F490918
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1155 | 613 | 990 | 104 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10173674|Ga0081455_101736742 |
| Length | 111 |
| Sequence | MTSPLEQKKIKIAGPSVVTANRTWDGAVIYRTAAKDWSTDLSQAAIVRVNDDARALLAESVADDVGAIGAYIAPVEVSDDGKIKPGNLREQIRRSGVTIDLPTQIGLPVQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 11 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 12 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 15 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 16 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 17 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 18 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 22 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 23 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 24 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 25 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 26 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 27 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 28 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 29 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 30 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 31 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 32 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 33 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 34 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 35 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 36 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 37 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 38 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 39 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 40 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 41 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 42 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 43 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 44 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 45 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 46 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 47 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 48 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 49 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 50 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 51 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 52 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 53 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 54 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 55 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 56 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 57 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 58 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 59 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 60 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 61 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 62 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 63 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 64 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 65 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 66 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 67 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 68 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 69 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 70 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 71 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 72 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 73 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 74 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 75 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 76 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 77 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 78 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 79 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 80 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 81 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 82 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 83 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 84 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 85 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 86 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 87 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 88 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 89 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 90 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 91 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 92 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 93 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 94 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 95 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 96 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 97 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 98 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 99 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 100 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 101 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 102 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 103 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 104 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 105 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 106 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 107 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 108 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 109 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 110 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 111 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 112 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 113 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 114 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 115 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 116 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 117 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 118 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 119 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 120 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 121 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 122 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 123 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 124 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 125 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 126 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 127 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 128 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 129 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 130 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 131 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 132 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 133 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 134 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 135 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 136 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 137 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 138 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 139 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 140 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 141 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 142 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 143 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 144 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 145 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 146 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 147 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 148 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 149 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 150 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 155 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 157 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 158 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 159 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 161 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 163 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 171 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 175 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 181 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 182 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 184 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 186 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 188 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 191 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 193 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 194 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 195 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 196 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 197 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 198 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 199 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 200 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 201 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 202 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 203 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 204 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 205 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 206 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 207 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 208 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 210 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 211 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 212 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 213 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 215 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 217 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 218 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 219 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 220 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 222 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 223 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 225 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 226 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 227 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 228 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 240 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 252 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 255 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 257 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 258 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 259 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 260 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 261 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 262 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 263 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 264 | 3300023224 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 | Metagenome | Unclassified |
| 265 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 266 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 271 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 272 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 337 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 338 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 339 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 340 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 346 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 347 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 348 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 349 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 350 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 351 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 352 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 353 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 354 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 355 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 356 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 357 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 358 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 359 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 360 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 361 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 362 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 363 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 364 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 365 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 366 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 367 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 368 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 369 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 370 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 371 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 372 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 373 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 374 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 375 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 376 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 377 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 378 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 379 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 380 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 381 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 382 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 383 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 384 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 385 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 386 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 387 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 388 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 389 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 390 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 391 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 392 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 393 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 394 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 395 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 396 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 397 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 398 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 399 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 400 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 401 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 402 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 403 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 404 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 405 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 406 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 407 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 408 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 409 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 410 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 411 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 412 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 413 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 414 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 415 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 416 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 494 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 495 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 496 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 497 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 498 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 499 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 500 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 501 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 502 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 503 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 504 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 505 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 506 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 507 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 508 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 509 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 510 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 511 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 512 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 513 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 514 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 515 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 516 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 517 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 518 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 519 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 523 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 524 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 525 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 526 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 527 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 528 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 529 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 530 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 531 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 532 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 535 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 538 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 539 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 540 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 541 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 542 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 543 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 544 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 545 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 546 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 547 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 548 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 549 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 550 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 551 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 552 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 553 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 554 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 555 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 556 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 557 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 558 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 559 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 560 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 562 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 563 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 564 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 565 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 566 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 567 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 568 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 569 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 570 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 571 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 572 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 573 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 574 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 575 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 576 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 577 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 578 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 579 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 580 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 581 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 582 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 583 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 584 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 585 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 586 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 587 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 588 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 589 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 590 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 591 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 592 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 593 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 594 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 595 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 596 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 597 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 598 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 599 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 600 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 601 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 602 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 603 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 604 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 605 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 606 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 607 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 608 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 609 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 610 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 611 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 612 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 613 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.54 |
