 127
1081 3300048926 Ga0496123_0032441 Ga0496123_0032441_2428_2811 127
1082 3300048926 Ga0496123_0035669 Ga0496123_0035669_2250_2633 127
1083 3300048926 Ga0496123_0038238 Ga0496123_0038238_2046_2429 127
1084 3300048926 Ga0496123_0066006 Ga0496123_0066006_1814_2197 127
1085 3300048926 Ga0496123_0136922 Ga0496123_0136922_164_547 127
1086 3300048927 Ga0496124_0002969 Ga0496124_0002969_155_538 127
1087 3300048927 Ga0496124_0004019 Ga0496124_0004019_9484_9867 127
1088 3300048927 Ga0496124_0006247 Ga0496124_0006247_5494_5877 127
1089 3300048927 Ga0496124_0010717 Ga0496124_0010717_3641_4024 127
1090 3300048927 Ga0496124_0012209 Ga0496124_0012209_3671_4054 127
1091 3300048927 Ga0496124_0031270 Ga0496124_0031270_3241_3624 127
1092 3300048927 Ga0496124_0046634 Ga0496124_0046634_1156_1539 127
1093 3300048927 Ga0496124_0051932 Ga0496124_0051932_154_537 127
1094 3300048927 Ga0496124_0064357 Ga0496124_0064357_622_1005 127
1095 3300048927 Ga0496124_0076989 Ga0496124_0076989_623_1006 127
1096 3300048927 Ga0496124_0110381 Ga0496124_0110381_534_917 127
1097 3300048927 Ga0496124_0150093 Ga0496124_0150093_546_929 127
1098 3300048927 Ga0496124_0238505 Ga0496124_0238505_154_537 127
1099 3300048927 Ga0496124_0561228 Ga0496124_0561228_297_680 127
1100 3300048928 Ga0496125_0003933 Ga0496125_0003933_9026_9409 127
1101 3300048928 Ga0496125_0006758 Ga0496125_0006758_8770_9153 127
1102 3300048928 Ga0496125_0014752 Ga0496125_0014752_3075_3458 127
1103 3300048928 Ga0496125_0020480 Ga0496125_0020480_4330_4713 127
1104 3300048928 Ga0496125_0027497 Ga0496125_0027497_2977_3360 127
1105 3300048928 Ga0496125_0036851 Ga0496125_0036851_2914_3297 127
1106 3300048928 Ga0496125_0051859 Ga0496125_0051859_2051_2434 127
1107 3300048928 Ga0496125_0064164 Ga0496125_0064164_2400_2783 127
1108 3300048928 Ga0496125_0070320 Ga0496125_0070320_1767_2150 127
1109 3300048928 Ga0496125_0647886 Ga0496125_0647886_62_445 127
1110 3300048929 Ga0496126_0009693 Ga0496126_0009693_3345_3728 127
1111 3300048929 Ga0496126_0090604 Ga0496126_0090604_1436_1819 127
1112 3300048929 Ga0496126_0269729 Ga0496126_0269729_564_947 127
1113 3300048929 Ga0496126_0589016 Ga0496126_0589016_69_452 127
1114 3300048929 Ga0496126_0778775 Ga0496126_0778775_12_395 127
1115 3300049128 Ga0501308_037983 Ga0501308_037983_142_531 127
1116 3300049459 Ga0495678_001198 Ga0495678_001198_17082_17465 127
1117 3300049459 Ga0495678_003432 Ga0495678_003432_8384_8767 127
1118 3300049459 Ga0495678_013127 Ga0495678_013127_93_476 127
1119 3300049459 Ga0495678_014798 Ga0495678_014798_3183_3566 127
1120 3300049459 Ga0495678_025053 Ga0495678_025053_2092_2475 127
1121 3300049459 Ga0495678_026859 Ga0495678_026859_573_956 127
1122 3300049459 Ga0495678_028133 Ga0495678_028133_1071_1454 127
1123 3300049459 Ga0495678_038201 Ga0495678_038201_994_1377 127
1124 3300049459 Ga0495678_060505 Ga0495678_060505_911_1294 127
1125 3300049459 Ga0495678_099242 Ga0495678_099242_530_913 127
1126 3300049459 Ga0495678_135526 Ga0495678_135526_259_642 127
1127 3300049460 Ga0495682_0001449 Ga0495682_0001449_8662_9045 127
1128 3300049460 Ga0495682_0012178 Ga0495682_0012178_1930_2346 127