| Metatranscriptomes | 0.17 |
| Isolates | 14.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.93 |
| Nodule | 12.29 |
| Rhizoplane | 7.36 |
| Rhizosphere | 56.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1013109 | 3300000549 | Bacteria | 977 |
| 2 | JGI24737J22298_10006499 | 3300001990 | Bacteria | 3991 |
| 3 | JGI24735J21928_10019922 | 3300002067 | Bacteria | 2059 |
| 4 | JGI24735J21928_10212446 | 3300002067 | Bacteria | 562 |
| 5 | JGI24738J21930_10019905 | 3300002075 | Bacteria | 1397 |
| 6 | JGI24738J21930_10124708 | 3300002075 | Bacteria | 561 |
| 7 | JGI24033J26618_1053361 | 3300002155 | Bacteria | 584 |
| 8 | JGI25153J46596_10001390 | 3300003215 | Bacteria | 14494 |
| 9 | JGI25153J46596_10002696 | 3300003215 | Bacteria | 10122 |
| 10 | JGI25153J46596_10003859 | 3300003215 | Bacteria | 8243 |
| 11 | JGI25153J46596_10020441 | 3300003215 | Bacteria | 2503 |
| 12 | JGI25160J50197_1002392 | 3300003354 | Bacteria | 8749 |
| 13 | JGI25404J52841_10033269 | 3300003659 | Bacteria | 1099 |
| 14 | Ga0055539_1001720 | 3300003752 | Bacteria | 3833 |
| 15 | Ga0055529_1027473 | 3300003763 | Bacteria | 701 |
| 16 | Ga0055526_1104461 | 3300003771 | Bacteria | 515 |
| 17 | Ga0055531_10003707 | 3300003794 | Bacteria | 9611 |
| 18 | Ga0055543_1079601 | 3300004625 | Bacteria | 506 |
| 19 | Ga0065165_1003638 | 3300005262 | Bacteria | 10535 |
| 20 | Ga0065165_1024512 | 3300005262 | Bacteria | 2024 |
| 21 | Ga0065712_10536602 | 3300005290 | Bacteria | 626 |
| 22 | Ga0070658_10878140 | 3300005327 | Bacteria | 779 |
| 23 | Ga0070676_11056465 | 3300005328 | Bacteria | 612 |
| 24 | Ga0070676_11313137 | 3300005328 | Bacteria | 553 |
| 25 | Ga0070683_100025330 | 3300005329 | Bacteria | 5327 |
| 26 | Ga0070683_100865744 | 3300005329 | Bacteria | 867 |
| 27 | Ga0070670_100055651 | 3300005331 | Bacteria | 3396 |
| 28 | Ga0068869_100163644 | 3300005334 | Bacteria | 1733 |
| 29 | Ga0068869_100350804 | 3300005334 | Bacteria | 1203 |
| 30 | Ga0070666_10181967 | 3300005335 | Bacteria | 1474 |
| 31 | Ga0070666_10331454 | 3300005335 | Bacteria | 1087 |
| 32 | Ga0070666_10422991 | 3300005335 | Bacteria | 960 |
| 33 | Ga0070680_100028590 | 3300005336 | Bacteria | 4472 |
| 34 | Ga0070680_100363103 | 3300005336 | Bacteria | 1232 |
| 35 | Ga0070682_100218969 | 3300005337 | Bacteria | 1353 |
| 36 | Ga0070682_100652971 | 3300005337 | Bacteria | 838 |
| 37 | Ga0070682_101076986 | 3300005337 | Bacteria | 672 |
| 38 | Ga0068868_100017643 | 3300005338 | Bacteria | 5322 |
| 39 | Ga0068868_100740246 | 3300005338 | Bacteria | 882 |
| 40 | Ga0068868_100947948 | 3300005338 | Bacteria | 785 |
| 41 | Ga0070660_100201906 | 3300005339 | Bacteria | 1613 |
| 42 | Ga0070660_100935065 | 3300005339 | Bacteria | 732 |
| 43 | Ga0070689_100499769 | 3300005340 | Bacteria | 1042 |
| 44 | Ga0070661_100416118 | 3300005344 | Bacteria | 1065 |
| 45 | Ga0070661_100512360 | 3300005344 | Bacteria | 961 |
| 46 | Ga0070661_100981450 | 3300005344 | Bacteria | 700 |
| 47 | Ga0070692_10359834 | 3300005345 | Bacteria | 907 |
| 48 | Ga0070668_100084326 | 3300005347 | Bacteria | 2495 |
| 49 | Ga0070668_100211842 | 3300005347 | Bacteria | 1594 |
| 50 | Ga0070668_100685543 | 3300005347 | Bacteria | 903 |
| 51 | Ga0070668_101426098 | 3300005347 | Bacteria | 632 |
| 52 | Ga0070668_102082679 | 3300005347 | Bacteria | 524 |
| 53 | Ga0070669_100466617 | 3300005353 | Bacteria | 1043 |
| 54 | Ga0070669_100566424 | 3300005353 | Bacteria | 949 |
| 55 | Ga0070675_100514555 | 3300005354 | Bacteria | 1080 |
| 56 | Ga0070675_101670178 | 3300005354 | Bacteria | 588 |
| 57 | Ga0070675_101795717 | 3300005354 | Bacteria | 566 |
| 58 | Ga0070675_102169297 | 3300005354 | Bacteria | 512 |
| 59 | Ga0070671_100642425 | 3300005355 | Bacteria | 918 |
| 60 | Ga0070674_100782225 | 3300005356 | Bacteria | 823 |
| 61 | Ga0070673_101477395 | 3300005364 | Bacteria | 641 |
| 62 | Ga0070673_102113052 | 3300005364 | Bacteria | 535 |
| 63 | Ga0070667_100524191 | 3300005367 | Bacteria | 1088 |
| 64 | Ga0070667_100845781 | 3300005367 | Bacteria | 851 |
| 65 | Ga0070667_100941738 | 3300005367 | Bacteria | 805 |
| 66 | Ga0070709_10000375 | 3300005434 | Bacteria | 27523 |
| 67 | Ga0070709_10009548 | 3300005434 | Bacteria | 5354 |
| 68 | Ga0070714_100047429 | 3300005435 | Bacteria | 3649 |
| 69 | Ga0070714_100161943 | 3300005435 | Bacteria | 2025 |
| 70 | Ga0070714_101989943 | 3300005435 | Bacteria | 567 |
| 71 | Ga0070713_100061380 | 3300005436 | Bacteria | 3144 |
| 72 | Ga0070713_100108259 | 3300005436 | Bacteria | 2419 |
| 73 | Ga0070713_100159215 | 3300005436 | Bacteria | 2014 |
| 74 | Ga0070713_100179267 | 3300005436 | Bacteria | 1903 |
| 75 | Ga0070710_10000275 | 3300005437 | Bacteria | 24270 |
| 76 | Ga0070710_10010323 | 3300005437 | Bacteria | 4586 |
| 77 | Ga0070710_10048124 | 3300005437 | Bacteria | 2381 |
| 78 | Ga0070710_11042584 | 3300005437 | Bacteria | 598 |
| 79 | Ga0070701_10215404 | 3300005438 | Bacteria | 1143 |
| 80 | Ga0070701_10611640 | 3300005438 | Bacteria | 723 |
| 81 | Ga0070711_100006414 | 3300005439 | Bacteria | 7094 |
| 82 | Ga0070711_100012405 | 3300005439 | Bacteria | 5323 |
| 83 | Ga0070711_100031039 | 3300005439 | Bacteria | 3543 |
| 84 | Ga0070700_100632785 | 3300005441 | Bacteria | 842 |
| 85 | Ga0070663_100056230 | 3300005455 | Bacteria | 2819 |
| 86 | Ga0070663_100847116 | 3300005455 | Bacteria | 787 |
| 87 | Ga0070663_100964815 | 3300005455 | Bacteria | 739 |
| 88 | Ga0070663_101204035 | 3300005455 | Bacteria | 666 |
| 89 | Ga0070663_101398573 | 3300005455 | Bacteria | 620 |
| 90 | Ga0070663_101816014 | 3300005455 | Bacteria | 547 |
| 91 | Ga0070678_102194918 | 3300005456 | Bacteria | 524 |
| 92 | Ga0070662_100262735 | 3300005457 | Bacteria | 1391 |
| 93 | Ga0070662_100286317 | 3300005457 | Bacteria | 1335 |
| 94 | Ga0070662_100835789 | 3300005457 | Bacteria | 784 |
| 95 | Ga0070681_10077381 | 3300005458 | Bacteria | 3285 |
| 96 | Ga0070681_10083478 | 3300005458 | Bacteria | 3148 |
| 97 | Ga0068867_101388401 | 3300005459 | Bacteria | 651 |
| 98 | Ga0070685_11173029 | 3300005466 | Bacteria | 583 |
| 99 | Ga0070685_11288246 | 3300005466 | Bacteria | 558 |
| 100 | Ga0070679_100039917 | 3300005530 | Bacteria | 4666 |
| 101 | Ga0070679_100434699 | 3300005530 | Bacteria | 1257 |
| 102 | Ga0070679_101406501 | 3300005530 | Bacteria | 644 |
| 103 | Ga0070684_100012084 | 3300005535 | Bacteria | 6904 |
| 104 | Ga0070684_100633947 | 3300005535 | Bacteria | 994 |
| 105 | Ga0068853_100145219 | 3300005539 | Bacteria | 2132 |
| 106 | Ga0068853_100184016 | 3300005539 | Bacteria | 1895 |
| 107 | Ga0068853_100222490 | 3300005539 | Bacteria | 1724 |
| 108 | Ga0068853_100411183 | 3300005539 | Bacteria | 1268 |
| 109 | Ga0068853_100581536 | 3300005539 | Bacteria | 1063 |
| 110 | Ga0068853_100888133 | 3300005539 | Bacteria | 856 |
| 111 | Ga0070672_100508626 | 3300005543 | Bacteria | 1043 |
| 112 | Ga0070686_101442585 | 3300005544 | Bacteria | 579 |
| 113 | Ga0070693_100137993 | 3300005547 | Bacteria | 1531 |
| 114 | Ga0070693_100560893 | 3300005547 | Bacteria | 819 |
| 115 | Ga0070665_100043079 | 3300005548 | Bacteria | 4537 |
| 116 | Ga0070665_100076636 | 3300005548 | Bacteria | 3350 |
| 117 | Ga0070665_100144262 | 3300005548 | Bacteria | 2384 |
| 118 | Ga0070665_101269524 | 3300005548 | Bacteria | 747 |
| 119 | Ga0068855_100022264 | 3300005563 | Bacteria | 7593 |
| 120 | Ga0068855_100032650 | 3300005563 | Bacteria | 6215 |
| 121 | Ga0068855_100504151 | 3300005563 | Bacteria | 1315 |
| 122 | Ga0068855_100905337 | 3300005563 | Bacteria | 932 |
| 123 | Ga0068855_101958389 | 3300005563 | Bacteria | 593 |
| 124 | Ga0070664_101304144 | 3300005564 | Bacteria | 686 |
| 125 | Ga0070664_101518657 | 3300005564 | Bacteria | 634 |
| 126 | Ga0068857_100015131 | 3300005577 | Bacteria | 6734 |
| 127 | Ga0068857_101653182 | 3300005577 | Bacteria | 626 |
| 128 | Ga0068857_102032301 | 3300005577 | Bacteria | 564 |
| 129 | Ga0068854_100094223 | 3300005578 | Bacteria | 2233 |
| 130 | Ga0068854_100787893 | 3300005578 | Bacteria | 828 |
| 131 | Ga0068854_100919635 | 3300005578 | Bacteria | 770 |
| 132 | Ga0068854_101347315 | 3300005578 | Bacteria | 644 |
| 133 | Ga0068854_101783430 | 3300005578 | Bacteria | 564 |
| 134 | Ga0068856_100051263 | 3300005614 | Bacteria | 4069 |
| 135 | Ga0068856_100248794 | 3300005614 | Bacteria | 1793 |
| 136 | Ga0068856_101074074 | 3300005614 | Bacteria | 823 |
| 137 | Ga0068856_101079199 | 3300005614 | Bacteria | 820 |
| 138 | Ga0068852_100141894 | 3300005616 | Bacteria | 2224 |
| 139 | Ga0068852_100335389 | 3300005616 | Bacteria | 1472 |
| 140 | Ga0068852_100739188 | 3300005616 | Bacteria | 996 |
| 141 | Ga0068852_100947886 | 3300005616 | Bacteria | 879 |
| 142 | Ga0068852_101578735 | 3300005616 | Bacteria | 678 |
| 143 | Ga0068859_100716532 | 3300005617 | Bacteria | 1091 |
| 144 | Ga0068864_100751494 | 3300005618 | Bacteria | 956 |
| 145 | Ga0068866_10367814 | 3300005718 | Bacteria | 918 |
| 146 | Ga0068866_10908821 | 3300005718 | Bacteria | 620 |
| 147 | Ga0068861_100388885 | 3300005719 | Bacteria | 1234 |
| 148 | Ga0068861_102233186 | 3300005719 | Bacteria | 549 |
| 149 | Ga0068851_11044641 | 3300005834 | Bacteria | 517 |
| 150 | Ga0068863_101206429 | 3300005841 | Bacteria | 763 |
| 151 | Ga0068863_102438177 | 3300005841 | Bacteria | 533 |
| 152 | Ga0068858_100278870 | 3300005842 | Bacteria | 1591 |
| 153 | Ga0068858_101166827 | 3300005842 | Bacteria | 757 |
| 154 | Ga0068858_101672213 | 3300005842 | Bacteria | 628 |
| 155 | Ga0068858_102468586 | 3300005842 | Bacteria | 513 |
| 156 | Ga0068860_101430726 | 3300005843 | Bacteria | 713 |
| 157 | Ga0068860_101501236 | 3300005843 | Bacteria | 695 |
| 158 | Ga0068862_100541426 | 3300005844 | Bacteria | 1110 |
| 159 | Ga0068862_100592134 | 3300005844 | Bacteria | 1064 |
| 160 | Ga0068862_100593488 | 3300005844 | Bacteria | 1062 |
| 161 | Ga0081455_10173674 | 3300005937 | Bacteria | 1638 |
| 162 | Ga0081540_1001275 | 3300005983 | Bacteria | 21968 |
| 163 | Ga0081540_1023738 | 3300005983 | Bacteria | 3577 |
| 164 | Ga0081539_10020815 | 3300005985 | Bacteria | 4411 |
| 165 | Ga0081539_10230483 | 3300005985 | Bacteria | 836 |
| 166 | Ga0070717_10061154 | 3300006028 | Bacteria | 3120 |
| 167 | Ga0070717_10324252 | 3300006028 | Bacteria | 1373 |
| 168 | Ga0070717_10756156 | 3300006028 | Bacteria | 884 |
| 169 | Ga0075365_10120219 | 3300006038 | Bacteria | 1811 |
| 170 | Ga0075365_10148633 | 3300006038 | Bacteria | 1629 |
| 171 | Ga0075365_10150418 | 3300006038 | Bacteria | 1619 |
| 172 | Ga0075365_10154768 | 3300006038 | Bacteria | 1595 |
| 173 | Ga0075365_10536388 | 3300006038 | Bacteria | 827 |
| 174 | Ga0075368_10000838 | 3300006042 | Bacteria | 9496 |
| 175 | Ga0075368_10001639 | 3300006042 | Bacteria | 7182 |
| 176 | Ga0075368_10170099 | 3300006042 | Bacteria | 916 |
| 177 | Ga0075363_100009411 | 3300006048 | Bacteria | 4593 |
| 178 | Ga0075363_100302276 | 3300006048 | Bacteria | 929 |
| 179 | Ga0075363_100553947 | 3300006048 | Bacteria | 686 |
| 180 | Ga0075363_100982277 | 3300006048 | Bacteria | 520 |
| 181 | Ga0075364_10128150 | 3300006051 | Bacteria | 1702 |
| 182 | Ga0075364_10485675 | 3300006051 | Bacteria | 844 |
| 183 | Ga0075364_10742082 | 3300006051 | Bacteria | 670 |
| 184 | Ga0070715_10063040 | 3300006163 | Bacteria | 1633 |
| 185 | Ga0070716_100012144 | 3300006173 | Bacteria | 4357 |
| 186 | Ga0070716_101088412 | 3300006173 | Bacteria | 637 |
| 187 | Ga0070712_100079181 | 3300006175 | Bacteria | 2374 |
| 188 | Ga0070712_100107849 | 3300006175 | Bacteria | 2073 |
| 189 | Ga0070712_100121246 | 3300006175 | Bacteria | 1967 |
| 190 | Ga0070712_100202978 | 3300006175 | Bacteria | 1558 |
| 191 | Ga0070712_101014354 | 3300006175 | Bacteria | 718 |
| 192 | Ga0075362_10042194 | 3300006177 | Bacteria | 2015 |
| 193 | Ga0075362_10150176 | 3300006177 | Bacteria | 1117 |
| 194 | Ga0075362_10167070 | 3300006177 | Bacteria | 1061 |
| 195 | Ga0075367_10077749 | 3300006178 | Bacteria | 2003 |
| 196 | Ga0075367_10129471 | 3300006178 | Bacteria | 1559 |
| 197 | Ga0075367_10172200 | 3300006178 | Bacteria | 1348 |
| 198 | Ga0075367_10346154 | 3300006178 | Bacteria | 938 |
| 199 | Ga0075367_10746461 | 3300006178 | Bacteria | 623 |
| 200 | Ga0075369_10015750 | 3300006186 | Bacteria | 3039 |
| 201 | Ga0075369_10077278 | 3300006186 | Bacteria | 1472 |
| 202 | Ga0075369_10104856 | 3300006186 | Bacteria | 1270 |
| 203 | Ga0075369_10109164 | 3300006186 | Bacteria | 1246 |
| 204 | Ga0075366_10009092 | 3300006195 | Bacteria | 5540 |
| 205 | Ga0075366_10084812 | 3300006195 | Bacteria | 1894 |
| 206 | Ga0075366_10366157 | 3300006195 | Bacteria | 885 |
| 207 | Ga0097621_100473854 | 3300006237 | Bacteria | 1131 |
| 208 | Ga0075370_10083443 | 3300006353 | Bacteria | 1838 |
| 209 | Ga0075370_10099134 | 3300006353 | Bacteria | 1685 |
| 210 | Ga0075370_10188880 | 3300006353 | Bacteria | 1213 |
| 211 | Ga0075370_10217076 | 3300006353 | Bacteria | 1130 |
| 212 | Ga0075370_10518817 | 3300006353 | Bacteria | 720 |
| 213 | Ga0075370_10687856 | 3300006353 | Bacteria | 622 |
| 214 | Ga0075370_10792221 | 3300006353 | Bacteria | 578 |
| 215 | Ga0068865_100106352 | 3300006881 | Bacteria | 2062 |
| 216 | Ga0068865_100134925 | 3300006881 | Bacteria | 1853 |
| 217 | Ga0068865_100486408 | 3300006881 | Bacteria | 1027 |
| 218 | Ga0068865_101049462 | 3300006881 | Bacteria | 716 |
| 219 | Ga0068865_101634796 | 3300006881 | Bacteria | 580 |
| 220 | Ga0097620_100716527 | 3300006931 | Bacteria | 1091 |
| 221 | Ga0099825_1035725 | 3300006941 | Bacteria | 1757 |
| 222 | Ga0099823_1033450 | 3300006944 | Bacteria | 4128 |
| 223 | Ga0099794_10310580 | 3300007265 | Bacteria | 817 |
| 224 | Ga0099795_10420302 | 3300007788 | Bacteria | 611 |
| 225 | Ga0105240_10005310 | 3300009093 | Bacteria | 19223 |
| 226 | Ga0105240_10029763 | 3300009093 | Bacteria | 7106 |
| 227 | Ga0105240_10092127 | 3300009093 | Bacteria | 3701 |
| 228 | Ga0105240_11067433 | 3300009093 | Bacteria | 861 |
| 229 | Ga0111539_10419589 | 3300009094 | Bacteria | 1558 |
| 230 | Ga0105245_10144713 | 3300009098 | Bacteria | 2242 |
| 231 | Ga0105245_10453572 | 3300009098 | Bacteria | 1291 |
| 232 | Ga0105245_10869902 | 3300009098 | Bacteria | 942 |
| 233 | Ga0105245_11055864 | 3300009098 | Bacteria | 858 |
| 234 | Ga0105247_10107152 | 3300009101 | Bacteria | 1794 |
| 235 | Ga0105247_11708364 | 3300009101 | Bacteria | 521 |
| 236 | Ga0105243_10274852 | 3300009148 | Bacteria | 1514 |
| 237 | Ga0105243_11121110 | 3300009148 | Bacteria | 796 |
| 238 | Ga0105243_11372652 | 3300009148 | Bacteria | 726 |
| 239 | Ga0105243_11716263 | 3300009148 | Bacteria | 657 |
| 240 | Ga0105243_11874069 | 3300009148 | Bacteria | 632 |
| 241 | Ga0105243_12640293 | 3300009148 | Bacteria | 542 |
| 242 | Ga0105241_10173482 | 3300009174 | Bacteria | 1783 |
| 243 | Ga0105241_10918119 | 3300009174 | Bacteria | 814 |
| 244 | Ga0105241_11059685 | 3300009174 | Bacteria | 761 |
| 245 | Ga0105241_12288879 | 3300009174 | Bacteria | 537 |
| 246 | Ga0105242_10291632 | 3300009176 | Bacteria | 1486 |
| 247 | Ga0105248_10184583 | 3300009177 | Bacteria | 2350 |
| 248 | Ga0105248_11036153 | 3300009177 | Bacteria | 927 |
| 249 | Ga0105248_11617383 | 3300009177 | Bacteria | 734 |
| 250 | Ga0105248_11934715 | 3300009177 | Bacteria | 669 |
| 251 | Ga0105248_11953603 | 3300009177 | Bacteria | 666 |
| 252 | Ga0105237_10052970 | 3300009545 | Bacteria | 4071 |
| 253 | Ga0105237_10055134 | 3300009545 | Bacteria | 3982 |
| 254 | Ga0105237_10115363 | 3300009545 | Bacteria | 2679 |
| 255 | Ga0105237_10380433 | 3300009545 | Bacteria | 1416 |
| 256 | Ga0105237_11676315 | 3300009545 | Bacteria | 643 |
| 257 | Ga0105237_11734707 | 3300009545 | Bacteria | 632 |
| 258 | Ga0105238_10096450 | 3300009551 | Bacteria | 2943 |
| 259 | Ga0105238_11991246 | 3300009551 | Bacteria | 614 |
| 260 | Ga0105249_10350366 | 3300009553 | Bacteria | 1496 |
| 261 | Ga0105249_10990339 | 3300009553 | Bacteria | 909 |
| 262 | Ga0105249_11143085 | 3300009553 | Bacteria | 849 |
| 263 | Ga0105249_11851787 | 3300009553 | Bacteria | 676 |
| 264 | Ga0099796_10022044 | 3300010159 | Bacteria | 1971 |
| 265 | Ga0099796_10067417 | 3300010159 | Bacteria | 1283 |
| 266 | Ga0099796_10255364 | 3300010159 | Bacteria | 729 |
| 267 | Ga0105239_10019285 | 3300010375 | Bacteria | 7532 |
| 268 | Ga0105239_10271510 | 3300010375 | Bacteria | 1907 |
| 269 | Ga0105239_10527690 | 3300010375 | Bacteria | 1343 |
| 270 | Ga0105239_10715804 | 3300010375 | Bacteria | 1145 |
| 271 | Ga0105239_11314257 | 3300010375 | Bacteria | 834 |
| 272 | Ga0105239_11528042 | 3300010375 | Bacteria | 772 |
| 273 | Ga0105239_11724026 | 3300010375 | Bacteria | 725 |
| 274 | Ga0105239_12171892 | 3300010375 | Bacteria | 645 |
| 275 | Ga0105239_13250119 | 3300010375 | Bacteria | 529 |
| 276 | Ga0105246_10045131 | 3300011119 | Bacteria | 2999 |
| 277 | Ga0105246_10790338 | 3300011119 | Bacteria | 841 |
| 278 | Ga0105246_11405721 | 3300011119 | Bacteria | 651 |
| 279 | Ga0105246_11633627 | 3300011119 | Bacteria | 610 |
| 280 | Ga0157370_11749053 | 3300013104 | Bacteria | 558 |
| 281 | Ga0157369_10087077 | 3300013105 | Bacteria | 3335 |
| 282 | Ga0157369_10922613 | 3300013105 | Bacteria | 895 |
| 283 | Ga0157374_10624053 | 3300013296 | Bacteria | 1089 |
| 284 | Ga0157374_10999916 | 3300013296 | Bacteria | 855 |
| 285 | Ga0157378_10023539 | 3300013297 | Bacteria | 5418 |
| 286 | Ga0157378_10551974 | 3300013297 | Bacteria | 1157 |
| 287 | Ga0163162_10101682 | 3300013306 | Bacteria | 2967 |
| 288 | Ga0163162_10456872 | 3300013306 | Bacteria | 1409 |
| 289 | Ga0163162_10760946 | 3300013306 | Bacteria | 1087 |
| 290 | Ga0163162_10886257 | 3300013306 | Bacteria | 1006 |
| 291 | Ga0163162_11106090 | 3300013306 | Bacteria | 898 |
| 292 | Ga0163162_11619985 | 3300013306 | Bacteria | 738 |
| 293 | Ga0157372_10147969 | 3300013307 | Bacteria | 2709 |
| 294 | Ga0157375_10415757 | 3300013308 | Bacteria | 1511 |
| 295 | Ga0163163_10171873 | 3300014325 | Bacteria | 2214 |
| 296 | Ga0163163_10179618 | 3300014325 | Bacteria | 2163 |
| 297 | Ga0163163_10417607 | 3300014325 | Bacteria | 1400 |
| 298 | Ga0163163_11592400 | 3300014325 | Bacteria | 714 |
| 299 | Ga0157380_11622522 | 3300014326 | Bacteria | 703 |
| 300 | Ga0182008_10367720 | 3300014497 | Bacteria | 766 |
| 301 | Ga0157379_10075681 | 3300014968 | Bacteria | 3014 |
| 302 | Ga0157379_10946410 | 3300014968 | Bacteria | 819 |
| 303 | Ga0157376_10901405 | 3300014969 | Bacteria | 902 |
| 304 | Ga0182005_1148057 | 3300015265 | Bacteria | 682 |
| 305 | Ga0163161_10401870 | 3300017792 | Bacteria | 1099 |
| 306 | Ga0163161_10546167 | 3300017792 | Bacteria | 949 |
| 307 | Ga0163161_12041113 | 3300017792 | Bacteria | 510 |
| 308 | Ga0206356_11101795 | 3300020070 | Bacteria | 711 |
| 309 | Ga0206350_11568595 | 3300020080 | Bacteria | 794 |
| 310 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 311 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 312 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 313 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 314 | Ga0213873_10007009 | 3300021358 | Bacteria | 2241 |
| 315 | Ga0213876_10001785 | 3300021384 | Bacteria | 13035 |
| 316 | Ga0213876_10271545 | 3300021384 | Bacteria | 901 |
| 317 | Ga0213876_10793367 | 3300021384 | Bacteria | 504 |
| 318 | Ga0224575_103461 | 3300023224 | Bacteria | 855 |
| 319 | Ga0228598_1021839 | 3300024227 | Bacteria | 1260 |
| 320 | Ga0209563_100662 | 3300025230 | Bacteria | 10988 |
| 321 | Ga0209677_102831 | 3300025253 | Bacteria | 6134 |
| 322 | Ga0209148_1001000 | 3300025254 | Bacteria | 18034 |
| 323 | Ga0209455_1014091 | 3300025272 | Bacteria | 1825 |
| 324 | Ga0209455_1052029 | 3300025272 | Bacteria | 569 |
| 325 | Ga0209673_1057707 | 3300025273 | Bacteria | 987 |
| 326 | Ga0209564_1002110 | 3300025295 | Bacteria | 16929 |
| 327 | Ga0209564_1074784 | 3300025295 | Bacteria | 687 |
| 328 | Ga0209758_1000206 | 3300025297 | Bacteria | 130177 |
| 329 | Ga0209758_1001109 | 3300025297 | Bacteria | 34763 |
| 330 | Ga0209758_1001267 | 3300025297 | Bacteria | 31294 |
| 331 | Ga0209758_1001347 | 3300025297 | Bacteria | 29637 |
| 332 | Ga0209758_1003015 | 3300025297 | Bacteria | 16099 |
| 333 | Ga0209758_1046625 | 3300025297 | Bacteria | 1560 |
| 334 | Ga0209758_1051293 | 3300025297 | Bacteria | 1437 |
| 335 | Ga0209758_1066050 | 3300025297 | Bacteria | 1164 |
| 336 | Ga0209256_1009375 | 3300025299 | Bacteria | 4306 |
| 337 | Ga0209256_1025126 | 3300025299 | Bacteria | 1741 |
| 338 | Ga0209256_1040740 | 3300025299 | Bacteria | 1184 |
| 339 | Ga0209256_1092325 | 3300025299 | Bacteria | 641 |
| 340 | Ga0207426_1000799 | 3300025302 | Bacteria | 34123 |
| 341 | Ga0207426_1001011 | 3300025302 | Bacteria | 27245 |
| 342 | Ga0207426_1016058 | 3300025302 | Bacteria | 2699 |
| 343 | Ga0207426_1062557 | 3300025302 | Bacteria | 1065 |
| 344 | Ga0209051_1057036 | 3300025303 | Bacteria | 1254 |
| 345 | Ga0209257_1000394 | 3300025304 | Bacteria | 86654 |
| 346 | Ga0209257_1073716 | 3300025304 | Bacteria | 893 |
| 347 | Ga0207697_10040925 | 3300025315 | Bacteria | 1903 |
| 348 | Ga0207697_10516397 | 3300025315 | Bacteria | 527 |
| 349 | Ga0207656_10144332 | 3300025321 | Bacteria | 1124 |
| 350 | Ga0207692_10000229 | 3300025898 | Bacteria | 19004 |
| 351 | Ga0207692_10017900 | 3300025898 | Bacteria | 3170 |
| 352 | Ga0207692_10022882 | 3300025898 | Bacteria | 2882 |
| 353 | Ga0207642_10488223 | 3300025899 | Bacteria | 752 |
| 354 | Ga0207642_11101092 | 3300025899 | Bacteria | 514 |
| 355 | Ga0207710_10270099 | 3300025900 | Bacteria | 854 |
| 356 | Ga0207688_10080948 | 3300025901 | Bacteria | 1854 |
| 357 | Ga0207688_10085817 | 3300025901 | Bacteria | 1803 |
| 358 | Ga0207680_10332906 | 3300025903 | Bacteria | 1064 |
| 359 | Ga0207647_10000666 | 3300025904 | Bacteria | 26819 |
| 360 | Ga0207647_10030786 | 3300025904 | Bacteria | 3459 |
| 361 | Ga0207647_10436727 | 3300025904 | Bacteria | 735 |
| 362 | Ga0207647_10646773 | 3300025904 | Bacteria | 580 |
| 363 | Ga0207685_10383428 | 3300025905 | Bacteria | 717 |
| 364 | Ga0207699_10000242 | 3300025906 | Bacteria | 30591 |
| 365 | Ga0207699_10028744 | 3300025906 | Bacteria | 3093 |
| 366 | Ga0207699_10992302 | 3300025906 | Bacteria | 621 |
| 367 | Ga0207645_10286533 | 3300025907 | Bacteria | 1095 |
| 368 | Ga0207643_10139004 | 3300025908 | Bacteria | 1450 |
| 369 | Ga0207705_10326558 | 3300025909 | Bacteria | 1179 |
| 370 | Ga0207654_10096744 | 3300025911 | Bacteria | 1811 |
| 371 | Ga0207654_10431646 | 3300025911 | Bacteria | 921 |
| 372 | Ga0207707_10045519 | 3300025912 | Bacteria | 3823 |
| 373 | Ga0207707_10096707 | 3300025912 | Bacteria | 2580 |
| 374 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 375 | Ga0207695_11047133 | 3300025913 | Bacteria | 696 |
| 376 | Ga0207671_10031050 | 3300025914 | Bacteria | 3983 |
| 377 | Ga0207671_10072946 | 3300025914 | Bacteria | 2563 |
| 378 | Ga0207671_10317470 | 3300025914 | Bacteria | 1233 |
| 379 | Ga0207671_10424265 | 3300025914 | Bacteria | 1058 |
| 380 | Ga0207671_10855664 | 3300025914 | Bacteria | 720 |
| 381 | Ga0207671_11073666 | 3300025914 | Bacteria | 633 |
| 382 | Ga0207693_10019358 | 3300025915 | Bacteria | 5415 |
| 383 | Ga0207693_10030703 | 3300025915 | Bacteria | 4245 |
| 384 | Ga0207693_10078755 | 3300025915 | Bacteria | 2579 |
| 385 | Ga0207693_10145064 | 3300025915 | Bacteria | 1867 |
| 386 | Ga0207693_10558348 | 3300025915 | Bacteria | 893 |
| 387 | Ga0207663_10010554 | 3300025916 | Bacteria | 4923 |
| 388 | Ga0207663_10020883 | 3300025916 | Bacteria | 3717 |
| 389 | Ga0207663_10028190 | 3300025916 | Bacteria | 3284 |
| 390 | Ga0207663_10050487 | 3300025916 | Bacteria | 2585 |
| 391 | Ga0207663_10489033 | 3300025916 | Bacteria | 954 |
| 392 | Ga0207660_10064743 | 3300025917 | Bacteria | 2639 |
| 393 | Ga0207660_10097345 | 3300025917 | Bacteria | 2192 |
| 394 | Ga0207660_11211818 | 3300025917 | Bacteria | 614 |
| 395 | Ga0207657_10304852 | 3300025919 | Bacteria | 1261 |
| 396 | Ga0207657_10463605 | 3300025919 | Bacteria | 994 |
| 397 | Ga0207649_10669358 | 3300025920 | Bacteria | 803 |
| 398 | Ga0207649_10994823 | 3300025920 | Bacteria | 660 |
| 399 | Ga0207649_11044015 | 3300025920 | Bacteria | 644 |
| 400 | Ga0207652_10302653 | 3300025921 | Bacteria | 1443 |
| 401 | Ga0207652_11387261 | 3300025921 | Bacteria | 606 |
| 402 | Ga0207681_10279959 | 3300025923 | Bacteria | 1313 |
| 403 | Ga0207681_10700305 | 3300025923 | Bacteria | 842 |
| 404 | Ga0207694_10026352 | 3300025924 | Bacteria | 4422 |
| 405 | Ga0207694_10581024 | 3300025924 | Bacteria | 942 |
| 406 | Ga0207650_10155963 | 3300025925 | Bacteria | 1805 |
| 407 | Ga0207659_11001280 | 3300025926 | Bacteria | 719 |
| 408 | Ga0207687_10015530 | 3300025927 | Bacteria | 4994 |
| 409 | Ga0207687_10374910 | 3300025927 | Bacteria | 1164 |
| 410 | Ga0207687_11184652 | 3300025927 | Bacteria | 656 |
| 411 | Ga0207700_10024263 | 3300025928 | Bacteria | 4195 |
| 412 | Ga0207700_10090867 | 3300025928 | Bacteria | 2411 |
| 413 | Ga0207700_10785940 | 3300025928 | Bacteria | 851 |
| 414 | Ga0207700_11916042 | 3300025928 | Bacteria | 519 |
| 415 | Ga0207664_10347792 | 3300025929 | Bacteria | 1312 |
| 416 | Ga0207664_10440266 | 3300025929 | Bacteria | 1162 |
| 417 | Ga0207664_10523687 | 3300025929 | Bacteria | 1062 |
| 418 | Ga0207644_10084782 | 3300025931 | Bacteria | 2349 |
| 419 | Ga0207706_10024351 | 3300025933 | Bacteria | 5427 |
| 420 | Ga0207706_10166211 | 3300025933 | Bacteria | 1939 |
| 421 | Ga0207706_11253479 | 3300025933 | Bacteria | 614 |
| 422 | Ga0207686_10203590 | 3300025934 | Bacteria | 1419 |
| 423 | Ga0207709_10322478 | 3300025935 | Bacteria | 1157 |
| 424 | Ga0207709_11308508 | 3300025935 | Bacteria | 599 |
| 425 | Ga0207709_11651221 | 3300025935 | Bacteria | 532 |
| 426 | Ga0207669_10567335 | 3300025937 | Bacteria | 918 |
| 427 | Ga0207669_11111475 | 3300025937 | Bacteria | 667 |
| 428 | Ga0207704_10488886 | 3300025938 | Bacteria | 990 |
| 429 | Ga0207704_11016289 | 3300025938 | Bacteria | 702 |
| 430 | Ga0207665_10009934 | 3300025939 | Bacteria | 6245 |
| 431 | Ga0207665_10029272 | 3300025939 | Bacteria | 3641 |
| 432 | Ga0207665_10198073 | 3300025939 | Bacteria | 1462 |
| 433 | Ga0207691_10041304 | 3300025940 | Bacteria | 4259 |
| 434 | Ga0207711_10107052 | 3300025941 | Bacteria | 2482 |
| 435 | Ga0207711_10471297 | 3300025941 | Bacteria | 1169 |
| 436 | Ga0207711_10964760 | 3300025941 | Bacteria | 791 |
| 437 | Ga0207689_10199543 | 3300025942 | Bacteria | 1651 |
| 438 | Ga0207689_10297792 | 3300025942 | Bacteria | 1337 |
| 439 | Ga0207679_10373457 | 3300025945 | Bacteria | 1248 |
| 440 | Ga0207679_10952536 | 3300025945 | Bacteria | 786 |
| 441 | Ga0207679_12062900 | 3300025945 | Bacteria | 518 |
| 442 | Ga0207667_10020145 | 3300025949 | Bacteria | 7426 |
| 443 | Ga0207667_10026155 | 3300025949 | Bacteria | 6380 |
| 444 | Ga0207667_10553523 | 3300025949 | Bacteria | 1163 |
| 445 | Ga0207667_10893107 | 3300025949 | Bacteria | 881 |
| 446 | Ga0207667_11363590 | 3300025949 | Bacteria | 684 |
| 447 | Ga0207651_11179231 | 3300025960 | Bacteria | 687 |
| 448 | Ga0207712_10537328 | 3300025961 | Bacteria | 1004 |
| 449 | Ga0207712_11740821 | 3300025961 | Bacteria | 559 |
| 450 | Ga0207668_10044853 | 3300025972 | Bacteria | 3011 |
| 451 | Ga0207668_10098525 | 3300025972 | Bacteria | 2166 |
| 452 | Ga0207640_10003411 | 3300025981 | Bacteria | 8553 |
| 453 | Ga0207640_10314746 | 3300025981 | Bacteria | 1244 |
| 454 | Ga0207640_10768331 | 3300025981 | Bacteria | 832 |
| 455 | Ga0207640_10785565 | 3300025981 | Bacteria | 824 |
| 456 | Ga0207640_12178109 | 3300025981 | Bacteria | 503 |
| 457 | Ga0207658_10484606 | 3300025986 | Bacteria | 1099 |
| 458 | Ga0207677_10105238 | 3300026023 | Bacteria | 2087 |
| 459 | Ga0207677_10200525 | 3300026023 | Bacteria | 1586 |
| 460 | Ga0207677_11183897 | 3300026023 | Bacteria | 699 |
| 461 | Ga0207703_10167720 | 3300026035 | Bacteria | 1928 |
| 462 | Ga0207703_10635946 | 3300026035 | Bacteria | 1011 |
| 463 | Ga0207703_11293637 | 3300026035 | Bacteria | 701 |
| 464 | Ga0207639_10007946 | 3300026041 | Bacteria | 7248 |
| 465 | Ga0207639_10634740 | 3300026041 | Bacteria | 987 |
| 466 | Ga0207639_11671874 | 3300026041 | Bacteria | 597 |
| 467 | Ga0207678_10072189 | 3300026067 | Bacteria | 2958 |
| 468 | Ga0207678_10139159 | 3300026067 | Bacteria | 2071 |
| 469 | Ga0207678_10189576 | 3300026067 | Bacteria | 1757 |
| 470 | Ga0207678_10261273 | 3300026067 | Bacteria | 1484 |
| 471 | Ga0207678_10370810 | 3300026067 | Bacteria | 1236 |
| 472 | Ga0207678_10519886 | 3300026067 | Bacteria | 1039 |
| 473 | Ga0207678_11982649 | 3300026067 | Bacteria | 507 |
| 474 | Ga0207702_10094732 | 3300026078 | Bacteria | 2621 |
| 475 | Ga0207702_10215699 | 3300026078 | Bacteria | 1786 |
| 476 | Ga0207702_10694345 | 3300026078 | Bacteria | 1003 |
| 477 | Ga0207702_10882907 | 3300026078 | Bacteria | 886 |
| 478 | Ga0207641_10189800 | 3300026088 | Bacteria | 1888 |
| 479 | Ga0207648_10310066 | 3300026089 | Bacteria | 1416 |
| 480 | Ga0207648_10480900 | 3300026089 | Bacteria | 1134 |
| 481 | Ga0207648_11012023 | 3300026089 | Bacteria | 778 |
| 482 | Ga0207676_11060082 | 3300026095 | Bacteria | 800 |
| 483 | Ga0207674_10151209 | 3300026116 | Bacteria | 2279 |
| 484 | Ga0207674_10536929 | 3300026116 | Bacteria | 1130 |
| 485 | Ga0207675_100319399 | 3300026118 | Bacteria | 1516 |
| 486 | Ga0207683_10239285 | 3300026121 | Bacteria | 1656 |
| 487 | Ga0207683_10258732 | 3300026121 | Bacteria | 1589 |
| 488 | Ga0207683_11287893 | 3300026121 | Bacteria | 677 |
| 489 | Ga0207698_10009622 | 3300026142 | Bacteria | 6172 |
| 490 | Ga0207698_10117597 | 3300026142 | Bacteria | 2243 |
| 491 | Ga0207698_10194042 | 3300026142 | Bacteria | 1812 |
| 492 | Ga0207698_10678094 | 3300026142 | Bacteria | 1024 |
| 493 | Ga0207698_11643708 | 3300026142 | Bacteria | 658 |
| 494 | Ga0207698_12268144 | 3300026142 | Bacteria | 555 |
| 495 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 496 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 497 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 498 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 499 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 500 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 501 | Ga0209179_1141654 | 3300027512 | Bacteria | 537 |
| 502 | Ga0209813_10002337 | 3300027866 | Bacteria | 4347 |
| 503 | Ga0209813_10208643 | 3300027866 | Bacteria | 726 |
| 504 | Ga0268266_10107532 | 3300028379 | Bacteria | 2467 |
| 505 | Ga0268266_10150605 | 3300028379 | Bacteria | 2096 |
| 506 | Ga0268266_10202279 | 3300028379 | Bacteria | 1818 |
| 507 | Ga0268266_10500186 | 3300028379 | Bacteria | 1160 |
| 508 | Ga0268265_10040061 | 3300028380 | Bacteria | 3457 |
| 509 | Ga0268265_10285384 | 3300028380 | Bacteria | 1479 |
| 510 | Ga0268264_11432346 | 3300028381 | Bacteria | 701 |
| 511 | Ga0307517_10188478 | 3300028786 | Bacteria | 1315 |
| 512 | Ga0265330_10052981 | 3300031235 | Bacteria | 1776 |
| 513 | Ga0265330_10062358 | 3300031235 | Bacteria | 1621 |
| 514 | Ga0265330_10064703 | 3300031235 | Bacteria | 1588 |
| 515 | Ga0265332_10064212 | 3300031238 | Bacteria | 1568 |
| 516 | Ga0265328_10037603 | 3300031239 | Bacteria | 1787 |
| 517 | Ga0265328_10054793 | 3300031239 | Bacteria | 1464 |
| 518 | Ga0265325_10016362 | 3300031241 | Bacteria | 4148 |
| 519 | Ga0265340_10011726 | 3300031247 | Bacteria | 4650 |
| 520 | Ga0265340_10517798 | 3300031247 | Bacteria | 525 |
| 521 | Ga0265339_10091647 | 3300031249 | Bacteria | 1592 |
| 522 | Ga0265339_10125098 | 3300031249 | Bacteria | 1318 |
| 523 | Ga0265339_10141105 | 3300031249 | Bacteria | 1226 |
| 524 | Ga0265339_10234071 | 3300031249 | Bacteria | 894 |
| 525 | Ga0265331_10139281 | 3300031250 | Bacteria | 1104 |
| 526 | Ga0265331_10145463 | 3300031250 | Bacteria | 1077 |
| 527 | Ga0265331_10259707 | 3300031250 | Bacteria | 779 |
| 528 | Ga0265331_10337385 | 3300031250 | Bacteria | 675 |
| 529 | Ga0265316_10354726 | 3300031344 | Bacteria | 1061 |
| 530 | Ga0265316_10387372 | 3300031344 | Bacteria | 1008 |
| 531 | Ga0265316_10448345 | 3300031344 | Bacteria | 925 |
| 532 | Ga0265316_10471349 | 3300031344 | Bacteria | 899 |
| 533 | Ga0307509_10139692 | 3300031507 | Bacteria | 2361 |
| 534 | Ga0265313_10080822 | 3300031595 | Bacteria | 1477 |
| 535 | Ga0307508_10352242 | 3300031616 | Bacteria | 1064 |
| 536 | Ga0307508_10724455 | 3300031616 | Bacteria | 606 |
| 537 | Ga0265314_10010709 | 3300031711 | Bacteria | 7631 |
| 538 | Ga0265342_10004756 | 3300031712 | Bacteria | 10556 |
| 539 | Ga0265342_10124830 | 3300031712 | Bacteria | 1446 |
| 540 | Ga0307516_10578230 | 3300031730 | Bacteria | 777 |
| 541 | Ga0307405_10694911 | 3300031731 | Bacteria | 842 |
| 542 | Ga0307405_11905850 | 3300031731 | Bacteria | 530 |
| 543 | Ga0307413_11719328 | 3300031824 | Bacteria | 560 |
| 544 | Ga0307406_12058479 | 3300031901 | Bacteria | 511 |
| 545 | Ga0307416_101588531 | 3300032002 | Bacteria | 759 |
| 546 | Ga0307414_10966732 | 3300032004 | Bacteria | 783 |
| 547 | Ga0307414_11118879 | 3300032004 | Bacteria | 728 |
| 548 | Ga0307415_100186945 | 3300032126 | Bacteria | 1631 |
| 549 | Ga0307415_101108416 | 3300032126 | Bacteria | 741 |
| 550 | Ga0307415_101744653 | 3300032126 | Bacteria | 601 |
| 551 | Ga0307507_10335433 | 3300033179 | Bacteria | 900 |
| 552 | Ga0307510_10029008 | 3300033180 | Bacteria | 6305 |
| 553 | Ga0307510_10543663 | 3300033180 | Bacteria | 607 |
| 554 | Ga0373944_0027117 | 3300035089 | Bacteria | 1697 |
| 555 | Ga0373923_0039597 | 3300035111 | Bacteria | 1936 |
| 556 | Ga0373936_0013718 | 3300035113 | Bacteria | 3092 |
| 557 | Ga0373936_0027229 | 3300035113 | Bacteria | 2242 |
| 558 | Ga0373939_0140823 | 3300035114 | Bacteria | 870 |
| 559 | Ga0373941_0265208 | 3300035115 | Bacteria | 675 |
| 560 | Ga0373945_0001999 | 3300035116 | Bacteria | 6335 |
| 561 | Ga0373954_0242302 | 3300035118 | Bacteria | 887 |
| 562 | Ga0373943_0012127 | 3300035170 | Bacteria | 3882 |
| 563 | Ga0373955_0010034 | 3300035172 | Bacteria | 4458 |
| 564 | Ga0373962_0129060 | 3300035242 | Bacteria | 812 |
| 565 | Ga0373931_0238478 | 3300035691 | Bacteria | 1101 |
| 566 | Ga0373931_0530921 | 3300035691 | Bacteria | 762 |
| 567 | Ga0373935_0000800 | 3300035692 | Bacteria | 16796 |
| 568 | Ga0373935_0614187 | 3300035692 | Bacteria | 796 |
| 569 | Ga0373927_0000666 | 3300035695 | Bacteria | 26107 |
| 570 | Ga0373933_0566854 | 3300035724 | Bacteria | 745 |
| 571 | Ga0373937_0015543 | 3300036401 | Bacteria | 6735 |
| 572 | Ga0373937_0062254 | 3300036401 | Bacteria | 3430 |
| 573 | Ga0373937_1173716 | 3300036401 | Bacteria | 716 |
| 574 | Ga0373925_0008568 | 3300037068 | Bacteria | 7453 |
| 575 | Ga0373925_1375616 | 3300037068 | Bacteria | 578 |
| 576 | Ga0395900_0001340 | 3300037418 | Bacteria | 29756 |
| 577 | Ga0395900_1182787 | 3300037418 | Bacteria | 680 |
| 578 | Ga0395898_0005324 | 3300037466 | Bacteria | 13909 |
| 579 | Ga0395898_1445006 | 3300037466 | Bacteria | 615 |
| 580 | Ga0395905_0006516 | 3300037471 | Bacteria | 11740 |
| 581 | Ga0395905_0323135 | 3300037471 | Bacteria | 1433 |
| 582 | Ga0395905_0837332 | 3300037471 | Bacteria | 823 |
| 583 | Ga0395905_1133897 | 3300037471 | Bacteria | 685 |
| 584 | Ga0395905_1377442 | 3300037471 | Bacteria | 609 |
| 585 | Ga0395901_0007542 | 3300038443 | Bacteria | 10989 |
| 586 | Ga0395901_0289239 | 3300038443 | Bacteria | 1701 |
| 587 | Ga0395901_1373431 | 3300038443 | Bacteria | 666 |
| 588 | Ga0436365_0165598 | 3300039437 | Bacteria | 761 |
| 589 | Ga0436365_0657145 | 3300039437 | Bacteria | 1328 |
| 590 | Ga0436365_0801580 | 3300039437 | Bacteria | 1759 |
| 591 | Ga0436365_1544802 | 3300039437 | Bacteria | 6693 |
| 592 | Ga0436365_1727831 | 3300039437 | Bacteria | 813 |
| 593 | Ga0436360_1050844 | 3300039438 | Bacteria | 581 |
| 594 | Ga0436363_0139435 | 3300039450 | Bacteria | 2067 |
| 595 | Ga0436363_0465325 | 3300039450 | Bacteria | 1029 |
| 596 | Ga0436363_0783763 | 3300039450 | Unclassified | 566 |
| 597 | Ga0436362_1167635 | 3300039453 | Bacteria | 539 |
| 598 | Ga0436362_1295510 | 3300039453 | Bacteria | 3402 |
| 599 | Ga0451791_1866899 | 3300041451 | Bacteria | 1104 |
| 600 | Ga0451793_0234425 | 3300041452 | Bacteria | 530 |
| 601 | Ga0451797_0114101 | 3300041453 | Bacteria | 653 |
| 602 | Ga0451795_0118586 | 3300041456 | Bacteria | 967 |
| 603 | Ga0451802_2074404 | 3300041460 | Bacteria | 882 |
| 604 | Ga0451807_0956237 | 3300041486 | Bacteria | 830 |
| 605 | Ga0451807_2333451 | 3300041486 | Bacteria | 662 |
| 606 | Ga0451835_0181475 | 3300041492 | Bacteria | 812 |
| 607 | Ga0451845_0824977 | 3300041501 | Bacteria | 947 |
| 608 | Ga0451849_0844733 | 3300041505 | Bacteria | 548 |
| 609 | Ga0451843_1376612 | 3300041509 | Bacteria | 703 |
| 610 | Ga0451855_0055418 | 3300041511 | Bacteria | 765 |
| 611 | Ga0451853_1565872 | 3300041512 | Bacteria | 1121 |
| 612 | Ga0451853_3946027 | 3300041512 | Bacteria | 716 |
| 613 | Ga0439459_0025420 | 3300042438 | Bacteria | 1169 |
| 614 | Ga0466969_0149159 | 3300044656 | Bacteria | 1078 |
| 615 | Ga0466972_0088356 | 3300044658 | Bacteria | 1471 |
| 616 | Ga0466965_0700870 | 3300044683 | Bacteria | 581 |
| 617 | Ga0466966_0013642 | 3300044684 | Bacteria | 5376 |
| 618 | Ga0466966_0249136 | 3300044684 | Bacteria | 1070 |
| 619 | Ga0466961_0000558 | 3300044693 | Bacteria | 23735 |
| 620 | Ga0466963_0125044 | 3300044694 | Bacteria | 1772 |
| 621 | Ga0466971_0062059 | 3300044719 | Bacteria | 1691 |
| 622 | Ga0466971_0412983 | 3300044719 | Bacteria | 659 |
| 623 | Ga0466968_0573845 | 3300044735 | Bacteria | 568 |
| 624 | Ga0466960_0086941 | 3300044901 | Bacteria | 1586 |
| 625 | Ga0466960_0088135 | 3300044901 | Bacteria | 1577 |
| 626 | Ga0466959_0150201 | 3300045049 | Bacteria | 1642 |
| 627 | Ga0466959_0293594 | 3300045049 | Bacteria | 1114 |
| 628 | Ga0466967_0397288 | 3300045976 | Bacteria | 1341 |
| 629 | Ga0495617_218053 | 3300046452 | Bacteria | 593 |
| 630 | Ga0495592_0024886 | 3300046454 | Bacteria | 4549 |
| 631 | Ga0495592_0768892 | 3300046454 | Bacteria | 574 |
| 632 | Ga0495603_0000206 | 3300046455 | Bacteria | 30433 |
| 633 | Ga0495603_0105026 | 3300046455 | Bacteria | 1648 |
| 634 | Ga0495590_0136332 | 3300046457 | Bacteria | 884 |
| 635 | Ga0495629_0000338 | 3300046459 | Bacteria | 40007 |
| 636 | Ga0495629_0002176 | 3300046459 | Bacteria | 15139 |
| 637 | Ga0495638_0003637 | 3300046460 | Bacteria | 12027 |
| 638 | Ga0495641_0005602 | 3300046461 | Bacteria | 8407 |
| 639 | Ga0495651_0044341 | 3300046462 | Bacteria | 3448 |
| 640 | Ga0495651_0155119 | 3300046462 | Bacteria | 1646 |
| 641 | Ga0495651_0397649 | 3300046462 | Bacteria | 900 |
| 642 | Ga0495653_0112657 | 3300046463 | Bacteria | 1952 |
| 643 | Ga0495580_0003372 | 3300046472 | Bacteria | 13653 |
| 644 | Ga0495582_0000423 | 3300046473 | Bacteria | 23085 |
| 645 | Ga0495582_0220606 | 3300046473 | Bacteria | 1085 |
| 646 | Ga0495605_0077839 | 3300046474 | Bacteria | 1555 |
| 647 | Ga0495605_0192928 | 3300046474 | Bacteria | 890 |
| 648 | Ga0495639_0000039 | 3300046475 | Bacteria | 57380 |
| 649 | Ga0495639_0330787 | 3300046475 | Bacteria | 763 |
| 650 | Ga0495639_0606631 | 3300046475 | Bacteria | 563 |
| 651 | Ga0495662_0004133 | 3300046476 | Bacteria | 7314 |
| 652 | Ga0495664_0000847 | 3300046477 | Bacteria | 15732 |
| 653 | Ga0495664_0111135 | 3300046477 | Bacteria | 1654 |
| 654 | Ga0495584_0283649 | 3300046491 | Bacteria | 841 |
| 655 | Ga0495584_0488166 | 3300046491 | Bacteria | 627 |
| 656 | Ga0495594_0006206 | 3300046499 | Bacteria | 6145 |
| 657 | Ga0495594_0503997 | 3300046499 | Bacteria | 687 |
| 658 | Ga0495596_0197978 | 3300046500 | Bacteria | 781 |
| 659 | Ga0495596_0374919 | 3300046500 | Bacteria | 554 |
| 660 | Ga0495607_0249394 | 3300046501 | Bacteria | 855 |
| 661 | Ga0495583_0138794 | 3300046506 | Bacteria | 1013 |