1129 3300049460 Ga0495682_0018021 Ga0495682_0018021_1461_1844 127
1130 3300049460 Ga0495682_0026902 Ga0495682_0026902_1665_2048 127
1131 3300049460 Ga0495682_0088276 Ga0495682_0088276_669_1052 127
1132 3300049530 Ga0501314_011131 Ga0501314_011131_189_629 127
1133 3300049531 Ga0501315_054101 Ga0501315_054101_181_564 127
1134 3300049571 Ga0501034_0000143 Ga0501034_0000143_112978_113361 127
1135 3300049662 Ga0501222_018685 Ga0501222_018685_410_793 127
1136 3300049665 Ga0501227_061635 Ga0501227_061635_362_745 127
1137 3300049673 Ga0501240_001908 Ga0501240_001908_1035_1418 127
1138 3300049708 Ga0501245_114848 Ga0501245_114848_99_491 127
1139 3300049758 Ga0501241_001000 Ga0501241_001000_1486_1869 127
1140 3300049853 Ga0501226_000001 Ga0501226_000001_242884_243324 127
1141 3300050489 nmdc:mga03683_207476_c1 nmdc:mga03683_207476_c1_114_497 127
1142 3300050489 nmdc:mga03683_49414_c1 nmdc:mga03683_49414_c1_111_494 127
1143 3300050491 nmdc:mga00v17_336831_c1 nmdc:mga00v17_336831_c1_252_635 127
1144 3300050491 nmdc:mga00v17_387897_c1 nmdc:mga00v17_387897_c1_90_473 127
1145 3300050514 nmdc:mga08x19_180272_c1 nmdc:mga08x19_180272_c1_615_998 127
1146 3300050514 nmdc:mga08x19_216267_c1 nmdc:mga08x19_216267_c1_53_436 127
1147 3300050514 nmdc:mga08x19_844824_c1 nmdc:mga08x19_844824_c1_77_460 127
1148 3300050516 nmdc:mga0sz30_463256_c1 nmdc:mga0sz30_463256_c1_158_541 127
1149 3300053111 Ga0500572_004557 Ga0500572_004557_943_1326 127
1150 3300053125 Ga0500618_002286 Ga0500618_002286_35_418 127
1151 3300053135 Ga0500659_0003926 Ga0500659_0003926_45_428 127
1152 3300053145 Ga0500586_188611 Ga0500586_188611_109_492 127
1153 3300053145 Ga0500586_257529 Ga0500586_257529_86_469 127
1154 3300053161 Ga0500634_0043183 Ga0500634_0043183_1861_2244 127
1155 iso_pu_bacteria 2606217733 2608380434 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

8

127

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9649 3 125
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9618 8 125
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9584 2 123
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9551 8 127
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9541 3 127
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9616 8 125 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9412 39 123 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9394 4 125 2.40.50.100
af_Q54FI0_21_147_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9357 4 123 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9343 2 127 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A658G1Z1-F1-model_v4 deleted 0.9876 16 125
AF-A0A7Y7XYL7-F1-model_v4 Glycine cleavage system H protein 0.9856 1 127 GO:0005829
GO:0005960
GO:0019464
AF-A0A089YA49-F1-model_v4 Glycine cleavage system H protein 0.9854 1 127 GO:0005829
GO:0005960
GO:0019464
AF-A0A0M3CTM7-F1-model_v4 deleted 0.9852 1 127
AF-A0A2N8EQ46-F1-model_v4 Glycine cleavage system H protein 0.9845 1 127 GO:0005829
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
95.49 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map