| 662 | Ga0495606_0005948 | 3300046507 | Bacteria | 11450 |
| 663 | Ga0495606_0105646 | 3300046507 | Bacteria | 1706 |
| 664 | Ga0495606_0123928 | 3300046507 | Bacteria | 1543 |
| 665 | Ga0495608_0332238 | 3300046511 | Bacteria | 937 |
| 666 | Ga0495610_0043333 | 3300046512 | Bacteria | 2243 |
| 667 | Ga0495610_0342266 | 3300046512 | Bacteria | 565 |
| 668 | Ga0495616_0038082 | 3300046513 | Bacteria | 2471 |
| 669 | Ga0495616_0132259 | 3300046513 | Bacteria | 1142 |
| 670 | Ga0495618_0081765 | 3300046514 | Bacteria | 2063 |
| 671 | Ga0495618_0114807 | 3300046514 | Bacteria | 1724 |
| 672 | Ga0495620_0022772 | 3300046515 | Bacteria | 3010 |
| 673 | Ga0495620_0110632 | 3300046515 | Bacteria | 1089 |
| 674 | Ga0495620_0216518 | 3300046515 | Bacteria | 734 |
| 675 | Ga0495628_0020083 | 3300046516 | Bacteria | 5514 |
| 676 | Ga0495628_0321728 | 3300046516 | Bacteria | 1141 |
| 677 | Ga0495630_0002808 | 3300046517 | Bacteria | 12078 |
| 678 | Ga0495631_0198376 | 3300046518 | Bacteria | 858 |
| 679 | Ga0495631_0313464 | 3300046518 | Bacteria | 667 |
| 680 | Ga0495632_0150242 | 3300046519 | Bacteria | 1077 |
| 681 | Ga0495632_0264694 | 3300046519 | Bacteria | 768 |
| 682 | Ga0495643_0123112 | 3300046522 | Bacteria | 1308 |
| 683 | Ga0495643_0248761 | 3300046522 | Bacteria | 830 |
| 684 | Ga0495643_0284270 | 3300046522 | Bacteria | 760 |
| 685 | Ga0495648_0018514 | 3300046524 | Bacteria | 4926 |
| 686 | Ga0495648_0077660 | 3300046524 | Bacteria | 1902 |
| 687 | Ga0495666_0028687 | 3300046526 | Bacteria | 2738 |
| 688 | Ga0495666_0392084 | 3300046526 | Bacteria | 624 |
| 689 | Ga0495652_0424179 | 3300046529 | Bacteria | 937 |
| 690 | Ga0495652_0975551 | 3300046529 | Bacteria | 555 |
| 691 | Ga0495654_0213818 | 3300046530 | Bacteria | 819 |
| 692 | Ga0495665_0316575 | 3300046531 | Bacteria | 797 |
| 693 | Ga0495640_0034933 | 3300046533 | Bacteria | 3560 |
| 694 | Ga0495640_0035609 | 3300046533 | Bacteria | 3522 |
| 695 | Ga0495609_0109965 | 3300046538 | Bacteria | 1190 |
| 696 | Ga0495597_0031555 | 3300046542 | Bacteria | 2410 |
| 697 | Ga0495597_0068663 | 3300046542 | Bacteria | 1531 |
| 698 | Ga0495622_0013395 | 3300046557 | Bacteria | 3803 |
| 699 | Ga0495622_0058693 | 3300046557 | Bacteria | 1782 |
| 700 | Ga0495667_0006278 | 3300046559 | Bacteria | 8060 |
| 701 | Ga0495668_0105757 | 3300046616 | Bacteria | 1539 |
| 702 | Ga0495634_0000776 | 3300046642 | Bacteria | 30917 |
| 703 | Ga0495634_0045232 | 3300046642 | Bacteria | 2977 |
| 704 | Ga0495634_0117832 | 3300046642 | Bacteria | 1703 |
| 705 | Ga0495611_0204822 | 3300046648 | Bacteria | 919 |
| 706 | Ga0495625_0130144 | 3300046660 | Bacteria | 1705 |
| 707 | Ga0495625_0344503 | 3300046660 | Bacteria | 943 |
| 708 | Ga0495635_0001246 | 3300046663 | Bacteria | 17055 |
| 709 | Ga0495635_0156040 | 3300046663 | Bacteria | 1553 |
| 710 | Ga0495588_0002998 | 3300046674 | Bacteria | 7298 |
| 711 | Ga0495588_0013921 | 3300046674 | Bacteria | 3841 |
| 712 | Ga0495657_0004548 | 3300046675 | Bacteria | 11084 |
| 713 | Ga0495657_0163833 | 3300046675 | Bacteria | 1374 |
| 714 | Ga0495657_0202761 | 3300046675 | Bacteria | 1208 |
| 715 | Ga0495657_0495180 | 3300046675 | Bacteria | 713 |
| 716 | Ga0495599_0314930 | 3300046678 | Bacteria | 943 |
| 717 | Ga0495623_0116717 | 3300046679 | Bacteria | 1612 |
| 718 | Ga0495623_0321274 | 3300046679 | Bacteria | 850 |
| 719 | Ga0495623_0338090 | 3300046679 | Bacteria | 823 |
| 720 | Ga0495646_0202724 | 3300046680 | Bacteria | 1080 |
| 721 | Ga0495646_0275801 | 3300046680 | Bacteria | 894 |
| 722 | Ga0495647_0001044 | 3300046681 | Bacteria | 8440 |
| 723 | Ga0495658_0000687 | 3300046683 | Bacteria | 18301 |
| 724 | Ga0495669_0234087 | 3300046684 | Bacteria | 881 |
| 725 | Ga0495613_0001857 | 3300046689 | Bacteria | 16088 |
| 726 | Ga0495613_0011844 | 3300046689 | Bacteria | 6481 |
| 727 | Ga0495624_0003908 | 3300046690 | Bacteria | 10982 |
| 728 | Ga0495649_0077025 | 3300046694 | Bacteria | 1785 |
| 729 | Ga0495649_0284591 | 3300046694 | Bacteria | 844 |
| 730 | Ga0495649_0593727 | 3300046694 | Bacteria | 546 |
| 731 | Ga0495589_0095970 | 3300046794 | Bacteria | 1438 |
| 732 | Ga0495600_0008582 | 3300046809 | Bacteria | 6284 |
| 733 | Ga0495600_0187212 | 3300046809 | Bacteria | 1332 |
| 734 | Ga0495600_0238802 | 3300046809 | Bacteria | 1158 |
| 735 | Ga0495600_0630139 | 3300046809 | Bacteria | 650 |
| 736 | Ga0495660_0156750 | 3300046810 | Bacteria | 1120 |
| 737 | Ga0495660_0284086 | 3300046810 | Bacteria | 756 |
| 738 | Ga0495581_0000006 | 3300047315 | Bacteria | 77433 |
| 739 | Ga0495581_0146908 | 3300047315 | Bacteria | 1376 |
| 740 | Ga0495604_0014161 | 3300047317 | Bacteria | 6357 |
| 741 | Ga0495674_0002636 | 3300047319 | Bacteria | 17455 |
| 742 | Ga0495672_0272711 | 3300047320 | Bacteria | 812 |
| 743 | Ga0495676_0045171 | 3300047321 | Bacteria | 3588 |
| 744 | Ga0495680_0074399 | 3300047322 | Bacteria | 2580 |
| 745 | Ga0495680_0278081 | 3300047322 | Bacteria | 1180 |
| 746 | Ga0495683_0045400 | 3300047323 | Bacteria | 2208 |
| 747 | Ga0495683_0199158 | 3300047323 | Bacteria | 904 |
| 748 | Ga0495687_075690 | 3300047443 | Bacteria | 1334 |
| 749 | Ga0495687_223117 | 3300047443 | Bacteria | 581 |
| 750 | Ga0495677_0316880 | 3300047445 | Bacteria | 614 |
| 751 | Ga0495673_0036359 | 3300047469 | Bacteria | 2260 |
| 752 | Ga0495684_0053162 | 3300047471 | Bacteria | 3090 |
| 753 | Ga0495684_0554012 | 3300047471 | Bacteria | 782 |
| 754 | Ga0495686_0318563 | 3300047472 | Bacteria | 853 |
| 755 | Ga0495686_0362894 | 3300047472 | Bacteria | 785 |
| 756 | Ga0495593_0000032 | 3300047673 | Bacteria | 58862 |
| 757 | Ga0495602_0138950 | 3300048088 | Bacteria | 1926 |
| 758 | Ga0495614_0031476 | 3300048089 | Bacteria | 2283 |
| 759 | Ga0495614_0343850 | 3300048089 | Bacteria | 694 |
| 760 | Ga0495626_0080213 | 3300048091 | Bacteria | 1451 |
| 761 | Ga0496100_0098042 | 3300048903 | Bacteria | 2014 |
| 762 | Ga0496100_0208245 | 3300048903 | Bacteria | 1429 |
| 763 | Ga0496100_0238632 | 3300048903 | Bacteria | 1340 |
| 764 | Ga0496100_0391004 | 3300048903 | Bacteria | 1057 |
| 765 | Ga0496100_0721687 | 3300048903 | Bacteria | 778 |
| 766 | Ga0496101_0031612 | 3300048904 | Bacteria | 3723 |
| 767 | Ga0496101_0035824 | 3300048904 | Bacteria | 3511 |
| 768 | Ga0496101_0146357 | 3300048904 | Bacteria | 1804 |
| 769 | Ga0496101_0350188 | 3300048904 | Bacteria | 1161 |
| 770 | Ga0496101_0357722 | 3300048904 | Bacteria | 1148 |
| 771 | Ga0496101_0404754 | 3300048904 | Bacteria | 1075 |
| 772 | Ga0496101_0536457 | 3300048904 | Bacteria | 925 |
| 773 | Ga0496101_0822489 | 3300048904 | Bacteria | 732 |
| 774 | Ga0496102_0006237 | 3300048905 | Bacteria | 10164 |
| 775 | Ga0496102_0156191 | 3300048905 | Bacteria | 2144 |
| 776 | Ga0496102_0277617 | 3300048905 | Bacteria | 1579 |
| 777 | Ga0496102_0849158 | 3300048905 | Bacteria | 835 |
| 778 | Ga0496103_0014126 | 3300048906 | Bacteria | 4740 |
| 779 | Ga0496103_0934490 | 3300048906 | Bacteria | 542 |
| 780 | Ga0496104_0024484 | 3300048907 | Bacteria | 5553 |
| 781 | Ga0496104_0047099 | 3300048907 | Bacteria | 4063 |
| 782 | Ga0496104_0283464 | 3300048907 | Bacteria | 1570 |
| 783 | Ga0496104_0354234 | 3300048907 | Bacteria | 1380 |
| 784 | Ga0496104_0390401 | 3300048907 | Bacteria | 1304 |
| 785 | Ga0496104_1130082 | 3300048907 | Bacteria | 687 |
| 786 | Ga0496105_0108566 | 3300048908 | Bacteria | 2291 |
| 787 | Ga0496105_0117313 | 3300048908 | Bacteria | 2195 |
| 788 | Ga0496105_0125438 | 3300048908 | Bacteria | 2116 |
| 789 | Ga0496105_1289912 | 3300048908 | Bacteria | 534 |
| 790 | Ga0496106_0056082 | 3300048909 | Bacteria | 2978 |
| 791 | Ga0496106_0081865 | 3300048909 | Bacteria | 2481 |
| 792 | Ga0496106_0175282 | 3300048909 | Bacteria | 1701 |
| 793 | Ga0496106_0580283 | 3300048909 | Bacteria | 899 |
| 794 | Ga0496106_0808172 | 3300048909 | Bacteria | 744 |
| 795 | Ga0496106_1509940 | 3300048909 | Bacteria | 517 |
| 796 | Ga0496107_0040809 | 3300048910 | Bacteria | 3332 |
| 797 | Ga0496107_0234497 | 3300048910 | Bacteria | 1365 |
| 798 | Ga0496107_0509866 | 3300048910 | Bacteria | 892 |
| 799 | Ga0496107_0833102 | 3300048910 | Bacteria | 674 |
| 800 | Ga0496108_0008957 | 3300048911 | Bacteria | 8110 |
| 801 | Ga0496108_0146647 | 3300048911 | Bacteria | 2035 |
| 802 | Ga0496108_0424225 | 3300048911 | Bacteria | 1162 |
| 803 | Ga0496108_0436706 | 3300048911 | Bacteria | 1143 |
| 804 | Ga0496109_0020552 | 3300048912 | Bacteria | 5831 |
| 805 | Ga0496109_0069711 | 3300048912 | Bacteria | 3225 |
| 806 | Ga0496109_0592670 | 3300048912 | Bacteria | 1044 |
| 807 | Ga0496109_0612735 | 3300048912 | Bacteria | 1025 |
| 808 | Ga0496110_0051284 | 3300048913 | Bacteria | 3625 |
| 809 | Ga0496110_0257806 | 3300048913 | Bacteria | 1587 |
| 810 | Ga0496110_0301193 | 3300048913 | Bacteria | 1460 |
| 811 | Ga0496110_0316974 | 3300048913 | Bacteria | 1420 |
| 812 | Ga0496110_0355092 | 3300048913 | Bacteria | 1335 |
| 813 | Ga0496110_0549553 | 3300048913 | Bacteria | 1050 |
| 814 | Ga0496110_0747888 | 3300048913 | Bacteria | 881 |
| 815 | Ga0496111_0327383 | 3300048914 | Bacteria | 1134 |
| 816 | Ga0496111_0426511 | 3300048914 | Bacteria | 979 |
| 817 | Ga0496111_0458900 | 3300048914 | Bacteria | 940 |
| 818 | Ga0496111_0631743 | 3300048914 | Bacteria | 782 |
| 819 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 820 | Ga0496112_0054801 | 3300048915 | Bacteria | 3918 |
| 821 | Ga0496112_0070474 | 3300048915 | Bacteria | 3455 |
| 822 | Ga0496112_0124542 | 3300048915 | Bacteria | 2548 |
| 823 | Ga0496112_0451914 | 3300048915 | Bacteria | 1222 |
| 824 | Ga0496112_0510875 | 3300048915 | Bacteria | 1137 |
| 825 | Ga0496113_0096906 | 3300048916 | Bacteria | 2281 |
| 826 | Ga0496113_0305377 | 3300048916 | Bacteria | 1274 |
| 827 | Ga0496113_0620375 | 3300048916 | Bacteria | 865 |
| 828 | Ga0496113_0841429 | 3300048916 | Bacteria | 727 |
| 829 | Ga0496113_0963187 | 3300048916 | Bacteria | 673 |
| 830 | Ga0496114_0021565 | 3300048917 | Bacteria | 5241 |
| 831 | Ga0496114_0295797 | 3300048917 | Bacteria | 1429 |
| 832 | Ga0496114_0392840 | 3300048917 | Bacteria | 1228 |
| 833 | Ga0496115_0063385 | 3300048918 | Bacteria | 2982 |
| 834 | Ga0496115_0149336 | 3300048918 | Bacteria | 1929 |
| 835 | Ga0496115_0215610 | 3300048918 | Bacteria | 1585 |
| 836 | Ga0496115_0274747 | 3300048918 | Bacteria | 1384 |
| 837 | Ga0496115_0298016 | 3300048918 | Bacteria | 1321 |
| 838 | Ga0496115_0779387 | 3300048918 | Bacteria | 746 |
| 839 | Ga0496116_0063414 | 3300048919 | Bacteria | 2381 |
| 840 | Ga0496117_0063496 | 3300048920 | Bacteria | 2524 |
| 841 | Ga0496117_0176090 | 3300048920 | Bacteria | 1236 |
| 842 | Ga0496117_0263275 | 3300048920 | Bacteria | 933 |
| 843 | Ga0496118_0061109 | 3300048921 | Bacteria | 2792 |
| 844 | Ga0496118_0210262 | 3300048921 | Bacteria | 1142 |
| 845 | Ga0496119_0004759 | 3300048922 | Bacteria | 13336 |
| 846 | Ga0496119_0162193 | 3300048922 | Bacteria | 1187 |
| 847 | Ga0496119_0506767 | 3300048922 | Bacteria | 561 |
| 848 | Ga0496120_0011234 | 3300048923 | Bacteria | 6174 |
| 849 | Ga0496120_0278911 | 3300048923 | Bacteria | 773 |
| 850 | Ga0496120_0483551 | 3300048923 | Bacteria | 534 |
| 851 | Ga0496121_0067065 | 3300048924 | Bacteria | 2909 |
| 852 | Ga0496121_0076862 | 3300048924 | Bacteria | 2661 |
| 853 | Ga0496121_0109120 | 3300048924 | Bacteria | 2115 |
| 854 | Ga0496121_0233292 | 3300048924 | Bacteria | 1287 |
| 855 | Ga0496121_0298971 | 3300048924 | Bacteria | 1093 |
| 856 | Ga0496122_0349071 | 3300048925 | Bacteria | 773 |
| 857 | Ga0496123_0245719 | 3300048926 | Bacteria | 886 |
| 858 | Ga0496124_0199891 | 3300048927 | Bacteria | 1521 |
| 859 | Ga0496124_0237878 | 3300048927 | Bacteria | 1356 |
| 860 | Ga0496124_0783328 | 3300048927 | Bacteria | 593 |
| 861 | Ga0496125_0074304 | 3300048928 | Bacteria | 2636 |
| 862 | Ga0496125_0239845 | 3300048928 | Bacteria | 1152 |
| 863 | Ga0496125_0413741 | 3300048928 | Bacteria | 784 |
| 864 | Ga0496126_0021452 | 3300048929 | Bacteria | 6307 |
| 865 | Ga0496126_0067946 | 3300048929 | Bacteria | 3183 |
| 866 | Ga0496126_0269263 | 3300048929 | Bacteria | 1414 |
| 867 | Ga0496126_0320161 | 3300048929 | Bacteria | 1275 |
| 868 | Ga0496126_0400598 | 3300048929 | Bacteria | 1113 |
| 869 | Ga0496126_0462816 | 3300048929 | Bacteria | 1019 |
| 870 | Ga0496126_0905477 | 3300048929 | Bacteria | 668 |
| 871 | Ga0495682_0050610 | 3300049460 | Bacteria | 1511 |
| 872 | Ga0495682_0319092 | 3300049460 | Bacteria | 548 |
| 873 | Ga0501067_0049759 | 3300049583 | Bacteria | 2322 |
| 874 | Ga0501076_0363520 | 3300049592 | Bacteria | 1189 |
| 875 | nmdc:mga03683_150490_c1 | 3300050489 | Bacteria | 1050 |
| 876 | nmdc:mga03683_199845_c1 | 3300050489 | Bacteria | 917 |
| 877 | nmdc:mga03683_252943_c1 | 3300050489 | Bacteria | 819 |
| 878 | nmdc:mga03n38_30594_c1 | 3300050490 | Bacteria | 2265 |
| 879 | nmdc:mga03n38_504504_c1 | 3300050490 | Bacteria | 679 |
| 880 | nmdc:mga00v17_205784_c1 | 3300050491 | Bacteria | 1273 |
| 881 | nmdc:mga00v17_433927_c1 | 3300050491 | Bacteria | 853 |
| 882 | nmdc:mga00v17_51191_c1 | 3300050491 | Bacteria | 2511 |
| 883 | nmdc:mga00v17_552923_c1 | 3300050491 | Bacteria | 744 |
| 884 | nmdc:mga0yw44_165693_c1 | 3300050492 | Bacteria | 1449 |
| 885 | nmdc:mga0yw44_290032_c1 | 3300050492 | Bacteria | 1095 |
| 886 | nmdc:mga0yw44_314787_c1 | 3300050492 | Bacteria | 1050 |
| 887 | nmdc:mga0yw44_430470_c1 | 3300050492 | Bacteria | 894 |
| 888 | nmdc:mga0yw44_489999_c1 | 3300050492 | Bacteria | 834 |
| 889 | nmdc:mga0yw44_52059_c2 | 3300050492 | Bacteria | 1713 |
| 890 | nmdc:mga0yw44_89419_c1 | 3300050492 | Bacteria | 1943 |
| 891 | nmdc:mga0k408_193427_c1 | 3300050493 | Bacteria | 1214 |
| 892 | nmdc:mga0k408_351600_c1 | 3300050493 | Bacteria | 878 |
| 893 | nmdc:mga0k408_535205_c1 | 3300050493 | Bacteria | 693 |
| 894 | nmdc:mga0k408_85455_c1 | 3300050493 | Bacteria | 1852 |
| 895 | nmdc:mga06z11_110142_c1 | 3300050494 | Bacteria | 1523 |
| 896 | nmdc:mga06z11_145484_c1 | 3300050494 | Bacteria | 1343 |
| 897 | nmdc:mga06z11_594653_c1 | 3300050494 | Bacteria | 673 |
| 898 | nmdc:mga06z11_803530_c1 | 3300050494 | Bacteria | 573 |
| 899 | nmdc:mga06z11_869202_c1 | 3300050494 | Bacteria | 549 |
| 900 | nmdc:mga06z11_98777_c1 | 3300050494 | Bacteria | 1598 |
| 901 | nmdc:mga04h51_239456_c1 | 3300050495 | Bacteria | 724 |
| 902 | nmdc:mga04h51_30802_c1 | 3300050495 | Bacteria | 1691 |
| 903 | nmdc:mga07m45_107885_c1 | 3300050496 | Bacteria | 1602 |
| 904 | nmdc:mga07m45_148537_c1 | 3300050496 | Bacteria | 1359 |
| 905 | nmdc:mga07m45_157563_c1 | 3300050496 | Bacteria | 1318 |
| 906 | nmdc:mga07m45_276925_c1 | 3300050496 | Bacteria | 976 |
| 907 | nmdc:mga07m45_360449_c1 | 3300050496 | Bacteria | 845 |
| 908 | nmdc:mga07m45_511601_c1 | 3300050496 | Bacteria | 695 |
| 909 | nmdc:mga08x19_555763_c1 | 3300050514 | Bacteria | 812 |
| 910 | nmdc:mga0sz30_117318_c1 | 3300050516 | Bacteria | 1169 |
| 911 | nmdc:mga0sz30_423468_c1 | 3300050516 | Bacteria | 597 |
| 912 | nmdc:mga0sz30_46487_c1 | 3300050516 | Bacteria | 1833 |
| 913 | nmdc:mga0sz30_56744_c1 | 3300050516 | Bacteria | 1668 |
| 914 | nmdc:mga0sz30_57816_c1 | 3300050516 | Bacteria | 1653 |
| 915 | Ga0495601_0399700 | 3300053077 | Bacteria | 891 |
| 916 | Ga0495601_0479505 | 3300053077 | Bacteria | 803 |
| 917 | Ga0495612_0063222 | 3300053078 | Bacteria | 1535 |
| 918 | Ga0500635_0052270 | 3300053080 | Bacteria | 1403 |
| 919 | Ga0500635_0104445 | 3300053080 | Bacteria | 1046 |
| 920 | Ga0495655_0036092 | 3300053083 | Bacteria | 1234 |
| 921 | Ga0495655_0228197 | 3300053083 | Bacteria | 619 |
| 922 | Ga0495655_0318806 | 3300053083 | Bacteria | 538 |
| 923 | Ga0495655_0331075 | 3300053083 | Bacteria | 529 |
| 924 | Ga0495619_0521281 | 3300053085 | Bacteria | 816 |
| 925 | Ga0500578_0089840 | 3300053086 | Bacteria | 1950 |
| 926 | Ga0500644_0416289 | 3300053088 | Bacteria | 587 |
| 927 | Ga0500647_0152105 | 3300053091 | Bacteria | 1079 |
| 928 | Ga0500647_0258320 | 3300053091 | Bacteria | 762 |
| 929 | Ga0500647_0292036 | 3300053091 | Bacteria | 700 |
| 930 | Ga0500651_0161790 | 3300053093 | Bacteria | 1338 |
| 931 | Ga0500651_0221522 | 3300053093 | Bacteria | 1109 |
| 932 | Ga0500566_0000270 | 3300053094 | Bacteria | 27957 |
| 933 | Ga0500566_0000780 | 3300053094 | Bacteria | 18033 |
| 934 | Ga0500640_000397 | 3300053095 | Bacteria | 10423 |
| 935 | Ga0500641_0220012 | 3300053096 | Bacteria | 805 |
| 936 | Ga0500648_205690 | 3300053097 | Bacteria | 983 |
| 937 | Ga0500650_0098641 | 3300053098 | Bacteria | 1368 |
| 938 | Ga0500556_0011510 | 3300053104 | Bacteria | 2621 |
| 939 | Ga0500557_000079 | 3300053105 | Bacteria | 34903 |
| 940 | Ga0500562_017834 | 3300053108 | Bacteria | 1832 |
| 941 | Ga0500569_106447 | 3300053109 | Bacteria | 923 |
| 942 | Ga0500572_001115 | 3300053111 | Bacteria | 7839 |
| 943 | Ga0500572_001993 | 3300053111 | Bacteria | 5096 |
| 944 | Ga0500591_054386 | 3300053115 | Bacteria | 1867 |
| 945 | Ga0500595_133684 | 3300053119 | Bacteria | 697 |
| 946 | Ga0500595_184201 | 3300053119 | Bacteria | 578 |
| 947 | Ga0500608_006525 | 3300053122 | Bacteria | 4758 |
| 948 | Ga0500608_290587 | 3300053122 | Bacteria | 613 |
| 949 | Ga0500614_003198 | 3300053123 | Bacteria | 3550 |
| 950 | Ga0500642_0000084 | 3300053130 | Bacteria | 49191 |
| 951 | Ga0500642_0129229 | 3300053130 | Bacteria | 1183 |
| 952 | Ga0500655_026358 | 3300053133 | Bacteria | 1106 |
| 953 | Ga0500658_0094183 | 3300053134 | Bacteria | 1299 |
| 954 | Ga0500658_0219063 | 3300053134 | Bacteria | 872 |
| 955 | Ga0500559_0000775 | 3300053136 | Bacteria | 20935 |
| 956 | Ga0500559_0001813 | 3300053136 | Bacteria | 11672 |
| 957 | Ga0500559_0187609 | 3300053136 | Bacteria | 974 |
| 958 | Ga0500568_0141164 | 3300053139 | Bacteria | 893 |
| 959 | Ga0500590_174738 | 3300053148 | Bacteria | 940 |
| 960 | Ga0500603_000151 | 3300053150 | Bacteria | 17010 |
| 961 | Ga0500603_071439 | 3300053150 | Bacteria | 989 |
| 962 | Ga0500604_0076153 | 3300053151 | Bacteria | 1078 |
| 963 | Ga0500604_0205667 | 3300053151 | Bacteria | 677 |
| 964 | Ga0500616_0023318 | 3300053153 | Bacteria | 3448 |
| 965 | Ga0500622_0017062 | 3300053156 | Bacteria | 3870 |
| 966 | Ga0500630_003510 | 3300053159 | Bacteria | 7582 |
| 967 | Ga0500633_0219779 | 3300053160 | Bacteria | 709 |
| 968 | Ga0500638_004618 | 3300053162 | Bacteria | 5344 |
| 969 | Ga0500638_139274 | 3300053162 | Bacteria | 1091 |
| 970 | Ga0500639_000065 | 3300053163 | Bacteria | 48250 |
| 971 | Ga0500639_166687 | 3300053163 | Bacteria | 994 |
| 972 | Ga0500639_322199 | 3300053163 | Bacteria | 565 |
| 973 | Ga0500637_0140051 | 3300053178 | Bacteria | 1400 |
| 974 | Ga0500649_056880 | 3300053722 | Bacteria | 1636 |
| 975 | Ga0500576_021808 | 3300053725 | Bacteria | 2923 |
| 976 | Ga0500611_199520 | 3300053727 | Bacteria | 566 |
| 977 | Ga0500625_072389 | 3300053729 | Bacteria | 1529 |
| 978 | Ga0500645_046585 | 3300053730 | Bacteria | 1272 |
| 979 | Ga0500609_002762 | 3300053731 | Bacteria | 2499 |
| 980 | Ga0500656_005804 | 3300053732 | Bacteria | 1232 |
| 981 | Ga0500552_001347 | 3300053733 | Bacteria | 2342 |
| 982 | Ga0500596_000494 | 3300053735 | Bacteria | 7393 |
| 983 | Ga0500596_003534 | 3300053735 | Bacteria | 2956 |
| 984 | Ga0500596_030737 | 3300053735 | Bacteria | 832 |
| 985 | Ga0500599_000973 | 3300053736 | Bacteria | 3206 |
| 986 | Ga0500601_000768 | 3300053737 | Bacteria | 4109 |
| 987 | Ga0500601_026213 | 3300053737 | Bacteria | 682 |
| 988 | Ga0500661_018802 | 3300055283 | Bacteria | 1231 |
| 989 | Ga0500661_040852 | 3300055283 | Bacteria | 822 |
| 990 | Ga0530510_0333709 | 3300061734 | Bacteria | 1138 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2922386360 | 2922389447 | 97 |
| 2 | iso_pu_bacteria | 2511231028 | 2511397332 | 98 |
| 3 | iso_pu_bacteria | 2513237095 | 2513649101 | 98 |
| 4 | iso_pu_bacteria | 2816332527 | 2818240492 | 98 |
| 5 | iso_pu_bacteria | 2824661429 | 2824666901 | 98 |
| 6 | iso_pu_bacteria | 2879099564 | 2879104369 | 98 |
| 7 | iso_pu_bacteria | 2888378607 | 2888387167 | 98 |
| 8 | iso_pu_bacteria | 2888388044 | 2888389858 | 98 |
| 9 | iso_pu_bacteria | 2932784394 | 2932787859 | 98 |
| 10 | iso_pu_bacteria | 2932809354 | 2932817583 | 98 |
| 11 | iso_pu_bacteria | 2932818245 | 2932826257 | 98 |
| 12 | iso_pu_bacteria | 2932828146 | 2932835113 | 98 |
| 13 | iso_pu_bacteria | 2935616580 | 2935620491 | 98 |
| 14 | iso_pu_bacteria | 2935638405 | 2935640813 | 98 |
| 15 | iso_pu_bacteria | 2935665750 | 2935670316 | 98 |
| 16 | iso_pu_bacteria | 2935675223 | 2935679746 | 98 |
| 17 | iso_pu_bacteria | 2935684952 | 2935687315 | 98 |
| 18 | iso_pu_bacteria | 2935694250 | 2935696714 | 98 |
| 19 | iso_pu_bacteria | 2935703347 | 2935709194 | 98 |
| 20 | iso_pu_bacteria | 2935713505 | 2935718774 | 98 |
| 21 | iso_pu_bacteria | 2935722832 | 2935728426 | 98 |
| 22 | iso_pu_bacteria | 2935732158 | 2935736977 | 98 |
| 23 | iso_pu_bacteria | 2935741537 | 2935746020 | 98 |
| 24 | iso_pu_bacteria | 2935750917 | 2935753281 | 98 |
| 25 | iso_pu_bacteria | 2935760218 | 2935766326 | 98 |
| 26 | iso_pu_bacteria | 2935801545 | 2935809008 | 98 |
| 27 | iso_pu_bacteria | 2935810662 | 2935813813 | 98 |
| 28 | iso_pu_bacteria | 2935827899 | 2935832320 | 98 |
| 29 | iso_pu_bacteria | 2935837841 | 2935844025 | 98 |
| 30 | iso_pu_bacteria | 2935855204 | 2935862817 | 98 |
| 31 | iso_pu_bacteria | 2935864058 | 2935864560 | 98 |
| 32 | iso_pu_bacteria | 2935873716 | 2935875088 | 98 |
| 33 | iso_pu_bacteria | 2935992306 | 2935999293 | 98 |
| 34 | iso_pu_bacteria | 2936002035 | 2936005848 | 98 |
| 35 | iso_pu_bacteria | 2936037263 | 2936039369 | 98 |
| 36 | iso_pu_bacteria | 2940556831 | 2940559194 | 98 |
| 37 | iso_pu_bacteria | 2941538514 | 2941541888 | 98 |
| 38 | iso_pu_bacteria | 8016511872 | 8016517188 | 98 |
| 39 | iso_pu_bacteria | 8017057580 | 8017059400 | 98 |
| 40 | iso_pu_bacteria | 8019576017 | 8019576218 | 98 |
| 41 | iso_pu_bacteria | 8019586578 | 8019594094 | 98 |
| 42 | iso_pu_bacteria | 8019597564 | 8019607470 | 98 |
| 43 | iso_pu_bacteria | 8019608314 | 8019611040 | 98 |
| 44 | 3300025916 | Ga0207663_10050487 | Ga0207663_100504873 | 99 |
| 45 | iso_pu_bacteria | 2507262055 | 2507505993 | 100 |
| 46 | iso_pu_bacteria | 2508501009 | 2508540181 | 100 |
| 47 | iso_pu_bacteria | 2508501042 | 2508696255 | 100 |
| 48 | iso_pu_bacteria | 2513237092 | 2513624904 | 100 |
| 49 | iso_pu_bacteria | 2513237094 | 2513638263 | 100 |
| 50 | iso_pu_bacteria | 2513237104 | 2513716255 | 100 |
| 51 | iso_pu_bacteria | 2513237139 | 2513877176 | 100 |
| 52 | iso_pu_bacteria | 2513237161 | 2514014545 | 100 |
| 53 | iso_pu_bacteria | 2515154112 | 2515628464 | 100 |
| 54 | iso_pu_bacteria | 2517093001 | 2517103183 | 100 |
| 55 | iso_pu_bacteria | 2524023205 | 2524440763 | 100 |
| 56 | iso_pu_bacteria | 2528768022 | 2528850758 | 100 |
| 57 | iso_pu_bacteria | 2617270735 | 2617347876 | 100 |
| 58 | iso_pu_bacteria | 2617270741 | 2617374798 | 100 |
| 59 | iso_pu_bacteria | 2744054633 | 2745076004 | 100 |
| 60 | iso_pu_bacteria | 2791355196 | 2793061473 | 100 |
| 61 | iso_pu_bacteria | 2802429603 | 2805916225 | 100 |
| 62 | iso_pu_bacteria | 2824671348 | 2824674079 | 100 |
| 63 | iso_pu_bacteria | 2824679649 | 2824683879 | 100 |
| 64 | iso_pu_bacteria | 2824687955 | 2824690745 | 100 |
| 65 | iso_pu_bacteria | 2824696289 | 2824704227 | 100 |
| 66 | iso_pu_bacteria | 2824704595 | 2824710968 | 100 |
| 67 | iso_pu_bacteria | 2824732956 | 2824737927 | 100 |
| 68 | iso_pu_bacteria | 2824746037 | 2824752192 | 100 |
| 69 | iso_pu_bacteria | 2824753945 | 2824760342 | 100 |
| 70 | iso_pu_bacteria | 2824763712 | 2824772490 | 100 |
| 71 | iso_pu_bacteria | 2824773399 | 2824776347 | 100 |
| 72 | iso_pu_bacteria | 2838122688 | 2838125014 | 100 |
| 73 | iso_pu_bacteria | 2841941048 | 2841945753 | 100 |
| 74 | iso_pu_bacteria | 2841949485 | 2841956852 | 100 |
| 75 | iso_pu_bacteria | 2841966195 | 2841973588 | 100 |
| 76 | iso_pu_bacteria | 2841974524 | 2841981934 | 100 |
| 77 | iso_pu_bacteria | 2841983080 | 2841989476 | 100 |
| 78 | iso_pu_bacteria | 2842038055 | 2842044461 | 100 |
| 79 | iso_pu_bacteria | 2842045827 | 2842051550 | 100 |
| 80 | iso_pu_bacteria | 2844315083 | 2844316335 | 100 |
| 81 | iso_pu_bacteria | 2847930680 | 2847939365 | 100 |
| 82 | iso_pu_bacteria | 2847939898 | 2847941121 | 100 |
| 83 | iso_pu_bacteria | 2849076700 | 2849082107 | 100 |
| 84 | iso_pu_bacteria | 2874590934 | 2874596270 | 100 |
| 85 | iso_pu_bacteria | 2874620515 | 2874622548 | 100 |
| 86 | iso_pu_bacteria | 2874628541 | 2874633461 | 100 |
| 87 | iso_pu_bacteria | 2874645413 | 2874650257 | 100 |
| 88 | iso_pu_bacteria | 2876761206 | 2876763658 | 100 |
| 89 | iso_pu_bacteria | 2876771140 | 2876776735 | 100 |
| 90 | iso_pu_bacteria | 2876818435 | 2876824525 | 100 |
| 91 | iso_pu_bacteria | 2879074833 | 2879080872 | 100 |
| 92 | iso_pu_bacteria | 2879083081 | 2879087038 | 100 |
| 93 | iso_pu_bacteria | 2879127579 | 2879133717 | 100 |
| 94 | iso_pu_bacteria | 2879142872 | 2879148219 | 100 |
| 95 | iso_pu_bacteria | 2881665667 | 2881669756 | 100 |
| 96 | iso_pu_bacteria | 2885366525 | 2885367826 | 100 |
| 97 | iso_pu_bacteria | 2885409591 | 2885412976 | 100 |
| 98 | iso_pu_bacteria | 2903727486 | 2903728331 | 100 |
| 99 | iso_pu_bacteria | 2904666416 | 2904671445 | 100 |
| 100 | iso_pu_bacteria | 2904711408 | 2904719737 | 100 |
| 101 | iso_pu_bacteria | 2906602504 | 2906606471 | 100 |
| 102 | iso_pu_bacteria | 2906626472 | 2906631364 | 100 |
| 103 | iso_pu_bacteria | 2906643746 | 2906646708 | 100 |
| 104 | iso_pu_bacteria | 2908775508 | 2908777280 | 100 |
| 105 | iso_pu_bacteria | 2922393267 | 2922398436 | 100 |
| 106 | iso_pu_bacteria | 2929615660 | 2929622136 | 100 |
| 107 | iso_pu_bacteria | 2929624759 | 2929630219 | 100 |
| 108 | iso_pu_bacteria | 2932794094 | 2932795977 | 100 |
| 109 | iso_pu_bacteria | 2932801729 | 2932807554 | 100 |
| 110 | iso_pu_bacteria | 2933577622 | 2933584248 | 100 |
| 111 | iso_pu_bacteria | 2935608549 | 2935614418 | 100 |
| 112 | iso_pu_bacteria | 2935648319 | 2935649447 | 100 |
| 113 | iso_pu_bacteria | 2935656913 | 2935657781 | 100 |
| 114 | iso_pu_bacteria | 2935769743 | 2935770285 | 100 |
| 115 | iso_pu_bacteria | 2935777560 | 2935777688 | 100 |
| 116 | iso_pu_bacteria | 2935785616 | 2935786662 | 100 |
| 117 | iso_pu_bacteria | 2935793552 | 2935794716 | 100 |
| 118 | iso_pu_bacteria | 2935819856 | 2935826636 | 100 |
| 119 | iso_pu_bacteria | 2935847175 | 2935851070 | 100 |
| 120 | iso_pu_bacteria | 2935883170 | 2935890232 | 100 |
| 121 | iso_pu_bacteria | 2935908558 | 2935913120 | 100 |
| 122 | iso_pu_bacteria | 2935916978 | 2935922542 | 100 |
| 123 | iso_pu_bacteria | 2935926038 | 2935930955 | 100 |
| 124 | iso_pu_bacteria | 2935934488 | 2935939711 | 100 |
| 125 | iso_pu_bacteria | 2935942939 | 2935946660 | 100 |
| 126 | iso_pu_bacteria | 2935951376 | 2935956139 | 100 |
| 127 | iso_pu_bacteria | 2935959822 | 2935965045 | 100 |
| 128 | iso_pu_bacteria | 2935967501 | 2935972932 | 100 |
| 129 | iso_pu_bacteria | 2935975950 | 2935978152 | 100 |
| 130 | iso_pu_bacteria | 2935984226 | 2935985724 | 100 |
| 131 | iso_pu_bacteria | 2936011229 | 2936012000 | 100 |
| 132 | iso_pu_bacteria | 2936019824 | 2936020919 | 100 |
| 133 | iso_pu_bacteria | 2936028420 | 2936029293 | 100 |
| 134 | iso_pu_bacteria | 2936046547 | 2936048383 | 100 |
| 135 | iso_pu_bacteria | 2936055302 | 2936056506 | 100 |
| 136 | iso_pu_bacteria | 2941531003 | 2941534518 | 100 |
| 137 | iso_pu_bacteria | 3005483717 | 3005491142 | 100 |
| 138 | iso_pu_bacteria | 3005506211 | 3005510983 | 100 |
| 139 | iso_pu_bacteria | 3005587118 | 3005591828 | 100 |
| 140 | iso_pu_bacteria | 3005594810 | 3005595946 | 100 |
| 141 | iso_pu_bacteria | 3005718088 | 3005719138 | 100 |
| 142 | iso_pu_bacteria | 8006926726 | 8006931475 | 100 |
| 143 | iso_pu_bacteria | 8016522445 | 8016527056 | 100 |
| 144 | iso_pu_bacteria | 8016539877 | 8016545347 | 100 |
| 145 | iso_pu_bacteria | 8016548790 | 8016556740 | 100 |
| 146 | iso_pu_bacteria | 8016566248 | 8016570435 | 100 |
| 147 | iso_pu_bacteria | 8016575299 | 8016582967 | 100 |
| 148 | iso_pu_bacteria | 8016583857 | 8016585333 | 100 |
| 149 | iso_pu_bacteria | 8016595262 | 8016602745 | 100 |
| 150 | iso_pu_bacteria | 8016603502 | 8016605604 | 100 |
| 151 | iso_pu_bacteria | 8016622563 | 8016624052 | 100 |
| 152 | iso_pu_bacteria | 8016630954 | 8016634814 | 100 |
| 153 | iso_pu_bacteria | 8019530166 | 8019531956 | 100 |
| 154 | iso_pu_bacteria | 8019538911 | 8019539582 | 100 |
| 155 | iso_pu_bacteria | 8019547302 | 8019551075 | 100 |
| 156 | iso_pu_bacteria | 8019619141 | 8019621890 | 100 |
| 157 | iso_pu_bacteria | 8019629233 | 8019631433 | 100 |
| 158 | iso_pu_bacteria | 8019648815 | 8019651328 | 100 |
| 159 | iso_pu_bacteria | 8019659431 | 8019668246 | 100 |
| 160 | iso_pu_bacteria | 8019668869 | 8019677699 | 100 |
| 161 | iso_pu_bacteria | 8019678201 | 8019687243 | 100 |
| 162 | iso_pu_bacteria | 8019687851 | 8019693225 | 100 |
| 163 | iso_pu_bacteria | 8055742211 | 8055743613 | 100 |
| 164 | iso_pu_bacteria | 8056681323 | 8056681587 | 100 |
| 165 | iso_pu_bacteria | 8056689827 | 8056692936 | 100 |
| 166 | iso_pu_bacteria | 8056967851 | 8056974080 | 100 |
| 167 | 3300003215 | JGI25153J46596_10001390 | JGI25153J46596_100013904 | 101 |
| 168 | 3300005328 | Ga0070676_11056465 | Ga0070676_110564652 | 101 |
| 169 | 3300005337 | Ga0070682_101076986 | Ga0070682_1010769862 | 101 |
| 170 | 3300005339 | Ga0070660_100201906 | Ga0070660_1002019062 | 101 |
| 171 | 3300005347 | Ga0070668_100685543 | Ga0070668_1006855432 | 101 |
| 172 | 3300005367 | Ga0070667_100845781 | Ga0070667_1008457812 | 101 |
| 173 | 3300005438 | Ga0070701_10611640 | Ga0070701_106116401 | 101 |
| 174 | 3300005455 | Ga0070663_101816014 | Ga0070663_1018160141 | 101 |
| 175 | 3300005456 | Ga0070678_102194918 | Ga0070678_1021949182 | 101 |
| 176 | 3300005466 | Ga0070685_11288246 | Ga0070685_112882462 | 101 |
| 177 | 3300005539 | Ga0068853_100581536 | Ga0068853_1005815362 | 101 |
| 178 | 3300005548 | Ga0070665_100043079 | Ga0070665_1000430794 | 101 |
| 179 | 3300005548 | Ga0070665_101269524 | Ga0070665_1012695242 | 101 |
| 180 | 3300005564 | Ga0070664_101518657 | Ga0070664_1015186572 | 101 |
| 181 | 3300005616 | Ga0068852_100947886 | Ga0068852_1009478861 | 101 |
| 182 | 3300005841 | Ga0068863_101206429 | Ga0068863_1012064292 | 101 |
| 183 | 3300005985 | Ga0081539_10020815 | Ga0081539_100208153 | 101 |
| 184 | 3300006038 | Ga0075365_10150418 | Ga0075365_101504182 | 101 |
| 185 | 3300006042 | Ga0075368_10170099 | Ga0075368_101700992 | 101 |
| 186 | 3300006048 | Ga0075363_100302276 | Ga0075363_1003022762 | 101 |
| 187 | 3300006051 | Ga0075364_10742082 | Ga0075364_107420822 | 101 |
| 188 | 3300006177 | Ga0075362_10150176 | Ga0075362_101501762 | 101 |
| 189 | 3300006178 | Ga0075367_10129471 | Ga0075367_101294712 | 101 |
| 190 | 3300006195 | Ga0075366_10366157 | Ga0075366_103661572 | 101 |
| 191 | 3300006353 | Ga0075370_10188880 | Ga0075370_101888802 | 101 |
| 192 | 3300006353 | Ga0075370_10687856 | Ga0075370_106878562 | 101 |
| 193 | 3300006881 | Ga0068865_101634796 | Ga0068865_1016347962 | 101 |
| 194 | 3300009553 | Ga0105249_11143085 | Ga0105249_111430852 | 101 |
| 195 | 3300010375 | Ga0105239_10527690 | Ga0105239_105276902 | 101 |
| 196 | 3300011119 | Ga0105246_11405721 | Ga0105246_114057212 | 101 |
| 197 | 3300017792 | Ga0163161_12041113 | Ga0163161_120411132 | 101 |
| 198 | 3300025297 | Ga0209758_1001109 | Ga0209758_100110933 | 101 |
| 199 | 3300025911 | Ga0207654_10431646 | Ga0207654_104316462 | 101 |
| 200 | 3300025917 | Ga0207660_11211818 | Ga0207660_112118182 | 101 |
| 201 | 3300025945 | Ga0207679_10373457 | Ga0207679_103734572 | 101 |
| 202 | 3300025981 | Ga0207640_10768331 | Ga0207640_107683312 | 101 |
| 203 | 3300026067 | Ga0207678_10261273 | Ga0207678_102612732 | 101 |
| 204 | 3300026067 | Ga0207678_11982649 | Ga0207678_119826492 | 101 |
| 205 | 3300028379 | Ga0268266_10500186 | Ga0268266_105001862 | 101 |
| 206 | 3300031731 | Ga0307405_11905850 | Ga0307405_119058502 | 101 |
| 207 | 3300032126 | Ga0307415_100186945 | Ga0307415_1001869452 | 101 |
| 208 | 3300035115 | Ga0373941_0265208 | Ga0373941_0265208_33_344 | 101 |
| 209 | 3300037471 | Ga0395905_0837332 | Ga0395905_0837332_294_605 | 101 |
| 210 | 3300041486 | Ga0451807_0956237 | Ga0451807_0956237_145_456 | 101 |
| 211 | 3300041505 | Ga0451849_0844733 | Ga0451849_0844733_202_513 | 101 |
| 212 | 3300041511 | Ga0451855_0055418 | Ga0451855_0055418_115_426 | 101 |
| 213 | 3300042438 | Ga0439459_0025420 | Ga0439459_0025420_408_719 | 101 |
| 214 | 3300048907 | Ga0496104_1130082 | Ga0496104_1130082_355_666 | 101 |
| 215 | 3300048909 | Ga0496106_0580283 | Ga0496106_0580283_575_886 | 101 |
| 216 | 3300049583 | Ga0501067_0049759 | Ga0501067_0049759_1477_1788 | 101 |
| 217 | 3300049592 | Ga0501076_0363520 | Ga0501076_0363520_587_898 | 101 |
| 218 | 3300050489 | nmdc:mga03683_252943_c1 | nmdc:mga03683_252943_c1_367_678 | 101 |
| 219 | 3300050491 | nmdc:mga00v17_433927_c1 | nmdc:mga00v17_433927_c1_391_702 | 101 |
| 220 | 3300050492 | nmdc:mga0yw44_52059_c2 | nmdc:mga0yw44_52059_c2_895_1206 | 101 |
| 221 | 3300050493 | nmdc:mga0k408_351600_c1 | nmdc:mga0k408_351600_c1_134_445 | 101 |
| 222 | 3300050494 | nmdc:mga06z11_145484_c1 | nmdc:mga06z11_145484_c1_195_506 | 101 |
| 223 | 3300050494 | nmdc:mga06z11_803530_c1 | nmdc:mga06z11_803530_c1_45_356 | 101 |
| 224 | 3300050496 | nmdc:mga07m45_107885_c1 | nmdc:mga07m45_107885_c1_206_517 | 101 |
| 225 | 3300050496 | nmdc:mga07m45_276925_c1 | nmdc:mga07m45_276925_c1_416_727 | 101 |
| 226 | 3300050516 | nmdc:mga0sz30_423468_c1 | nmdc:mga0sz30_423468_c1_228_539 | 101 |
| 227 | 3300002075 | JGI24738J21930_10019905 | JGI24738J21930_100199052 | 102 |
| 228 | 3300002155 | JGI24033J26618_1053361 | JGI24033J26618_10533611 | 102 |
| 229 | 3300003215 | JGI25153J46596_10020441 | JGI25153J46596_100204412 | 102 |
| 230 | 3300003354 | JGI25160J50197_1002392 | JGI25160J50197_10023927 | 102 |
| 231 | 3300003659 | JGI25404J52841_10033269 | JGI25404J52841_100332692 | 102 |
| 232 | 3300003752 | Ga0055539_1001720 | Ga0055539_10017202 | 102 |
| 233 | 3300004625 | Ga0055543_1079601 | Ga0055543_10796012 | 102 |
| 234 | 3300005262 | Ga0065165_1024512 | Ga0065165_10245122 | 102 |
| 235 | 3300005290 | Ga0065712_10536602 | Ga0065712_105366022 | 102 |
| 236 | 3300005328 | Ga0070676_11313137 | Ga0070676_113131372 | 102 |
| 237 | 3300005331 | Ga0070670_100055651 | Ga0070670_1000556512 | 102 |
| 238 | 3300005334 | Ga0068869_100163644 | Ga0068869_1001636442 | 102 |
| 239 | 3300005334 | Ga0068869_100350804 | Ga0068869_1003508042 | 102 |
| 240 | 3300005335 | Ga0070666_10181967 | Ga0070666_101819671 | 102 |
| 241 | 3300005335 | Ga0070666_10331454 | Ga0070666_103314541 | 102 |
| 242 | 3300005335 | Ga0070666_10422991 | Ga0070666_104229911 | 102 |
| 243 | 3300005337 | Ga0070682_100652971 | Ga0070682_1006529712 | 102 |
| 244 | 3300005338 | Ga0068868_100740246 | Ga0068868_1007402462 | 102 |
| 245 | 3300005338 | Ga0068868_100947948 | Ga0068868_1009479482 | 102 |
| 246 | 3300005339 | Ga0070660_100935065 | Ga0070660_1009350652 | 102 |
| 247 | 3300005340 | Ga0070689_100499769 | Ga0070689_1004997692 | 102 |
| 248 | 3300005344 | Ga0070661_100981450 | Ga0070661_1009814502 | 102 |
| 249 | 3300005347 | Ga0070668_100084326 | Ga0070668_1000843263 | 102 |
| 250 | 3300005347 | Ga0070668_100211842 | Ga0070668_1002118422 | 102 |
| 251 | 3300005347 | Ga0070668_102082679 | Ga0070668_1020826792 | 102 |
| 252 | 3300005353 | Ga0070669_100466617 | Ga0070669_1004666172 | 102 |
| 253 | 3300005353 | Ga0070669_100566424 | Ga0070669_1005664241 | 102 |
| 254 | 3300005354 | Ga0070675_100514555 | Ga0070675_1005145551 | 102 |
| 255 | 3300005354 | Ga0070675_101670178 | Ga0070675_1016701781 | 102 |
| 256 | 3300005354 | Ga0070675_102169297 | Ga0070675_1021692972 | 102 |
| 257 | 3300005355 | Ga0070671_100642425 | Ga0070671_1006424252 | 102 |
| 258 | 3300005356 | Ga0070674_100782225 | Ga0070674_1007822252 | 102 |
| 259 | 3300005364 | Ga0070673_102113052 | Ga0070673_1021130522 | 102 |
| 260 | 3300005367 | Ga0070667_100524191 | Ga0070667_1005241912 | 102 |
| 261 | 3300005367 | Ga0070667_100941738 | Ga0070667_1009417382 | 102 |
| 262 | 3300005437 | Ga0070710_11042584 | Ga0070710_110425842 | 102 |
| 263 | 3300005438 | Ga0070701_10215404 | Ga0070701_102154042 | 102 |
| 264 | 3300005441 | Ga0070700_100632785 | Ga0070700_1006327851 | 102 |
| 265 | 3300005455 | Ga0070663_100056230 | Ga0070663_1000562302 | 102 |
| 266 | 3300005455 | Ga0070663_100847116 | Ga0070663_1008471162 | 102 |
| 267 | 3300005466 | Ga0070685_11173029 | Ga0070685_111730291 | 102 |
| 268 | 3300005539 | Ga0068853_100145219 | Ga0068853_1001452192 | 102 |
| 269 | 3300005539 | Ga0068853_100184016 | Ga0068853_1001840162 | 102 |
| 270 | 3300005543 | Ga0070672_100508626 | Ga0070672_1005086261 | 102 |
| 271 | 3300005544 | Ga0070686_101442585 | Ga0070686_1014425852 | 102 |
| 272 | 3300005548 | Ga0070665_100076636 | Ga0070665_1000766362 | 102 |
| 273 | 3300005548 | Ga0070665_100144262 | Ga0070665_1001442622 | 102 |
| 274 | 3300005563 | Ga0068855_100905337 | Ga0068855_1009053372 | 102 |
| 275 | 3300005564 | Ga0070664_101304144 | Ga0070664_1013041441 | 102 |
| 276 | 3300005577 | Ga0068857_102032301 | Ga0068857_1020323011 | 102 |
| 277 | 3300005578 | Ga0068854_100787893 | Ga0068854_1007878932 | 102 |
| 278 | 3300005578 | Ga0068854_101347315 | Ga0068854_1013473152 | 102 |
| 279 | 3300005614 | Ga0068856_100248794 | Ga0068856_1002487942 | 102 |
| 280 | 3300005614 | Ga0068856_101074074 | Ga0068856_1010740741 | 102 |
| 281 | 3300005616 | Ga0068852_101578735 | Ga0068852_1015787351 | 102 |
| 282 | 3300005617 | Ga0068859_100716532 | Ga0068859_1007165322 | 102 |
| 283 | 3300005618 | Ga0068864_100751494 | Ga0068864_1007514942 | 102 |
| 284 | 3300005718 | Ga0068866_10367814 | Ga0068866_103678142 | 102 |
| 285 | 3300005719 | Ga0068861_100388885 | Ga0068861_1003888852 | 102 |
| 286 | 3300005719 | Ga0068861_102233186 | Ga0068861_1022331861 | 102 |
| 287 | 3300005834 | Ga0068851_11044641 | Ga0068851_110446412 | 102 |
| 288 | 3300005841 | Ga0068863_102438177 | Ga0068863_1024381771 | 102 |
| 289 | 3300005842 | Ga0068858_100278870 | Ga0068858_1002788702 | 102 |
| 290 | 3300005842 | Ga0068858_101672213 | Ga0068858_1016722132 | 102 |
| 291 | 3300005843 | Ga0068860_101430726 | Ga0068860_1014307262 | 102 |
| 292 | 3300005843 | Ga0068860_101501236 | Ga0068860_1015012361 | 102 |
| 293 | 3300005844 | Ga0068862_100541426 | Ga0068862_1005414262 | 102 |
| 294 | 3300005844 | Ga0068862_100592134 | Ga0068862_1005921342 | 102 |
| 295 | 3300005844 | Ga0068862_100593488 | Ga0068862_1005934882 | 102 |
| 296 | 3300005983 | Ga0081540_1001275 | Ga0081540_100127514 | 102 |
| 297 | 3300006042 | Ga0075368_10000838 | Ga0075368_100008382 | 102 |
| 298 | 3300006042 | Ga0075368_10001639 | Ga0075368_100016398 | 102 |
| 299 | 3300006048 | Ga0075363_100009411 | Ga0075363_1000094115 | 102 |
| 300 | 3300006177 | Ga0075362_10042194 | Ga0075362_100421942 | 102 |
| 301 | 3300006178 | Ga0075367_10172200 | Ga0075367_101722002 | 102 |
| 302 | 3300006178 | Ga0075367_10746461 | Ga0075367_107464611 | 102 |
| 303 | 3300006186 | Ga0075369_10104856 | Ga0075369_101048562 | 102 |
| 304 | 3300006195 | Ga0075366_10009092 | Ga0075366_100090925 | 102 |
| 305 | 3300006237 | Ga0097621_100473854 | Ga0097621_1004738542 | 102 |
| 306 | 3300006353 | Ga0075370_10099134 | Ga0075370_100991342 | 102 |
| 307 | 3300006353 | Ga0075370_10518817 | Ga0075370_105188172 | 102 |
| 308 | 3300006353 | Ga0075370_10792221 | Ga0075370_107922212 | 102 |
| 309 | 3300006881 | Ga0068865_100106352 | Ga0068865_1001063522 | 102 |
| 310 | 3300006881 | Ga0068865_100486408 | Ga0068865_1004864082 | 102 |
| 311 | 3300006931 | Ga0097620_100716527 | Ga0097620_1007165272 | 102 |
| 312 | 3300009093 | Ga0105240_11067433 | Ga0105240_110674332 | 102 |
| 313 | 3300009094 | Ga0111539_10419589 | Ga0111539_104195892 | 102 |
| 314 | 3300009098 | Ga0105245_10453572 | Ga0105245_104535722 | 102 |
| 315 | 3300009098 | Ga0105245_10869902 | Ga0105245_108699022 | 102 |
| 316 | 3300009101 | Ga0105247_10107152 | Ga0105247_101071522 | 102 |
| 317 | 3300009148 | Ga0105243_10274852 | Ga0105243_102748522 | 102 |
| 318 | 3300009174 | Ga0105241_10918119 | Ga0105241_109181192 | 102 |
| 319 | 3300009177 | Ga0105248_10184583 | Ga0105248_101845833 | 102 |
| 320 | 3300009177 | Ga0105248_11617383 | Ga0105248_116173832 | 102 |
| 321 | 3300009545 | Ga0105237_10115363 | Ga0105237_101153632 | 102 |
| 322 | 3300009545 | Ga0105237_10380433 | Ga0105237_103804332 | 102 |
| 323 | 3300009553 | Ga0105249_10350366 | Ga0105249_103503662 | 102 |
| 324 | 3300009553 | Ga0105249_10990339 | Ga0105249_109903392 | 102 |
| 325 | 3300009553 | Ga0105249_11851787 | Ga0105249_118517872 | 102 |
| 326 | 3300010375 | Ga0105239_10715804 | Ga0105239_107158042 | 102 |
| 327 | 3300010375 | Ga0105239_13250119 | Ga0105239_132501192 | 102 |
| 328 | 3300011119 | Ga0105246_10045131 | Ga0105246_100451313 | 102 |
| 329 | 3300011119 | Ga0105246_11633627 | Ga0105246_116336272 | 102 |
| 330 | 3300013296 | Ga0157374_10999916 | Ga0157374_109999162 | 102 |
| 331 | 3300013306 | Ga0163162_10760946 | Ga0163162_107609462 | 102 |
| 332 | 3300013306 | Ga0163162_10886257 | Ga0163162_108862571 | 102 |
| 333 | 3300013306 | Ga0163162_11619985 | Ga0163162_116199852 | 102 |
| 334 | 3300013308 | Ga0157375_10415757 | Ga0157375_104157572 | 102 |
| 335 | 3300014325 | Ga0163163_10171873 | Ga0163163_101718732 | 102 |
| 336 | 3300014325 | Ga0163163_10179618 | Ga0163163_101796182 | 102 |
| 337 | 3300014325 | Ga0163163_11592400 | Ga0163163_115924002 | 102 |
| 338 | 3300014497 | Ga0182008_10367720 | Ga0182008_103677202 | 102 |
| 339 | 3300014968 | Ga0157379_10075681 | Ga0157379_100756812 | 102 |
| 340 | 3300014968 | Ga0157379_10946410 | Ga0157379_109464102 | 102 |
| 341 | 3300014969 | Ga0157376_10901405 | Ga0157376_109014052 | 102 |
| 342 | 3300017792 | Ga0163161_10401870 | Ga0163161_104018701 | 102 |
| 343 | 3300025230 | Ga0209563_100662 | Ga0209563_1006624 | 102 |
| 344 | 3300025253 | Ga0209677_102831 | Ga0209677_1028315 | 102 |
| 345 | 3300025297 | Ga0209758_1046625 | Ga0209758_10466251 | 102 |
| 346 | 3300025297 | Ga0209758_1051293 | Ga0209758_10512932 | 102 |
| 347 | 3300025297 | Ga0209758_1066050 | Ga0209758_10660502 | 102 |
| 348 | 3300025299 | Ga0209256_1025126 | Ga0209256_10251262 | 102 |
| 349 | 3300025299 | Ga0209256_1092325 | Ga0209256_10923252 | 102 |
| 350 | 3300025302 | Ga0207426_1001011 | Ga0207426_100101122 | 102 |
| 351 | 3300025302 | Ga0207426_1016058 | Ga0207426_10160582 | 102 |
| 352 | 3300025315 | Ga0207697_10040925 | Ga0207697_100409252 | 102 |
| 353 | 3300025321 | Ga0207656_10144332 | Ga0207656_101443322 | 102 |
| 354 | 3300025899 | Ga0207642_10488223 | Ga0207642_104882232 | 102 |
| 355 | 3300025900 | Ga0207710_10270099 | Ga0207710_102700992 | 102 |
| 356 | 3300025901 | Ga0207688_10085817 | Ga0207688_100858172 | 102 |
| 357 | 3300025903 | Ga0207680_10332906 | Ga0207680_103329062 | 102 |
| 358 | 3300025904 | Ga0207647_10030786 | Ga0207647_100307862 | 102 |
| 359 | 3300025904 | Ga0207647_10436727 | Ga0207647_104367272 | 102 |
| 360 | 3300025905 | Ga0207685_10383428 | Ga0207685_103834281 | 102 |
| 361 | 3300025907 | Ga0207645_10286533 | Ga0207645_102865332 | 102 |
| 362 | 3300025908 | Ga0207643_10139004 | Ga0207643_101390042 | 102 |
| 363 | 3300025914 | Ga0207671_10072946 | Ga0207671_100729462 | 102 |
| 364 | 3300025915 | Ga0207693_10558348 | Ga0207693_105583481 | 102 |
| 365 | 3300025920 | Ga0207649_11044015 | Ga0207649_110440152 | 102 |
| 366 | 3300025923 | Ga0207681_10279959 | Ga0207681_102799592 | 102 |
| 367 | 3300025923 | Ga0207681_10700305 | Ga0207681_107003052 | 102 |
| 368 | 3300025925 | Ga0207650_10155963 | Ga0207650_101559632 | 102 |
| 369 | 3300025926 | Ga0207659_11001280 | Ga0207659_110012802 | 102 |
| 370 | 3300025927 | Ga0207687_11184652 | Ga0207687_111846522 | 102 |
| 371 | 3300025929 | Ga0207664_10347792 | Ga0207664_103477923 | 102 |
| 372 | 3300025931 | Ga0207644_10084782 | Ga0207644_100847823 | 102 |
| 373 | 3300025933 | Ga0207706_10166211 | Ga0207706_101662112 | 102 |
| 374 | 3300025933 | Ga0207706_11253479 | Ga0207706_112534792 | 102 |
| 375 | 3300025935 | Ga0207709_10322478 | Ga0207709_103224782 | 102 |
| 376 | 3300025937 | Ga0207669_11111475 | Ga0207669_111114752 | 102 |
| 377 | 3300025938 | Ga0207704_10488886 | Ga0207704_104888862 | 102 |
| 378 | 3300025938 | Ga0207704_11016289 | Ga0207704_110162892 | 102 |
| 379 | 3300025940 | Ga0207691_10041304 | Ga0207691_100413042 | 102 |
| 380 | 3300025941 | Ga0207711_10107052 | Ga0207711_101070522 | 102 |
| 381 | 3300025942 | Ga0207689_10199543 | Ga0207689_101995432 | 102 |
| 382 | 3300025942 | Ga0207689_10297792 | Ga0207689_102977922 | 102 |
| 383 | 3300025945 | Ga0207679_10952536 | Ga0207679_109525362 | 102 |
| 384 | 3300025949 | Ga0207667_10553523 | Ga0207667_105535232 | 102 |
| 385 | 3300025949 | Ga0207667_11363590 | Ga0207667_113635902 | 102 |
| 386 | 3300025961 | Ga0207712_10537328 | Ga0207712_105373282 | 102 |
| 387 | 3300025972 | Ga0207668_10044853 | Ga0207668_100448532 | 102 |
| 388 | 3300025972 | Ga0207668_10098525 | Ga0207668_100985252 | 102 |
| 389 | 3300025981 | Ga0207640_10314746 | Ga0207640_103147462 | 102 |
| 390 | 3300025986 | Ga0207658_10484606 | Ga0207658_104846062 | 102 |
| 391 | 3300026023 | Ga0207677_10200525 | Ga0207677_102005252 | 102 |
| 392 | 3300026023 | Ga0207677_11183897 | Ga0207677_111838972 | 102 |
| 393 | 3300026035 | Ga0207703_10167720 | Ga0207703_101677202 | 102 |
| 394 | 3300026035 | Ga0207703_11293637 | Ga0207703_112936371 | 102 |
| 395 | 3300026041 | Ga0207639_10634740 | Ga0207639_106347402 | 102 |
| 396 | 3300026067 | Ga0207678_10072189 | Ga0207678_100721893 | 102 |
| 397 | 3300026067 | Ga0207678_10519886 | Ga0207678_105198862 | 102 |
| 398 | 3300026078 | Ga0207702_10215699 | Ga0207702_102156992 | 102 |
| 399 | 3300026078 | Ga0207702_10694345 | Ga0207702_106943452 | 102 |
| 400 | 3300026088 | Ga0207641_10189800 | Ga0207641_101898002 | 102 |
| 401 | 3300026089 | Ga0207648_10480900 | Ga0207648_104809002 | 102 |
| 402 | 3300026089 | Ga0207648_11012023 | Ga0207648_110120232 | 102 |
| 403 | 3300026095 | Ga0207676_11060082 | Ga0207676_110600822 | 102 |
| 404 | 3300026118 | Ga0207675_100319399 | Ga0207675_1003193992 | 102 |
| 405 | 3300026121 | Ga0207683_10258732 | Ga0207683_102587322 | 102 |
| 406 | 3300026142 | Ga0207698_12268144 | Ga0207698_122681442 | 102 |
| 407 | 3300027866 | Ga0209813_10002337 | Ga0209813_100023374 | 102 |
| 408 | 3300027866 | Ga0209813_10208643 | Ga0209813_102086432 | 102 |
| 409 | 3300028379 | Ga0268266_10107532 | Ga0268266_101075322 | 102 |
| 410 | 3300028379 | Ga0268266_10150605 | Ga0268266_101506052 | 102 |
| 411 | 3300028380 | Ga0268265_10040061 | Ga0268265_100400612 | 102 |
| 412 | 3300028380 | Ga0268265_10285384 | Ga0268265_102853842 | 102 |
| 413 | 3300028381 | Ga0268264_11432346 | Ga0268264_114323462 | 102 |
| 414 | 3300028786 | Ga0307517_10188478 | Ga0307517_101884782 | 102 |
| 415 | 3300031616 | Ga0307508_10352242 | Ga0307508_103522422 | 102 |
| 416 | 3300031901 | Ga0307406_12058479 | Ga0307406_120584791 | 102 |
| 417 | 3300032002 | Ga0307416_101588531 | Ga0307416_1015885312 | 102 |
| 418 | 3300032004 | Ga0307414_11118879 | Ga0307414_111188792 | 102 |
| 419 | 3300032126 | Ga0307415_101744653 | Ga0307415_1017446532 | 102 |
| 420 | 3300033180 | Ga0307510_10029008 | Ga0307510_100290085 | 102 |
| 421 | 3300033180 | Ga0307510_10543663 | Ga0307510_105436632 | 102 |
| 422 | 3300035692 | Ga0373935_0614187 | Ga0373935_0614187_184_492 | 102 |
| 423 | 3300037418 | Ga0395900_0001340 | Ga0395900_0001340_9813_10124 | 102 |
| 424 | 3300037466 | Ga0395898_0005324 | Ga0395898_0005324_3828_4139 | 102 |
| 425 | 3300037471 | Ga0395905_0323135 | Ga0395905_0323135_847_1158 | 102 |
| 426 | 3300038443 | Ga0395901_0007542 | Ga0395901_0007542_9842_10153 | 102 |
| 427 | 3300041452 | Ga0451793_0234425 | Ga0451793_0234425_57_371 | 102 |
| 428 | 3300046452 | Ga0495617_218053 | Ga0495617_218053_24_332 | 102 |
| 429 | 3300046455 | Ga0495603_0105026 | Ga0495603_0105026_1254_1562 | 102 |
| 430 | 3300046457 | Ga0495590_0136332 | Ga0495590_0136332_214_522 | 102 |
| 431 | 3300046459 | Ga0495629_0002176 | Ga0495629_0002176_5153_5461 | 102 |
| 432 | 3300046460 | Ga0495638_0003637 | Ga0495638_0003637_3584_3892 | 102 |
| 433 | 3300046462 | Ga0495651_0044341 | Ga0495651_0044341_161_469 | 102 |
| 434 | 3300046473 | Ga0495582_0220606 | Ga0495582_0220606_454_762 | 102 |
| 435 | 3300046474 | Ga0495605_0077839 | Ga0495605_0077839_539_847 | 102 |
| 436 | 3300046474 | Ga0495605_0192928 | Ga0495605_0192928_388_696 | 102 |
| 437 | 3300046475 | Ga0495639_0330787 | Ga0495639_0330787_97_405 | 102 |
| 438 | 3300046491 | Ga0495584_0283649 | Ga0495584_0283649_378_686 | 102 |
| 439 | 3300046491 | Ga0495584_0488166 | Ga0495584_0488166_273_581 | 102 |
| 440 | 3300046499 | Ga0495594_0503997 | Ga0495594_0503997_274_582 | 102 |
| 441 | 3300046500 | Ga0495596_0374919 | Ga0495596_0374919_70_378 | 102 |
| 442 | 3300046501 | Ga0495607_0249394 | Ga0495607_0249394_142_450 | 102 |
| 443 | 3300046506 | Ga0495583_0138794 | Ga0495583_0138794_358_666 | 102 |
| 444 | 3300046507 | Ga0495606_0105646 | Ga0495606_0105646_1284_1592 | 102 |
| 445 | 3300046507 | Ga0495606_0123928 | Ga0495606_0123928_540_848 | 102 |
| 446 | 3300046511 | Ga0495608_0332238 | Ga0495608_0332238_346_654 | 102 |
| 447 | 3300046512 | Ga0495610_0043333 | Ga0495610_0043333_1648_1956 | 102 |
| 448 | 3300046512 | Ga0495610_0342266 | Ga0495610_0342266_53_361 | 102 |
| 449 | 3300046513 | Ga0495616_0038082 | Ga0495616_0038082_1371_1679 | 102 |
| 450 | 3300046513 | Ga0495616_0132259 | Ga0495616_0132259_618_926 | 102 |
| 451 | 3300046514 | Ga0495618_0114807 | Ga0495618_0114807_291_599 | 102 |
| 452 | 3300046515 | Ga0495620_0022772 | Ga0495620_0022772_1791_2099 | 102 |
| 453 | 3300046515 | Ga0495620_0110632 | Ga0495620_0110632_598_906 | 102 |
| 454 | 3300046516 | Ga0495628_0321728 | Ga0495628_0321728_619_927 | 102 |
| 455 | 3300046518 | Ga0495631_0198376 | Ga0495631_0198376_507_815 | 102 |
| 456 | 3300046518 | Ga0495631_0313464 | Ga0495631_0313464_62_370 | 102 |
| 457 | 3300046519 | Ga0495632_0150242 | Ga0495632_0150242_156_464 | 102 |
| 458 | 3300046519 | Ga0495632_0264694 | Ga0495632_0264694_367_675 | 102 |
| 459 | 3300046522 | Ga0495643_0123112 | Ga0495643_0123112_761_1069 | 102 |
| 460 | 3300046522 | Ga0495643_0248761 | Ga0495643_0248761_433_741 | 102 |
| 461 | 3300046524 | Ga0495648_0018514 | Ga0495648_0018514_3754_4062 | 102 |
| 462 | 3300046524 | Ga0495648_0077660 | Ga0495648_0077660_1112_1420 | 102 |
| 463 | 3300046526 | Ga0495666_0392084 | Ga0495666_0392084_181_489 | 102 |
| 464 | 3300046529 | Ga0495652_0975551 | Ga0495652_0975551_113_421 | 102 |
| 465 | 3300046530 | Ga0495654_0213818 | Ga0495654_0213818_73_381 | 102 |
| 466 | 3300046531 | Ga0495665_0316575 | Ga0495665_0316575_418_726 | 102 |
| 467 | 3300046533 | Ga0495640_0034933 | Ga0495640_0034933_282_590 | 102 |
| 468 | 3300046538 | Ga0495609_0109965 | Ga0495609_0109965_492_800 | 102 |
| 469 | 3300046542 | Ga0495597_0031555 | Ga0495597_0031555_941_1249 | 102 |
| 470 | 3300046542 | Ga0495597_0068663 | Ga0495597_0068663_84_392 | 102 |
| 471 | 3300046557 | Ga0495622_0058693 | Ga0495622_0058693_1288_1596 | 102 |
| 472 | 3300046616 | Ga0495668_0105757 | Ga0495668_0105757_145_453 | 102 |
| 473 | 3300046642 | Ga0495634_0045232 | Ga0495634_0045232_1694_2002 | 102 |
| 474 | 3300046648 | Ga0495611_0204822 | Ga0495611_0204822_233_541 | 102 |
| 475 | 3300046660 | Ga0495625_0130144 | Ga0495625_0130144_658_966 | 102 |
| 476 | 3300046660 | Ga0495625_0344503 | Ga0495625_0344503_517_825 | 102 |
| 477 | 3300046663 | Ga0495635_0156040 | Ga0495635_0156040_424_732 | 102 |
| 478 | 3300046674 | Ga0495588_0002998 | Ga0495588_0002998_1475_1783 | 102 |
| 479 | 3300046675 | Ga0495657_0004548 | Ga0495657_0004548_5723_6031 | 102 |
| 480 | 3300046678 | Ga0495599_0314930 | Ga0495599_0314930_283_591 | 102 |
| 481 | 3300046680 | Ga0495646_0275801 | Ga0495646_0275801_430_738 | 102 |
| 482 | 3300046684 | Ga0495669_0234087 | Ga0495669_0234087_362_670 | 102 |
| 483 | 3300046689 | Ga0495613_0011844 | Ga0495613_0011844_1530_1838 | 102 |
| 484 | 3300046694 | Ga0495649_0077025 | Ga0495649_0077025_181_489 | 102 |
| 485 | 3300046694 | Ga0495649_0284591 | Ga0495649_0284591_87_395 | 102 |
| 486 | 3300046694 | Ga0495649_0593727 | Ga0495649_0593727_163_471 | 102 |
| 487 | 3300046794 | Ga0495589_0095970 | Ga0495589_0095970_597_905 | 102 |
| 488 | 3300046809 | Ga0495600_0008582 | Ga0495600_0008582_5266_5574 | 102 |
| 489 | 3300046810 | Ga0495660_0156750 | Ga0495660_0156750_328_636 | 102 |
| 490 | 3300046810 | Ga0495660_0284086 | Ga0495660_0284086_315_623 | 102 |
| 491 | 3300047315 | Ga0495581_0146908 | Ga0495581_0146908_652_960 | 102 |
| 492 | 3300047317 | Ga0495604_0014161 | Ga0495604_0014161_5079_5387 | 102 |
| 493 | 3300047320 | Ga0495672_0272711 | Ga0495672_0272711_250_558 | 102 |
| 494 | 3300047323 | Ga0495683_0045400 | Ga0495683_0045400_1711_2019 | 102 |
| 495 | 3300047323 | Ga0495683_0199158 | Ga0495683_0199158_152_460 | 102 |
| 496 | 3300047443 | Ga0495687_075690 | Ga0495687_075690_601_909 | 102 |
| 497 | 3300047443 | Ga0495687_223117 | Ga0495687_223117_145_453 | 102 |
| 498 | 3300047445 | Ga0495677_0316880 | Ga0495677_0316880_89_397 | 102 |
| 499 | 3300047471 | Ga0495684_0554012 | Ga0495684_0554012_124_432 | 102 |
| 500 | 3300047472 | Ga0495686_0318563 | Ga0495686_0318563_97_405 | 102 |
| 501 | 3300047472 | Ga0495686_0362894 | Ga0495686_0362894_415_729 | 102 |
| 502 | 3300048088 | Ga0495602_0138950 | Ga0495602_0138950_1314_1622 | 102 |
| 503 | 3300048089 | Ga0495614_0343850 | Ga0495614_0343850_227_535 | 102 |
| 504 | 3300048091 | Ga0495626_0080213 | Ga0495626_0080213_559_867 | 102 |
| 505 | 3300048903 | Ga0496100_0208245 | Ga0496100_0208245_380_688 | 102 |
| 506 | 3300048903 | Ga0496100_0238632 | Ga0496100_0238632_526_834 | 102 |
| 507 | 3300048904 | Ga0496101_0031612 | Ga0496101_0031612_713_1021 | 102 |
| 508 | 3300048904 | Ga0496101_0035824 | Ga0496101_0035824_2924_3232 | 102 |
| 509 | 3300048905 | Ga0496102_0156191 | Ga0496102_0156191_612_920 | 102 |
| 510 | 3300048905 | Ga0496102_0277617 | Ga0496102_0277617_924_1232 | 102 |
| 511 | 3300048906 | Ga0496103_0014126 | Ga0496103_0014126_1509_1817 | 102 |
| 512 | 3300048906 | Ga0496103_0934490 | Ga0496103_0934490_175_489 | 102 |
| 513 | 3300048907 | Ga0496104_0047099 | Ga0496104_0047099_1625_1933 | 102 |
| 514 | 3300048907 | Ga0496104_0283464 | Ga0496104_0283464_893_1201 | 102 |
| 515 | 3300048907 | Ga0496104_0354234 | Ga0496104_0354234_1003_1311 | 102 |
| 516 | 3300048909 | Ga0496106_0056082 | Ga0496106_0056082_1049_1357 | 102 |
| 517 | 3300048909 | Ga0496106_1509940 | Ga0496106_1509940_47_355 | 102 |
| 518 | 3300048910 | Ga0496107_0234497 | Ga0496107_0234497_134_442 | 102 |
| 519 | 3300048910 | Ga0496107_0833102 | Ga0496107_0833102_316_624 | 102 |
| 520 | 3300048911 | Ga0496108_0436706 | Ga0496108_0436706_601_909 | 102 |
| 521 | 3300048912 | Ga0496109_0069711 | Ga0496109_0069711_95_403 | 102 |
| 522 | 3300048912 | Ga0496109_0592670 | Ga0496109_0592670_129_437 | 102 |
| 523 | 3300048913 | Ga0496110_0051284 | Ga0496110_0051284_1165_1473 | 102 |
| 524 | 3300048913 | Ga0496110_0549553 | Ga0496110_0549553_80_388 | 102 |
| 525 | 3300048914 | Ga0496111_0327383 | Ga0496111_0327383_134_442 | 102 |
| 526 | 3300048915 | Ga0496112_0070474 | Ga0496112_0070474_2263_2571 | 102 |
| 527 | 3300048915 | Ga0496112_0451914 | Ga0496112_0451914_410_718 | 102 |
| 528 | 3300048916 | Ga0496113_0620375 | Ga0496113_0620375_453_761 | 102 |
| 529 | 3300048916 | Ga0496113_0841429 | Ga0496113_0841429_402_710 | 102 |
| 530 | 3300048917 | Ga0496114_0021565 | Ga0496114_0021565_2809_3117 | 102 |
| 531 | 3300048918 | Ga0496115_0298016 | Ga0496115_0298016_502_810 | 102 |
| 532 | 3300048918 | Ga0496115_0779387 | Ga0496115_0779387_189_497 | 102 |
| 533 | 3300048919 | Ga0496116_0063414 | Ga0496116_0063414_1842_2150 | 102 |
| 534 | 3300048920 | Ga0496117_0063496 | Ga0496117_0063496_899_1207 | 102 |
| 535 | 3300048920 | Ga0496117_0176090 | Ga0496117_0176090_781_1095 | 102 |
| 536 | 3300048920 | Ga0496117_0263275 | Ga0496117_0263275_505_813 | 102 |
| 537 | 3300048921 | Ga0496118_0061109 | Ga0496118_0061109_2133_2441 | 102 |
| 538 | 3300048921 | Ga0496118_0210262 | Ga0496118_0210262_580_888 | 102 |
| 539 | 3300048922 | Ga0496119_0004759 | Ga0496119_0004759_6557_6865 | 102 |
| 540 | 3300048922 | Ga0496119_0162193 | Ga0496119_0162193_707_1021 | 102 |
| 541 | 3300048922 | Ga0496119_0506767 | Ga0496119_0506767_140_448 | 102 |
| 542 | 3300048923 | Ga0496120_0011234 | Ga0496120_0011234_3546_3854 | 102 |
| 543 | 3300048923 | Ga0496120_0278911 | Ga0496120_0278911_164_472 | 102 |
| 544 | 3300048923 | Ga0496120_0483551 | Ga0496120_0483551_38_346 | 102 |
| 545 | 3300048924 | Ga0496121_0067065 | Ga0496121_0067065_1451_1759 | 102 |
| 546 | 3300048924 | Ga0496121_0109120 | Ga0496121_0109120_48_356 | 102 |
| 547 | 3300048924 | Ga0496121_0298971 | Ga0496121_0298971_133_441 | 102 |
| 548 | 3300048925 | Ga0496122_0349071 | Ga0496122_0349071_448_756 | 102 |
| 549 | 3300048926 | Ga0496123_0245719 | Ga0496123_0245719_396_704 | 102 |
| 550 | 3300048927 | Ga0496124_0199891 | Ga0496124_0199891_1069_1377 | 102 |
| 551 | 3300048927 | Ga0496124_0237878 | Ga0496124_0237878_886_1194 | 102 |
| 552 | 3300048927 | Ga0496124_0783328 | Ga0496124_0783328_47_355 | 102 |
| 553 | 3300048928 | Ga0496125_0239845 | Ga0496125_0239845_376_684 | 102 |
| 554 | 3300048929 | Ga0496126_0067946 | Ga0496126_0067946_164_472 | 102 |
| 555 | 3300048929 | Ga0496126_0905477 | Ga0496126_0905477_257_565 | 102 |
| 556 | 3300049460 | Ga0495682_0050610 | Ga0495682_0050610_597_905 | 102 |
| 557 | 3300050489 | nmdc:mga03683_150490_c1 | nmdc:mga03683_150490_c1_553_861 | 102 |
| 558 | 3300050490 | nmdc:mga03n38_30594_c1 | nmdc:mga03n38_30594_c1_1262_1570 | 102 |
| 559 | 3300050491 | nmdc:mga00v17_51191_c1 | nmdc:mga00v17_51191_c1_1925_2233 | 102 |
| 560 | 3300050492 | nmdc:mga0yw44_165693_c1 | nmdc:mga0yw44_165693_c1_368_676 | 102 |
| 561 | 3300050493 | nmdc:mga0k408_85455_c1 | nmdc:mga0k408_85455_c1_1306_1614 | 102 |
| 562 | 3300050494 | nmdc:mga06z11_594653_c1 | nmdc:mga06z11_594653_c1_341_649 | 102 |
| 563 | 3300050494 | nmdc:mga06z11_869202_c1 | nmdc:mga06z11_869202_c1_163_474 | 102 |
| 564 | 3300050495 | nmdc:mga04h51_239456_c1 | nmdc:mga04h51_239456_c1_214_522 | 102 |
| 565 | 3300050495 | nmdc:mga04h51_30802_c1 | nmdc:mga04h51_30802_c1_791_1099 | 102 |
| 566 | 3300050496 | nmdc:mga07m45_157563_c1 | nmdc:mga07m45_157563_c1_368_676 | 102 |
| 567 | 3300050496 | nmdc:mga07m45_511601_c1 | nmdc:mga07m45_511601_c1_247_555 | 102 |
| 568 | 3300050516 | nmdc:mga0sz30_57816_c1 | nmdc:mga0sz30_57816_c1_790_1098 | 102 |
| 569 | 3300053077 | Ga0495601_0399700 | Ga0495601_0399700_399_707 | 102 |
| 570 | 3300053080 | Ga0500635_0052270 | Ga0500635_0052270_376_684 | 102 |
| 571 | 3300053083 | Ga0495655_0036092 | Ga0495655_0036092_387_695 | 102 |
| 572 | 3300053085 | Ga0495619_0521281 | Ga0495619_0521281_70_378 | 102 |
| 573 | 3300053086 | Ga0500578_0089840 | Ga0500578_0089840_1187_1495 | 102 |
| 574 | 3300053088 | Ga0500644_0416289 | Ga0500644_0416289_69_377 | 102 |
| 575 | 3300053093 | Ga0500651_0221522 | Ga0500651_0221522_731_1039 | 102 |
| 576 | 3300053094 | Ga0500566_0000780 | Ga0500566_0000780_7576_7884 | 102 |
| 577 | 3300053096 | Ga0500641_0220012 | Ga0500641_0220012_419_727 | 102 |
| 578 | 3300053104 | Ga0500556_0011510 | Ga0500556_0011510_172_480 | 102 |
| 579 | 3300053108 | Ga0500562_017834 | Ga0500562_017834_171_479 | 102 |
| 580 | 3300053119 | Ga0500595_184201 | Ga0500595_184201_80_388 | 102 |
| 581 | 3300053130 | Ga0500642_0129229 | Ga0500642_0129229_54_362 | 102 |
| 582 | 3300053134 | Ga0500658_0219063 | Ga0500658_0219063_410_718 | 102 |
| 583 | 3300053136 | Ga0500559_0187609 | Ga0500559_0187609_163_471 | 102 |
| 584 | 3300053148 | Ga0500590_174738 | Ga0500590_174738_510_818 | 102 |
| 585 | 3300053151 | Ga0500604_0205667 | Ga0500604_0205667_314_622 | 102 |
| 586 | 3300053153 | Ga0500616_0023318 | Ga0500616_0023318_2873_3181 | 102 |
| 587 | 3300053156 | Ga0500622_0017062 | Ga0500622_0017062_1708_2016 | 102 |
| 588 | 3300053160 | Ga0500633_0219779 | Ga0500633_0219779_132_440 | 102 |
| 589 | 3300053162 | Ga0500638_139274 | Ga0500638_139274_130_438 | 102 |
| 590 | 3300053722 | Ga0500649_056880 | Ga0500649_056880_1098_1406 | 102 |
| 591 | 3300053730 | Ga0500645_046585 | Ga0500645_046585_332_640 | 102 |
| 592 | 3300053732 | Ga0500656_005804 | Ga0500656_005804_41_349 | 102 |
| 593 | 3300053733 | Ga0500552_001347 | Ga0500552_001347_1617_1925 | 102 |
| 594 | 3300053735 | Ga0500596_030737 | Ga0500596_030737_499_807 | 102 |
| 595 | 3300053736 | Ga0500599_000973 | Ga0500599_000973_590_898 | 102 |
| 596 | 3300055283 | Ga0500661_040852 | Ga0500661_040852_323_631 | 102 |
| 597 | 3300061734 | Ga0530510_0333709 | Ga0530510_0333709_86_400 | 102 |
| 598 | 3300005329 | Ga0070683_100025330 | Ga0070683_1000253303 | 103 |
| 599 | 3300005336 | Ga0070680_100028590 | Ga0070680_1000285905 | 103 |
| 600 | 3300005434 | Ga0070709_10000375 | Ga0070709_1000037517 | 103 |
| 601 | 3300005435 | Ga0070714_100047429 | Ga0070714_1000474292 | 103 |
| 602 | 3300005436 | Ga0070713_100061380 | Ga0070713_1000613802 | 103 |
| 603 | 3300005436 | Ga0070713_100179267 | Ga0070713_1001792672 | 103 |
| 604 | 3300005437 | Ga0070710_10000275 | Ga0070710_1000027512 | 103 |
| 605 | 3300005439 | Ga0070711_100006414 | Ga0070711_1000064142 | 103 |
| 606 | 3300005455 | Ga0070663_101204035 | Ga0070663_1012040352 | 103 |
| 607 | 3300005458 | Ga0070681_10083478 | Ga0070681_100834782 | 103 |
| 608 | 3300005530 | Ga0070679_100039917 | Ga0070679_1000399174 | 103 |
| 609 | 3300005535 | Ga0070684_100012084 | Ga0070684_1000120845 | 103 |
| 610 | 3300005563 | Ga0068855_100504151 | Ga0068855_1005041512 | 103 |
| 611 | 3300005577 | Ga0068857_101653182 | Ga0068857_1016531822 | 103 |
| 612 | 3300005842 | Ga0068858_101166827 | Ga0068858_1011668272 | 103 |
| 613 | 3300006028 | Ga0070717_10061154 | Ga0070717_100611542 | 103 |
| 614 | 3300006028 | Ga0070717_10756156 | Ga0070717_107561562 | 103 |
| 615 | 3300006048 | Ga0075363_100553947 | Ga0075363_1005539472 | 103 |
| 616 | 3300006163 | Ga0070715_10063040 | Ga0070715_100630402 | 103 |
| 617 | 3300006173 | Ga0070716_100012144 | Ga0070716_1000121442 | 103 |
| 618 | 3300006173 | Ga0070716_101088412 | Ga0070716_1010884122 | 103 |
| 619 | 3300006175 | Ga0070712_100121246 | Ga0070712_1001212462 | 103 |
| 620 | 3300006178 | Ga0075367_10346154 | Ga0075367_103461542 | 103 |
| 621 | 3300009148 | Ga0105243_11121110 | Ga0105243_111211101 | 103 |
| 622 | 3300009545 | Ga0105237_11676315 | Ga0105237_116763152 | 103 |
| 623 | 3300009551 | Ga0105238_11991246 | Ga0105238_119912462 | 103 |
| 624 | 3300013105 | Ga0157369_10087077 | Ga0157369_100870772 | 103 |
| 625 | 3300013105 | Ga0157369_10922613 | Ga0157369_109226132 | 103 |
| 626 | 3300013307 | Ga0157372_10147969 | Ga0157372_101479692 | 103 |
| 627 | 3300017792 | Ga0163161_10546167 | Ga0163161_105461672 | 103 |
| 628 | 3300020070 | Ga0206356_11101795 | Ga0206356_111017951 | 103 |
| 629 | 3300021358 | Ga0213873_10007009 | Ga0213873_100070092 | 103 |
| 630 | 3300021384 | Ga0213876_10001785 | Ga0213876_100017855 | 103 |
| 631 | 3300025898 | Ga0207692_10000229 | Ga0207692_100002298 | 103 |
| 632 | 3300025906 | Ga0207699_10000242 | Ga0207699_1000024218 | 103 |
| 633 | 3300025909 | Ga0207705_10326558 | Ga0207705_103265582 | 103 |
| 634 | 3300025912 | Ga0207707_10045519 | Ga0207707_100455192 | 103 |
| 635 | 3300025914 | Ga0207671_10855664 | Ga0207671_108556642 | 103 |
| 636 | 3300025915 | Ga0207693_10145064 | Ga0207693_101450642 | 103 |
| 637 | 3300025916 | Ga0207663_10020883 | Ga0207663_100208832 | 103 |
| 638 | 3300025917 | Ga0207660_10097345 | Ga0207660_100973452 | 103 |
| 639 | 3300025921 | Ga0207652_10302653 | Ga0207652_103026532 | 103 |
| 640 | 3300025928 | Ga0207700_10024263 | Ga0207700_100242632 | 103 |
| 641 | 3300025928 | Ga0207700_10090867 | Ga0207700_100908672 | 103 |
| 642 | 3300025929 | Ga0207664_10523687 | Ga0207664_105236871 | 103 |
| 643 | 3300025939 | Ga0207665_10009934 | Ga0207665_100099344 | 103 |
| 644 | 3300026035 | Ga0207703_10635946 | Ga0207703_106359462 | 103 |
| 645 | 3300026067 | Ga0207678_10189576 | Ga0207678_101895762 | 103 |
| 646 | 3300026116 | Ga0207674_10536929 | Ga0207674_105369292 | 103 |
| 647 | 3300031250 | Ga0265331_10259707 | Ga0265331_102597072 | 103 |
| 648 | 3300032004 | Ga0307414_10966732 | Ga0307414_109667322 | 103 |
| 649 | 3300039437 | Ga0436365_0165598 | Ga0436365_0165598_178_498 | 103 |
| 650 | 3300039437 | Ga0436365_1544802 | Ga0436365_1544802_880_1212 | 103 |
| 651 | 3300039450 | Ga0436363_0139435 | Ga0436363_0139435_1097_1426 | 103 |
| 652 | 3300039450 | Ga0436363_0465325 | Ga0436363_0465325_144_476 | 103 |
| 653 | 3300039453 | Ga0436362_1167635 | Ga0436362_1167635_18_350 | 103 |
| 654 | 3300039453 | Ga0436362_1295510 | Ga0436362_1295510_1342_1674 | 103 |
| 655 | 3300048904 | Ga0496101_0822489 | Ga0496101_0822489_230_541 | 103 |
| 656 | 3300048913 | Ga0496110_0747888 | Ga0496110_0747888_503_814 | 103 |
| 657 | 3300048924 | Ga0496121_0076862 | Ga0496121_0076862_1127_1438 | 103 |
| 658 | 3300048929 | Ga0496126_0269263 | Ga0496126_0269263_185_517 | 103 |
| 659 | 3300048929 | Ga0496126_0320161 | Ga0496126_0320161_204_521 | 103 |
| 660 | 3300050490 | nmdc:mga03n38_504504_c1 | nmdc:mga03n38_504504_c1_294_626 | 103 |
| 661 | 3300050494 | nmdc:mga06z11_110142_c1 | nmdc:mga06z11_110142_c1_544_876 | 103 |
| 662 | 3300000549 | LJQas_1013109 | LJQas_10131091 | 104 |
| 663 | 3300001990 | JGI24737J22298_10006499 | JGI24737J22298_100064992 | 104 |
| 664 | 3300002067 | JGI24735J21928_10019922 | JGI24735J21928_100199222 | 104 |
| 665 | 3300002067 | JGI24735J21928_10212446 | JGI24735J21928_102124462 | 104 |
| 666 | 3300002075 | JGI24738J21930_10124708 | JGI24738J21930_101247082 | 104 |
| 667 | 3300003215 | JGI25153J46596_10002696 | JGI25153J46596_100026964 | 104 |
| 668 | 3300003215 | JGI25153J46596_10003859 | JGI25153J46596_100038594 | 104 |
| 669 | 3300003763 | Ga0055529_1027473 | Ga0055529_10274732 | 104 |
| 670 | 3300003771 | Ga0055526_1104461 | Ga0055526_11044611 | 104 |
| 671 | 3300003794 | Ga0055531_10003707 | Ga0055531_100037076 | 104 |
| 672 | 3300005262 | Ga0065165_1003638 | Ga0065165_10036386 | 104 |
| 673 | 3300005327 | Ga0070658_10878140 | Ga0070658_108781402 | 104 |
| 674 | 3300005329 | Ga0070683_100865744 | Ga0070683_1008657442 | 104 |
| 675 | 3300005336 | Ga0070680_100363103 | Ga0070680_1003631032 | 104 |
| 676 | 3300005337 | Ga0070682_100218969 | Ga0070682_1002189692 | 104 |
| 677 | 3300005338 | Ga0068868_100017643 | Ga0068868_1000176434 | 104 |
| 678 | 3300005344 | Ga0070661_100416118 | Ga0070661_1004161181 | 104 |
| 679 | 3300005344 | Ga0070661_100512360 | Ga0070661_1005123602 | 104 |
| 680 | 3300005345 | Ga0070692_10359834 | Ga0070692_103598342 | 104 |
| 681 | 3300005347 | Ga0070668_101426098 | Ga0070668_1014260981 | 104 |
| 682 | 3300005354 | Ga0070675_101795717 | Ga0070675_1017957172 | 104 |
| 683 | 3300005364 | Ga0070673_101477395 | Ga0070673_1014773952 | 104 |
| 684 | 3300005434 | Ga0070709_10009548 | Ga0070709_100095482 | 104 |
| 685 | 3300005435 | Ga0070714_100161943 | Ga0070714_1001619432 | 104 |
| 686 | 3300005435 | Ga0070714_101989943 | Ga0070714_1019899432 | 104 |
| 687 | 3300005436 | Ga0070713_100108259 | Ga0070713_1001082592 | 104 |
| 688 | 3300005436 | Ga0070713_100159215 | Ga0070713_1001592152 | 104 |
| 689 | 3300005437 | Ga0070710_10010323 | Ga0070710_100103235 | 104 |
| 690 | 3300005437 | Ga0070710_10048124 | Ga0070710_100481242 | 104 |
| 691 | 3300005439 | Ga0070711_100012405 | Ga0070711_1000124054 | 104 |
| 692 | 3300005439 | Ga0070711_100031039 | Ga0070711_1000310393 | 104 |
| 693 | 3300005455 | Ga0070663_100964815 | Ga0070663_1009648151 | 104 |
| 694 | 3300005455 | Ga0070663_101398573 | Ga0070663_1013985731 | 104 |
| 695 | 3300005457 | Ga0070662_100262735 | Ga0070662_1002627352 | 104 |
| 696 | 3300005457 | Ga0070662_100286317 | Ga0070662_1002863172 | 104 |
| 697 | 3300005457 | Ga0070662_100835789 | Ga0070662_1008357891 | 104 |
| 698 | 3300005458 | Ga0070681_10077381 | Ga0070681_100773813 | 104 |
| 699 | 3300005459 | Ga0068867_101388401 | Ga0068867_1013884011 | 104 |
| 700 | 3300005530 | Ga0070679_100434699 | Ga0070679_1004346991 | 104 |
| 701 | 3300005530 | Ga0070679_101406501 | Ga0070679_1014065011 | 104 |
| 702 | 3300005535 | Ga0070684_100633947 | Ga0070684_1006339472 | 104 |
| 703 | 3300005539 | Ga0068853_100222490 | Ga0068853_1002224902 | 104 |
| 704 | 3300005539 | Ga0068853_100411183 | Ga0068853_1004111831 | 104 |
| 705 | 3300005539 | Ga0068853_100888133 | Ga0068853_1008881332 | 104 |
| 706 | 3300005547 | Ga0070693_100137993 | Ga0070693_1001379932 | 104 |
| 707 | 3300005547 | Ga0070693_100560893 | Ga0070693_1005608932 | 104 |
| 708 | 3300005563 | Ga0068855_100022264 | Ga0068855_1000222645 | 104 |
| 709 | 3300005563 | Ga0068855_100032650 | Ga0068855_1000326505 | 104 |
| 710 | 3300005563 | Ga0068855_101958389 | Ga0068855_1019583891 | 104 |
| 711 | 3300005577 | Ga0068857_100015131 | Ga0068857_1000151312 | 104 |
| 712 | 3300005578 | Ga0068854_100094223 | Ga0068854_1000942233 | 104 |
| 713 | 3300005578 | Ga0068854_100919635 | Ga0068854_1009196351 | 104 |
| 714 | 3300005578 | Ga0068854_101783430 | Ga0068854_1017834302 | 104 |
| 715 | 3300005614 | Ga0068856_100051263 | Ga0068856_1000512632 | 104 |
| 716 | 3300005614 | Ga0068856_101079199 | Ga0068856_1010791992 | 104 |
| 717 | 3300005616 | Ga0068852_100141894 | Ga0068852_1001418943 | 104 |
| 718 | 3300005616 | Ga0068852_100335389 | Ga0068852_1003353892 | 104 |
| 719 | 3300005616 | Ga0068852_100739188 | Ga0068852_1007391882 | 104 |
| 720 | 3300005718 | Ga0068866_10908821 | Ga0068866_109088212 | 104 |
| 721 | 3300005842 | Ga0068858_102468586 | Ga0068858_1024685861 | 104 |
| 722 | 3300005937 | Ga0081455_10173674 | Ga0081455_101736742 | 104 |
| 723 | 3300005983 | Ga0081540_1023738 | Ga0081540_10237382 | 104 |
| 724 | 3300005985 | Ga0081539_10230483 | Ga0081539_102304831 | 104 |
| 725 | 3300006028 | Ga0070717_10324252 | Ga0070717_103242522 | 104 |
| 726 | 3300006038 | Ga0075365_10120219 | Ga0075365_101202192 | 104 |
| 727 | 3300006038 | Ga0075365_10148633 | Ga0075365_101486332 | 104 |
| 728 | 3300006038 | Ga0075365_10154768 | Ga0075365_101547682 | 104 |
| 729 | 3300006038 | Ga0075365_10536388 | Ga0075365_105363882 | 104 |
| 730 | 3300006048 | Ga0075363_100982277 | Ga0075363_1009822772 | 104 |
| 731 | 3300006051 | Ga0075364_10128150 | Ga0075364_101281502 | 104 |
| 732 | 3300006051 | Ga0075364_10485675 | Ga0075364_104856752 | 104 |
| 733 | 3300006175 | Ga0070712_100079181 | Ga0070712_1000791811 | 104 |
| 734 | 3300006175 | Ga0070712_100107849 | Ga0070712_1001078492 | 104 |
| 735 | 3300006175 | Ga0070712_100202978 | Ga0070712_1002029782 | 104 |
| 736 | 3300006175 | Ga0070712_101014354 | Ga0070712_1010143542 | 104 |
| 737 | 3300006177 | Ga0075362_10167070 | Ga0075362_101670702 | 104 |
| 738 | 3300006178 | Ga0075367_10077749 | Ga0075367_100777492 | 104 |
| 739 | 3300006186 | Ga0075369_10015750 | Ga0075369_100157502 | 104 |
| 740 | 3300006186 | Ga0075369_10077278 | Ga0075369_100772782 | 104 |
| 741 | 3300006186 | Ga0075369_10109164 | Ga0075369_101091642 | 104 |
| 742 | 3300006195 | Ga0075366_10084812 | Ga0075366_100848122 | 104 |
| 743 | 3300006353 | Ga0075370_10083443 | Ga0075370_100834432 | 104 |
| 744 | 3300006353 | Ga0075370_10217076 | Ga0075370_102170762 | 104 |
| 745 | 3300006881 | Ga0068865_100134925 | Ga0068865_1001349252 | 104 |
| 746 | 3300006881 | Ga0068865_101049462 | Ga0068865_1010494622 | 104 |
| 747 | 3300006941 | Ga0099825_1035725 | Ga0099825_10357252 | 104 |
| 748 | 3300006944 | Ga0099823_1033450 | Ga0099823_10334502 | 104 |
| 749 | 3300007265 | Ga0099794_10310580 | Ga0099794_103105802 | 104 |
| 750 | 3300007788 | Ga0099795_10420302 | Ga0099795_104203022 | 104 |
| 751 | 3300009093 | Ga0105240_10005310 | Ga0105240_1000531015 | 104 |
| 752 | 3300009093 | Ga0105240_10029763 | Ga0105240_100297632 | 104 |
| 753 | 3300009093 | Ga0105240_10092127 | Ga0105240_100921274 | 104 |
| 754 | 3300009098 | Ga0105245_10144713 | Ga0105245_101447132 | 104 |
| 755 | 3300009098 | Ga0105245_11055864 | Ga0105245_110558642 | 104 |
| 756 | 3300009101 | Ga0105247_11708364 | Ga0105247_117083642 | 104 |
| 757 | 3300009148 | Ga0105243_11372652 | Ga0105243_113726522 | 104 |
| 758 | 3300009148 | Ga0105243_11716263 | Ga0105243_117162632 | 104 |
| 759 | 3300009148 | Ga0105243_11874069 | Ga0105243_118740692 | 104 |
| 760 | 3300009148 | Ga0105243_12640293 | Ga0105243_126402932 | 104 |
| 761 | 3300009174 | Ga0105241_10173482 | Ga0105241_101734821 | 104 |
| 762 | 3300009174 | Ga0105241_11059685 | Ga0105241_110596852 | 104 |
| 763 | 3300009174 | Ga0105241_12288879 | Ga0105241_122888792 | 104 |
| 764 | 3300009176 | Ga0105242_10291632 | Ga0105242_102916322 | 104 |
| 765 | 3300009177 | Ga0105248_11036153 | Ga0105248_110361532 | 104 |
| 766 | 3300009177 | Ga0105248_11934715 | Ga0105248_119347151 | 104 |
| 767 | 3300009177 | Ga0105248_11953603 | Ga0105248_119536031 | 104 |
| 768 | 3300009545 | Ga0105237_10052970 | Ga0105237_100529701 | 104 |
| 769 | 3300009545 | Ga0105237_10055134 | Ga0105237_100551342 | 104 |
| 770 | 3300009545 | Ga0105237_11734707 | Ga0105237_117347072 | 104 |
| 771 | 3300009551 | Ga0105238_10096450 | Ga0105238_100964502 | 104 |
| 772 | 3300010159 | Ga0099796_10022044 | Ga0099796_100220442 | 104 |
| 773 | 3300010159 | Ga0099796_10067417 | Ga0099796_100674172 | 104 |
| 774 | 3300010159 | Ga0099796_10255364 | Ga0099796_102553642 | 104 |
| 775 | 3300010375 | Ga0105239_10019285 | Ga0105239_100192855 | 104 |
| 776 | 3300010375 | Ga0105239_10271510 | Ga0105239_102715102 | 104 |
| 777 | 3300010375 | Ga0105239_11314257 | Ga0105239_113142572 | 104 |
| 778 | 3300010375 | Ga0105239_11528042 | Ga0105239_115280422 | 104 |
| 779 | 3300010375 | Ga0105239_11724026 | Ga0105239_117240262 | 104 |
| 780 | 3300010375 | Ga0105239_12171892 | Ga0105239_121718921 | 104 |
| 781 | 3300011119 | Ga0105246_10790338 | Ga0105246_107903382 | 104 |
| 782 | 3300013104 | Ga0157370_11749053 | Ga0157370_117490532 | 104 |
| 783 | 3300013296 | Ga0157374_10624053 | Ga0157374_106240531 | 104 |
| 784 | 3300013297 | Ga0157378_10023539 | Ga0157378_100235394 | 104 |
| 785 | 3300013297 | Ga0157378_10551974 | Ga0157378_105519742 | 104 |
| 786 | 3300013306 | Ga0163162_10101682 | Ga0163162_101016823 | 104 |
| 787 | 3300013306 | Ga0163162_10456872 | Ga0163162_104568722 | 104 |
| 788 | 3300013306 | Ga0163162_11106090 | Ga0163162_111060902 | 104 |
| 789 | 3300014325 | Ga0163163_10417607 | Ga0163163_104176072 | 104 |
| 790 | 3300014326 | Ga0157380_11622522 | Ga0157380_116225222 | 104 |
| 791 | 3300015265 | Ga0182005_1148057 | Ga0182005_11480571 | 104 |
| 792 | 3300020080 | Ga0206350_11568595 | Ga0206350_115685952 | 104 |
| 793 | 3300021320 | Ga0214544_1000011 | Ga0214544_1000011178 | 104 |
| 794 | 3300021321 | Ga0214542_1000009 | Ga0214542_100000964 | 104 |
| 795 | 3300021324 | Ga0214545_1000007 | Ga0214545_1000007178 | 104 |
| 796 | 3300021327 | Ga0214543_1000020 | Ga0214543_100002064 | 104 |
| 797 | 3300021384 | Ga0213876_10271545 | Ga0213876_102715452 | 104 |
| 798 | 3300021384 | Ga0213876_10793367 | Ga0213876_107933672 | 104 |
| 799 | 3300023224 | Ga0224575_103461 | Ga0224575_1034612 | 104 |
| 800 | 3300024227 | Ga0228598_1021839 | Ga0228598_10218392 | 104 |
| 801 | 3300025254 | Ga0209148_1001000 | Ga0209148_100100016 | 104 |
| 802 | 3300025272 | Ga0209455_1014091 | Ga0209455_10140911 | 104 |
| 803 | 3300025272 | Ga0209455_1052029 | Ga0209455_10520292 | 104 |
| 804 | 3300025273 | Ga0209673_1057707 | Ga0209673_10577072 | 104 |
| 805 | 3300025295 | Ga0209564_1002110 | Ga0209564_100211013 | 104 |
| 806 | 3300025295 | Ga0209564_1074784 | Ga0209564_10747842 | 104 |
| 807 | 3300025297 | Ga0209758_1000206 | Ga0209758_100020667 | 104 |
| 808 | 3300025297 | Ga0209758_1001267 | Ga0209758_10012672 | 104 |
| 809 | 3300025297 | Ga0209758_1001347 | Ga0209758_10013474 | 104 |
| 810 | 3300025297 | Ga0209758_1003015 | Ga0209758_100301511 | 104 |
| 811 | 3300025299 | Ga0209256_1009375 | Ga0209256_10093754 | 104 |
| 812 | 3300025299 | Ga0209256_1040740 | Ga0209256_10407402 | 104 |
| 813 | 3300025302 | Ga0207426_1000799 | Ga0207426_100079931 | 104 |
| 814 | 3300025302 | Ga0207426_1062557 | Ga0207426_10625572 | 104 |
| 815 | 3300025303 | Ga0209051_1057036 | Ga0209051_10570362 | 104 |
| 816 | 3300025304 | Ga0209257_1000394 | Ga0209257_100039467 | 104 |
| 817 | 3300025304 | Ga0209257_1073716 | Ga0209257_10737162 | 104 |
| 818 | 3300025315 | Ga0207697_10516397 | Ga0207697_105163972 | 104 |
| 819 | 3300025898 | Ga0207692_10017900 | Ga0207692_100179004 | 104 |
| 820 | 3300025898 | Ga0207692_10022882 | Ga0207692_100228822 | 104 |
| 821 | 3300025899 | Ga0207642_11101092 | Ga0207642_111010922 | 104 |
| 822 | 3300025901 | Ga0207688_10080948 | Ga0207688_100809482 | 104 |
| 823 | 3300025904 | Ga0207647_10000666 | Ga0207647_1000066623 | 104 |
| 824 | 3300025904 | Ga0207647_10646773 | Ga0207647_106467732 | 104 |
| 825 | 3300025906 | Ga0207699_10028744 | Ga0207699_100287443 | 104 |
| 826 | 3300025906 | Ga0207699_10992302 | Ga0207699_109923021 | 104 |
| 827 | 3300025911 | Ga0207654_10096744 | Ga0207654_100967442 | 104 |
| 828 | 3300025912 | Ga0207707_10096707 | Ga0207707_100967072 | 104 |
| 829 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006647 | 104 |
| 830 | 3300025913 | Ga0207695_11047133 | Ga0207695_110471332 | 104 |
| 831 | 3300025914 | Ga0207671_10031050 | Ga0207671_100310504 | 104 |
| 832 | 3300025914 | Ga0207671_10317470 | Ga0207671_103174702 | 104 |
| 833 | 3300025914 | Ga0207671_10424265 | Ga0207671_104242652 | 104 |
| 834 | 3300025914 | Ga0207671_11073666 | Ga0207671_110736662 | 104 |
| 835 | 3300025915 | Ga0207693_10019358 | Ga0207693_100193584 | 104 |
| 836 | 3300025915 | Ga0207693_10030703 | Ga0207693_100307033 | 104 |
| 837 | 3300025915 | Ga0207693_10078755 | Ga0207693_100787553 | 104 |
| 838 | 3300025916 | Ga0207663_10010554 | Ga0207663_100105544 | 104 |
| 839 | 3300025916 | Ga0207663_10028190 | Ga0207663_100281902 | 104 |
| 840 | 3300025916 | Ga0207663_10489033 | Ga0207663_104890332 | 104 |
| 841 | 3300025917 | Ga0207660_10064743 | Ga0207660_100647432 | 104 |
| 842 | 3300025919 | Ga0207657_10304852 | Ga0207657_103048521 | 104 |
| 843 | 3300025919 | Ga0207657_10463605 | Ga0207657_104636051 | 104 |
| 844 | 3300025920 | Ga0207649_10669358 | Ga0207649_106693581 | 104 |
| 845 | 3300025920 | Ga0207649_10994823 | Ga0207649_109948232 | 104 |
| 846 | 3300025921 | Ga0207652_11387261 | Ga0207652_113872612 | 104 |
| 847 | 3300025924 | Ga0207694_10026352 | Ga0207694_100263524 | 104 |
| 848 | 3300025924 | Ga0207694_10581024 | Ga0207694_105810242 | 104 |
| 849 | 3300025927 | Ga0207687_10015530 | Ga0207687_100155306 | 104 |
| 850 | 3300025927 | Ga0207687_10374910 | Ga0207687_103749102 | 104 |
| 851 | 3300025928 | Ga0207700_10785940 | Ga0207700_107859402 | 104 |
| 852 | 3300025928 | Ga0207700_11916042 | Ga0207700_119160421 | 104 |
| 853 | 3300025929 | Ga0207664_10440266 | Ga0207664_104402662 | 104 |
| 854 | 3300025933 | Ga0207706_10024351 | Ga0207706_100243512 | 104 |
| 855 | 3300025934 | Ga0207686_10203590 | Ga0207686_102035902 | 104 |
| 856 | 3300025935 | Ga0207709_11308508 | Ga0207709_113085082 | 104 |
| 857 | 3300025935 | Ga0207709_11651221 | Ga0207709_116512212 | 104 |
| 858 | 3300025937 | Ga0207669_10567335 | Ga0207669_105673352 | 104 |
| 859 | 3300025939 | Ga0207665_10029272 | Ga0207665_100292723 | 104 |
| 860 | 3300025939 | Ga0207665_10198073 | Ga0207665_101980732 | 104 |
| 861 | 3300025941 | Ga0207711_10471297 | Ga0207711_104712972 | 104 |
| 862 | 3300025941 | Ga0207711_10964760 | Ga0207711_109647602 | 104 |
| 863 | 3300025945 | Ga0207679_12062900 | Ga0207679_120629002 | 104 |
| 864 | 3300025949 | Ga0207667_10020145 | Ga0207667_100201452 | 104 |
| 865 | 3300025949 | Ga0207667_10026155 | Ga0207667_100261554 | 104 |
| 866 | 3300025949 | Ga0207667_10893107 | Ga0207667_108931072 | 104 |
| 867 | 3300025960 | Ga0207651_11179231 | Ga0207651_111792312 | 104 |
| 868 | 3300025961 | Ga0207712_11740821 | Ga0207712_117408212 | 104 |
| 869 | 3300025981 | Ga0207640_10003411 | Ga0207640_100034112 | 104 |
| 870 | 3300025981 | Ga0207640_10785565 | Ga0207640_107855652 | 104 |
| 871 | 3300025981 | Ga0207640_12178109 | Ga0207640_121781092 | 104 |
| 872 | 3300026023 | Ga0207677_10105238 | Ga0207677_101052382 | 104 |
| 873 | 3300026041 | Ga0207639_10007946 | Ga0207639_100079461 | 104 |
| 874 | 3300026041 | Ga0207639_11671874 | Ga0207639_116718742 | 104 |
| 875 | 3300026067 | Ga0207678_10139159 | Ga0207678_101391592 | 104 |
| 876 | 3300026067 | Ga0207678_10370810 | Ga0207678_103708102 | 104 |
| 877 | 3300026078 | Ga0207702_10094732 | Ga0207702_100947323 | 104 |
| 878 | 3300026078 | Ga0207702_10882907 | Ga0207702_108829072 | 104 |
| 879 | 3300026089 | Ga0207648_10310066 | Ga0207648_103100662 | 104 |
| 880 | 3300026116 | Ga0207674_10151209 | Ga0207674_101512093 | 104 |
| 881 | 3300026121 | Ga0207683_10239285 | Ga0207683_102392852 | 104 |
| 882 | 3300026121 | Ga0207683_11287893 | Ga0207683_112878932 | 104 |
| 883 | 3300026142 | Ga0207698_10009622 | Ga0207698_100096227 | 104 |
| 884 | 3300026142 | Ga0207698_10117597 | Ga0207698_101175972 | 104 |
| 885 | 3300026142 | Ga0207698_10194042 | Ga0207698_101940422 | 104 |
| 886 | 3300026142 | Ga0207698_10678094 | Ga0207698_106780941 | 104 |
| 887 | 3300026142 | Ga0207698_11643708 | Ga0207698_116437082 | 104 |
| 888 | 3300027296 | Ga0209389_1000034 | Ga0209389_100003452 | 104 |
| 889 | 3300027296 | Ga0209389_1000039 | Ga0209389_100003955 | 104 |
| 890 | 3300027357 | Ga0209589_1000038 | Ga0209589_100003868 | 104 |
| 891 | 3300027361 | Ga0209489_100023 | Ga0209489_100023125 | 104 |
| 892 | 3300027361 | Ga0209489_100087 | Ga0209489_10008755 | 104 |
| 893 | 3300027363 | Ga0209700_100090 | Ga0209700_10009062 | 104 |
| 894 | 3300027512 | Ga0209179_1141654 | Ga0209179_11416542 | 104 |
| 895 | 3300028379 | Ga0268266_10202279 | Ga0268266_102022792 | 104 |
| 896 | 3300031235 | Ga0265330_10052981 | Ga0265330_100529812 | 104 |
| 897 | 3300031235 | Ga0265330_10062358 | Ga0265330_100623582 | 104 |
| 898 | 3300031235 | Ga0265330_10064703 | Ga0265330_100647032 | 104 |
| 899 | 3300031238 | Ga0265332_10064212 | Ga0265332_100642122 | 104 |
| 900 | 3300031239 | Ga0265328_10037603 | Ga0265328_100376031 | 104 |
| 901 | 3300031239 | Ga0265328_10054793 | Ga0265328_100547932 | 104 |
| 902 | 3300031241 | Ga0265325_10016362 | Ga0265325_100163622 | 104 |
| 903 | 3300031247 | Ga0265340_10011726 | Ga0265340_100117264 | 104 |
| 904 | 3300031247 | Ga0265340_10517798 | Ga0265340_105177982 | 104 |
| 905 | 3300031249 | Ga0265339_10091647 | Ga0265339_100916472 | 104 |
| 906 | 3300031249 | Ga0265339_10125098 | Ga0265339_101250982 | 104 |
| 907 | 3300031249 | Ga0265339_10141105 | Ga0265339_101411052 | 104 |
| 908 | 3300031249 | Ga0265339_10234071 | Ga0265339_102340712 | 104 |
| 909 | 3300031250 | Ga0265331_10139281 | Ga0265331_101392812 | 104 |
| 910 | 3300031250 | Ga0265331_10145463 | Ga0265331_101454632 | 104 |
| 911 | 3300031250 | Ga0265331_10337385 | Ga0265331_103373851 | 104 |
| 912 | 3300031344 | Ga0265316_10354726 | Ga0265316_103547262 | 104 |
| 913 | 3300031344 | Ga0265316_10387372 | Ga0265316_103873722 | 104 |
| 914 | 3300031344 | Ga0265316_10448345 | Ga0265316_104483452 | 104 |
| 915 | 3300031344 | Ga0265316_10471349 | Ga0265316_104713492 | 104 |
| 916 | 3300031507 | Ga0307509_10139692 | Ga0307509_101396922 | 104 |
| 917 | 3300031595 | Ga0265313_10080822 | Ga0265313_100808222 | 104 |
| 918 | 3300031616 | Ga0307508_10724455 | Ga0307508_107244552 | 104 |
| 919 | 3300031711 | Ga0265314_10010709 | Ga0265314_100107098 | 104 |
| 920 | 3300031712 | Ga0265342_10004756 | Ga0265342_100047565 | 104 |
| 921 | 3300031712 | Ga0265342_10124830 | Ga0265342_101248302 | 104 |
| 922 | 3300031730 | Ga0307516_10578230 | Ga0307516_105782302 | 104 |
| 923 | 3300031731 | Ga0307405_10694911 | Ga0307405_106949112 | 104 |
| 924 | 3300031824 | Ga0307413_11719328 | Ga0307413_117193282 | 104 |
| 925 | 3300032126 | Ga0307415_101108416 | Ga0307415_1011084162 | 104 |
| 926 | 3300033179 | Ga0307507_10335433 | Ga0307507_103354332 | 104 |
| 927 | 3300035089 | Ga0373944_0027117 | Ga0373944_0027117_979_1296 | 104 |
| 928 | 3300035111 | Ga0373923_0039597 | Ga0373923_0039597_1039_1356 | 104 |
| 929 | 3300035113 | Ga0373936_0013718 | Ga0373936_0013718_2620_2934 | 104 |
| 930 | 3300035113 | Ga0373936_0027229 | Ga0373936_0027229_1405_1722 | 104 |
| 931 | 3300035114 | Ga0373939_0140823 | Ga0373939_0140823_177_494 | 104 |
| 932 | 3300035116 | Ga0373945_0001999 | Ga0373945_0001999_1123_1440 | 104 |
| 933 | 3300035118 | Ga0373954_0242302 | Ga0373954_0242302_339_656 | 104 |
| 934 | 3300035170 | Ga0373943_0012127 | Ga0373943_0012127_2611_2928 | 104 |
| 935 | 3300035172 | Ga0373955_0010034 | Ga0373955_0010034_1996_2313 | 104 |
| 936 | 3300035242 | Ga0373962_0129060 | Ga0373962_0129060_110_427 | 104 |
| 937 | 3300035691 | Ga0373931_0238478 | Ga0373931_0238478_470_787 | 104 |
| 938 | 3300035691 | Ga0373931_0530921 | Ga0373931_0530921_124_441 | 104 |
| 939 | 3300035692 | Ga0373935_0000800 | Ga0373935_0000800_2459_2776 | 104 |
| 940 | 3300035695 | Ga0373927_0000666 | Ga0373927_0000666_17376_17693 | 104 |
| 941 | 3300035724 | Ga0373933_0566854 | Ga0373933_0566854_287_604 | 104 |
| 942 | 3300036401 | Ga0373937_0015543 | Ga0373937_0015543_1710_2027 | 104 |
| 943 | 3300036401 | Ga0373937_0062254 | Ga0373937_0062254_808_1125 | 104 |
| 944 | 3300036401 | Ga0373937_1173716 | Ga0373937_1173716_42_359 | 104 |
| 945 | 3300037068 | Ga0373925_0008568 | Ga0373925_0008568_3022_3339 | 104 |
| 946 | 3300037068 | Ga0373925_1375616 | Ga0373925_1375616_36_371 | 104 |
| 947 | 3300037418 | Ga0395900_1182787 | Ga0395900_1182787_212_529 | 104 |
| 948 | 3300037466 | Ga0395898_1445006 | Ga0395898_1445006_119_436 | 104 |
| 949 | 3300037471 | Ga0395905_0006516 | Ga0395905_0006516_8768_9085 | 104 |
| 950 | 3300037471 | Ga0395905_1133897 | Ga0395905_1133897_176_493 | 104 |
| 951 | 3300037471 | Ga0395905_1377442 | Ga0395905_1377442_10_327 | 104 |
| 952 | 3300038443 | Ga0395901_0289239 | Ga0395901_0289239_1027_1344 | 104 |
| 953 | 3300038443 | Ga0395901_1373431 | Ga0395901_1373431_55_372 | 104 |
| 954 | 3300039437 | Ga0436365_0657145 | Ga0436365_0657145_71_388 | 104 |
| 955 | 3300039437 | Ga0436365_0801580 | Ga0436365_0801580_1035_1370 | 104 |
| 956 | 3300039437 | Ga0436365_1727831 | Ga0436365_1727831_174_491 | 104 |
| 957 | 3300039438 | Ga0436360_1050844 | Ga0436360_1050844_84_401 | 104 |
| 958 | 3300039450 | Ga0436363_0783763 | Ga0436363_0783763_46_369 | 104 |
| 959 | 3300041451 | Ga0451791_1866899 | Ga0451791_1866899_612_929 | 104 |
| 960 | 3300041453 | Ga0451797_0114101 | Ga0451797_0114101_170_487 | 104 |
| 961 | 3300041456 | Ga0451795_0118586 | Ga0451795_0118586_469_786 | 104 |
| 962 | 3300041460 | Ga0451802_2074404 | Ga0451802_2074404_489_806 | 104 |
| 963 | 3300041486 | Ga0451807_2333451 | Ga0451807_2333451_206_523 | 104 |
| 964 | 3300041492 | Ga0451835_0181475 | Ga0451835_0181475_135_452 | 104 |
| 965 | 3300041501 | Ga0451845_0824977 | Ga0451845_0824977_549_866 | 104 |
| 966 | 3300041509 | Ga0451843_1376612 | Ga0451843_1376612_48_365 | 104 |
| 967 | 3300041512 | Ga0451853_1565872 | Ga0451853_1565872_616_933 | 104 |
| 968 | 3300041512 | Ga0451853_3946027 | Ga0451853_3946027_297_614 | 104 |
| 969 | 3300044656 | Ga0466969_0149159 | Ga0466969_0149159_190_507 | 104 |
| 970 | 3300044658 | Ga0466972_0088356 | Ga0466972_0088356_706_1023 | 104 |
| 971 | 3300044683 | Ga0466965_0700870 | Ga0466965_0700870_93_410 | 104 |
| 972 | 3300044684 | Ga0466966_0013642 | Ga0466966_0013642_3888_4205 | 104 |
| 973 | 3300044684 | Ga0466966_0249136 | Ga0466966_0249136_218_535 | 104 |
| 974 | 3300044693 | Ga0466961_0000558 | Ga0466961_0000558_2860_3177 | 104 |
| 975 | 3300044694 | Ga0466963_0125044 | Ga0466963_0125044_625_942 | 104 |
| 976 | 3300044719 | Ga0466971_0062059 | Ga0466971_0062059_1042_1359 | 104 |
| 977 | 3300044719 | Ga0466971_0412983 | Ga0466971_0412983_218_535 | 104 |
| 978 | 3300044735 | Ga0466968_0573845 | Ga0466968_0573845_68_385 | 104 |
| 979 | 3300044901 | Ga0466960_0086941 | Ga0466960_0086941_1033_1350 | 104 |
| 980 | 3300044901 | Ga0466960_0088135 | Ga0466960_0088135_426_743 | 104 |
| 981 | 3300045049 | Ga0466959_0150201 | Ga0466959_0150201_1152_1469 | 104 |
| 982 | 3300045049 | Ga0466959_0293594 | Ga0466959_0293594_199_516 | 104 |
| 983 | 3300045976 | Ga0466967_0397288 | Ga0466967_0397288_119_436 | 104 |
| 984 | 3300046454 | Ga0495592_0024886 | Ga0495592_0024886_1869_2186 | 104 |
| 985 | 3300046454 | Ga0495592_0768892 | Ga0495592_0768892_32_346 | 104 |
| 986 | 3300046455 | Ga0495603_0000206 | Ga0495603_0000206_1616_1933 | 104 |
| 987 | 3300046459 | Ga0495629_0000338 | Ga0495629_0000338_2910_3227 | 104 |
| 988 | 3300046461 | Ga0495641_0005602 | Ga0495641_0005602_997_1314 | 104 |
| 989 | 3300046462 | Ga0495651_0155119 | Ga0495651_0155119_50_367 | 104 |
| 990 | 3300046462 | Ga0495651_0397649 | Ga0495651_0397649_48_365 | 104 |
| 991 | 3300046463 | Ga0495653_0112657 | Ga0495653_0112657_759_1076 | 104 |
| 992 | 3300046472 | Ga0495580_0003372 | Ga0495580_0003372_7130_7447 | 104 |
| 993 | 3300046473 | Ga0495582_0000423 | Ga0495582_0000423_8722_9039 | 104 |
| 994 | 3300046475 | Ga0495639_0000039 | Ga0495639_0000039_17869_18186 | 104 |
| 995 | 3300046475 | Ga0495639_0606631 | Ga0495639_0606631_142_459 | 104 |
| 996 | 3300046476 | Ga0495662_0004133 | Ga0495662_0004133_5755_6072 | 104 |
| 997 | 3300046477 | Ga0495664_0000847 | Ga0495664_0000847_12681_12998 | 104 |
| 998 | 3300046477 | Ga0495664_0111135 | Ga0495664_0111135_1086_1403 | 104 |
| 999 | 3300046499 | Ga0495594_0006206 | Ga0495594_0006206_5020_5337 | 104 |
| 1000 | 3300046500 | Ga0495596_0197978 | Ga0495596_0197978_274_591 | 104 |
| 1001 | 3300046507 | Ga0495606_0005948 | Ga0495606_0005948_9618_9935 | 104 |
| 1002 | 3300046514 | Ga0495618_0081765 | Ga0495618_0081765_788_1105 | 104 |
| 1003 | 3300046515 | Ga0495620_0216518 | Ga0495620_0216518_234_551 | 104 |
| 1004 | 3300046516 | Ga0495628_0020083 | Ga0495628_0020083_4829_5146 | 104 |
| 1005 | 3300046517 | Ga0495630_0002808 | Ga0495630_0002808_6129_6446 | 104 |
| 1006 | 3300046522 | Ga0495643_0284270 | Ga0495643_0284270_208_525 | 104 |
| 1007 | 3300046526 | Ga0495666_0028687 | Ga0495666_0028687_1592_1909 | 104 |
| 1008 | 3300046529 | Ga0495652_0424179 | Ga0495652_0424179_137_451 | 104 |
| 1009 | 3300046533 | Ga0495640_0035609 | Ga0495640_0035609_1742_2059 | 104 |
| 1010 | 3300046557 | Ga0495622_0013395 | Ga0495622_0013395_3022_3339 | 104 |
| 1011 | 3300046559 | Ga0495667_0006278 | Ga0495667_0006278_5277_5594 | 104 |
| 1012 | 3300046642 | Ga0495634_0000776 | Ga0495634_0000776_5496_5813 | 104 |
| 1013 | 3300046642 | Ga0495634_0117832 | Ga0495634_0117832_1151_1468 | 104 |
| 1014 | 3300046663 | Ga0495635_0001246 | Ga0495635_0001246_4202_4519 | 104 |
| 1015 | 3300046674 | Ga0495588_0013921 | Ga0495588_0013921_2379_2696 | 104 |
| 1016 | 3300046675 | Ga0495657_0163833 | Ga0495657_0163833_856_1173 | 104 |
| 1017 | 3300046675 | Ga0495657_0202761 | Ga0495657_0202761_64_381 | 104 |
| 1018 | 3300046675 | Ga0495657_0495180 | Ga0495657_0495180_260_577 | 104 |
| 1019 | 3300046679 | Ga0495623_0116717 | Ga0495623_0116717_993_1310 | 104 |
| 1020 | 3300046679 | Ga0495623_0321274 | Ga0495623_0321274_160_477 | 104 |
| 1021 | 3300046679 | Ga0495623_0338090 | Ga0495623_0338090_275_592 | 104 |
| 1022 | 3300046680 | Ga0495646_0202724 | Ga0495646_0202724_220_537 | 104 |
| 1023 | 3300046681 | Ga0495647_0001044 | Ga0495647_0001044_4754_5071 | 104 |
| 1024 | 3300046683 | Ga0495658_0000687 | Ga0495658_0000687_4125_4442 | 104 |
| 1025 | 3300046689 | Ga0495613_0001857 | Ga0495613_0001857_10154_10471 | 104 |
| 1026 | 3300046690 | Ga0495624_0003908 | Ga0495624_0003908_6287_6604 | 104 |
| 1027 | 3300046809 | Ga0495600_0187212 | Ga0495600_0187212_501_818 | 104 |
| 1028 | 3300046809 | Ga0495600_0238802 | Ga0495600_0238802_635_952 | 104 |
| 1029 | 3300046809 | Ga0495600_0630139 | Ga0495600_0630139_244_561 | 104 |
| 1030 | 3300047315 | Ga0495581_0000006 | Ga0495581_0000006_63257_63574 | 104 |
| 1031 | 3300047319 | Ga0495674_0002636 | Ga0495674_0002636_536_853 | 104 |
| 1032 | 3300047321 | Ga0495676_0045171 | Ga0495676_0045171_2685_3002 | 104 |
| 1033 | 3300047322 | Ga0495680_0074399 | Ga0495680_0074399_1409_1726 | 104 |
| 1034 | 3300047322 | Ga0495680_0278081 | Ga0495680_0278081_349_666 | 104 |
| 1035 | 3300047469 | Ga0495673_0036359 | Ga0495673_0036359_171_485 | 104 |
| 1036 | 3300047471 | Ga0495684_0053162 | Ga0495684_0053162_1522_1839 | 104 |
| 1037 | 3300047673 | Ga0495593_0000032 | Ga0495593_0000032_44691_45008 | 104 |
| 1038 | 3300048089 | Ga0495614_0031476 | Ga0495614_0031476_824_1141 | 104 |
| 1039 | 3300048903 | Ga0496100_0098042 | Ga0496100_0098042_1526_1843 | 104 |
| 1040 | 3300048903 | Ga0496100_0391004 | Ga0496100_0391004_106_423 | 104 |
| 1041 | 3300048903 | Ga0496100_0721687 | Ga0496100_0721687_421_738 | 104 |
| 1042 | 3300048904 | Ga0496101_0146357 | Ga0496101_0146357_577_894 | 104 |
| 1043 | 3300048904 | Ga0496101_0350188 | Ga0496101_0350188_83_400 | 104 |
| 1044 | 3300048904 | Ga0496101_0357722 | Ga0496101_0357722_656_970 | 104 |
| 1045 | 3300048904 | Ga0496101_0404754 | Ga0496101_0404754_172_489 | 104 |
| 1046 | 3300048904 | Ga0496101_0536457 | Ga0496101_0536457_282_599 | 104 |
| 1047 | 3300048905 | Ga0496102_0006237 | Ga0496102_0006237_747_1064 | 104 |
| 1048 | 3300048905 | Ga0496102_0849158 | Ga0496102_0849158_327_644 | 104 |
| 1049 | 3300048907 | Ga0496104_0024484 | Ga0496104_0024484_2421_2738 | 104 |
| 1050 | 3300048907 | Ga0496104_0390401 | Ga0496104_0390401_831_1148 | 104 |
| 1051 | 3300048908 | Ga0496105_0108566 | Ga0496105_0108566_894_1211 | 104 |
| 1052 | 3300048908 | Ga0496105_0117313 | Ga0496105_0117313_1194_1511 | 104 |
| 1053 | 3300048908 | Ga0496105_0125438 | Ga0496105_0125438_929_1246 | 104 |
| 1054 | 3300048908 | Ga0496105_1289912 | Ga0496105_1289912_164_481 | 104 |
| 1055 | 3300048909 | Ga0496106_0081865 | Ga0496106_0081865_1514_1831 | 104 |
| 1056 | 3300048909 | Ga0496106_0175282 | Ga0496106_0175282_1226_1543 | 104 |
| 1057 | 3300048909 | Ga0496106_0808172 | Ga0496106_0808172_33_347 | 104 |
| 1058 | 3300048910 | Ga0496107_0040809 | Ga0496107_0040809_1820_2137 | 104 |
| 1059 | 3300048910 | Ga0496107_0509866 | Ga0496107_0509866_76_390 | 104 |
| 1060 | 3300048911 | Ga0496108_0008957 | Ga0496108_0008957_4504_4821 | 104 |
| 1061 | 3300048911 | Ga0496108_0146647 | Ga0496108_0146647_1679_1993 | 104 |
| 1062 | 3300048911 | Ga0496108_0424225 | Ga0496108_0424225_726_1043 | 104 |
| 1063 | 3300048912 | Ga0496109_0020552 | Ga0496109_0020552_818_1135 | 104 |
| 1064 | 3300048912 | Ga0496109_0612735 | Ga0496109_0612735_94_411 | 104 |
| 1065 | 3300048913 | Ga0496110_0257806 | Ga0496110_0257806_92_409 | 104 |
| 1066 | 3300048913 | Ga0496110_0301193 | Ga0496110_0301193_95_412 | 104 |
| 1067 | 3300048913 | Ga0496110_0316974 | Ga0496110_0316974_682_999 | 104 |
| 1068 | 3300048913 | Ga0496110_0355092 | Ga0496110_0355092_619_936 | 104 |
| 1069 | 3300048914 | Ga0496111_0426511 | Ga0496111_0426511_539_856 | 104 |
| 1070 | 3300048914 | Ga0496111_0458900 | Ga0496111_0458900_534_851 | 104 |
| 1071 | 3300048914 | Ga0496111_0631743 | Ga0496111_0631743_53_370 | 104 |
| 1072 | 3300048915 | Ga0496112_0000029 | Ga0496112_0000029_73389_73706 | 104 |
| 1073 | 3300048915 | Ga0496112_0054801 | Ga0496112_0054801_1076_1393 | 104 |
| 1074 | 3300048915 | Ga0496112_0124542 | Ga0496112_0124542_538_852 | 104 |
| 1075 | 3300048915 | Ga0496112_0510875 | Ga0496112_0510875_449_766 | 104 |
| 1076 | 3300048916 | Ga0496113_0096906 | Ga0496113_0096906_1160_1477 | 104 |
| 1077 | 3300048916 | Ga0496113_0305377 | Ga0496113_0305377_410_727 | 104 |
| 1078 | 3300048916 | Ga0496113_0963187 | Ga0496113_0963187_205_522 | 104 |
| 1079 | 3300048917 | Ga0496114_0295797 | Ga0496114_0295797_160_477 | 104 |
| 1080 | 3300048917 | Ga0496114_0392840 | Ga0496114_0392840_844_1161 | 104 |
| 1081 | 3300048918 | Ga0496115_0063385 | Ga0496115_0063385_2493_2810 | 104 |
| 1082 | 3300048918 | Ga0496115_0149336 | Ga0496115_0149336_1164_1481 | 104 |
| 1083 | 3300048918 | Ga0496115_0215610 | Ga0496115_0215610_13_330 | 104 |
| 1084 | 3300048918 | Ga0496115_0274747 | Ga0496115_0274747_726_1043 | 104 |
| 1085 | 3300048924 | Ga0496121_0233292 | Ga0496121_0233292_123_440 | 104 |
| 1086 | 3300048928 | Ga0496125_0074304 | Ga0496125_0074304_441_755 | 104 |
| 1087 | 3300048928 | Ga0496125_0413741 | Ga0496125_0413741_182_505 | 104 |
| 1088 | 3300048929 | Ga0496126_0021452 | Ga0496126_0021452_2405_2722 | 104 |
| 1089 | 3300048929 | Ga0496126_0400598 | Ga0496126_0400598_301_633 | 104 |
| 1090 | 3300048929 | Ga0496126_0462816 | Ga0496126_0462816_505_828 | 104 |
| 1091 | 3300049460 | Ga0495682_0319092 | Ga0495682_0319092_49_366 | 104 |
| 1092 | 3300050489 | nmdc:mga03683_199845_c1 | nmdc:mga03683_199845_c1_368_685 | 104 |
| 1093 | 3300050491 | nmdc:mga00v17_205784_c1 | nmdc:mga00v17_205784_c1_671_988 | 104 |
| 1094 | 3300050491 | nmdc:mga00v17_552923_c1 | nmdc:mga00v17_552923_c1_372_686 | 104 |
| 1095 | 3300050492 | nmdc:mga0yw44_290032_c1 | nmdc:mga0yw44_290032_c1_444_758 | 104 |
| 1096 | 3300050492 | nmdc:mga0yw44_314787_c1 | nmdc:mga0yw44_314787_c1_291_608 | 104 |
| 1097 | 3300050492 | nmdc:mga0yw44_430470_c1 | nmdc:mga0yw44_430470_c1_522_839 | 104 |
| 1098 | 3300050492 | nmdc:mga0yw44_489999_c1 | nmdc:mga0yw44_489999_c1_82_399 | 104 |
| 1099 | 3300050492 | nmdc:mga0yw44_89419_c1 | nmdc:mga0yw44_89419_c1_526_843 | 104 |
| 1100 | 3300050493 | nmdc:mga0k408_193427_c1 | nmdc:mga0k408_193427_c1_586_903 | 104 |
| 1101 | 3300050493 | nmdc:mga0k408_535205_c1 | nmdc:mga0k408_535205_c1_300_614 | 104 |
| 1102 | 3300050494 | nmdc:mga06z11_98777_c1 | nmdc:mga06z11_98777_c1_812_1126 | 104 |
| 1103 | 3300050496 | nmdc:mga07m45_148537_c1 | nmdc:mga07m45_148537_c1_32_349 | 104 |
| 1104 | 3300050496 | nmdc:mga07m45_360449_c1 | nmdc:mga07m45_360449_c1_195_509 | 104 |
| 1105 | 3300050514 | nmdc:mga08x19_555763_c1 | nmdc:mga08x19_555763_c1_227_541 | 104 |
| 1106 | 3300050516 | nmdc:mga0sz30_117318_c1 | nmdc:mga0sz30_117318_c1_181_498 | 104 |
| 1107 | 3300050516 | nmdc:mga0sz30_46487_c1 | nmdc:mga0sz30_46487_c1_1182_1496 | 104 |
| 1108 | 3300050516 | nmdc:mga0sz30_56744_c1 | nmdc:mga0sz30_56744_c1_437_754 | 104 |
| 1109 | 3300053077 | Ga0495601_0479505 | Ga0495601_0479505_175_492 | 104 |
| 1110 | 3300053078 | Ga0495612_0063222 | Ga0495612_0063222_519_836 | 104 |
| 1111 | 3300053080 | Ga0500635_0104445 | Ga0500635_0104445_539_853 | 104 |
| 1112 | 3300053083 | Ga0495655_0228197 | Ga0495655_0228197_282_599 | 104 |
| 1113 | 3300053083 | Ga0495655_0318806 | Ga0495655_0318806_95_412 | 104 |
| 1114 | 3300053083 | Ga0495655_0331075 | Ga0495655_0331075_24_341 | 104 |
| 1115 | 3300053091 | Ga0500647_0152105 | Ga0500647_0152105_573_887 | 104 |
| 1116 | 3300053091 | Ga0500647_0258320 | Ga0500647_0258320_227_541 | 104 |
| 1117 | 3300053091 | Ga0500647_0292036 | Ga0500647_0292036_259_576 | 104 |
| 1118 | 3300053093 | Ga0500651_0161790 | Ga0500651_0161790_400_714 | 104 |
| 1119 | 3300053094 | Ga0500566_0000270 | Ga0500566_0000270_16702_17016 | 104 |
| 1120 | 3300053095 | Ga0500640_000397 | Ga0500640_000397_4498_4812 | 104 |
| 1121 | 3300053097 | Ga0500648_205690 | Ga0500648_205690_183_497 | 104 |
| 1122 | 3300053098 | Ga0500650_0098641 | Ga0500650_0098641_413_727 | 104 |
| 1123 | 3300053105 | Ga0500557_000079 | Ga0500557_000079_25669_25986 | 104 |
| 1124 | 3300053109 | Ga0500569_106447 | Ga0500569_106447_459_773 | 104 |
| 1125 | 3300053111 | Ga0500572_001115 | Ga0500572_001115_6130_6444 | 104 |
| 1126 | 3300053111 | Ga0500572_001993 | Ga0500572_001993_3813_4130 | 104 |
| 1127 | 3300053115 | Ga0500591_054386 | Ga0500591_054386_769_1083 | 104 |
| 1128 | 3300053119 | Ga0500595_133684 | Ga0500595_133684_108_422 | 104 |
| 1129 | 3300053122 | Ga0500608_006525 | Ga0500608_006525_2726_3040 | 104 |
| 1130 | 3300053122 | Ga0500608_290587 | Ga0500608_290587_173_490 | 104 |
| 1131 | 3300053123 | Ga0500614_003198 | Ga0500614_003198_999_1313 | 104 |
| 1132 | 3300053130 | Ga0500642_0000084 | Ga0500642_0000084_21013_21330 | 104 |
| 1133 | 3300053133 | Ga0500655_026358 | Ga0500655_026358_445_759 | 104 |
| 1134 | 3300053134 | Ga0500658_0094183 | Ga0500658_0094183_796_1110 | 104 |
| 1135 | 3300053136 | Ga0500559_0000775 | Ga0500559_0000775_7191_7508 | 104 |
| 1136 | 3300053136 | Ga0500559_0001813 | Ga0500559_0001813_2567_2881 | 104 |
| 1137 | 3300053139 | Ga0500568_0141164 | Ga0500568_0141164_378_695 | 104 |
| 1138 | 3300053150 | Ga0500603_000151 | Ga0500603_000151_6527_6841 | 104 |
| 1139 | 3300053150 | Ga0500603_071439 | Ga0500603_071439_156_473 | 104 |
| 1140 | 3300053151 | Ga0500604_0076153 | Ga0500604_0076153_173_490 | 104 |
| 1141 | 3300053159 | Ga0500630_003510 | Ga0500630_003510_3429_3743 | 104 |
| 1142 | 3300053162 | Ga0500638_004618 | Ga0500638_004618_1860_2174 | 104 |
| 1143 | 3300053163 | Ga0500639_000065 | Ga0500639_000065_15714_16028 | 104 |
| 1144 | 3300053163 | Ga0500639_166687 | Ga0500639_166687_269_586 | 104 |
| 1145 | 3300053163 | Ga0500639_322199 | Ga0500639_322199_86_400 | 104 |
| 1146 | 3300053178 | Ga0500637_0140051 | Ga0500637_0140051_176_490 | 104 |
| 1147 | 3300053725 | Ga0500576_021808 | Ga0500576_021808_790_1107 | 104 |
| 1148 | 3300053727 | Ga0500611_199520 | Ga0500611_199520_138_452 | 104 |
| 1149 | 3300053729 | Ga0500625_072389 | Ga0500625_072389_736_1053 | 104 |
| 1150 | 3300053731 | Ga0500609_002762 | Ga0500609_002762_1414_1728 | 104 |
| 1151 | 3300053735 | Ga0500596_000494 | Ga0500596_000494_606_920 | 104 |
| 1152 | 3300053735 | Ga0500596_003534 | Ga0500596_003534_2407_2724 | 104 |
| 1153 | 3300053737 | Ga0500601_000768 | Ga0500601_000768_2383_2697 | 104 |
| 1154 | 3300053737 | Ga0500601_026213 | Ga0500601_026213_85_399 | 104 |
| 1155 | 3300055283 | Ga0500661_018802 | Ga0500661_018802_372_686 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ra2-assembly1.cif.gz_A | x-ray structure of the q7cpv8 protein from salmonella typhimurium at the resolution 1.9 a. northeast structural genomics consortium target str88a | 0.6339 | 14 | 37 |
| 5cai-assembly1.cif.gz_A | crystal structure of a putative lipoprotein from the duf903 family (kpn_03160) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.30 a resolution | 0.5957 | 12 | 37 |
| 6hah-assembly1.cif.gz_A | crystal structure of paf - p-sulfonatocalix[6]arene complex | 0.4871 | 15 | 47 |
| 7vtk-assembly1.cif.gz_A | crystal structure of glycoside hydrolases family 64 beta-1,3-glucanase | 0.4671 | 13 | 48 |
| 7unf-assembly1.cif.gz_U | cryoem structure of a meak7 bound human v-atpase complex | 0.4558 | 5 | 29 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9W4N2_488_788_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.6303 | 7 | 37 | 3.30.470.30 |
| af_Q5A6S0_10_141_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.5746 | 66 | 83 | 2.30.30.30 |
| af_P48360_55_360_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.5121 | 62 | 88 | 3.50.50.60 |
| af_Q9FHB0_225_327_2.40.330.10 | Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain | 0.5089 | 68 | 99 | 2.40.330.10 |
| af_Q9VSI1_5_198_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.5041 | 71 | 92 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350AFY8-F1-model_v4 | DUF2849 domain-containing protein | 0.9545 | 14 | 52 |
|
| AF-A0A523G486-F1-model_v4 | DUF2849 domain-containing protein | 0.9333 | 14 | 97 |
|
| AF-A0A1E3W2T4-F1-model_v4 | Nitrite reductase | 0.9228 | 14 | 98 |
|
| AF-A0A3D3WIW3-F1-model_v4 | DUF2849 domain-containing protein | 0.9153 | 14 | 94 |
GO:0046872
GO:0051536 |
| AF-A0A2E6YPC1-F1-model_v4 | Sulfite reductase | 0.9131 | 10 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar