F490924
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1155 | 385 | 1152 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0599685|Ga0436364_0599685_295_870 |
| Length | 191 |
| Sequence | MSRIGRQPIPVPAGVDITVDGGQITVKGPKGTLSRPLRPEVSIRRENGTLYVDRNGDNKTERAMHGLSRTLVNNMVVGVTQGYQKVLEISGVGYRATKQGSDLQLSVGYSHPVLIAPRPGIEFEVGQDVNTRAPIITVRGIDKEVVGQTAAEVRSVRKPEPYKGKGIRYQGEIIRRKAGKSAKAGGKGGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 2 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 116 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 184 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 187 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 219 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 230 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 231 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 232 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 233 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 234 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 235 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 385 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.61 |
| Isolates | 0.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.69 |
| Nodule | 0 |
| Rhizoplane | 6.32 |
| Rhizosphere | 92.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c012431 | 3300000043 | Bacteria | 718 |
| 2 | ARSoilOldRDRAFT_c001158 | 3300000044 | Bacteria | 2527 |
| 3 | ARCol0yngRDRAFT_1001005 | 3300000652 | Bacteria | 2475 |
| 4 | JGI24739J22299_10031625 | 3300001989 | Unclassified | 1827 |
| 5 | JGI24735J21928_10171835 | 3300002067 | Unclassified | 627 |
| 6 | JGI25407J50210_10006859 | 3300003373 | Bacteria | 2845 |
| 7 | Ga0070683_100053944 | 3300005329 | Bacteria | 3726 |
| 8 | Ga0070683_100184472 | 3300005329 | Bacteria | 1980 |
| 9 | Ga0070683_100308906 | 3300005329 | Bacteria | 1504 |
| 10 | Ga0070683_101062045 | 3300005329 | Bacteria | 778 |
| 11 | Ga0070670_100002726 | 3300005331 | Bacteria | 14597 |
| 12 | Ga0070670_100091757 | 3300005331 | Bacteria | 2611 |
| 13 | Ga0068869_100022221 | 3300005334 | Bacteria | 4369 |
| 14 | Ga0068869_100491812 | 3300005334 | Bacteria | 1023 |
| 15 | Ga0070680_100098314 | 3300005336 | Bacteria | 2427 |
| 16 | Ga0070680_100123282 | 3300005336 | Bacteria | 2164 |
| 17 | Ga0070682_100189583 | 3300005337 | Bacteria | 1443 |
| 18 | Ga0070682_100226337 | 3300005337 | Bacteria | 1334 |
| 19 | Ga0070682_100727505 | 3300005337 | Bacteria | 799 |
| 20 | Ga0068868_100098882 | 3300005338 | Bacteria | 2360 |
| 21 | Ga0068868_100523321 | 3300005338 | Bacteria | 1041 |
| 22 | Ga0070660_100518276 | 3300005339 | Bacteria | 993 |
| 23 | Ga0070660_100766323 | 3300005339 | Bacteria | 811 |
| 24 | Ga0070691_10030122 | 3300005341 | Bacteria | 2541 |
| 25 | Ga0070687_100073999 | 3300005343 | Bacteria | 1838 |
| 26 | Ga0070661_100040522 | 3300005344 | Bacteria | 3398 |
| 27 | Ga0070661_100370265 | 3300005344 | Bacteria | 1128 |
| 28 | Ga0070661_100633240 | 3300005344 | Bacteria | 867 |
| 29 | Ga0070692_10022707 | 3300005345 | Bacteria | 3067 |
| 30 | Ga0070668_100969449 | 3300005347 | Bacteria | 763 |
| 31 | Ga0070669_100458555 | 3300005353 | Bacteria | 1052 |
| 32 | Ga0070675_100054439 | 3300005354 | Bacteria | 3292 |
| 33 | Ga0070675_100106705 | 3300005354 | Bacteria | 2364 |
| 34 | Ga0070675_100929320 | 3300005354 | Bacteria | 798 |
| 35 | Ga0070671_100068504 | 3300005355 | Bacteria | 2960 |
| 36 | Ga0070671_100107077 | 3300005355 | Bacteria | 2347 |
| 37 | Ga0070671_100894008 | 3300005355 | Bacteria | 776 |
| 38 | Ga0070674_100106394 | 3300005356 | Bacteria | 2053 |
| 39 | Ga0070674_100336072 | 3300005356 | Bacteria | 1215 |
| 40 | Ga0070674_100604946 | 3300005356 | Bacteria | 927 |
| 41 | Ga0070673_100009174 | 3300005364 | Bacteria | 6630 |
| 42 | Ga0070688_100010080 | 3300005365 | Bacteria | 5195 |
| 43 | Ga0070659_100116007 | 3300005366 | Bacteria | 2165 |
| 44 | Ga0070659_100461407 | 3300005366 | Bacteria | 1079 |
| 45 | Ga0070709_10017436 | 3300005434 | Bacteria | 4119 |
| 46 | Ga0070714_100023042 | 3300005435 | Bacteria | 5111 |
| 47 | Ga0070714_100138461 | 3300005435 | Bacteria | 2182 |
| 48 | Ga0070714_100171566 | 3300005435 | Bacteria | 1968 |
| 49 | Ga0070714_100542659 | 3300005435 | Bacteria | 1112 |
| 50 | Ga0070714_101254020 | 3300005435 | Bacteria | 723 |
| 51 | Ga0070713_100001889 | 3300005436 | Bacteria | 13509 |
| 52 | Ga0070713_100035918 | 3300005436 | Bacteria | 3994 |
| 53 | Ga0070713_100163538 | 3300005436 | Bacteria | 1988 |
| 54 | Ga0070710_10010919 | 3300005437 | Bacteria | 4473 |
| 55 | Ga0070710_10055055 | 3300005437 | Bacteria | 2246 |
| 56 | Ga0070711_100175072 | 3300005439 | Bacteria | 1638 |
| 57 | Ga0070711_100258287 | 3300005439 | Bacteria | 1369 |
| 58 | Ga0070711_100961031 | 3300005439 | Bacteria | 731 |
| 59 | Ga0070705_100023560 | 3300005440 | Bacteria | 3308 |
| 60 | Ga0070700_100048730 | 3300005441 | Bacteria | 2627 |
| 61 | Ga0070694_100095994 | 3300005444 | Bacteria | 2089 |
| 62 | Ga0070694_100461334 | 3300005444 | Bacteria | 1005 |
| 63 | Ga0070708_100361595 | 3300005445 | Bacteria | 1368 |
| 64 | Ga0070678_100162368 | 3300005456 | Bacteria | 1811 |
| 65 | Ga0070678_100651518 | 3300005456 | Bacteria | 945 |
| 66 | Ga0070678_100691956 | 3300005456 | Bacteria | 918 |
| 67 | Ga0070678_100943477 | 3300005456 | Bacteria | 791 |
| 68 | Ga0070662_100144820 | 3300005457 | Bacteria | 1845 |
| 69 | Ga0070662_100290847 | 3300005457 | Bacteria | 1325 |
| 70 | Ga0070662_100377263 | 3300005457 | Bacteria | 1167 |
| 71 | Ga0070662_101042223 | 3300005457 | Bacteria | 701 |
| 72 | Ga0070681_10015900 | 3300005458 | Bacteria | 7503 |
| 73 | Ga0070681_10154710 | 3300005458 | Bacteria | 2218 |
| 74 | Ga0068867_100768082 | 3300005459 | Bacteria | 857 |
| 75 | Ga0070685_10005868 | 3300005466 | Bacteria | 6247 |
| 76 | Ga0070707_100001557 | 3300005468 | Bacteria | 22299 |
| 77 | Ga0070699_100149836 | 3300005518 | Bacteria | 2062 |
| 78 | Ga0070679_100029555 | 3300005530 | Bacteria | 5407 |
| 79 | Ga0070679_100337405 | 3300005530 | Bacteria | 1455 |
| 80 | Ga0070684_100022860 | 3300005535 | Bacteria | 5220 |
| 81 | Ga0070684_100089974 | 3300005535 | Bacteria | 2728 |
| 82 | Ga0070684_100156385 | 3300005535 | Bacteria | 2067 |
| 83 | Ga0070684_100240626 | 3300005535 | Bacteria | 1653 |
| 84 | Ga0070684_100402869 | 3300005535 | Bacteria | 1261 |
| 85 | Ga0068853_100214281 | 3300005539 | Bacteria | 1756 |
| 86 | Ga0068853_100284547 | 3300005539 | Bacteria | 1525 |
| 87 | Ga0070672_100064211 | 3300005543 | Bacteria | 2900 |
| 88 | Ga0070672_100132695 | 3300005543 | Bacteria | 2048 |
| 89 | Ga0070686_100434402 | 3300005544 | Bacteria | 1006 |
| 90 | Ga0070695_100001595 | 3300005545 | Bacteria | 12688 |
| 91 | Ga0070696_100198203 | 3300005546 | Bacteria | 1498 |
| 92 | Ga0070693_100107157 | 3300005547 | Bacteria | 1712 |
| 93 | Ga0070704_100191887 | 3300005549 | Bacteria | 1643 |
| 94 | Ga0070704_100340969 | 3300005549 | Bacteria | 1262 |
| 95 | Ga0068855_100939809 | 3300005563 | Bacteria | 911 |
| 96 | Ga0070664_100007134 | 3300005564 | Bacteria | 9012 |
| 97 | Ga0068857_100035784 | 3300005577 | Bacteria | 4398 |
| 98 | Ga0068857_100138893 | 3300005577 | Bacteria | 2196 |
| 99 | Ga0068857_100222749 | 3300005577 | Bacteria | 1723 |
| 100 | Ga0068856_100056684 | 3300005614 | Bacteria | 3867 |
| 101 | Ga0068856_100432985 | 3300005614 | Bacteria | 1335 |
| 102 | Ga0068856_100601606 | 3300005614 | Bacteria | 1120 |
| 103 | Ga0070702_100014750 | 3300005615 | Bacteria | 3972 |
| 104 | Ga0070702_100242311 | 3300005615 | Bacteria | 1217 |
| 105 | Ga0068852_100215349 | 3300005616 | Bacteria | 1824 |
| 106 | Ga0068859_100194972 | 3300005617 | Bacteria | 2110 |
| 107 | Ga0068864_100008046 | 3300005618 | Bacteria | 8696 |
| 108 | Ga0068864_100145545 | 3300005618 | Bacteria | 2142 |
| 109 | Ga0068866_10047907 | 3300005718 | Bacteria | 2158 |
| 110 | Ga0068851_10085219 | 3300005834 | Bacteria | 1656 |
| 111 | Ga0068870_10040559 | 3300005840 | Bacteria | 2414 |
| 112 | Ga0068870_10052187 | 3300005840 | Bacteria | 2167 |
| 113 | Ga0068870_10073954 | 3300005840 | Bacteria | 1865 |
| 114 | Ga0068870_10129624 | 3300005840 | Bacteria | 1463 |
| 115 | Ga0068863_100246016 | 3300005841 | Bacteria | 1727 |
| 116 | Ga0068862_100860677 | 3300005844 | Bacteria | 889 |
| 117 | Ga0081455_10013977 | 3300005937 | Bacteria | 7890 |
| 118 | Ga0081455_10040463 | 3300005937 | Bacteria | 4109 |
| 119 | Ga0081455_10050855 | 3300005937 | Bacteria | 3559 |
| 120 | Ga0081455_10207841 | 3300005937 | Bacteria | 1461 |
| 121 | Ga0081455_10280757 | 3300005937 | Bacteria | 1203 |
| 122 | Ga0081538_10000515 | 3300005981 | Bacteria | 43219 |
| 123 | Ga0081538_10139009 | 3300005981 | Bacteria | 1124 |
| 124 | Ga0081539_10000433 | 3300005985 | Bacteria | 89118 |
| 125 | Ga0070717_10012019 | 3300006028 | Bacteria | 6593 |
| 126 | Ga0070717_10024999 | 3300006028 | Bacteria | 4744 |
| 127 | Ga0070717_10032247 | 3300006028 | Bacteria | 4221 |
| 128 | Ga0070717_10069262 | 3300006028 | Bacteria | 2938 |
| 129 | Ga0070717_10190202 | 3300006028 | Bacteria | 1793 |
| 130 | Ga0070717_10575879 | 3300006028 | Bacteria | 1020 |
| 131 | Ga0075365_10179639 | 3300006038 | Bacteria | 1479 |
| 132 | Ga0075365_10515393 | 3300006038 | Bacteria | 845 |
| 133 | Ga0075365_10618456 | 3300006038 | Bacteria | 766 |
| 134 | Ga0075364_10044999 | 3300006051 | Bacteria | 2872 |
| 135 | Ga0075432_10001059 | 3300006058 | Bacteria | 8769 |
| 136 | Ga0070715_10009632 | 3300006163 | Bacteria | 3412 |
| 137 | Ga0070716_100028679 | 3300006173 | Bacteria | 3001 |
| 138 | Ga0070716_100047618 | 3300006173 | Bacteria | 2419 |
| 139 | Ga0070712_100093717 | 3300006175 | Bacteria | 2205 |
| 140 | Ga0070712_100107998 | 3300006175 | Bacteria | 2071 |
| 141 | Ga0070712_100196031 | 3300006175 | Bacteria | 1583 |
| 142 | Ga0097621_100382488 | 3300006237 | Bacteria | 1257 |
| 143 | Ga0075428_100006916 | 3300006844 | Bacteria | 12599 |
| 144 | Ga0075428_100634603 | 3300006844 | Bacteria | 1140 |
| 145 | Ga0075428_100662417 | 3300006844 | Bacteria | 1113 |
| 146 | Ga0075428_101513565 | 3300006844 | Bacteria | 703 |
| 147 | Ga0075430_100236322 | 3300006846 | Bacteria | 1515 |
| 148 | Ga0075431_100004224 | 3300006847 | Bacteria | 14071 |
| 149 | Ga0075431_100145840 | 3300006847 | Bacteria | 2439 |
| 150 | Ga0075433_10061868 | 3300006852 | Bacteria | 3279 |
| 151 | Ga0075433_10453679 | 3300006852 | Bacteria | 1130 |
| 152 | Ga0075429_100011161 | 3300006880 | Bacteria | 7778 |
| 153 | Ga0075429_100122353 | 3300006880 | Bacteria | 2275 |
| 154 | Ga0075429_100140179 | 3300006880 | Bacteria | 2116 |
| 155 | Ga0068865_100076824 | 3300006881 | Bacteria | 2385 |
| 156 | Ga0075436_100438644 | 3300006914 | Bacteria | 950 |
| 157 | Ga0097620_100194983 | 3300006931 | Bacteria | 2110 |
| 158 | Ga0105240_10134085 | 3300009093 | Bacteria | 2967 |
| 159 | Ga0105240_10689056 | 3300009093 | Bacteria | 1116 |
| 160 | Ga0111539_10008690 | 3300009094 | Bacteria | 12890 |
| 161 | Ga0111539_10065262 | 3300009094 | Bacteria | 4302 |
| 162 | Ga0111539_10074113 | 3300009094 | Bacteria | 4011 |
| 163 | Ga0111539_10665582 | 3300009094 | Bacteria | 1212 |
| 164 | Ga0111539_10998168 | 3300009094 | Bacteria | 973 |
| 165 | Ga0111539_11085749 | 3300009094 | Bacteria | 930 |
| 166 | Ga0105245_10050741 | 3300009098 | Bacteria | 3719 |
| 167 | Ga0105245_10106734 | 3300009098 | Bacteria | 2599 |
| 168 | Ga0105245_10302976 | 3300009098 | Bacteria | 1569 |
| 169 | Ga0105247_10331647 | 3300009101 | Bacteria | 1064 |
| 170 | Ga0114129_10035990 | 3300009147 | Bacteria | 6992 |
| 171 | Ga0114129_10104282 | 3300009147 | Bacteria | 3918 |
| 172 | Ga0114129_10154347 | 3300009147 | Bacteria | 3141 |
| 173 | Ga0114129_10211509 | 3300009147 | Bacteria | 2621 |
| 174 | Ga0114129_10220001 | 3300009147 | Bacteria | 2562 |
| 175 | Ga0114129_10771180 | 3300009147 | Bacteria | 1229 |
| 176 | Ga0105243_10120150 | 3300009148 | Bacteria | 2214 |
| 177 | Ga0105243_10223874 | 3300009148 | Bacteria | 1665 |
| 178 | Ga0105243_10244316 | 3300009148 | Bacteria | 1599 |
| 179 | Ga0105242_10017261 | 3300009176 | Bacteria | 5621 |
| 180 | Ga0105242_10019594 | 3300009176 | Bacteria | 5302 |
| 181 | Ga0105242_10137109 | 3300009176 | Bacteria | 2119 |
| 182 | Ga0105242_10156053 | 3300009176 | Bacteria | 1994 |
| 183 | Ga0105248_10206586 | 3300009177 | Bacteria | 2213 |
| 184 | Ga0105248_10266891 | 3300009177 | Bacteria | 1927 |
| 185 | Ga0105248_10914761 | 3300009177 | Bacteria | 991 |
| 186 | Ga0105237_10429166 | 3300009545 | Bacteria | 1327 |
| 187 | Ga0105238_10270169 | 3300009551 | Bacteria | 1681 |
| 188 | Ga0105249_10198350 | 3300009553 | Bacteria | 1963 |
| 189 | Ga0105030_106641 | 3300009987 | Bacteria | 983 |
| 190 | Ga0105239_10048544 | 3300010375 | Bacteria | 4655 |
| 191 | Ga0105239_10256295 | 3300010375 | Bacteria | 1965 |
| 192 | Ga0105239_10294777 | 3300010375 | Bacteria | 1826 |
| 193 | Ga0105239_10815453 | 3300010375 | Bacteria | 1069 |
| 194 | Ga0105239_11633232 | 3300010375 | Bacteria | 746 |
| 195 | Ga0105246_10260717 | 3300011119 | Bacteria | 1381 |
| 196 | Ga0105246_10349304 | 3300011119 | Bacteria | 1211 |
| 197 | Ga0105246_10353928 | 3300011119 | Bacteria | 1204 |
| 198 | Ga0105246_10984773 | 3300011119 | Bacteria | 762 |
| 199 | Ga0157315_1004064 | 3300012508 | Bacteria | 1025 |
| 200 | Ga0157373_10450061 | 3300013100 | Bacteria | 927 |
| 201 | Ga0157369_10035022 | 3300013105 | Bacteria | 5506 |
| 202 | Ga0157374_10575437 | 3300013296 | Bacteria | 1135 |
| 203 | Ga0157374_10738143 | 3300013296 | Bacteria | 999 |
| 204 | Ga0157374_11753115 | 3300013296 | Bacteria | 646 |
| 205 | Ga0157378_10363416 | 3300013297 | Bacteria | 1417 |
| 206 | Ga0163162_10580982 | 3300013306 | Bacteria | 1247 |
| 207 | Ga0163162_10879949 | 3300013306 | Bacteria | 1010 |
| 208 | Ga0163162_11547895 | 3300013306 | Bacteria | 756 |
| 209 | Ga0157372_10048166 | 3300013307 | Bacteria | 4737 |
| 210 | Ga0157372_10370753 | 3300013307 | Bacteria | 1668 |
| 211 | Ga0157372_10412731 | 3300013307 | Bacteria | 1573 |
| 212 | Ga0157372_10483699 | 3300013307 | Bacteria | 1443 |
| 213 | Ga0157372_11145923 | 3300013307 | Bacteria | 899 |
| 214 | Ga0157375_10047233 | 3300013308 | Bacteria | 4203 |
| 215 | Ga0157375_10485398 | 3300013308 | Bacteria | 1400 |
| 216 | Ga0163163_10356316 | 3300014325 | Bacteria | 1519 |
| 217 | Ga0157380_10094813 | 3300014326 | Bacteria | 2471 |
| 218 | Ga0157380_10433743 | 3300014326 | Bacteria | 1257 |
| 219 | Ga0157380_10462836 | 3300014326 | Bacteria | 1221 |
| 220 | Ga0182008_10247557 | 3300014497 | Bacteria | 919 |
| 221 | Ga0182008_10618451 | 3300014497 | Bacteria | 610 |
| 222 | Ga0157377_10045735 | 3300014745 | Bacteria | 2446 |
| 223 | Ga0157377_10600473 | 3300014745 | Bacteria | 785 |
| 224 | Ga0157377_10692806 | 3300014745 | Bacteria | 739 |
| 225 | Ga0157379_10174406 | 3300014968 | Bacteria | 1941 |
| 226 | Ga0157379_10689001 | 3300014968 | Bacteria | 959 |
| 227 | Ga0157376_10126357 | 3300014969 | Bacteria | 2275 |
| 228 | Ga0157376_10470591 | 3300014969 | Bacteria | 1229 |
| 229 | Ga0157376_10709745 | 3300014969 | Bacteria | 1011 |
| 230 | Ga0163161_10391273 | 3300017792 | Bacteria | 1113 |
| 231 | Ga0206356_10473551 | 3300020070 | Bacteria | 1155 |
| 232 | Ga0213871_10031694 | 3300021441 | Bacteria | 1382 |
| 233 | Ga0224712_10064454 | 3300022467 | Bacteria | 1470 |
| 234 | Ga0224712_10168148 | 3300022467 | Bacteria | 982 |
| 235 | Ga0207692_10034920 | 3300025898 | Bacteria | 2438 |
| 236 | Ga0207692_10420172 | 3300025898 | Bacteria | 837 |
| 237 | Ga0207692_10455059 | 3300025898 | Bacteria | 806 |
| 238 | Ga0207642_10033564 | 3300025899 | Bacteria | 2173 |
| 239 | Ga0207642_10511485 | 3300025899 | Bacteria | 737 |
| 240 | Ga0207710_10269904 | 3300025900 | Bacteria | 854 |
| 241 | Ga0207688_10000094 | 3300025901 | Bacteria | 34655 |
| 242 | Ga0207685_10421115 | 3300025905 | Bacteria | 689 |
| 243 | Ga0207699_10022230 | 3300025906 | Bacteria | 3433 |
| 244 | Ga0207699_10933990 | 3300025906 | Bacteria | 640 |
| 245 | Ga0207645_10124230 | 3300025907 | Bacteria | 1677 |
| 246 | Ga0207643_10012632 | 3300025908 | Bacteria | 4561 |
| 247 | Ga0207643_10018007 | 3300025908 | Bacteria | 3868 |
| 248 | Ga0207643_10019179 | 3300025908 | Bacteria | 3747 |
| 249 | Ga0207643_10052899 | 3300025908 | Bacteria | 2307 |
| 250 | Ga0207684_10061237 | 3300025910 | Bacteria | 3196 |
| 251 | Ga0207707_10108421 | 3300025912 | Bacteria | 2428 |
| 252 | Ga0207707_10214293 | 3300025912 | Bacteria | 1677 |
| 253 | Ga0207695_10443156 | 3300025913 | Bacteria | 1182 |
| 254 | Ga0207695_10608670 | 3300025913 | Bacteria | 974 |
| 255 | Ga0207695_10758460 | 3300025913 | Bacteria | 850 |
| 256 | Ga0207671_10102167 | 3300025914 | Bacteria | 2173 |
| 257 | Ga0207693_10009230 | 3300025915 | Bacteria | 8052 |
| 258 | Ga0207693_10163875 | 3300025915 | Bacteria | 1750 |
| 259 | Ga0207693_10245231 | 3300025915 | Bacteria | 1406 |
| 260 | Ga0207663_10007294 | 3300025916 | Bacteria | 5724 |
| 261 | Ga0207663_10137312 | 3300025916 | Bacteria | 1699 |
| 262 | Ga0207662_10016896 | 3300025918 | Bacteria | 4122 |
| 263 | Ga0207662_10484022 | 3300025918 | Bacteria | 850 |
| 264 | Ga0207657_10009472 | 3300025919 | Bacteria | 9785 |
| 265 | Ga0207657_10032320 | 3300025919 | Bacteria | 4730 |
| 266 | Ga0207649_10324113 | 3300025920 | Bacteria | 1133 |
| 267 | Ga0207649_10737867 | 3300025920 | Bacteria | 766 |
| 268 | Ga0207652_10096320 | 3300025921 | Bacteria | 2607 |
| 269 | Ga0207652_10861220 | 3300025921 | Bacteria | 802 |
| 270 | Ga0207646_10000851 | 3300025922 | Bacteria | 39515 |
| 271 | Ga0207681_10144022 | 3300025923 | Bacteria | 1778 |
| 272 | Ga0207694_10075978 | 3300025924 | Bacteria | 2630 |
| 273 | Ga0207650_10018684 | 3300025925 | Bacteria | 4867 |
| 274 | Ga0207650_10030694 | 3300025925 | Bacteria | 3874 |
| 275 | Ga0207659_10046963 | 3300025926 | Bacteria | 3052 |
| 276 | Ga0207687_10109632 | 3300025927 | Bacteria | 2045 |
| 277 | Ga0207687_10294726 | 3300025927 | Bacteria | 1305 |
| 278 | Ga0207687_10371103 | 3300025927 | Bacteria | 1170 |
| 279 | Ga0207687_10614904 | 3300025927 | Bacteria | 917 |
| 280 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 281 | Ga0207700_10045665 | 3300025928 | Bacteria | 3234 |
| 282 | Ga0207700_10047734 | 3300025928 | Bacteria | 3175 |
| 283 | Ga0207664_10025458 | 3300025929 | Bacteria | 4459 |
| 284 | Ga0207664_10038854 | 3300025929 | Bacteria | 3692 |
| 285 | Ga0207664_10096443 | 3300025929 | Bacteria | 2434 |
| 286 | Ga0207664_10137050 | 3300025929 | Bacteria | 2066 |
| 287 | Ga0207664_10194359 | 3300025929 | Bacteria | 1748 |
| 288 | Ga0207664_10204157 | 3300025929 | Bacteria | 1707 |
| 289 | Ga0207644_10164705 | 3300025931 | Bacteria | 1726 |
| 290 | Ga0207644_10822363 | 3300025931 | Bacteria | 777 |
| 291 | Ga0207690_10163415 | 3300025932 | Bacteria | 1662 |
| 292 | Ga0207690_10697385 | 3300025932 | Bacteria | 834 |
| 293 | Ga0207706_10174250 | 3300025933 | Bacteria | 1890 |
| 294 | Ga0207706_10230165 | 3300025933 | Bacteria | 1622 |
| 295 | Ga0207686_10121872 | 3300025934 | Bacteria | 1776 |
| 296 | Ga0207686_10144148 | 3300025934 | Bacteria | 1650 |
| 297 | Ga0207709_10006045 | 3300025935 | Bacteria | 6820 |
| 298 | Ga0207709_10056512 | 3300025935 | Bacteria | 2429 |
| 299 | Ga0207709_10260242 | 3300025935 | Bacteria | 1272 |
| 300 | Ga0207669_10075819 | 3300025937 | Bacteria | 2132 |
| 301 | Ga0207669_10327646 | 3300025937 | Bacteria | 1175 |
| 302 | Ga0207669_10428016 | 3300025937 | Bacteria | 1043 |
| 303 | Ga0207704_10071929 | 3300025938 | Bacteria | 2196 |
| 304 | Ga0207704_10335079 | 3300025938 | Bacteria | 1172 |
| 305 | Ga0207704_10376060 | 3300025938 | Bacteria | 1114 |
| 306 | Ga0207665_10000058 | 3300025939 | Bacteria | 72882 |
| 307 | Ga0207665_10549878 | 3300025939 | Bacteria | 897 |
| 308 | Ga0207691_10071530 | 3300025940 | Bacteria | 3130 |
| 309 | Ga0207691_10781154 | 3300025940 | Bacteria | 803 |
| 310 | Ga0207711_10110013 | 3300025941 | Bacteria | 2449 |
| 311 | Ga0207711_10254679 | 3300025941 | Bacteria | 1613 |
| 312 | Ga0207711_10342546 | 3300025941 | Bacteria | 1384 |
| 313 | Ga0207689_10032263 | 3300025942 | Bacteria | 4358 |
| 314 | Ga0207689_10663114 | 3300025942 | Bacteria | 879 |
| 315 | Ga0207661_10029243 | 3300025944 | Bacteria | 4230 |
| 316 | Ga0207661_10190988 | 3300025944 | Bacteria | 1795 |
| 317 | Ga0207661_10546301 | 3300025944 | Bacteria | 1061 |
| 318 | Ga0207661_10863333 | 3300025944 | Bacteria | 833 |
| 319 | Ga0207679_10050795 | 3300025945 | Bacteria | 3032 |
| 320 | Ga0207679_10054481 | 3300025945 | Bacteria | 2945 |
| 321 | Ga0207679_10092595 | 3300025945 | Bacteria | 2342 |
| 322 | Ga0207667_10381044 | 3300025949 | Bacteria | 1437 |
| 323 | Ga0207651_10313135 | 3300025960 | Bacteria | 1310 |
| 324 | Ga0207668_10201977 | 3300025972 | Bacteria | 1584 |
| 325 | Ga0207668_10345582 | 3300025972 | Bacteria | 1242 |
| 326 | Ga0207640_10191544 | 3300025981 | Bacteria | 1542 |
| 327 | Ga0207677_10468320 | 3300026023 | Bacteria | 1083 |
| 328 | Ga0207677_10550610 | 3300026023 | Bacteria | 1005 |
| 329 | Ga0207677_11573873 | 3300026023 | Bacteria | 608 |
| 330 | Ga0207639_10084823 | 3300026041 | Bacteria | 2517 |
| 331 | Ga0207639_11048843 | 3300026041 | Bacteria | 764 |
| 332 | Ga0207678_10039202 | 3300026067 | Bacteria | 4112 |
| 333 | Ga0207708_10039177 | 3300026075 | Bacteria | 3610 |
| 334 | Ga0207708_10490920 | 3300026075 | Bacteria | 1028 |
| 335 | Ga0207702_11047895 | 3300026078 | Bacteria | 809 |
| 336 | Ga0207641_10235360 | 3300026088 | Bacteria | 1704 |
| 337 | Ga0207641_11482352 | 3300026088 | Bacteria | 680 |
| 338 | Ga0207648_10042703 | 3300026089 | Bacteria | 3980 |
| 339 | Ga0207648_10780212 | 3300026089 | Bacteria | 889 |
| 340 | Ga0207648_10891679 | 3300026089 | Bacteria | 830 |
| 341 | Ga0207676_10113884 | 3300026095 | Bacteria | 2268 |
| 342 | Ga0207674_10055770 | 3300026116 | Bacteria | 4016 |
| 343 | Ga0207674_10153021 | 3300026116 | Bacteria | 2263 |
| 344 | Ga0207675_100553554 | 3300026118 | Bacteria | 1150 |
| 345 | Ga0207683_10058879 | 3300026121 | Bacteria | 3373 |
| 346 | Ga0207683_10161304 | 3300026121 | Bacteria | 2027 |
| 347 | Ga0207683_10221925 | 3300026121 | Bacteria | 1722 |
| 348 | Ga0207698_10741602 | 3300026142 | Bacteria | 980 |
| 349 | Ga0207698_11902535 | 3300026142 | Bacteria | 610 |
| 350 | Ga0207428_10000181 | 3300027907 | Bacteria | 88299 |
| 351 | Ga0207428_10019256 | 3300027907 | Bacteria | 5820 |
| 352 | Ga0207428_10320405 | 3300027907 | Bacteria | 1145 |
| 353 | Ga0207428_10512868 | 3300027907 | Bacteria | 870 |
| 354 | Ga0268266_10043001 | 3300028379 | Bacteria | 3860 |
| 355 | Ga0268265_10526911 | 3300028380 | Bacteria | 1118 |
| 356 | Ga0265337_1061382 | 3300028556 | Bacteria | 1042 |
| 357 | Ga0265334_10010285 | 3300028573 | Bacteria | 3949 |
| 358 | Ga0265322_10062119 | 3300028654 | Bacteria | 1060 |
| 359 | Ga0265336_10001318 | 3300028666 | Bacteria | 11596 |
| 360 | Ga0265338_10012206 | 3300028800 | Bacteria | 9811 |
| 361 | Ga0265327_10035110 | 3300031251 | Bacteria | 2776 |
| 362 | Ga0265313_10050529 | 3300031595 | Bacteria | 1994 |
| 363 | Ga0307406_10132712 | 3300031901 | Bacteria | 1751 |
| 364 | Ga0316583_10026202 | 3300032133 | Bacteria | 2081 |
| 365 | Ga0316593_10010384 | 3300032168 | Bacteria | 2668 |
| 366 | Ga0316596_1017568 | 3300033541 | Bacteria | 1801 |
| 367 | Ga0373926_0005643 | 3300035083 | Bacteria | 4127 |
| 368 | Ga0373926_0086955 | 3300035083 | Bacteria | 1160 |
| 369 | Ga0373928_0016089 | 3300035084 | Bacteria | 1528 |
| 370 | Ga0373934_0023921 | 3300035086 | Bacteria | 2362 |
| 371 | Ga0373949_0014842 | 3300035090 | Bacteria | 1737 |
| 372 | Ga0373952_0036322 | 3300035092 | Bacteria | 1119 |
| 373 | Ga0373923_0165417 | 3300035111 | Bacteria | 1011 |
| 374 | Ga0373936_0015763 | 3300035113 | Bacteria | 2899 |
| 375 | Ga0373939_0031302 | 3300035114 | Bacteria | 1537 |
| 376 | Ga0373945_0027844 | 3300035116 | Bacteria | 1976 |
| 377 | Ga0373953_0116309 | 3300035117 | Bacteria | 1134 |
| 378 | Ga0373956_0062256 | 3300035119 | Bacteria | 1691 |
| 379 | Ga0373960_0021225 | 3300035121 | Bacteria | 1725 |
| 380 | Ga0373943_0007053 | 3300035170 | Bacteria | 5040 |
| 381 | Ga0373943_0053897 | 3300035170 | Bacteria | 1987 |
| 382 | Ga0373943_0057742 | 3300035170 | Bacteria | 1929 |
| 383 | Ga0373946_0014684 | 3300035171 | Bacteria | 2956 |
| 384 | Ga0373946_0063508 | 3300035171 | Bacteria | 1577 |
| 385 | Ga0373955_0026984 | 3300035172 | Bacteria | 2964 |
| 386 | Ga0373961_0049540 | 3300035241 | Bacteria | 1242 |
| 387 | Ga0373962_0174743 | 3300035242 | Bacteria | 715 |
| 388 | Ga0316574_0171894 | 3300035398 | Bacteria | 1395 |
| 389 | Ga0373924_0081084 | 3300035410 | Bacteria | 1380 |
| 390 | Ga0373931_0017440 | 3300035691 | Bacteria | 3552 |
| 391 | Ga0373935_0042154 | 3300035692 | Bacteria | 2869 |
| 392 | Ga0373935_0079916 | 3300035692 | Bacteria | 2123 |
| 393 | Ga0373935_0319526 | 3300035692 | Bacteria | 1101 |
| 394 | Ga0373935_0591751 | 3300035692 | Bacteria | 811 |
| 395 | Ga0373927_0048850 | 3300035695 | Bacteria | 2737 |
| 396 | Ga0373927_0361397 | 3300035695 | Bacteria | 957 |
| 397 | Ga0373933_0021469 | 3300035724 | Bacteria | 3668 |
| 398 | Ga0373947_0017628 | 3300035725 | Bacteria | 4108 |
| 399 | Ga0373947_0021201 | 3300035725 | Bacteria | 3760 |
| 400 | Ga0373947_0321031 | 3300035725 | Bacteria | 1035 |
| 401 | Ga0373937_0001944 | 3300036401 | Bacteria | 17289 |
| 402 | Ga0373937_0720054 | 3300036401 | Bacteria | 945 |
| 403 | Ga0373925_0002218 | 3300037068 | Bacteria | 15763 |
| 404 | Ga0373925_0062170 | 3300037068 | Bacteria | 2807 |
| 405 | Ga0373925_0177521 | 3300037068 | Bacteria | 1684 |
| 406 | Ga0395899_0153589 | 3300037312 | Bacteria | 1630 |
| 407 | Ga0395899_0190775 | 3300037312 | Bacteria | 1434 |
| 408 | Ga0395899_0207337 | 3300037312 | Bacteria | 1364 |
| 409 | Ga0395900_0011178 | 3300037418 | Bacteria | 9178 |
| 410 | Ga0395900_0167439 | 3300037418 | Bacteria | 2239 |
| 411 | Ga0395900_0284549 | 3300037418 | Bacteria | 1644 |
| 412 | Ga0395900_0752662 | 3300037418 | Bacteria | 904 |
| 413 | Ga0395900_1214729 | 3300037418 | Bacteria | 669 |
| 414 | Ga0395898_0091882 | 3300037466 | Bacteria | 2919 |
| 415 | Ga0395898_0297972 | 3300037466 | Bacteria | 1538 |
| 416 | Ga0395898_1106446 | 3300037466 | Bacteria | 725 |
| 417 | Ga0395905_0055653 | 3300037471 | Bacteria | 3702 |
| 418 | Ga0395905_0342344 | 3300037471 | Bacteria | 1386 |
| 419 | Ga0395905_0700236 | 3300037471 | Bacteria | 915 |
| 420 | Ga0436364_0599685 | 3300037853 | Bacteria | 3313 |
| 421 | Ga0395901_0019091 | 3300038443 | Bacteria | 7010 |
| 422 | Ga0395901_0074476 | 3300038443 | Bacteria | 3542 |
| 423 | Ga0395901_0161249 | 3300038443 | Bacteria | 2355 |
| 424 | Ga0395901_0212831 | 3300038443 | Bacteria | 2022 |
| 425 | Ga0395901_0571535 | 3300038443 | Bacteria | 1143 |
| 426 | Ga0400490_17491 | 3300038726 | Bacteria | 28094 |
| 427 | Ga0400491_12215 | 3300038727 | Bacteria | 7556 |
| 428 | Ga0436365_1358796 | 3300039437 | Bacteria | 845 |
| 429 | Ga0436360_1013902 | 3300039438 | Bacteria | 3542 |
| 430 | Ga0436361_0766437 | 3300039447 | Bacteria | 2031 |
| 431 | Ga0436363_1151979 | 3300039450 | Bacteria | 1043 |
| 432 | Ga0436362_1022308 | 3300039453 | Bacteria | 958 |
| 433 | Ga0439466_0031680 | 3300041411 | Bacteria | 1807 |
| 434 | Ga0451793_1286489 | 3300041452 | Bacteria | 990 |
| 435 | Ga0451795_0086528 | 3300041456 | Bacteria | 795 |
| 436 | Ga0451798_0303405 | 3300041458 | Bacteria | 871 |
| 437 | Ga0451800_0225302 | 3300041459 | Bacteria | 1400 |
| 438 | Ga0450920_002132 | 3300042122 | Bacteria | 3348 |
| 439 | Ga0450920_003850 | 3300042122 | Bacteria | 2614 |
| 440 | Ga0450900_023776 | 3300042136 | Bacteria | 867 |
| 441 | Ga0450902_032249 | 3300042137 | Bacteria | 883 |
| 442 | Ga0450903_024523 | 3300042138 | Bacteria | 925 |
| 443 | Ga0450907_001870 | 3300042146 | Bacteria | 4312 |
| 444 | Ga0450910_013079 | 3300042147 | Bacteria | 1205 |
| 445 | Ga0466969_0003758 | 3300044656 | Bacteria | 8068 |
| 446 | Ga0466969_0064936 | 3300044656 | Bacteria | 1766 |
| 447 | Ga0466969_0198983 | 3300044656 | Bacteria | 914 |
| 448 | Ga0453683_0088991 | 3300044673 | Bacteria | 1935 |
| 449 | Ga0466965_0077701 | 3300044683 | Bacteria | 1676 |
| 450 | Ga0466965_0923505 | 3300044683 | Bacteria | 510 |
| 451 | Ga0466966_0034146 | 3300044684 | Bacteria | 3291 |
| 452 | Ga0466966_0044853 | 3300044684 | Bacteria | 2828 |
| 453 | Ga0466961_0000463 | 3300044693 | Bacteria | 25666 |
| 454 | Ga0466961_0015787 | 3300044693 | Bacteria | 4846 |
| 455 | Ga0466961_0060307 | 3300044693 | Bacteria | 2412 |
| 456 | Ga0466961_0077983 | 3300044693 | Bacteria | 2098 |
| 457 | Ga0466961_0085051 | 3300044693 | Bacteria | 2000 |
| 458 | Ga0466963_0000055 | 3300044694 | Bacteria | 37968 |
| 459 | Ga0466963_0002044 | 3300044694 | Bacteria | 11114 |
| 460 | Ga0466963_0004340 | 3300044694 | Bacteria | 8227 |
| 461 | Ga0466963_0006350 | 3300044694 | Bacteria | 6990 |
| 462 | Ga0466963_0006417 | 3300044694 | Bacteria | 6956 |
| 463 | Ga0466963_0017674 | 3300044694 | Bacteria | 4447 |
| 464 | Ga0466963_0026186 | 3300044694 | Bacteria | 3728 |
| 465 | Ga0466963_0048563 | 3300044694 | Bacteria | 2804 |
| 466 | Ga0466963_0092269 | 3300044694 | Bacteria | 2063 |
| 467 | Ga0466963_0097328 | 3300044694 | Bacteria | 2010 |
| 468 | Ga0466963_0135655 | 3300044694 | Bacteria | 1702 |
| 469 | Ga0466963_0184877 | 3300044694 | Bacteria | 1455 |
| 470 | Ga0466963_0593879 | 3300044694 | Bacteria | 782 |
| 471 | Ga0466963_0638521 | 3300044694 | Bacteria | 751 |
| 472 | Ga0466964_0031729 | 3300044706 | Bacteria | 2097 |
| 473 | Ga0466964_0033993 | 3300044706 | Bacteria | 2033 |
| 474 | Ga0466964_0073886 | 3300044706 | Bacteria | 1448 |
| 475 | Ga0466964_0095241 | 3300044706 | Bacteria | 1302 |
| 476 | Ga0453684_0734803 | 3300044712 | Bacteria | 1070 |
| 477 | Ga0466971_0009943 | 3300044719 | Bacteria | 4155 |
| 478 | Ga0466971_0011670 | 3300044719 | Bacteria | 3847 |
| 479 | Ga0466971_0028795 | 3300044719 | Bacteria | 2484 |
| 480 | Ga0466971_0142487 | 3300044719 | Bacteria | 1116 |
| 481 | Ga0466968_0008743 | 3300044735 | Bacteria | 3882 |
| 482 | Ga0466968_0028416 | 3300044735 | Bacteria | 2306 |
| 483 | Ga0466968_0031656 | 3300044735 | Bacteria | 2195 |
| 484 | Ga0466968_0103594 | 3300044735 | Bacteria | 1273 |
| 485 | Ga0466968_0126664 | 3300044735 | Bacteria | 1159 |
| 486 | Ga0466968_0161488 | 3300044735 | Bacteria | 1034 |
| 487 | Ga0466970_0007299 | 3300044765 | Bacteria | 5538 |
| 488 | Ga0466970_0070016 | 3300044765 | Bacteria | 1886 |
| 489 | Ga0466970_0371652 | 3300044765 | Bacteria | 813 |
| 490 | Ga0466957_0005217 | 3300044842 | Bacteria | 7271 |
| 491 | Ga0466957_0016697 | 3300044842 | Bacteria | 4294 |
| 492 | Ga0466957_0029951 | 3300044842 | Bacteria | 3248 |
| 493 | Ga0466957_0193152 | 3300044842 | Bacteria | 1334 |
| 494 | Ga0466957_0349714 | 3300044842 | Bacteria | 1002 |
| 495 | Ga0466960_0021506 | 3300044901 | Bacteria | 2873 |
| 496 | Ga0466960_0056340 | 3300044901 | Bacteria | 1913 |
| 497 | Ga0466959_0000761 | 3300045049 | Bacteria | 18843 |
| 498 | Ga0466959_0004174 | 3300045049 | Bacteria | 9625 |
| 499 | Ga0466959_0006516 | 3300045049 | Bacteria | 8094 |
| 500 | Ga0466959_0022832 | 3300045049 | Bacteria | 4624 |
| 501 | Ga0466959_0168935 | 3300045049 | Bacteria | 1534 |
| 502 | Ga0466959_0264676 | 3300045049 | Bacteria | 1183 |
| 503 | Ga0466958_0006835 | 3300045836 | Bacteria | 6239 |
| 504 | Ga0466958_0010924 | 3300045836 | Bacteria | 5100 |
| 505 | Ga0466958_0013846 | 3300045836 | Bacteria | 4599 |
| 506 | Ga0466958_0031826 | 3300045836 | Bacteria | 3135 |
| 507 | Ga0466958_0205627 | 3300045836 | Bacteria | 1253 |
| 508 | Ga0466958_0345198 | 3300045836 | Bacteria | 958 |
| 509 | Ga0466958_0375338 | 3300045836 | Bacteria | 916 |
| 510 | Ga0466958_0459671 | 3300045836 | Bacteria | 824 |
| 511 | Ga0466967_0002348 | 3300045976 | Bacteria | 11708 |
| 512 | Ga0466967_0039139 | 3300045976 | Bacteria | 4073 |
| 513 | Ga0466967_0046458 | 3300045976 | Bacteria | 3780 |
| 514 | Ga0466967_0053112 | 3300045976 | Bacteria | 3560 |
| 515 | Ga0466967_0065217 | 3300045976 | Bacteria | 3240 |
| 516 | Ga0466967_0075823 | 3300045976 | Bacteria | 3023 |
| 517 | Ga0466967_0078419 | 3300045976 | Bacteria | 2975 |
| 518 | Ga0466967_0099841 | 3300045976 | Bacteria | 2651 |
| 519 | Ga0466967_0116175 | 3300045976 | Bacteria | 2465 |
| 520 | Ga0466967_0189810 | 3300045976 | Bacteria | 1941 |
| 521 | Ga0466967_0212598 | 3300045976 | Bacteria | 1835 |
| 522 | Ga0466967_0223460 | 3300045976 | Bacteria | 1790 |
| 523 | Ga0466967_0225253 | 3300045976 | Bacteria | 1783 |
| 524 | Ga0466967_0336155 | 3300045976 | Bacteria | 1459 |
| 525 | Ga0466967_0466266 | 3300045976 | Bacteria | 1236 |
| 526 | Ga0466967_0527842 | 3300045976 | Bacteria | 1160 |
| 527 | Ga0466967_0626652 | 3300045976 | Bacteria | 1062 |
| 528 | Ga0466967_0829701 | 3300045976 | Bacteria | 918 |
| 529 | Ga0466967_1157853 | 3300045976 | Bacteria | 770 |
| 530 | Ga0466967_1372260 | 3300045976 | Bacteria | 704 |
| 531 | Ga0466967_1471974 | 3300045976 | Bacteria | 678 |
| 532 | Ga0495592_0000082 | 3300046454 | Bacteria | 83312 |
| 533 | Ga0495592_0005470 | 3300046454 | Bacteria | 9382 |
| 534 | Ga0495592_0074198 | 3300046454 | Bacteria | 2471 |
| 535 | Ga0495592_0475797 | 3300046454 | Bacteria | 779 |
| 536 | Ga0495592_0770835 | 3300046454 | Bacteria | 573 |
| 537 | Ga0495603_0032804 | 3300046455 | Bacteria | 3124 |
| 538 | Ga0495603_0040839 | 3300046455 | Bacteria | 2776 |
| 539 | Ga0495603_0043193 | 3300046455 | Bacteria | 2693 |
| 540 | Ga0495603_0189160 | 3300046455 | Bacteria | 1190 |
| 541 | Ga0495603_0440952 | 3300046455 | Bacteria | 746 |
| 542 | Ga0495629_0001157 | 3300046459 | Bacteria | 20835 |
| 543 | Ga0495629_0107062 | 3300046459 | Bacteria | 1950 |
| 544 | Ga0495629_0458389 | 3300046459 | Bacteria | 863 |
| 545 | Ga0495629_0496358 | 3300046459 | Bacteria | 823 |
| 546 | Ga0495629_0732121 | 3300046459 | Bacteria | 655 |
| 547 | Ga0495641_0002322 | 3300046461 | Bacteria | 15128 |
| 548 | Ga0495641_0003735 | 3300046461 | Bacteria | 11202 |
| 549 | Ga0495641_0013465 | 3300046461 | Bacteria | 4492 |
| 550 | Ga0495641_0016679 | 3300046461 | Bacteria | 3859 |
| 551 | Ga0495641_0168032 | 3300046461 | Bacteria | 981 |
| 552 | Ga0495641_0262499 | 3300046461 | Bacteria | 777 |
| 553 | Ga0495641_0324433 | 3300046461 | Bacteria | 695 |
| 554 | Ga0495651_0000254 | 3300046462 | Bacteria | 41379 |
| 555 | Ga0495651_0222455 | 3300046462 | Bacteria | 1305 |
| 556 | Ga0495651_0285830 | 3300046462 | Bacteria | 1112 |
| 557 | Ga0495653_0023292 | 3300046463 | Bacteria | 5006 |
| 558 | Ga0495653_0110292 | 3300046463 | Bacteria | 1978 |
| 559 | Ga0495653_0168599 | 3300046463 | Bacteria | 1513 |
| 560 | Ga0495653_0206095 | 3300046463 | Bacteria | 1331 |
| 561 | Ga0495580_0009973 | 3300046472 | Bacteria | 7427 |
| 562 | Ga0495582_0000808 | 3300046473 | Bacteria | 17389 |
| 563 | Ga0495582_0001703 | 3300046473 | Bacteria | 12403 |
| 564 | Ga0495582_0265163 | 3300046473 | Bacteria | 985 |
| 565 | Ga0495582_0358266 | 3300046473 | Bacteria | 840 |
| 566 | Ga0495582_0412425 | 3300046473 | Bacteria | 779 |
| 567 | Ga0495582_0484312 | 3300046473 | Bacteria | 715 |
| 568 | Ga0495605_0054527 | 3300046474 | Bacteria | 1936 |
| 569 | Ga0495639_0000659 | 3300046475 | Bacteria | 15963 |
| 570 | Ga0495639_0000828 | 3300046475 | Bacteria | 14100 |
| 571 | Ga0495662_0002737 | 3300046476 | Bacteria | 8908 |
| 572 | Ga0495662_0111106 | 3300046476 | Bacteria | 1343 |
| 573 | Ga0495662_0163504 | 3300046476 | Bacteria | 1097 |
| 574 | Ga0495662_0206358 | 3300046476 | Bacteria | 968 |
| 575 | Ga0495664_0018869 | 3300046477 | Bacteria | 3958 |
| 576 | Ga0495664_0073142 | 3300046477 | Bacteria | 2049 |
| 577 | Ga0495664_0073533 | 3300046477 | Bacteria | 2044 |
| 578 | Ga0495585_0025984 | 3300046492 | Bacteria | 3349 |
| 579 | Ga0495594_0037202 | 3300046499 | Bacteria | 2655 |
| 580 | Ga0495594_0284652 | 3300046499 | Bacteria | 942 |
| 581 | Ga0495594_0378856 | 3300046499 | Bacteria | 805 |
| 582 | Ga0495594_0603824 | 3300046499 | Bacteria | 622 |
| 583 | Ga0495596_0071343 | 3300046500 | Bacteria | 1349 |
| 584 | Ga0495596_0085594 | 3300046500 | Bacteria | 1223 |
| 585 | Ga0495608_0003029 | 3300046511 | Bacteria | 11991 |
| 586 | Ga0495608_0019774 | 3300046511 | Bacteria | 4631 |
| 587 | Ga0495608_0076168 | 3300046511 | Bacteria | 2186 |
| 588 | Ga0495608_0301504 | 3300046511 | Bacteria | 992 |
| 589 | Ga0495618_0010074 | 3300046514 | Bacteria | 5714 |
| 590 | Ga0495618_0011530 | 3300046514 | Bacteria | 5362 |
| 591 | Ga0495618_0079738 | 3300046514 | Bacteria | 2088 |
| 592 | Ga0495618_0130632 | 3300046514 | Bacteria | 1607 |
| 593 | Ga0495618_0224637 | 3300046514 | Bacteria | 1184 |
| 594 | Ga0495618_0285957 | 3300046514 | Bacteria | 1027 |
| 595 | Ga0495618_0604342 | 3300046514 | Bacteria | 652 |
| 596 | Ga0495628_0008466 | 3300046516 | Bacteria | 8819 |
| 597 | Ga0495628_0013181 | 3300046516 | Bacteria | 6956 |
| 598 | Ga0495628_0037042 | 3300046516 | Bacteria | 3911 |
| 599 | Ga0495628_0255320 | 3300046516 | Bacteria | 1307 |
| 600 | Ga0495628_0693428 | 3300046516 | Bacteria | 720 |
| 601 | Ga0495630_0018065 | 3300046517 | Bacteria | 5175 |
| 602 | Ga0495630_0059957 | 3300046517 | Bacteria | 2855 |
| 603 | Ga0495630_0081900 | 3300046517 | Bacteria | 2435 |
| 604 | Ga0495630_0207836 | 3300046517 | Bacteria | 1494 |
| 605 | Ga0495630_0627798 | 3300046517 | Bacteria | 823 |
| 606 | Ga0495630_0742766 | 3300046517 | Bacteria | 750 |
| 607 | Ga0495631_0048561 | 3300046518 | Bacteria | 1861 |
| 608 | Ga0495631_0259748 | 3300046518 | Bacteria | 740 |
| 609 | Ga0495644_0072868 | 3300046523 | Bacteria | 1291 |
| 610 | Ga0495644_0223804 | 3300046523 | Bacteria | 728 |
| 611 | Ga0495663_0025814 | 3300046525 | Bacteria | 1716 |
| 612 | Ga0495666_0000309 | 3300046526 | Bacteria | 21203 |
| 613 | Ga0495666_0008288 | 3300046526 | Bacteria | 5208 |
| 614 | Ga0495642_0037952 | 3300046528 | Bacteria | 1950 |
| 615 | Ga0495642_0354807 | 3300046528 | Bacteria | 645 |
| 616 | Ga0495652_0000144 | 3300046529 | Bacteria | 80486 |
| 617 | Ga0495652_0005095 | 3300046529 | Bacteria | 12426 |
| 618 | Ga0495665_0001383 | 3300046531 | Bacteria | 12998 |
| 619 | Ga0495665_0003045 | 3300046531 | Bacteria | 9054 |
| 620 | Ga0495640_0002828 | 3300046533 | Bacteria | 13955 |
| 621 | Ga0495640_0016017 | 3300046533 | Bacteria | 5621 |
| 622 | Ga0495640_0188659 | 3300046533 | Bacteria | 1311 |
| 623 | Ga0495640_0255781 | 3300046533 | Bacteria | 1095 |
| 624 | Ga0495586_0035224 | 3300046535 | Bacteria | 2688 |
| 625 | Ga0495586_0259235 | 3300046535 | Bacteria | 993 |
| 626 | Ga0495586_0596015 | 3300046535 | Bacteria | 638 |
| 627 | Ga0495587_0000060 | 3300046536 | Bacteria | 93780 |
| 628 | Ga0495587_0042989 | 3300046536 | Bacteria | 2692 |
| 629 | Ga0495587_0267091 | 3300046536 | Bacteria | 960 |
| 630 | Ga0495609_0082219 | 3300046538 | Bacteria | 1407 |
| 631 | Ga0495645_0000038 | 3300046543 | Bacteria | 96124 |
| 632 | Ga0495645_0039870 | 3300046543 | Bacteria | 3425 |
| 633 | Ga0495645_0112646 | 3300046543 | Bacteria | 1923 |
| 634 | Ga0495667_0008738 | 3300046559 | Bacteria | 6882 |
| 635 | Ga0495667_0117024 | 3300046559 | Bacteria | 1722 |
| 636 | Ga0495667_0149217 | 3300046559 | Bacteria | 1505 |
| 637 | Ga0495667_0173797 | 3300046559 | Bacteria | 1384 |
| 638 | Ga0495667_0308668 | 3300046559 | Bacteria | 1002 |
| 639 | Ga0495656_0001194 | 3300046615 | Bacteria | 8463 |
| 640 | Ga0495656_0163686 | 3300046615 | Bacteria | 1083 |
| 641 | Ga0495634_0004455 | 3300046642 | Bacteria | 10990 |
| 642 | Ga0495634_0031559 | 3300046642 | Bacteria | 3648 |
| 643 | Ga0495634_0159950 | 3300046642 | Bacteria | 1420 |
| 644 | Ga0495634_0175161 | 3300046642 | Bacteria | 1346 |
| 645 | Ga0495611_0037229 | 3300046648 | Bacteria | 2161 |
| 646 | Ga0495635_0059021 | 3300046663 | Bacteria | 2638 |
| 647 | Ga0495635_0209839 | 3300046663 | Bacteria | 1319 |
| 648 | Ga0495635_0221470 | 3300046663 | Bacteria | 1279 |
| 649 | Ga0495659_0010631 | 3300046664 | Bacteria | 2959 |
| 650 | Ga0495588_0260965 | 3300046674 | Bacteria | 913 |
| 651 | Ga0495657_0021956 | 3300046675 | Bacteria | 4576 |
| 652 | Ga0495657_0026518 | 3300046675 | Bacteria | 4103 |
| 653 | Ga0495657_0029234 | 3300046675 | Bacteria | 3867 |
| 654 | Ga0495657_0074859 | 3300046675 | Bacteria | 2202 |
| 655 | Ga0495657_0192428 | 3300046675 | Bacteria | 1246 |
| 656 | Ga0495599_0003010 | 3300046678 | Bacteria | 9810 |
| 657 | Ga0495599_0042619 | 3300046678 | Bacteria | 2848 |
| 658 | Ga0495599_0251432 | 3300046678 | Bacteria | 1075 |
| 659 | Ga0495623_0003795 | 3300046679 | Bacteria | 9954 |
| 660 | Ga0495623_0301324 | 3300046679 | Bacteria | 885 |
| 661 | Ga0495646_0016747 | 3300046680 | Bacteria | 4654 |
| 662 | Ga0495646_0027797 | 3300046680 | Bacteria | 3546 |
| 663 | Ga0495646_0075159 | 3300046680 | Bacteria | 1981 |
| 664 | Ga0495646_0167143 | 3300046680 | Bacteria | 1214 |
| 665 | Ga0495647_0010914 | 3300046681 | Bacteria | 3103 |
| 666 | Ga0495647_0013196 | 3300046681 | Bacteria | 2859 |
| 667 | Ga0495647_0112595 | 3300046681 | Bacteria | 1137 |
| 668 | Ga0495647_0274276 | 3300046681 | Bacteria | 755 |
| 669 | Ga0495658_0000498 | 3300046683 | Bacteria | 21575 |
| 670 | Ga0495658_0001453 | 3300046683 | Bacteria | 12469 |
| 671 | Ga0495658_0117774 | 3300046683 | Bacteria | 1603 |
| 672 | Ga0495613_0061335 | 3300046689 | Bacteria | 2753 |
| 673 | Ga0495613_0141595 | 3300046689 | Bacteria | 1718 |
| 674 | Ga0495613_0157507 | 3300046689 | Bacteria | 1617 |
| 675 | Ga0495613_0168864 | 3300046689 | Bacteria | 1553 |
| 676 | Ga0495624_0007698 | 3300046690 | Bacteria | 7557 |
| 677 | Ga0495624_0011808 | 3300046690 | Bacteria | 5993 |
| 678 | Ga0495624_0034041 | 3300046690 | Bacteria | 3298 |
| 679 | Ga0495624_0079393 | 3300046690 | Bacteria | 2035 |
| 680 | Ga0495624_0109404 | 3300046690 | Bacteria | 1700 |
| 681 | Ga0495624_0495574 | 3300046690 | Bacteria | 731 |
| 682 | Ga0495670_0056634 | 3300046691 | Bacteria | 1967 |
| 683 | Ga0495600_0062127 | 3300046809 | Bacteria | 2440 |
| 684 | Ga0495600_0366427 | 3300046809 | Bacteria | 901 |
| 685 | Ga0495581_0001143 | 3300047315 | Bacteria | 14507 |
| 686 | Ga0495581_0017975 | 3300047315 | Bacteria | 4108 |
| 687 | Ga0495581_0230668 | 3300047315 | Bacteria | 1083 |
| 688 | Ga0495604_0000043 | 3300047317 | Bacteria | 116335 |
| 689 | Ga0495604_0148730 | 3300047317 | Bacteria | 1666 |
| 690 | Ga0495604_0220666 | 3300047317 | Bacteria | 1305 |
| 691 | Ga0495604_0254304 | 3300047317 | Bacteria | 1196 |
| 692 | Ga0495674_0007325 | 3300047319 | Bacteria | 10549 |
| 693 | Ga0495674_0019407 | 3300047319 | Bacteria | 6310 |
| 694 | Ga0495674_0138750 | 3300047319 | Bacteria | 2044 |
| 695 | Ga0495674_0227405 | 3300047319 | Bacteria | 1540 |
| 696 | Ga0495674_0493327 | 3300047319 | Bacteria | 980 |
| 697 | Ga0495676_0016334 | 3300047321 | Bacteria | 6592 |
| 698 | Ga0495676_0036425 | 3300047321 | Bacteria | 4108 |
| 699 | Ga0495676_0070005 | 3300047321 | Bacteria | 2705 |
| 700 | Ga0495676_0072781 | 3300047321 | Bacteria | 2638 |
| 701 | Ga0495676_0118846 | 3300047321 | Bacteria | 1927 |
| 702 | Ga0495676_0355612 | 3300047321 | Bacteria | 978 |
| 703 | Ga0495676_0472150 | 3300047321 | Bacteria | 826 |
| 704 | Ga0495680_0005229 | 3300047322 | Bacteria | 12252 |
| 705 | Ga0495680_0009827 | 3300047322 | Bacteria | 8578 |
| 706 | Ga0495680_0010993 | 3300047322 | Bacteria | 8042 |
| 707 | Ga0495680_0286568 | 3300047322 | Bacteria | 1159 |
| 708 | Ga0495675_0000413 | 3300047444 | Bacteria | 29216 |
| 709 | Ga0495685_043204 | 3300047447 | Bacteria | 1538 |
| 710 | Ga0495684_0001111 | 3300047471 | Bacteria | 21659 |
| 711 | Ga0495684_0076140 | 3300047471 | Bacteria | 2548 |
| 712 | Ga0495684_0129709 | 3300047471 | Bacteria | 1894 |
| 713 | Ga0495684_0274597 | 3300047471 | Bacteria | 1218 |
| 714 | Ga0495684_0280426 | 3300047471 | Bacteria | 1202 |
| 715 | Ga0495684_0435114 | 3300047471 | Bacteria | 914 |
| 716 | Ga0495593_0001256 | 3300047673 | Bacteria | 14872 |
| 717 | Ga0495593_0004784 | 3300047673 | Bacteria | 8036 |
| 718 | Ga0495593_0092131 | 3300047673 | Bacteria | 1560 |
| 719 | Ga0495602_0022762 | 3300048088 | Bacteria | 6126 |
| 720 | Ga0495614_0002476 | 3300048089 | Bacteria | 8212 |
| 721 | Ga0495614_0004362 | 3300048089 | Bacteria | 6373 |
| 722 | Ga0495614_0296538 | 3300048089 | Bacteria | 746 |
| 723 | Ga0496100_0001629 | 3300048903 | Bacteria | 11110 |
| 724 | Ga0496100_0053677 | 3300048903 | Bacteria | 2625 |
| 725 | Ga0496100_0272426 | 3300048903 | Bacteria | 1259 |
| 726 | Ga0496100_0276059 | 3300048903 | Bacteria | 1251 |
| 727 | Ga0496100_0444036 | 3300048903 | Bacteria | 994 |
| 728 | Ga0496101_0006702 | 3300048904 | Bacteria | 7426 |
| 729 | Ga0496101_0149061 | 3300048904 | Bacteria | 1788 |
| 730 | Ga0496101_0149940 | 3300048904 | Bacteria | 1783 |
| 731 | Ga0496101_0285472 | 3300048904 | Bacteria | 1291 |
| 732 | Ga0496101_0457958 | 3300048904 | Bacteria | 1006 |
| 733 | Ga0496102_0008253 | 3300048905 | Bacteria | 8919 |
| 734 | Ga0496102_0063343 | 3300048905 | Bacteria | 3385 |
| 735 | Ga0496102_0181949 | 3300048905 | Bacteria | 1980 |
| 736 | Ga0496102_0523215 | 3300048905 | Bacteria | 1109 |
| 737 | Ga0496102_1297569 | 3300048905 | Bacteria | 647 |
| 738 | Ga0496103_0014004 | 3300048906 | Bacteria | 4761 |
| 739 | Ga0496103_0057089 | 3300048906 | Bacteria | 2423 |
| 740 | Ga0496104_0007021 | 3300048907 | Bacteria | 9931 |
| 741 | Ga0496104_0307271 | 3300048907 | Bacteria | 1498 |
| 742 | Ga0496104_0382082 | 3300048907 | Bacteria | 1321 |
| 743 | Ga0496104_0597812 | 3300048907 | Bacteria | 1013 |
| 744 | Ga0496105_0029069 | 3300048908 | Bacteria | 4523 |
| 745 | Ga0496105_0118125 | 3300048908 | Bacteria | 2187 |
| 746 | Ga0496105_0198444 | 3300048908 | Bacteria | 1638 |
| 747 | Ga0496105_0678076 | 3300048908 | Bacteria | 793 |
| 748 | Ga0496106_0031105 | 3300048909 | Bacteria | 3977 |
| 749 | Ga0496106_0232204 | 3300048909 | Bacteria | 1473 |
| 750 | Ga0496106_0530873 | 3300048909 | Bacteria | 945 |
| 751 | Ga0496106_0853683 | 3300048909 | Bacteria | 720 |
| 752 | Ga0496107_0017701 | 3300048910 | Bacteria | 5013 |
| 753 | Ga0496107_0180696 | 3300048910 | Bacteria | 1566 |
| 754 | Ga0496107_0571075 | 3300048910 | Bacteria | 837 |
| 755 | Ga0496107_0727413 | 3300048910 | Bacteria | 729 |
| 756 | Ga0496108_0058486 | 3300048911 | Bacteria | 3240 |
| 757 | Ga0496108_0107249 | 3300048911 | Bacteria | 2385 |
| 758 | Ga0496108_0568902 | 3300048911 | Bacteria | 988 |
| 759 | Ga0496109_0082695 | 3300048912 | Bacteria | 2959 |
| 760 | Ga0496109_0089833 | 3300048912 | Bacteria | 2841 |
| 761 | Ga0496109_0099702 | 3300048912 | Bacteria | 2694 |
| 762 | Ga0496109_0113923 | 3300048912 | Bacteria | 2515 |
| 763 | Ga0496109_0384105 | 3300048912 | Bacteria | 1326 |
| 764 | Ga0496109_0480016 | 3300048912 | Bacteria | 1174 |
| 765 | Ga0496109_0518190 | 3300048912 | Bacteria | 1125 |
| 766 | Ga0496109_1028350 | 3300048912 | Bacteria | 761 |
| 767 | Ga0496109_1393720 | 3300048912 | Bacteria | 636 |
| 768 | Ga0496110_0023971 | 3300048913 | Bacteria | 5197 |
| 769 | Ga0496110_0030835 | 3300048913 | Bacteria | 4624 |
| 770 | Ga0496110_0160468 | 3300048913 | Bacteria | 2038 |
| 771 | Ga0496110_0169073 | 3300048913 | Bacteria | 1983 |
| 772 | Ga0496110_0241280 | 3300048913 | Bacteria | 1644 |
| 773 | Ga0496110_0302419 | 3300048913 | Bacteria | 1457 |
| 774 | Ga0496111_0011827 | 3300048914 | Bacteria | 5892 |
| 775 | Ga0496111_0033779 | 3300048914 | Bacteria | 3649 |
| 776 | Ga0496111_0257450 | 3300048914 | Bacteria | 1295 |
| 777 | Ga0496111_0373134 | 3300048914 | Bacteria | 1055 |
| 778 | Ga0496111_0508613 | 3300048914 | Bacteria | 886 |
| 779 | Ga0496112_0059463 | 3300048915 | Bacteria | 3766 |
| 780 | Ga0496112_0185242 | 3300048915 | Bacteria | 2045 |
| 781 | Ga0496113_0088698 | 3300048916 | Bacteria | 2379 |
| 782 | Ga0496113_0483302 | 3300048916 | Bacteria | 995 |
| 783 | Ga0496114_0005056 | 3300048917 | Bacteria | 10281 |
| 784 | Ga0496114_0006185 | 3300048917 | Bacteria | 9424 |
| 785 | Ga0496114_0151150 | 3300048917 | Bacteria | 2014 |
| 786 | Ga0496114_0172351 | 3300048917 | Bacteria | 1886 |
| 787 | Ga0496114_0194655 | 3300048917 | Bacteria | 1774 |
| 788 | Ga0496114_0361856 | 3300048917 | Bacteria | 1283 |
| 789 | Ga0496114_0386754 | 3300048917 | Bacteria | 1239 |
| 790 | Ga0496115_0033907 | 3300048918 | Bacteria | 4033 |
| 791 | Ga0496115_0123165 | 3300048918 | Bacteria | 2134 |
| 792 | Ga0501031_0001922 | 3300049568 | Bacteria | 13097 |
| 793 | Ga0501031_0002118 | 3300049568 | Bacteria | 12520 |
| 794 | Ga0501031_0005180 | 3300049568 | Bacteria | 8498 |
| 795 | Ga0501031_0068501 | 3300049568 | Bacteria | 2312 |
| 796 | Ga0501031_0091203 | 3300049568 | Bacteria | 1987 |
| 797 | Ga0501031_0114103 | 3300049568 | Bacteria | 1764 |
| 798 | Ga0501031_0209414 | 3300049568 | Bacteria | 1271 |
| 799 | Ga0501031_0340727 | 3300049568 | Bacteria | 970 |
| 800 | Ga0501031_0475227 | 3300049568 | Bacteria | 807 |
| 801 | Ga0501032_0004421 | 3300049569 | Bacteria | 10604 |
| 802 | Ga0501032_0023340 | 3300049569 | Bacteria | 4276 |
| 803 | Ga0501032_0044036 | 3300049569 | Bacteria | 3021 |
| 804 | Ga0501032_0079859 | 3300049569 | Bacteria | 2177 |
| 805 | Ga0501032_0093895 | 3300049569 | Bacteria | 1989 |
| 806 | Ga0501032_0239962 | 3300049569 | Bacteria | 1178 |
| 807 | Ga0501033_0003063 | 3300049570 | Bacteria | 13899 |
| 808 | Ga0501033_0008979 | 3300049570 | Bacteria | 7718 |
| 809 | Ga0501033_0020491 | 3300049570 | Bacteria | 4995 |
| 810 | Ga0501033_0032660 | 3300049570 | Bacteria | 3909 |
| 811 | Ga0501033_0075805 | 3300049570 | Bacteria | 2468 |
| 812 | Ga0501033_0207271 | 3300049570 | Bacteria | 1399 |
| 813 | Ga0501033_0219796 | 3300049570 | Bacteria | 1353 |
| 814 | Ga0501034_0036580 | 3300049571 | Bacteria | 4972 |
| 815 | Ga0501036_0003710 | 3300049572 | Bacteria | 12240 |
| 816 | Ga0501036_0009021 | 3300049572 | Bacteria | 8199 |
| 817 | Ga0501036_0015282 | 3300049572 | Bacteria | 6408 |
| 818 | Ga0501036_0057668 | 3300049572 | Bacteria | 3289 |
| 819 | Ga0501036_0086042 | 3300049572 | Bacteria | 2657 |
| 820 | Ga0501036_0148825 | 3300049572 | Bacteria | 1975 |
| 821 | Ga0501037_0001718 | 3300049573 | Bacteria | 15893 |
| 822 | Ga0501037_0013457 | 3300049573 | Bacteria | 6025 |
| 823 | Ga0501037_0018672 | 3300049573 | Bacteria | 5111 |
| 824 | Ga0501037_0040595 | 3300049573 | Bacteria | 3424 |
| 825 | Ga0501037_0059507 | 3300049573 | Bacteria | 2786 |
| 826 | Ga0501037_0275252 | 3300049573 | Bacteria | 1174 |
| 827 | Ga0501037_0329506 | 3300049573 | Bacteria | 1056 |
| 828 | Ga0501037_0334181 | 3300049573 | Bacteria | 1047 |
| 829 | Ga0501038_0002469 | 3300049574 | Bacteria | 17199 |
| 830 | Ga0501038_0012658 | 3300049574 | Bacteria | 7710 |
| 831 | Ga0501038_0019828 | 3300049574 | Bacteria | 6053 |
| 832 | Ga0501038_0096442 | 3300049574 | Bacteria | 2468 |
| 833 | Ga0501038_0255487 | 3300049574 | Bacteria | 1387 |
| 834 | Ga0501038_0695045 | 3300049574 | Bacteria | 762 |
| 835 | Ga0501038_0733596 | 3300049574 | Bacteria | 738 |
| 836 | Ga0501039_0004772 | 3300049575 | Bacteria | 10271 |
| 837 | Ga0501039_0007709 | 3300049575 | Bacteria | 8218 |
| 838 | Ga0501039_0010859 | 3300049575 | Bacteria | 6941 |
| 839 | Ga0501039_0015250 | 3300049575 | Bacteria | 5881 |
| 840 | Ga0501039_0022477 | 3300049575 | Bacteria | 4841 |
| 841 | Ga0501039_0115948 | 3300049575 | Bacteria | 2097 |
| 842 | Ga0501039_0132026 | 3300049575 | Bacteria | 1960 |
| 843 | Ga0501039_0223910 | 3300049575 | Bacteria | 1478 |
| 844 | Ga0501039_0258374 | 3300049575 | Bacteria | 1369 |
| 845 | Ga0501039_0340275 | 3300049575 | Bacteria | 1179 |
| 846 | Ga0501039_0467126 | 3300049575 | Bacteria | 991 |
| 847 | Ga0501040_0000912 | 3300049576 | Bacteria | 18528 |
| 848 | Ga0501040_0011832 | 3300049576 | Bacteria | 5709 |
| 849 | Ga0501040_0014970 | 3300049576 | Bacteria | 5123 |
| 850 | Ga0501040_0015710 | 3300049576 | Bacteria | 5005 |
| 851 | Ga0501040_0023663 | 3300049576 | Bacteria | 4119 |
| 852 | Ga0501040_0119856 | 3300049576 | Bacteria | 1846 |
| 853 | Ga0501040_0176929 | 3300049576 | Bacteria | 1511 |
| 854 | Ga0501040_0191955 | 3300049576 | Bacteria | 1449 |
| 855 | Ga0501040_0213523 | 3300049576 | Bacteria | 1372 |
| 856 | Ga0501040_0269412 | 3300049576 | Bacteria | 1216 |
| 857 | Ga0501040_0314193 | 3300049576 | Bacteria | 1120 |
| 858 | Ga0501040_0326816 | 3300049576 | Bacteria | 1097 |
| 859 | Ga0501040_0602148 | 3300049576 | Bacteria | 794 |
| 860 | Ga0501041_0001188 | 3300049577 | Bacteria | 14191 |
| 861 | Ga0501041_0001660 | 3300049577 | Bacteria | 12450 |
| 862 | Ga0501041_0001929 | 3300049577 | Bacteria | 11642 |
| 863 | Ga0501041_0002244 | 3300049577 | Bacteria | 10922 |
| 864 | Ga0501041_0004355 | 3300049577 | Bacteria | 8192 |
| 865 | Ga0501041_0012382 | 3300049577 | Bacteria | 5052 |
| 866 | Ga0501041_0036262 | 3300049577 | Bacteria | 2988 |
| 867 | Ga0501041_0401617 | 3300049577 | Bacteria | 868 |
| 868 | Ga0501042_0000667 | 3300049578 | Bacteria | 18449 |
| 869 | Ga0501042_0007635 | 3300049578 | Bacteria | 7094 |
| 870 | Ga0501042_0015136 | 3300049578 | Bacteria | 5275 |
| 871 | Ga0501042_0019313 | 3300049578 | Bacteria | 4730 |
| 872 | Ga0501042_0020347 | 3300049578 | Bacteria | 4618 |
| 873 | Ga0501042_0031825 | 3300049578 | Bacteria | 3732 |
| 874 | Ga0501042_0035028 | 3300049578 | Bacteria | 3561 |
| 875 | Ga0501042_0076737 | 3300049578 | Bacteria | 2392 |
| 876 | Ga0501043_0008410 | 3300049579 | Bacteria | 8128 |
| 877 | Ga0501043_0020037 | 3300049579 | Bacteria | 5249 |
| 878 | Ga0501043_0084192 | 3300049579 | Bacteria | 2499 |
| 879 | Ga0501043_0216269 | 3300049579 | Bacteria | 1484 |
| 880 | Ga0501043_0217764 | 3300049579 | Bacteria | 1478 |
| 881 | Ga0501043_0281015 | 3300049579 | Bacteria | 1276 |
| 882 | Ga0501043_0832755 | 3300049579 | Bacteria | 666 |
| 883 | Ga0501046_0004156 | 3300049580 | Bacteria | 13179 |
| 884 | Ga0501046_0006661 | 3300049580 | Bacteria | 10200 |
| 885 | Ga0501046_0006809 | 3300049580 | Bacteria | 10086 |
| 886 | Ga0501046_0008923 | 3300049580 | Bacteria | 8705 |
| 887 | Ga0501046_0020980 | 3300049580 | Bacteria | 5394 |
| 888 | Ga0501046_0057062 | 3300049580 | Bacteria | 3064 |
| 889 | Ga0501046_0325560 | 3300049580 | Bacteria | 1119 |
| 890 | Ga0501047_0021018 | 3300049581 | Bacteria | 6269 |
| 891 | Ga0501047_0023307 | 3300049581 | Bacteria | 5944 |
| 892 | Ga0501047_0136800 | 3300049581 | Bacteria | 2330 |
| 893 | Ga0501047_0479348 | 3300049581 | Bacteria | 1072 |
| 894 | Ga0501047_1210379 | 3300049581 | Bacteria | 569 |
| 895 | Ga0501048_0004215 | 3300049582 | Bacteria | 10958 |
| 896 | Ga0501048_0006265 | 3300049582 | Bacteria | 9047 |
| 897 | Ga0501048_0015470 | 3300049582 | Bacteria | 5636 |
| 898 | Ga0501048_0023093 | 3300049582 | Bacteria | 4546 |
| 899 | Ga0501048_0026749 | 3300049582 | Bacteria | 4198 |
| 900 | Ga0501048_0034066 | 3300049582 | Bacteria | 3677 |
| 901 | Ga0501048_0039880 | 3300049582 | Bacteria | 3366 |
| 902 | Ga0501048_0052687 | 3300049582 | Bacteria | 2896 |
| 903 | Ga0501048_0092533 | 3300049582 | Bacteria | 2132 |
| 904 | Ga0501048_0367479 | 3300049582 | Bacteria | 1027 |
| 905 | Ga0501048_0675448 | 3300049582 | Bacteria | 742 |
| 906 | Ga0501067_0026731 | 3300049583 | Bacteria | 3195 |
| 907 | Ga0501067_0031044 | 3300049583 | Bacteria | 2965 |
| 908 | Ga0501067_0069254 | 3300049583 | Bacteria | 1953 |
| 909 | Ga0501067_0126627 | 3300049583 | Bacteria | 1421 |
| 910 | Ga0501068_0002839 | 3300049584 | Bacteria | 9214 |
| 911 | Ga0501068_0003273 | 3300049584 | Bacteria | 8682 |
| 912 | Ga0501068_0010460 | 3300049584 | Bacteria | 5214 |
| 913 | Ga0501068_0016129 | 3300049584 | Bacteria | 4302 |
| 914 | Ga0501068_0017184 | 3300049584 | Bacteria | 4180 |
| 915 | Ga0501068_0017701 | 3300049584 | Bacteria | 4122 |
| 916 | Ga0501068_0029609 | 3300049584 | Bacteria | 3243 |
| 917 | Ga0501068_0170713 | 3300049584 | Bacteria | 1372 |
| 918 | Ga0501069_0000281 | 3300049585 | Bacteria | 23211 |
| 919 | Ga0501069_0003229 | 3300049585 | Bacteria | 8360 |
| 920 | Ga0501069_0022228 | 3300049585 | Bacteria | 3447 |
| 921 | Ga0501069_0036892 | 3300049585 | Bacteria | 2697 |
| 922 | Ga0501069_0073093 | 3300049585 | Bacteria | 1922 |
| 923 | Ga0501069_0085775 | 3300049585 | Bacteria | 1777 |
| 924 | Ga0501069_0088552 | 3300049585 | Bacteria | 1749 |
| 925 | Ga0501069_0214449 | 3300049585 | Bacteria | 1118 |
| 926 | Ga0501069_0362565 | 3300049585 | Bacteria | 855 |
| 927 | Ga0501069_0381137 | 3300049585 | Bacteria | 833 |
| 928 | Ga0501070_0007966 | 3300049586 | Bacteria | 8974 |
| 929 | Ga0501070_0010802 | 3300049586 | Bacteria | 7714 |
| 930 | Ga0501070_0035611 | 3300049586 | Bacteria | 4159 |
| 931 | Ga0501070_0094901 | 3300049586 | Bacteria | 2468 |
| 932 | Ga0501070_0181280 | 3300049586 | Bacteria | 1733 |
| 933 | Ga0501070_0234063 | 3300049586 | Bacteria | 1505 |
| 934 | Ga0501071_0001083 | 3300049587 | Bacteria | 15121 |
| 935 | Ga0501071_0004817 | 3300049587 | Bacteria | 8596 |
| 936 | Ga0501071_0006860 | 3300049587 | Bacteria | 7420 |
| 937 | Ga0501071_0010486 | 3300049587 | Bacteria | 6211 |
| 938 | Ga0501071_0057394 | 3300049587 | Bacteria | 2813 |
| 939 | Ga0501071_0064544 | 3300049587 | Bacteria | 2656 |
| 940 | Ga0501071_0074357 | 3300049587 | Bacteria | 2479 |
| 941 | Ga0501071_0157353 | 3300049587 | Bacteria | 1697 |
| 942 | Ga0501071_0172866 | 3300049587 | Bacteria | 1617 |
| 943 | Ga0501071_0250313 | 3300049587 | Bacteria | 1337 |
| 944 | Ga0501071_0513484 | 3300049587 | Bacteria | 919 |
| 945 | Ga0501072_0001268 | 3300049588 | Bacteria | 18858 |
| 946 | Ga0501072_0010632 | 3300049588 | Bacteria | 7009 |
| 947 | Ga0501072_0012923 | 3300049588 | Bacteria | 6386 |
| 948 | Ga0501072_0016036 | 3300049588 | Bacteria | 5745 |
| 949 | Ga0501072_0033633 | 3300049588 | Bacteria | 4017 |
| 950 | Ga0501072_0053837 | 3300049588 | Bacteria | 3170 |
| 951 | Ga0501072_0087000 | 3300049588 | Bacteria | 2479 |
| 952 | Ga0501072_0107030 | 3300049588 | Bacteria | 2224 |
| 953 | Ga0501072_0188856 | 3300049588 | Bacteria | 1643 |
| 954 | Ga0501072_0273938 | 3300049588 | Bacteria | 1343 |
| 955 | Ga0501072_0276702 | 3300049588 | Bacteria | 1335 |
| 956 | Ga0501072_0289965 | 3300049588 | Bacteria | 1301 |
| 957 | Ga0501072_0807292 | 3300049588 | Bacteria | 735 |
| 958 | Ga0501073_0008765 | 3300049589 | Bacteria | 7485 |
| 959 | Ga0501073_0012210 | 3300049589 | Bacteria | 6272 |
| 960 | Ga0501073_0013552 | 3300049589 | Bacteria | 5929 |
| 961 | Ga0501073_0141779 | 3300049589 | Bacteria | 1665 |
| 962 | Ga0501074_0001000 | 3300049590 | Bacteria | 18378 |
| 963 | Ga0501074_0002634 | 3300049590 | Bacteria | 12568 |
| 964 | Ga0501074_0003320 | 3300049590 | Bacteria | 11387 |
| 965 | Ga0501074_0023738 | 3300049590 | Bacteria | 4457 |
| 966 | Ga0501074_0036342 | 3300049590 | Bacteria | 3568 |
| 967 | Ga0501074_0040628 | 3300049590 | Bacteria | 3368 |
| 968 | Ga0501074_0070993 | 3300049590 | Bacteria | 2503 |
| 969 | Ga0501074_0197734 | 3300049590 | Bacteria | 1433 |
| 970 | Ga0501075_0001943 | 3300049591 | Bacteria | 13629 |
| 971 | Ga0501075_0002651 | 3300049591 | Bacteria | 11960 |
| 972 | Ga0501075_0003018 | 3300049591 | Bacteria | 11243 |
| 973 | Ga0501075_0008555 | 3300049591 | Bacteria | 7135 |
| 974 | Ga0501075_0015752 | 3300049591 | Bacteria | 5432 |
| 975 | Ga0501075_0035626 | 3300049591 | Bacteria | 3712 |
| 976 | Ga0501075_0138840 | 3300049591 | Bacteria | 1852 |
| 977 | Ga0501075_0146035 | 3300049591 | Bacteria | 1802 |
| 978 | Ga0501075_0284160 | 3300049591 | Bacteria | 1260 |
| 979 | Ga0501075_0493070 | 3300049591 | Bacteria | 935 |
| 980 | Ga0501075_0583917 | 3300049591 | Bacteria | 852 |
| 981 | Ga0501076_0001626 | 3300049592 | Bacteria | 15152 |
| 982 | Ga0501076_0005603 | 3300049592 | Bacteria | 9045 |
| 983 | Ga0501076_0007318 | 3300049592 | Bacteria | 8030 |
| 984 | Ga0501076_0008207 | 3300049592 | Bacteria | 7649 |
| 985 | Ga0501076_0009171 | 3300049592 | Bacteria | 7291 |
| 986 | Ga0501076_0010290 | 3300049592 | Bacteria | 6933 |
| 987 | Ga0501076_0018971 | 3300049592 | Bacteria | 5249 |
| 988 | Ga0501076_0040146 | 3300049592 | Bacteria | 3676 |
| 989 | Ga0501076_0059670 | 3300049592 | Bacteria | 3034 |
| 990 | Ga0501076_0813538 | 3300049592 | Bacteria | 771 |
| 991 | Ga0501077_0001393 | 3300049593 | Bacteria | 14562 |
| 992 | Ga0501077_0001912 | 3300049593 | Bacteria | 12613 |
| 993 | Ga0501077_0002204 | 3300049593 | Bacteria | 11750 |
| 994 | Ga0501077_0005398 | 3300049593 | Bacteria | 7771 |
| 995 | Ga0501077_0007498 | 3300049593 | Bacteria | 6731 |
| 996 | Ga0501077_0010312 | 3300049593 | Bacteria | 5813 |
| 997 | Ga0501077_0018672 | 3300049593 | Bacteria | 4385 |
| 998 | Ga0501077_0138018 | 3300049593 | Bacteria | 1546 |
| 999 | Ga0501077_0213669 | 3300049593 | Bacteria | 1226 |
| 1000 | Ga0501077_0221186 | 3300049593 | Bacteria | 1203 |
| 1001 | Ga0501077_0307363 | 3300049593 | Bacteria | 1010 |
| 1002 | Ga0501077_0330346 | 3300049593 | Bacteria | 972 |
| 1003 | Ga0501079_0000076 | 3300049741 | Bacteria | 46459 |
| 1004 | Ga0501079_0003409 | 3300049741 | Bacteria | 11673 |
| 1005 | Ga0501079_0006042 | 3300049741 | Bacteria | 9074 |
| 1006 | Ga0501079_0008393 | 3300049741 | Bacteria | 7829 |
| 1007 | Ga0501079_0026369 | 3300049741 | Bacteria | 4455 |
| 1008 | Ga0501079_0027015 | 3300049741 | Bacteria | 4400 |
| 1009 | Ga0501079_0051929 | 3300049741 | Bacteria | 3166 |
| 1010 | Ga0501079_0062704 | 3300049741 | Bacteria | 2867 |
| 1011 | Ga0501079_0079460 | 3300049741 | Bacteria | 2536 |
| 1012 | Ga0501079_0312217 | 3300049741 | Bacteria | 1230 |
| 1013 | Ga0501079_0360704 | 3300049741 | Bacteria | 1139 |
| 1014 | Ga0501079_1230235 | 3300049741 | Bacteria | 590 |
| 1015 | Ga0501080_0012586 | 3300049742 | Bacteria | 7757 |
| 1016 | Ga0501080_0012861 | 3300049742 | Bacteria | 7679 |
| 1017 | Ga0501080_0016472 | 3300049742 | Bacteria | 6827 |
| 1018 | Ga0501080_0029054 | 3300049742 | Bacteria | 5146 |
| 1019 | Ga0501080_0030844 | 3300049742 | Bacteria | 4995 |
| 1020 | Ga0501080_0032304 | 3300049742 | Bacteria | 4880 |
| 1021 | Ga0501080_0048644 | 3300049742 | Bacteria | 3946 |
| 1022 | Ga0501080_0105638 | 3300049742 | Bacteria | 2611 |
| 1023 | Ga0501080_0204327 | 3300049742 | Bacteria | 1813 |
| 1024 | Ga0501080_0320739 | 3300049742 | Bacteria | 1403 |
| 1025 | Ga0501081_0004393 | 3300049743 | Bacteria | 9040 |
| 1026 | Ga0501081_0006383 | 3300049743 | Bacteria | 7649 |
| 1027 | Ga0501081_0017769 | 3300049743 | Bacteria | 4713 |
| 1028 | Ga0501081_0024644 | 3300049743 | Bacteria | 4041 |
| 1029 | Ga0501081_0028999 | 3300049743 | Bacteria | 3737 |
| 1030 | Ga0501081_0084466 | 3300049743 | Bacteria | 2227 |
| 1031 | Ga0501081_0140333 | 3300049743 | Bacteria | 1731 |
| 1032 | Ga0501081_0155437 | 3300049743 | Bacteria | 1645 |
| 1033 | Ga0501081_0243867 | 3300049743 | Bacteria | 1310 |
| 1034 | Ga0501081_0475259 | 3300049743 | Bacteria | 930 |
| 1035 | Ga0501081_0935705 | 3300049743 | Bacteria | 654 |
| 1036 | Ga0501083_0005072 | 3300049744 | Bacteria | 9327 |
| 1037 | Ga0501083_0006583 | 3300049744 | Bacteria | 8244 |
| 1038 | Ga0501083_0011542 | 3300049744 | Bacteria | 6196 |
| 1039 | Ga0501083_0023084 | 3300049744 | Bacteria | 4317 |
| 1040 | Ga0501083_0035316 | 3300049744 | Bacteria | 3415 |
| 1041 | Ga0501083_0251137 | 3300049744 | Bacteria | 1151 |
| 1042 | Ga0501035_0003302 | 3300049822 | Bacteria | 15457 |
| 1043 | Ga0501035_0021361 | 3300049822 | Bacteria | 5950 |
| 1044 | Ga0501035_0034996 | 3300049822 | Bacteria | 4562 |
| 1045 | Ga0501035_0045094 | 3300049822 | Bacteria | 3967 |
| 1046 | Ga0501035_0308733 | 3300049822 | Bacteria | 1331 |
| 1047 | Ga0501035_0773721 | 3300049822 | Bacteria | 769 |
| 1048 | Ga0501044_0018755 | 3300049823 | Bacteria | 7410 |
| 1049 | Ga0501044_0122766 | 3300049823 | Bacteria | 2596 |
| 1050 | Ga0501044_0126002 | 3300049823 | Bacteria | 2559 |
| 1051 | Ga0501044_0153340 | 3300049823 | Bacteria | 2285 |
| 1052 | Ga0501044_0400241 | 3300049823 | Bacteria | 1285 |
| 1053 | Ga0501045_0000077 | 3300049824 | Bacteria | 46550 |
| 1054 | Ga0501045_0001835 | 3300049824 | Bacteria | 14347 |
| 1055 | Ga0501045_0009478 | 3300049824 | Bacteria | 6814 |
| 1056 | Ga0501045_0021888 | 3300049824 | Bacteria | 4574 |
| 1057 | Ga0501045_0028964 | 3300049824 | Bacteria | 3997 |
| 1058 | Ga0501045_0042172 | 3300049824 | Bacteria | 3322 |
| 1059 | Ga0501045_0049099 | 3300049824 | Bacteria | 3076 |
| 1060 | Ga0501045_0070095 | 3300049824 | Bacteria | 2578 |
| 1061 | Ga0501045_0077628 | 3300049824 | Bacteria | 2447 |
| 1062 | nmdc:mga00v17_29338_c1 | 3300050491 | Bacteria | 2255 |
| 1063 | nmdc:mga0yw44_147904_c1 | 3300050492 | Bacteria | 1531 |
| 1064 | nmdc:mga06z11_49760_c1 | 3300050494 | Bacteria | 2139 |
| 1065 | nmdc:mga05p37_10099_c1 | 3300050507 | Bacteria | 11207 |
| 1066 | nmdc:mga05p37_183984_c1 | 3300050507 | Bacteria | 2541 |
| 1067 | nmdc:mga05p37_200451_c1 | 3300050507 | Bacteria | 2418 |
| 1068 | nmdc:mga05p37_47021_c1 | 3300050507 | Bacteria | 5307 |
| 1069 | nmdc:mga05p37_48463_c1 | 3300050507 | Bacteria | 5225 |
| 1070 | nmdc:mga05p37_555413_c1 | 3300050507 | Bacteria | 1306 |
| 1071 | nmdc:mga05p37_63542_c1 | 3300050507 | Bacteria | 4543 |
| 1072 | nmdc:mga05p37_639709_c1 | 3300050507 | Bacteria | 1193 |
| 1073 | nmdc:mga05p37_681750_c1 | 3300050507 | Bacteria | 1145 |
| 1074 | nmdc:mga09592_45593_c1 | 3300050508 | Bacteria | 3693 |
| 1075 | nmdc:mga09592_5692_c1 | 3300050508 | Bacteria | 10165 |
| 1076 | nmdc:mga09592_94219_c1 | 3300050508 | Bacteria | 2561 |
| 1077 | nmdc:mga0qj67_1148600_c1 | 3300050509 | Bacteria | 605 |
| 1078 | nmdc:mga0qj67_27322_c1 | 3300050509 | Bacteria | 4422 |
| 1079 | nmdc:mga06r32_153768_c1 | 3300050510 | Bacteria | 2280 |
| 1080 | nmdc:mga06r32_210913_c1 | 3300050510 | Bacteria | 1930 |
| 1081 | nmdc:mga08y16_1089817_c1 | 3300050511 | Bacteria | 774 |
| 1082 | nmdc:mga08y16_125036_c1 | 3300050511 | Bacteria | 2676 |
| 1083 | nmdc:mga08y16_131091_c1 | 3300050511 | Bacteria | 2607 |
| 1084 | nmdc:mga08y16_398239_c1 | 3300050511 | Bacteria | 1409 |
| 1085 | nmdc:mga08y16_481751_c1 | 3300050511 | Bacteria | 1262 |
| 1086 | nmdc:mga0n895_106199_c1 | 3300050512 | Bacteria | 2821 |
| 1087 | nmdc:mga0rr50_521970_c1 | 3300050513 | Bacteria | 1010 |
| 1088 | nmdc:mga08x19_261282_c1 | 3300050514 | Bacteria | 1197 |
| 1089 | nmdc:mga08x19_691122_c1 | 3300050514 | Bacteria | 724 |
| 1090 | nmdc:mga0a205_62900_c1 | 3300050515 | Bacteria | 3585 |
| 1091 | Ga0495601_0012252 | 3300053077 | Bacteria | 5141 |
| 1092 | Ga0495601_0015676 | 3300053077 | Bacteria | 4582 |
| 1093 | Ga0495601_0167766 | 3300053077 | Bacteria | 1434 |
| 1094 | Ga0495601_0244147 | 3300053077 | Bacteria | 1172 |
| 1095 | Ga0495601_0297604 | 3300053077 | Bacteria | 1051 |
| 1096 | Ga0495612_0030648 | 3300053078 | Bacteria | 2166 |
| 1097 | Ga0495612_0095619 | 3300053078 | Bacteria | 1261 |
| 1098 | Ga0495612_0098364 | 3300053078 | Bacteria | 1244 |
| 1099 | Ga0495612_0110195 | 3300053078 | Bacteria | 1177 |
| 1100 | Ga0495655_0021716 | 3300053083 | Bacteria | 1457 |
| 1101 | Ga0495655_0035009 | 3300053083 | Bacteria | 1246 |
| 1102 | Ga0495595_0026564 | 3300053084 | Bacteria | 2573 |
| 1103 | Ga0495595_0031260 | 3300053084 | Bacteria | 2392 |
| 1104 | Ga0495595_0158127 | 3300053084 | Bacteria | 1117 |
| 1105 | Ga0495619_0003592 | 3300053085 | Bacteria | 9996 |
| 1106 | Ga0495619_0036099 | 3300053085 | Bacteria | 3217 |
| 1107 | Ga0495619_0115933 | 3300053085 | Bacteria | 1833 |
| 1108 | Ga0495619_0216230 | 3300053085 | Bacteria | 1327 |
| 1109 | Ga0500566_0089234 | 3300053094 | Bacteria | 1705 |
| 1110 | Ga0501084_0000125 | 3300054114 | Bacteria | 57691 |
| 1111 | Ga0501084_0003582 | 3300054114 | Bacteria | 12609 |
| 1112 | Ga0501084_0005571 | 3300054114 | Bacteria | 10338 |
| 1113 | Ga0501084_0012078 | 3300054114 | Bacteria | 7152 |
| 1114 | Ga0501084_0040131 | 3300054114 | Bacteria | 3915 |
| 1115 | Ga0501084_0046874 | 3300054114 | Bacteria | 3620 |
| 1116 | Ga0501084_0060248 | 3300054114 | Bacteria | 3177 |
| 1117 | Ga0501084_0067888 | 3300054114 | Bacteria | 2985 |
| 1118 | Ga0501084_0159974 | 3300054114 | Bacteria | 1900 |
| 1119 | Ga0501084_0305995 | 3300054114 | Bacteria | 1342 |
| 1120 | Ga0501084_0308775 | 3300054114 | Bacteria | 1336 |
| 1121 | Ga0501084_0442662 | 3300054114 | Bacteria | 1098 |
| 1122 | Ga0501084_0450992 | 3300054114 | Bacteria | 1087 |
| 1123 | Ga0501084_0600101 | 3300054114 | Bacteria | 930 |
| 1124 | Ga0501084_0798072 | 3300054114 | Bacteria | 795 |
| 1125 | Ga0590075_014407 | 3300059424 | Bacteria | 1933 |
| 1126 | Ga0587091_014186 | 3300059511 | Bacteria | 1293 |
| 1127 | Ga0587115_049326 | 3300059626 | Bacteria | 680 |
| 1128 | Ga0501082_0011395 | 3300060353 | Bacteria | 7649 |
| 1129 | Ga0501082_0016042 | 3300060353 | Bacteria | 6444 |
| 1130 | Ga0501082_0021659 | 3300060353 | Bacteria | 5541 |
| 1131 | Ga0501082_0030512 | 3300060353 | Bacteria | 4645 |
| 1132 | Ga0501082_0031405 | 3300060353 | Bacteria | 4579 |
| 1133 | Ga0501082_0032987 | 3300060353 | Bacteria | 4465 |
| 1134 | Ga0501082_0049398 | 3300060353 | Bacteria | 3627 |
| 1135 | Ga0501082_0070390 | 3300060353 | Bacteria | 3012 |
| 1136 | Ga0501082_0079300 | 3300060353 | Bacteria | 2833 |
| 1137 | Ga0501082_0084830 | 3300060353 | Bacteria | 2731 |
| 1138 | Ga0501082_0282268 | 3300060353 | Bacteria | 1445 |
| 1139 | Ga0501082_0399182 | 3300060353 | Bacteria | 1200 |
| 1140 | Ga0466962_0052638 | 3300061719 | Bacteria | 1945 |
| 1141 | Ga0466962_0061050 | 3300061719 | Bacteria | 1799 |
| 1142 | Ga0466962_0067913 | 3300061719 | Bacteria | 1702 |
| 1143 | Ga0466962_0233146 | 3300061719 | Bacteria | 903 |
| 1144 | Ga0466962_0327486 | 3300061719 | Bacteria | 760 |
| 1145 | Ga0530510_0001850 | 3300061734 | Bacteria | 14459 |
| 1146 | Ga0530510_0001934 | 3300061734 | Bacteria | 14165 |
| 1147 | Ga0530510_0006651 | 3300061734 | Bacteria | 8063 |
| 1148 | Ga0530510_0010209 | 3300061734 | Bacteria | 6580 |
| 1149 | Ga0530510_0032518 | 3300061734 | Bacteria | 3754 |
| 1150 | Ga0530510_0052620 | 3300061734 | Bacteria | 2942 |
| 1151 | Ga0530510_0130624 | 3300061734 | Bacteria | 1848 |
| 1152 | Ga0530510_0874729 | 3300061734 | Bacteria | 686 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005457 | Ga0070662_100377263 | Ga0070662_1003772632 | 142 |
| 2 | 3300005543 | Ga0070672_100064211 | Ga0070672_1000642112 | 142 |
| 3 | 3300009098 | Ga0105245_10050741 | Ga0105245_100507413 | 142 |
| 4 | 3300009176 | Ga0105242_10017261 | Ga0105242_100172618 | 142 |
| 5 | 3300005338 | Ga0068868_100098882 | Ga0068868_1000988824 | 143 |
| 6 | 3300005343 | Ga0070687_100073999 | Ga0070687_1000739994 | 143 |
| 7 | 3300005356 | Ga0070674_100336072 | Ga0070674_1003360721 | 143 |
| 8 | 3300005546 | Ga0070696_100198203 | Ga0070696_1001982034 | 143 |
| 9 | 3300009147 | Ga0114129_10220001 | Ga0114129_102200015 | 143 |
| 10 | 3300014326 | Ga0157380_10094813 | Ga0157380_100948132 | 143 |
| 11 | 3300017792 | Ga0163161_10391273 | Ga0163161_103912733 | 143 |
| 12 | 3300025908 | Ga0207643_10012632 | Ga0207643_100126327 | 143 |
| 13 | 3300025918 | Ga0207662_10016896 | Ga0207662_100168967 | 143 |
| 14 | 3300025937 | Ga0207669_10428016 | Ga0207669_104280162 | 143 |
| 15 | 3300025941 | Ga0207711_10254679 | Ga0207711_102546793 | 143 |
| 16 | 3300025981 | Ga0207640_10191544 | Ga0207640_101915442 | 143 |
| 17 | 3300026023 | Ga0207677_10468320 | Ga0207677_104683202 | 143 |
| 18 | 3300026089 | Ga0207648_10042703 | Ga0207648_100427036 | 143 |
| 19 | 3300026142 | Ga0207698_11902535 | Ga0207698_119025351 | 143 |
| 20 | 3300045976 | Ga0466967_1471974 | Ga0466967_1471974_20_553 | 143 |
| 21 | 3300050507 | nmdc:mga05p37_555413_c1 | nmdc:mga05p37_555413_c1_653_1186 | 143 |
| 22 | 3300050509 | nmdc:mga0qj67_1148600_c1 | nmdc:mga0qj67_1148600_c1_10_543 | 143 |
| 23 | 3300035170 | Ga0373943_0053897 | Ga0373943_0053897_1288_1821 | 144 |
| 24 | 3300035692 | Ga0373935_0079916 | Ga0373935_0079916_201_734 | 144 |
| 25 | 3300035695 | Ga0373927_0048850 | Ga0373927_0048850_1894_2427 | 144 |
| 26 | 3300035725 | Ga0373947_0321031 | Ga0373947_0321031_384_917 | 144 |
| 27 | 3300037068 | Ga0373925_0062170 | Ga0373925_0062170_1015_1548 | 144 |
| 28 | 3300046455 | Ga0495603_0040839 | Ga0495603_0040839_1045_1578 | 144 |
| 29 | 3300046459 | Ga0495629_0001157 | Ga0495629_0001157_18639_19172 | 144 |
| 30 | 3300046461 | Ga0495641_0002322 | Ga0495641_0002322_4393_4926 | 144 |
| 31 | 3300046462 | Ga0495651_0285830 | Ga0495651_0285830_493_1026 | 144 |
| 32 | 3300046463 | Ga0495653_0110292 | Ga0495653_0110292_1409_1942 | 144 |
| 33 | 3300046473 | Ga0495582_0000808 | Ga0495582_0000808_16372_16905 | 144 |
| 34 | 3300046475 | Ga0495639_0000659 | Ga0495639_0000659_579_1112 | 144 |
| 35 | 3300046476 | Ga0495662_0206358 | Ga0495662_0206358_384_917 | 144 |
| 36 | 3300046499 | Ga0495594_0037202 | Ga0495594_0037202_1404_1937 | 144 |
| 37 | 3300046514 | Ga0495618_0285957 | Ga0495618_0285957_86_619 | 144 |
| 38 | 3300046526 | Ga0495666_0008288 | Ga0495666_0008288_4092_4625 | 144 |
| 39 | 3300046531 | Ga0495665_0001383 | Ga0495665_0001383_8311_8844 | 144 |
| 40 | 3300046533 | Ga0495640_0255781 | Ga0495640_0255781_54_587 | 144 |
| 41 | 3300046535 | Ga0495586_0259235 | Ga0495586_0259235_119_652 | 144 |
| 42 | 3300046559 | Ga0495667_0149217 | Ga0495667_0149217_898_1431 | 144 |
| 43 | 3300046642 | Ga0495634_0031559 | Ga0495634_0031559_384_917 | 144 |
| 44 | 3300046663 | Ga0495635_0059021 | Ga0495635_0059021_1727_2260 | 144 |
| 45 | 3300046675 | Ga0495657_0192428 | Ga0495657_0192428_460_993 | 144 |
| 46 | 3300046681 | Ga0495647_0010914 | Ga0495647_0010914_774_1307 | 144 |
| 47 | 3300046683 | Ga0495658_0001453 | Ga0495658_0001453_7946_8479 | 144 |
| 48 | 3300046689 | Ga0495613_0168864 | Ga0495613_0168864_485_1018 | 144 |
| 49 | 3300046690 | Ga0495624_0011808 | Ga0495624_0011808_4976_5509 | 144 |
| 50 | 3300047315 | Ga0495581_0001143 | Ga0495581_0001143_11792_12325 | 144 |
| 51 | 3300047319 | Ga0495674_0138750 | Ga0495674_0138750_976_1509 | 144 |
| 52 | 3300047321 | Ga0495676_0016334 | Ga0495676_0016334_4274_4807 | 144 |
| 53 | 3300047322 | Ga0495680_0286568 | Ga0495680_0286568_72_605 | 144 |
| 54 | 3300047471 | Ga0495684_0076140 | Ga0495684_0076140_1940_2473 | 144 |
| 55 | 3300047673 | Ga0495593_0004784 | Ga0495593_0004784_3360_3893 | 144 |
| 56 | 3300048089 | Ga0495614_0004362 | Ga0495614_0004362_4211_4744 | 144 |
| 57 | 3300053078 | Ga0495612_0030648 | Ga0495612_0030648_1587_2120 | 144 |
| 58 | 3300053084 | Ga0495595_0158127 | Ga0495595_0158127_79_612 | 144 |
| 59 | 3300053085 | Ga0495619_0115933 | Ga0495619_0115933_1245_1778 | 144 |
| 60 | 3300005331 | Ga0070670_100002726 | Ga0070670_10000272616 | 145 |
| 61 | 3300005334 | Ga0068869_100022221 | Ga0068869_1000222217 | 145 |
| 62 | 3300005355 | Ga0070671_100107077 | Ga0070671_1001070775 | 145 |
| 63 | 3300005365 | Ga0070688_100010080 | Ga0070688_1000100809 | 145 |
| 64 | 3300005366 | Ga0070659_100461407 | Ga0070659_1004614073 | 145 |
| 65 | 3300005466 | Ga0070685_10005868 | Ga0070685_100058688 | 145 |
| 66 | 3300005535 | Ga0070684_100022860 | Ga0070684_10002286010 | 145 |
| 67 | 3300005549 | Ga0070704_100340969 | Ga0070704_1003409693 | 145 |
| 68 | 3300005615 | Ga0070702_100014750 | Ga0070702_1000147507 | 145 |
| 69 | 3300005617 | Ga0068859_100194972 | Ga0068859_1001949722 | 145 |
| 70 | 3300005618 | Ga0068864_100008046 | Ga0068864_1000080461 | 145 |
| 71 | 3300005840 | Ga0068870_10129624 | Ga0068870_101296243 | 145 |
| 72 | 3300006931 | Ga0097620_100194983 | Ga0097620_1001949832 | 145 |
| 73 | 3300009177 | Ga0105248_10266891 | Ga0105248_102668912 | 145 |
| 74 | 3300011119 | Ga0105246_10260717 | Ga0105246_102607173 | 145 |
| 75 | 3300013308 | Ga0157375_10047233 | Ga0157375_100472336 | 145 |
| 76 | 3300014745 | Ga0157377_10045735 | Ga0157377_100457355 | 145 |
| 77 | 3300025925 | Ga0207650_10018684 | Ga0207650_1001868410 | 145 |
| 78 | 3300025926 | Ga0207659_10046963 | Ga0207659_100469634 | 145 |
| 79 | 3300025942 | Ga0207689_10032263 | Ga0207689_100322632 | 145 |
| 80 | 3300025945 | Ga0207679_10092595 | Ga0207679_100925954 | 145 |
| 81 | 3300026095 | Ga0207676_10113884 | Ga0207676_101138845 | 145 |
| 82 | 3300028379 | Ga0268266_10043001 | Ga0268266_100430015 | 145 |
| 83 | 3300048913 | Ga0496110_0169073 | Ga0496110_0169073_32_565 | 145 |
| 84 | 3300049575 | Ga0501039_0340275 | Ga0501039_0340275_46_579 | 145 |
| 85 | 3300049576 | Ga0501040_0269412 | Ga0501040_0269412_347_880 | 145 |
| 86 | 3300049577 | Ga0501041_0401617 | Ga0501041_0401617_93_626 | 145 |
| 87 | 3300049588 | Ga0501072_0188856 | Ga0501072_0188856_210_743 | 145 |
| 88 | 3300049591 | Ga0501075_0583917 | Ga0501075_0583917_47_580 | 145 |
| 89 | 3300049592 | Ga0501076_0018971 | Ga0501076_0018971_301_834 | 145 |
| 90 | 3300049741 | Ga0501079_0062704 | Ga0501079_0062704_461_994 | 145 |
| 91 | 3300049743 | Ga0501081_0017769 | Ga0501081_0017769_873_1406 | 145 |
| 92 | 3300049824 | Ga0501045_0077628 | Ga0501045_0077628_654_1187 | 145 |
| 93 | 3300060353 | Ga0501082_0070390 | Ga0501082_0070390_800_1333 | 145 |
| 94 | 3300061734 | Ga0530510_0006651 | Ga0530510_0006651_3923_4456 | 145 |
| 95 | 3300048910 | Ga0496107_0571075 | Ga0496107_0571075_292_825 | 147 |
| 96 | 3300049585 | Ga0501069_0362565 | Ga0501069_0362565_68_601 | 147 |
| 97 | 3300035083 | Ga0373926_0086955 | Ga0373926_0086955_414_947 | 148 |
| 98 | 3300035170 | Ga0373943_0057742 | Ga0373943_0057742_719_1252 | 148 |
| 99 | 3300035171 | Ga0373946_0063508 | Ga0373946_0063508_870_1403 | 148 |
| 100 | 3300035692 | Ga0373935_0319526 | Ga0373935_0319526_502_1035 | 148 |
| 101 | 3300035725 | Ga0373947_0021201 | Ga0373947_0021201_799_1332 | 148 |
| 102 | 3300037068 | Ga0373925_0177521 | Ga0373925_0177521_966_1499 | 148 |
| 103 | 3300046455 | Ga0495603_0043193 | Ga0495603_0043193_1095_1628 | 148 |
| 104 | 3300046499 | Ga0495594_0284652 | Ga0495594_0284652_27_560 | 148 |
| 105 | 3300046517 | Ga0495630_0207836 | Ga0495630_0207836_428_961 | 148 |
| 106 | 3300046674 | Ga0495588_0260965 | Ga0495588_0260965_368_901 | 148 |
| 107 | 3300046690 | Ga0495624_0079393 | Ga0495624_0079393_502_1035 | 148 |
| 108 | 3300047321 | Ga0495676_0070005 | Ga0495676_0070005_420_953 | 148 |
| 109 | 3300047673 | Ga0495593_0092131 | Ga0495593_0092131_431_964 | 148 |
| 110 | 3300025899 | Ga0207642_10033564 | Ga0207642_100335642 | 149 |
| 111 | 3300049575 | Ga0501039_0132026 | Ga0501039_0132026_588_1121 | 149 |
| 112 | 3300049576 | Ga0501040_0602148 | Ga0501040_0602148_167_700 | 149 |
| 113 | 3300049579 | Ga0501043_0832755 | Ga0501043_0832755_43_576 | 149 |
| 114 | 3300044694 | Ga0466963_0184877 | Ga0466963_0184877_725_1258 | 150 |
| 115 | 3300044706 | Ga0466964_0031729 | Ga0466964_0031729_925_1458 | 150 |
| 116 | 3300045976 | Ga0466967_0046458 | Ga0466967_0046458_2233_2766 | 150 |
| 117 | 3300045976 | Ga0466967_0075823 | Ga0466967_0075823_1243_1776 | 150 |
| 118 | 3300011119 | Ga0105246_10353928 | Ga0105246_103539282 | 152 |
| 119 | 3300038726 | Ga0400490_17491 | Ga0400490_17491_6522_7061 | 152 |
| 120 | 3300038727 | Ga0400491_12215 | Ga0400491_12215_6561_7100 | 152 |
| 121 | 3300044683 | Ga0466965_0923505 | Ga0466965_0923505_32_490 | 152 |
| 122 | 3300046454 | Ga0495592_0770835 | Ga0495592_0770835_103_561 | 152 |
| 123 | 3300050507 | nmdc:mga05p37_10099_c1 | nmdc:mga05p37_10099_c1_2470_3003 | 152 |
| 124 | 3300050511 | nmdc:mga08y16_1089817_c1 | nmdc:mga08y16_1089817_c1_154_687 | 152 |
| 125 | 3300061719 | Ga0466962_0233146 | Ga0466962_0233146_175_708 | 152 |
| 126 | 3300003373 | JGI25407J50210_10006859 | JGI25407J50210_100068594 | 153 |
| 127 | 3300005981 | Ga0081538_10000515 | Ga0081538_1000051546 | 153 |
| 128 | 3300006847 | Ga0075431_100145840 | Ga0075431_1001458404 | 153 |
| 129 | 3300006880 | Ga0075429_100140179 | Ga0075429_1001401792 | 153 |
| 130 | 3300014497 | Ga0182008_10618451 | Ga0182008_106184511 | 153 |
| 131 | 3300048905 | Ga0496102_1297569 | Ga0496102_1297569_171_632 | 153 |
| 132 | 3300049568 | Ga0501031_0002118 | Ga0501031_0002118_7486_7947 | 153 |
| 133 | 3300049568 | Ga0501031_0005180 | Ga0501031_0005180_7217_7750 | 153 |
| 134 | 3300049569 | Ga0501032_0044036 | Ga0501032_0044036_1949_2410 | 153 |
| 135 | 3300049569 | Ga0501032_0239962 | Ga0501032_0239962_205_738 | 153 |
| 136 | 3300049570 | Ga0501033_0003063 | Ga0501033_0003063_11492_11953 | 153 |
| 137 | 3300049572 | Ga0501036_0086042 | Ga0501036_0086042_81_542 | 153 |
| 138 | 3300049573 | Ga0501037_0040595 | Ga0501037_0040595_2749_3210 | 153 |
| 139 | 3300049573 | Ga0501037_0275252 | Ga0501037_0275252_358_891 | 153 |
| 140 | 3300049574 | Ga0501038_0012658 | Ga0501038_0012658_3424_3885 | 153 |
| 141 | 3300049574 | Ga0501038_0695045 | Ga0501038_0695045_182_715 | 153 |
| 142 | 3300049575 | Ga0501039_0010859 | Ga0501039_0010859_6266_6727 | 153 |
| 143 | 3300049575 | Ga0501039_0223910 | Ga0501039_0223910_818_1351 | 153 |
| 144 | 3300049576 | Ga0501040_0014970 | Ga0501040_0014970_1921_2382 | 153 |
| 145 | 3300049577 | Ga0501041_0001660 | Ga0501041_0001660_4596_5057 | 153 |
| 146 | 3300049577 | Ga0501041_0036262 | Ga0501041_0036262_1249_1782 | 153 |
| 147 | 3300049578 | Ga0501042_0020347 | Ga0501042_0020347_2244_2705 | 153 |
| 148 | 3300049578 | Ga0501042_0076737 | Ga0501042_0076737_1240_1773 | 153 |
| 149 | 3300049579 | Ga0501043_0020037 | Ga0501043_0020037_215_676 | 153 |
| 150 | 3300049579 | Ga0501043_0216269 | Ga0501043_0216269_38_499 | 153 |
| 151 | 3300049580 | Ga0501046_0006809 | Ga0501046_0006809_5615_6076 | 153 |
| 152 | 3300049581 | Ga0501047_0023307 | Ga0501047_0023307_911_1372 | 153 |
| 153 | 3300049582 | Ga0501048_0006265 | Ga0501048_0006265_4574_5035 | 153 |
| 154 | 3300049582 | Ga0501048_0092533 | Ga0501048_0092533_696_1229 | 153 |
| 155 | 3300049583 | Ga0501067_0031044 | Ga0501067_0031044_1924_2385 | 153 |
| 156 | 3300049584 | Ga0501068_0003273 | Ga0501068_0003273_5358_5819 | 153 |
| 157 | 3300049585 | Ga0501069_0003229 | Ga0501069_0003229_5954_6415 | 153 |
| 158 | 3300049586 | Ga0501070_0181280 | Ga0501070_0181280_1173_1706 | 153 |
| 159 | 3300049587 | Ga0501071_0010486 | Ga0501071_0010486_3830_4291 | 153 |
| 160 | 3300049588 | Ga0501072_0053837 | Ga0501072_0053837_581_1114 | 153 |
| 161 | 3300049589 | Ga0501073_0013552 | Ga0501073_0013552_4568_5029 | 153 |
| 162 | 3300049590 | Ga0501074_0002634 | Ga0501074_0002634_2742_3203 | 153 |
| 163 | 3300049591 | Ga0501075_0008555 | Ga0501075_0008555_2849_3310 | 153 |
| 164 | 3300049591 | Ga0501075_0138840 | Ga0501075_0138840_352_885 | 153 |
| 165 | 3300049592 | Ga0501076_0009171 | Ga0501076_0009171_6652_7185 | 153 |
| 166 | 3300049592 | Ga0501076_0010290 | Ga0501076_0010290_169_630 | 153 |
| 167 | 3300049593 | Ga0501077_0002204 | Ga0501077_0002204_5260_5721 | 153 |
| 168 | 3300049593 | Ga0501077_0221186 | Ga0501077_0221186_39_500 | 153 |
| 169 | 3300049593 | Ga0501077_0307363 | Ga0501077_0307363_511_972 | 153 |
| 170 | 3300049593 | Ga0501077_0330346 | Ga0501077_0330346_209_742 | 153 |
| 171 | 3300049741 | Ga0501079_0000076 | Ga0501079_0000076_41983_42444 | 153 |
| 172 | 3300049742 | Ga0501080_0029054 | Ga0501080_0029054_4471_4932 | 153 |
| 173 | 3300049742 | Ga0501080_0105638 | Ga0501080_0105638_616_1149 | 153 |
| 174 | 3300049743 | Ga0501081_0140333 | Ga0501081_0140333_169_630 | 153 |
| 175 | 3300049743 | Ga0501081_0243867 | Ga0501081_0243867_811_1272 | 153 |
| 176 | 3300049743 | Ga0501081_0475259 | Ga0501081_0475259_446_907 | 153 |
| 177 | 3300049744 | Ga0501083_0006583 | Ga0501083_0006583_5891_6352 | 153 |
| 178 | 3300049822 | Ga0501035_0045094 | Ga0501035_0045094_519_980 | 153 |
| 179 | 3300049823 | Ga0501044_0018755 | Ga0501044_0018755_787_1248 | 153 |
| 180 | 3300049824 | Ga0501045_0000077 | Ga0501045_0000077_11637_12098 | 153 |
| 181 | 3300049824 | Ga0501045_0070095 | Ga0501045_0070095_34_495 | 153 |
| 182 | 3300050507 | nmdc:mga05p37_200451_c1 | nmdc:mga05p37_200451_c1_656_1117 | 153 |
| 183 | 3300050508 | nmdc:mga09592_5692_c1 | nmdc:mga09592_5692_c1_4058_4519 | 153 |
| 184 | 3300050510 | nmdc:mga06r32_210913_c1 | nmdc:mga06r32_210913_c1_494_955 | 153 |
| 185 | 3300054114 | Ga0501084_0000125 | Ga0501084_0000125_48412_48873 | 153 |
| 186 | 3300060353 | Ga0501082_0016042 | Ga0501082_0016042_5946_6407 | 153 |
| 187 | 3300060353 | Ga0501082_0030512 | Ga0501082_0030512_4016_4477 | 153 |
| 188 | 3300060353 | Ga0501082_0079300 | Ga0501082_0079300_2182_2715 | 153 |
| 189 | 3300061734 | Ga0530510_0001934 | Ga0530510_0001934_7682_8143 | 153 |
| 190 | 3300037418 | Ga0395900_0752662 | Ga0395900_0752662_60_524 | 154 |
| 191 | 3300037466 | Ga0395898_0091882 | Ga0395898_0091882_2373_2837 | 154 |
| 192 | 3300038443 | Ga0395901_0212831 | Ga0395901_0212831_546_1010 | 154 |
| 193 | 3300045976 | Ga0466967_0039139 | Ga0466967_0039139_11_475 | 154 |
| 194 | 3300049581 | Ga0501047_1210379 | Ga0501047_1210379_50_532 | 154 |
| 195 | 3300049582 | Ga0501048_0367479 | Ga0501048_0367479_547_1011 | 154 |
| 196 | 3300046528 | Ga0495642_0354807 | Ga0495642_0354807_52_585 | 155 |
| 197 | 3300047471 | Ga0495684_0280426 | Ga0495684_0280426_367_900 | 155 |
| 198 | 3300005364 | Ga0070673_100009174 | Ga0070673_1000091748 | 157 |
| 199 | 3300005441 | Ga0070700_100048730 | Ga0070700_1000487301 | 157 |
| 200 | 3300005718 | Ga0068866_10047907 | Ga0068866_100479075 | 157 |
| 201 | 3300025901 | Ga0207688_10000094 | Ga0207688_1000009443 | 157 |
| 202 | 3300025929 | Ga0207664_10025458 | Ga0207664_100254583 | 157 |
| 203 | 3300025938 | Ga0207704_10335079 | Ga0207704_103350792 | 157 |
| 204 | 3300026088 | Ga0207641_11482352 | Ga0207641_114823522 | 157 |
| 205 | 3300050511 | nmdc:mga08y16_131091_c1 | nmdc:mga08y16_131091_c1_1423_1956 | 158 |
| 206 | 3300048915 | Ga0496112_0059463 | Ga0496112_0059463_654_1157 | 159 |
| 207 | 3300049583 | Ga0501067_0069254 | Ga0501067_0069254_1054_1587 | 159 |
| 208 | 3300049584 | Ga0501068_0017184 | Ga0501068_0017184_1570_2103 | 159 |
| 209 | 3300049585 | Ga0501069_0088552 | Ga0501069_0088552_388_921 | 159 |
| 210 | 3300061734 | Ga0530510_0874729 | Ga0530510_0874729_121_654 | 159 |
| 211 | 3300048903 | Ga0496100_0276059 | Ga0496100_0276059_739_1221 | 160 |
| 212 | 3300035398 | Ga0316574_0171894 | Ga0316574_0171894_714_1217 | 161 |
| 213 | 3300039453 | Ga0436362_1022308 | Ga0436362_1022308_246_779 | 161 |
| 214 | 3300005331 | Ga0070670_100091757 | Ga0070670_1000917575 | 162 |
| 215 | 3300005356 | Ga0070674_100106394 | Ga0070674_1001063944 | 162 |
| 216 | 3300005356 | Ga0070674_100604946 | Ga0070674_1006049461 | 162 |
| 217 | 3300005456 | Ga0070678_100943477 | Ga0070678_1009434771 | 162 |
| 218 | 3300005457 | Ga0070662_101042223 | Ga0070662_1010422231 | 162 |
| 219 | 3300005459 | Ga0068867_100768082 | Ga0068867_1007680821 | 162 |
| 220 | 3300005518 | Ga0070699_100149836 | Ga0070699_1001498365 | 162 |
| 221 | 3300005577 | Ga0068857_100035784 | Ga0068857_1000357847 | 162 |
| 222 | 3300005840 | Ga0068870_10040559 | Ga0068870_100405595 | 162 |
| 223 | 3300005840 | Ga0068870_10073954 | Ga0068870_100739543 | 162 |
| 224 | 3300005937 | Ga0081455_10013977 | Ga0081455_1001397713 | 162 |
| 225 | 3300005981 | Ga0081538_10139009 | Ga0081538_101390092 | 162 |
| 226 | 3300006844 | Ga0075428_100634603 | Ga0075428_1006346032 | 162 |
| 227 | 3300006881 | Ga0068865_100076824 | Ga0068865_1000768245 | 162 |
| 228 | 3300009148 | Ga0105243_10120150 | Ga0105243_101201503 | 162 |
| 229 | 3300014969 | Ga0157376_10709745 | Ga0157376_107097452 | 162 |
| 230 | 3300025908 | Ga0207643_10018007 | Ga0207643_100180075 | 162 |
| 231 | 3300025908 | Ga0207643_10019179 | Ga0207643_100191792 | 162 |
| 232 | 3300025925 | Ga0207650_10030694 | Ga0207650_100306946 | 162 |
| 233 | 3300025935 | Ga0207709_10056512 | Ga0207709_100565125 | 162 |
| 234 | 3300025935 | Ga0207709_10260242 | Ga0207709_102602422 | 162 |
| 235 | 3300025937 | Ga0207669_10075819 | Ga0207669_100758191 | 162 |
| 236 | 3300025938 | Ga0207704_10071929 | Ga0207704_100719292 | 162 |
| 237 | 3300025940 | Ga0207691_10781154 | Ga0207691_107811542 | 162 |
| 238 | 3300026089 | Ga0207648_10780212 | Ga0207648_107802122 | 162 |
| 239 | 3300026116 | Ga0207674_10055770 | Ga0207674_100557705 | 162 |
| 240 | 3300026121 | Ga0207683_10161304 | Ga0207683_101613042 | 162 |
| 241 | 3300038443 | Ga0395901_0074476 | Ga0395901_0074476_1041_1529 | 162 |
| 242 | 3300042122 | Ga0450920_002132 | Ga0450920_002132_235_723 | 162 |
| 243 | 3300042146 | Ga0450907_001870 | Ga0450907_001870_2711_3199 | 162 |
| 244 | 3300049568 | Ga0501031_0340727 | Ga0501031_0340727_196_684 | 162 |
| 245 | 3300049569 | Ga0501032_0093895 | Ga0501032_0093895_1217_1705 | 162 |
| 246 | 3300049570 | Ga0501033_0032660 | Ga0501033_0032660_606_1094 | 162 |
| 247 | 3300049572 | Ga0501036_0009021 | Ga0501036_0009021_5821_6309 | 162 |
| 248 | 3300049573 | Ga0501037_0013457 | Ga0501037_0013457_3645_4133 | 162 |
| 249 | 3300049573 | Ga0501037_0329506 | Ga0501037_0329506_407_895 | 162 |
| 250 | 3300049574 | Ga0501038_0002469 | Ga0501038_0002469_15370_15858 | 162 |
| 251 | 3300049575 | Ga0501039_0004772 | Ga0501039_0004772_7866_8354 | 162 |
| 252 | 3300049576 | Ga0501040_0023663 | Ga0501040_0023663_3323_3811 | 162 |
| 253 | 3300049576 | Ga0501040_0119856 | Ga0501040_0119856_991_1479 | 162 |
| 254 | 3300049577 | Ga0501041_0004355 | Ga0501041_0004355_6172_6660 | 162 |
| 255 | 3300049578 | Ga0501042_0000667 | Ga0501042_0000667_3525_4013 | 162 |
| 256 | 3300049580 | Ga0501046_0006661 | Ga0501046_0006661_7865_8353 | 162 |
| 257 | 3300049582 | Ga0501048_0004215 | Ga0501048_0004215_1724_2212 | 162 |
| 258 | 3300049584 | Ga0501068_0017701 | Ga0501068_0017701_1722_2210 | 162 |
| 259 | 3300049586 | Ga0501070_0007966 | Ga0501070_0007966_1364_1852 | 162 |
| 260 | 3300049587 | Ga0501071_0172866 | Ga0501071_0172866_265_753 | 162 |
| 261 | 3300049588 | Ga0501072_0012923 | Ga0501072_0012923_2465_2953 | 162 |
| 262 | 3300049589 | Ga0501073_0141779 | Ga0501073_0141779_1123_1611 | 162 |
| 263 | 3300049590 | Ga0501074_0001000 | Ga0501074_0001000_8186_8674 | 162 |
| 264 | 3300049591 | Ga0501075_0284160 | Ga0501075_0284160_287_775 | 162 |
| 265 | 3300049592 | Ga0501076_0007318 | Ga0501076_0007318_4617_5105 | 162 |
| 266 | 3300049593 | Ga0501077_0007498 | Ga0501077_0007498_6057_6545 | 162 |
| 267 | 3300049741 | Ga0501079_0006042 | Ga0501079_0006042_4800_5288 | 162 |
| 268 | 3300049741 | Ga0501079_0360704 | Ga0501079_0360704_262_750 | 162 |
| 269 | 3300049742 | Ga0501080_0012861 | Ga0501080_0012861_1833_2321 | 162 |
| 270 | 3300049743 | Ga0501081_0024644 | Ga0501081_0024644_2192_2680 | 162 |
| 271 | 3300049744 | Ga0501083_0023084 | Ga0501083_0023084_2103_2591 | 162 |
| 272 | 3300049822 | Ga0501035_0021361 | Ga0501035_0021361_4187_4675 | 162 |
| 273 | 3300049823 | Ga0501044_0126002 | Ga0501044_0126002_896_1384 | 162 |
| 274 | 3300049824 | Ga0501045_0001835 | Ga0501045_0001835_9297_9785 | 162 |
| 275 | 3300050507 | nmdc:mga05p37_183984_c1 | nmdc:mga05p37_183984_c1_1673_2161 | 162 |
| 276 | 3300054114 | Ga0501084_0060248 | Ga0501084_0060248_2140_2628 | 162 |
| 277 | 3300054114 | Ga0501084_0450992 | Ga0501084_0450992_62_550 | 162 |
| 278 | 3300060353 | Ga0501082_0032987 | Ga0501082_0032987_3768_4256 | 162 |
| 279 | 3300005436 | Ga0070713_100163538 | Ga0070713_1001635385 | 163 |
| 280 | 3300005444 | Ga0070694_100095994 | Ga0070694_1000959944 | 163 |
| 281 | 3300006173 | Ga0070716_100028679 | Ga0070716_1000286792 | 163 |
| 282 | 3300006846 | Ga0075430_100236322 | Ga0075430_1002363222 | 163 |
| 283 | 3300013105 | Ga0157369_10035022 | Ga0157369_100350228 | 163 |
| 284 | 3300025928 | Ga0207700_10000001 | Ga0207700_1000000188 | 163 |
| 285 | 3300026121 | Ga0207683_10221925 | Ga0207683_102219254 | 163 |
| 286 | 3300027907 | Ga0207428_10512868 | Ga0207428_105128682 | 163 |
| 287 | 3300037312 | Ga0395899_0153589 | Ga0395899_0153589_221_712 | 163 |
| 288 | 3300037471 | Ga0395905_0342344 | Ga0395905_0342344_418_909 | 163 |
| 289 | 3300046525 | Ga0495663_0025814 | Ga0495663_0025814_1187_1678 | 163 |
| 290 | 3300048913 | Ga0496110_0023971 | Ga0496110_0023971_737_1228 | 163 |
| 291 | 3300048914 | Ga0496111_0033779 | Ga0496111_0033779_1307_1798 | 163 |
| 292 | 3300049568 | Ga0501031_0114103 | Ga0501031_0114103_30_521 | 163 |
| 293 | 3300049569 | Ga0501032_0004421 | Ga0501032_0004421_3348_3839 | 163 |
| 294 | 3300049570 | Ga0501033_0075805 | Ga0501033_0075805_30_521 | 163 |
| 295 | 3300049572 | Ga0501036_0003710 | Ga0501036_0003710_8402_8893 | 163 |
| 296 | 3300049573 | Ga0501037_0059507 | Ga0501037_0059507_348_839 | 163 |
| 297 | 3300049574 | Ga0501038_0096442 | Ga0501038_0096442_30_521 | 163 |
| 298 | 3300049575 | Ga0501039_0015250 | Ga0501039_0015250_30_521 | 163 |
| 299 | 3300049576 | Ga0501040_0000912 | Ga0501040_0000912_16794_17285 | 163 |
| 300 | 3300049577 | Ga0501041_0001188 | Ga0501041_0001188_8825_9316 | 163 |
| 301 | 3300049578 | Ga0501042_0035028 | Ga0501042_0035028_2252_2743 | 163 |
| 302 | 3300049579 | Ga0501043_0084192 | Ga0501043_0084192_118_609 | 163 |
| 303 | 3300049580 | Ga0501046_0004156 | Ga0501046_0004156_4694_5185 | 163 |
| 304 | 3300049581 | Ga0501047_0021018 | Ga0501047_0021018_861_1352 | 163 |
| 305 | 3300049582 | Ga0501048_0023093 | Ga0501048_0023093_2976_3467 | 163 |
| 306 | 3300049583 | Ga0501067_0126627 | Ga0501067_0126627_521_1054 | 163 |
| 307 | 3300049584 | Ga0501068_0010460 | Ga0501068_0010460_30_521 | 163 |
| 308 | 3300049585 | Ga0501069_0022228 | Ga0501069_0022228_1321_1812 | 163 |
| 309 | 3300049586 | Ga0501070_0094901 | Ga0501070_0094901_30_521 | 163 |
| 310 | 3300049587 | Ga0501071_0074357 | Ga0501071_0074357_1201_1692 | 163 |
| 311 | 3300049588 | Ga0501072_0033633 | Ga0501072_0033633_788_1279 | 163 |
| 312 | 3300049590 | Ga0501074_0040628 | Ga0501074_0040628_1798_2289 | 163 |
| 313 | 3300049591 | Ga0501075_0001943 | Ga0501075_0001943_5361_5852 | 163 |
| 314 | 3300049592 | Ga0501076_0008207 | Ga0501076_0008207_1798_2289 | 163 |
| 315 | 3300049593 | Ga0501077_0001912 | Ga0501077_0001912_4471_4962 | 163 |
| 316 | 3300049741 | Ga0501079_0003409 | Ga0501079_0003409_4876_5367 | 163 |
| 317 | 3300049742 | Ga0501080_0032304 | Ga0501080_0032304_2592_3083 | 163 |
| 318 | 3300049743 | Ga0501081_0006383 | Ga0501081_0006383_1798_2289 | 163 |
| 319 | 3300049744 | Ga0501083_0011542 | Ga0501083_0011542_345_836 | 163 |
| 320 | 3300049822 | Ga0501035_0034996 | Ga0501035_0034996_1948_2439 | 163 |
| 321 | 3300049823 | Ga0501044_0122766 | Ga0501044_0122766_30_521 | 163 |
| 322 | 3300049824 | Ga0501045_0049099 | Ga0501045_0049099_788_1279 | 163 |
| 323 | 3300054114 | Ga0501084_0003582 | Ga0501084_0003582_9380_9871 | 163 |
| 324 | 3300060353 | Ga0501082_0011395 | Ga0501082_0011395_1798_2289 | 163 |
| 325 | 3300061734 | Ga0530510_0001850 | Ga0530510_0001850_8608_9099 | 163 |
| 326 | 3300009148 | Ga0105243_10244316 | Ga0105243_102443163 | 164 |
| 327 | 3300049582 | Ga0501048_0675448 | Ga0501048_0675448_19_552 | 165 |
| 328 | 3300049588 | Ga0501072_0276702 | Ga0501072_0276702_286_819 | 165 |
| 329 | 3300054114 | Ga0501084_0798072 | Ga0501084_0798072_245_778 | 165 |
| 330 | 3300025918 | Ga0207662_10484022 | Ga0207662_104840222 | 166 |
| 331 | 3300035242 | Ga0373962_0174743 | Ga0373962_0174743_198_704 | 166 |
| 332 | 3300006852 | Ga0075433_10453679 | Ga0075433_104536792 | 167 |
| 333 | 3300039437 | Ga0436365_1358796 | Ga0436365_1358796_179_712 | 167 |
| 334 | 3300046516 | Ga0495628_0693428 | Ga0495628_0693428_25_528 | 167 |
| 335 | 3300054114 | Ga0501084_0067888 | Ga0501084_0067888_20_523 | 167 |
| 336 | 3300037312 | Ga0395899_0190775 | Ga0395899_0190775_488_1021 | 170 |
| 337 | 3300037418 | Ga0395900_0011178 | Ga0395900_0011178_7207_7740 | 170 |
| 338 | 3300037466 | Ga0395898_0297972 | Ga0395898_0297972_670_1203 | 170 |
| 339 | 3300037471 | Ga0395905_0055653 | Ga0395905_0055653_322_855 | 170 |
| 340 | 3300038443 | Ga0395901_0019091 | Ga0395901_0019091_2216_2749 | 170 |
| 341 | 3300044673 | Ga0453683_0088991 | Ga0453683_0088991_484_1005 | 171 |
| 342 | 3300006028 | Ga0070717_10069262 | Ga0070717_100692623 | 172 |
| 343 | 3300031251 | Ga0265327_10035110 | Ga0265327_100351103 | 172 |
| 344 | iso_pu_bacteria | 2524614857 | 2526062871 | 173 |
| 345 | iso_pu_bacteria | 2739367875 | 2740063893 | 173 |
| 346 | iso_pu_bacteria | 8055588893 | 8055591283 | 174 |
| 347 | 3300005329 | Ga0070683_100053944 | Ga0070683_1000539444 | 177 |
| 348 | 3300005329 | Ga0070683_101062045 | Ga0070683_1010620452 | 177 |
| 349 | 3300005336 | Ga0070680_100098314 | Ga0070680_1000983144 | 177 |
| 350 | 3300005336 | Ga0070680_100123282 | Ga0070680_1001232823 | 177 |
| 351 | 3300005337 | Ga0070682_100189583 | Ga0070682_1001895832 | 177 |
| 352 | 3300005337 | Ga0070682_100727505 | Ga0070682_1007275051 | 177 |
| 353 | 3300005339 | Ga0070660_100766323 | Ga0070660_1007663232 | 177 |
| 354 | 3300005341 | Ga0070691_10030122 | Ga0070691_100301225 | 177 |
| 355 | 3300005344 | Ga0070661_100040522 | Ga0070661_1000405227 | 177 |
| 356 | 3300005355 | Ga0070671_100068504 | Ga0070671_1000685043 | 177 |
| 357 | 3300005355 | Ga0070671_100894008 | Ga0070671_1008940081 | 177 |
| 358 | 3300005434 | Ga0070709_10017436 | Ga0070709_100174367 | 177 |
| 359 | 3300005435 | Ga0070714_100023042 | Ga0070714_1000230428 | 177 |
| 360 | 3300005435 | Ga0070714_100138461 | Ga0070714_1001384613 | 177 |
| 361 | 3300005435 | Ga0070714_100171566 | Ga0070714_1001715662 | 177 |
| 362 | 3300005435 | Ga0070714_100542659 | Ga0070714_1005426592 | 177 |
| 363 | 3300005435 | Ga0070714_101254020 | Ga0070714_1012540201 | 177 |
| 364 | 3300005436 | Ga0070713_100001889 | Ga0070713_10000188912 | 177 |
| 365 | 3300005436 | Ga0070713_100035918 | Ga0070713_1000359183 | 177 |
| 366 | 3300005437 | Ga0070710_10010919 | Ga0070710_100109197 | 177 |
| 367 | 3300005437 | Ga0070710_10055055 | Ga0070710_100550552 | 177 |
| 368 | 3300005439 | Ga0070711_100175072 | Ga0070711_1001750723 | 177 |
| 369 | 3300005439 | Ga0070711_100258287 | Ga0070711_1002582872 | 177 |
| 370 | 3300005439 | Ga0070711_100961031 | Ga0070711_1009610311 | 177 |
| 371 | 3300005440 | Ga0070705_100023560 | Ga0070705_1000235607 | 177 |
| 372 | 3300005445 | Ga0070708_100361595 | Ga0070708_1003615953 | 177 |
| 373 | 3300005456 | Ga0070678_100651518 | Ga0070678_1006515181 | 177 |
| 374 | 3300005456 | Ga0070678_100691956 | Ga0070678_1006919562 | 177 |
| 375 | 3300005458 | Ga0070681_10015900 | Ga0070681_100159004 | 177 |
| 376 | 3300005458 | Ga0070681_10154710 | Ga0070681_101547102 | 177 |
| 377 | 3300005468 | Ga0070707_100001557 | Ga0070707_1000015576 | 177 |
| 378 | 3300005530 | Ga0070679_100029555 | Ga0070679_1000295555 | 177 |
| 379 | 3300005535 | Ga0070684_100156385 | Ga0070684_1001563852 | 177 |
| 380 | 3300005535 | Ga0070684_100402869 | Ga0070684_1004028691 | 177 |
| 381 | 3300005539 | Ga0068853_100284547 | Ga0068853_1002845473 | 177 |
| 382 | 3300005545 | Ga0070695_100001595 | Ga0070695_1000015959 | 177 |
| 383 | 3300005549 | Ga0070704_100191887 | Ga0070704_1001918872 | 177 |
| 384 | 3300005563 | Ga0068855_100939809 | Ga0068855_1009398092 | 177 |
| 385 | 3300005564 | Ga0070664_100007134 | Ga0070664_10000713415 | 177 |
| 386 | 3300005577 | Ga0068857_100138893 | Ga0068857_1001388931 | 177 |
| 387 | 3300005577 | Ga0068857_100222749 | Ga0068857_1002227494 | 177 |
| 388 | 3300005614 | Ga0068856_100056684 | Ga0068856_1000566842 | 177 |
| 389 | 3300005614 | Ga0068856_100432985 | Ga0068856_1004329852 | 177 |
| 390 | 3300005614 | Ga0068856_100601606 | Ga0068856_1006016062 | 177 |
| 391 | 3300005615 | Ga0070702_100242311 | Ga0070702_1002423112 | 177 |
| 392 | 3300005616 | Ga0068852_100215349 | Ga0068852_1002153494 | 177 |
| 393 | 3300005618 | Ga0068864_100145545 | Ga0068864_1001455453 | 177 |
| 394 | 3300005841 | Ga0068863_100246016 | Ga0068863_1002460162 | 177 |
| 395 | 3300005844 | Ga0068862_100860677 | Ga0068862_1008606772 | 177 |
| 396 | 3300005937 | Ga0081455_10050855 | Ga0081455_100508552 | 177 |
| 397 | 3300006028 | Ga0070717_10012019 | Ga0070717_100120192 | 177 |
| 398 | 3300006028 | Ga0070717_10024999 | Ga0070717_100249995 | 177 |
| 399 | 3300006028 | Ga0070717_10032247 | Ga0070717_100322473 | 177 |
| 400 | 3300006028 | Ga0070717_10190202 | Ga0070717_101902024 | 177 |
| 401 | 3300006028 | Ga0070717_10575879 | Ga0070717_105758792 | 177 |
| 402 | 3300006038 | Ga0075365_10618456 | Ga0075365_106184562 | 177 |
| 403 | 3300006163 | Ga0070715_10009632 | Ga0070715_100096323 | 177 |
| 404 | 3300006173 | Ga0070716_100047618 | Ga0070716_1000476182 | 177 |
| 405 | 3300006175 | Ga0070712_100093717 | Ga0070712_1000937172 | 177 |
| 406 | 3300006175 | Ga0070712_100107998 | Ga0070712_1001079982 | 177 |
| 407 | 3300006175 | Ga0070712_100196031 | Ga0070712_1001960313 | 177 |
| 408 | 3300006844 | Ga0075428_100662417 | Ga0075428_1006624173 | 177 |
| 409 | 3300006847 | Ga0075431_100004224 | Ga0075431_10000422418 | 177 |
| 410 | 3300006880 | Ga0075429_100011161 | Ga0075429_1000111616 | 177 |
| 411 | 3300006914 | Ga0075436_100438644 | Ga0075436_1004386441 | 177 |
| 412 | 3300009093 | Ga0105240_10134085 | Ga0105240_101340857 | 177 |
| 413 | 3300009093 | Ga0105240_10689056 | Ga0105240_106890562 | 177 |
| 414 | 3300009094 | Ga0111539_10065262 | Ga0111539_100652626 | 177 |
| 415 | 3300009094 | Ga0111539_10665582 | Ga0111539_106655823 | 177 |
| 416 | 3300009094 | Ga0111539_10998168 | Ga0111539_109981682 | 177 |
| 417 | 3300009101 | Ga0105247_10331647 | Ga0105247_103316472 | 177 |
| 418 | 3300009147 | Ga0114129_10035990 | Ga0114129_100359904 | 177 |
| 419 | 3300009147 | Ga0114129_10154347 | Ga0114129_101543473 | 177 |
| 420 | 3300009147 | Ga0114129_10211509 | Ga0114129_102115093 | 177 |
| 421 | 3300009176 | Ga0105242_10019594 | Ga0105242_100195943 | 177 |
| 422 | 3300009177 | Ga0105248_10914761 | Ga0105248_109147613 | 177 |
| 423 | 3300009545 | Ga0105237_10429166 | Ga0105237_104291661 | 177 |
| 424 | 3300009551 | Ga0105238_10270169 | Ga0105238_102701693 | 177 |
| 425 | 3300010375 | Ga0105239_10294777 | Ga0105239_102947773 | 177 |
| 426 | 3300010375 | Ga0105239_11633232 | Ga0105239_116332322 | 177 |
| 427 | 3300011119 | Ga0105246_10349304 | Ga0105246_103493042 | 177 |
| 428 | 3300012508 | Ga0157315_1004064 | Ga0157315_10040642 | 177 |
| 429 | 3300013296 | Ga0157374_10575437 | Ga0157374_105754372 | 177 |
| 430 | 3300013296 | Ga0157374_11753115 | Ga0157374_117531151 | 177 |
| 431 | 3300013306 | Ga0163162_11547895 | Ga0163162_115478951 | 177 |
| 432 | 3300013307 | Ga0157372_10048166 | Ga0157372_100481664 | 177 |
| 433 | 3300013307 | Ga0157372_10370753 | Ga0157372_103707533 | 177 |
| 434 | 3300013307 | Ga0157372_11145923 | Ga0157372_111459232 | 177 |
| 435 | 3300014325 | Ga0163163_10356316 | Ga0163163_103563162 | 177 |
| 436 | 3300014326 | Ga0157380_10462836 | Ga0157380_104628362 | 177 |
| 437 | 3300014497 | Ga0182008_10247557 | Ga0182008_102475572 | 177 |
| 438 | 3300014968 | Ga0157379_10689001 | Ga0157379_106890012 | 177 |
| 439 | 3300014969 | Ga0157376_10126357 | Ga0157376_101263572 | 177 |
| 440 | 3300020070 | Ga0206356_10473551 | Ga0206356_104735512 | 177 |
| 441 | 3300021441 | Ga0213871_10031694 | Ga0213871_100316942 | 177 |
| 442 | 3300022467 | Ga0224712_10064454 | Ga0224712_100644543 | 177 |
| 443 | 3300022467 | Ga0224712_10168148 | Ga0224712_101681482 | 177 |
| 444 | 3300025898 | Ga0207692_10034920 | Ga0207692_100349205 | 177 |
| 445 | 3300025898 | Ga0207692_10420172 | Ga0207692_104201722 | 177 |
| 446 | 3300025898 | Ga0207692_10455059 | Ga0207692_104550591 | 177 |
| 447 | 3300025900 | Ga0207710_10269904 | Ga0207710_102699041 | 177 |
| 448 | 3300025905 | Ga0207685_10421115 | Ga0207685_104211152 | 177 |
| 449 | 3300025906 | Ga0207699_10022230 | Ga0207699_100222305 | 177 |
| 450 | 3300025906 | Ga0207699_10933990 | Ga0207699_109339901 | 177 |
| 451 | 3300025910 | Ga0207684_10061237 | Ga0207684_100612374 | 177 |
| 452 | 3300025912 | Ga0207707_10108421 | Ga0207707_101084214 | 177 |
| 453 | 3300025912 | Ga0207707_10214293 | Ga0207707_102142932 | 177 |
| 454 | 3300025913 | Ga0207695_10443156 | Ga0207695_104431562 | 177 |
| 455 | 3300025913 | Ga0207695_10608670 | Ga0207695_106086702 | 177 |
| 456 | 3300025913 | Ga0207695_10758460 | Ga0207695_107584602 | 177 |
| 457 | 3300025914 | Ga0207671_10102167 | Ga0207671_101021675 | 177 |
| 458 | 3300025915 | Ga0207693_10009230 | Ga0207693_1000923013 | 177 |
| 459 | 3300025915 | Ga0207693_10163875 | Ga0207693_101638752 | 177 |
| 460 | 3300025915 | Ga0207693_10245231 | Ga0207693_102452313 | 177 |
| 461 | 3300025916 | Ga0207663_10007294 | Ga0207663_100072947 | 177 |
| 462 | 3300025916 | Ga0207663_10137312 | Ga0207663_101373122 | 177 |
| 463 | 3300025919 | Ga0207657_10009472 | Ga0207657_100094729 | 177 |
| 464 | 3300025921 | Ga0207652_10096320 | Ga0207652_100963205 | 177 |
| 465 | 3300025922 | Ga0207646_10000851 | Ga0207646_1000085116 | 177 |
| 466 | 3300025924 | Ga0207694_10075978 | Ga0207694_100759784 | 177 |
| 467 | 3300025927 | Ga0207687_10109632 | Ga0207687_101096323 | 177 |
| 468 | 3300025927 | Ga0207687_10614904 | Ga0207687_106149041 | 177 |
| 469 | 3300025928 | Ga0207700_10045665 | Ga0207700_100456653 | 177 |
| 470 | 3300025928 | Ga0207700_10047734 | Ga0207700_100477343 | 177 |
| 471 | 3300025929 | Ga0207664_10038854 | Ga0207664_100388546 | 177 |
| 472 | 3300025929 | Ga0207664_10096443 | Ga0207664_100964434 | 177 |
| 473 | 3300025929 | Ga0207664_10137050 | Ga0207664_101370504 | 177 |
| 474 | 3300025929 | Ga0207664_10194359 | Ga0207664_101943593 | 177 |
| 475 | 3300025929 | Ga0207664_10204157 | Ga0207664_102041572 | 177 |
| 476 | 3300025931 | Ga0207644_10164705 | Ga0207644_101647053 | 177 |
| 477 | 3300025931 | Ga0207644_10822363 | Ga0207644_108223632 | 177 |
| 478 | 3300025932 | Ga0207690_10697385 | Ga0207690_106973852 | 177 |
| 479 | 3300025939 | Ga0207665_10000058 | Ga0207665_100000582 | 177 |
| 480 | 3300025939 | Ga0207665_10549878 | Ga0207665_105498781 | 177 |
| 481 | 3300025941 | Ga0207711_10110013 | Ga0207711_101100134 | 177 |
| 482 | 3300025942 | Ga0207689_10663114 | Ga0207689_106631142 | 177 |
| 483 | 3300025944 | Ga0207661_10863333 | Ga0207661_108633332 | 177 |
| 484 | 3300025945 | Ga0207679_10054481 | Ga0207679_100544813 | 177 |
| 485 | 3300025949 | Ga0207667_10381044 | Ga0207667_103810442 | 177 |
| 486 | 3300026041 | Ga0207639_11048843 | Ga0207639_110488431 | 177 |
| 487 | 3300026075 | Ga0207708_10490920 | Ga0207708_104909202 | 177 |
| 488 | 3300026088 | Ga0207641_10235360 | Ga0207641_102353603 | 177 |
| 489 | 3300026116 | Ga0207674_10153021 | Ga0207674_101530215 | 177 |
| 490 | 3300026118 | Ga0207675_100553554 | Ga0207675_1005535542 | 177 |
| 491 | 3300027907 | Ga0207428_10019256 | Ga0207428_100192566 | 177 |
| 492 | 3300027907 | Ga0207428_10320405 | Ga0207428_103204052 | 177 |
| 493 | 3300028380 | Ga0268265_10526911 | Ga0268265_105269112 | 177 |
| 494 | 3300028556 | Ga0265337_1061382 | Ga0265337_10613822 | 177 |
| 495 | 3300028573 | Ga0265334_10010285 | Ga0265334_100102853 | 177 |
| 496 | 3300028654 | Ga0265322_10062119 | Ga0265322_100621192 | 177 |
| 497 | 3300028666 | Ga0265336_10001318 | Ga0265336_100013188 | 177 |
| 498 | 3300028800 | Ga0265338_10012206 | Ga0265338_1001220610 | 177 |
| 499 | 3300031595 | Ga0265313_10050529 | Ga0265313_100505293 | 177 |
| 500 | 3300032133 | Ga0316583_10026202 | Ga0316583_100262024 | 177 |
| 501 | 3300032168 | Ga0316593_10010384 | Ga0316593_100103843 | 177 |
| 502 | 3300033541 | Ga0316596_1017568 | Ga0316596_10175682 | 177 |
| 503 | 3300035083 | Ga0373926_0005643 | Ga0373926_0005643_876_1409 | 177 |
| 504 | 3300035084 | Ga0373928_0016089 | Ga0373928_0016089_283_816 | 177 |
| 505 | 3300035086 | Ga0373934_0023921 | Ga0373934_0023921_954_1487 | 177 |
| 506 | 3300035090 | Ga0373949_0014842 | Ga0373949_0014842_305_838 | 177 |
| 507 | 3300035092 | Ga0373952_0036322 | Ga0373952_0036322_443_976 | 177 |
| 508 | 3300035111 | Ga0373923_0165417 | Ga0373923_0165417_355_888 | 177 |
| 509 | 3300035113 | Ga0373936_0015763 | Ga0373936_0015763_283_816 | 177 |
| 510 | 3300035114 | Ga0373939_0031302 | Ga0373939_0031302_55_588 | 177 |
| 511 | 3300035116 | Ga0373945_0027844 | Ga0373945_0027844_831_1364 | 177 |
| 512 | 3300035117 | Ga0373953_0116309 | Ga0373953_0116309_16_549 | 177 |
| 513 | 3300035119 | Ga0373956_0062256 | Ga0373956_0062256_411_944 | 177 |
| 514 | 3300035121 | Ga0373960_0021225 | Ga0373960_0021225_182_715 | 177 |
| 515 | 3300035170 | Ga0373943_0007053 | Ga0373943_0007053_362_895 | 177 |
| 516 | 3300035171 | Ga0373946_0014684 | Ga0373946_0014684_1012_1545 | 177 |
| 517 | 3300035172 | Ga0373955_0026984 | Ga0373955_0026984_223_756 | 177 |
| 518 | 3300035241 | Ga0373961_0049540 | Ga0373961_0049540_287_820 | 177 |
| 519 | 3300035410 | Ga0373924_0081084 | Ga0373924_0081084_699_1232 | 177 |
| 520 | 3300035691 | Ga0373931_0017440 | Ga0373931_0017440_1934_2467 | 177 |
| 521 | 3300035692 | Ga0373935_0042154 | Ga0373935_0042154_1535_2068 | 177 |
| 522 | 3300035692 | Ga0373935_0591751 | Ga0373935_0591751_100_633 | 177 |
| 523 | 3300035695 | Ga0373927_0361397 | Ga0373927_0361397_413_946 | 177 |
| 524 | 3300035724 | Ga0373933_0021469 | Ga0373933_0021469_3019_3552 | 177 |
| 525 | 3300035725 | Ga0373947_0017628 | Ga0373947_0017628_1790_2323 | 177 |
| 526 | 3300036401 | Ga0373937_0001944 | Ga0373937_0001944_863_1396 | 177 |
| 527 | 3300036401 | Ga0373937_0720054 | Ga0373937_0720054_219_752 | 177 |
| 528 | 3300037068 | Ga0373925_0002218 | Ga0373925_0002218_4516_5049 | 177 |
| 529 | 3300037312 | Ga0395899_0207337 | Ga0395899_0207337_786_1319 | 177 |
| 530 | 3300037418 | Ga0395900_0167439 | Ga0395900_0167439_1528_2061 | 177 |
| 531 | 3300037418 | Ga0395900_0284549 | Ga0395900_0284549_62_595 | 177 |
| 532 | 3300037418 | Ga0395900_1214729 | Ga0395900_1214729_98_631 | 177 |
| 533 | 3300037466 | Ga0395898_1106446 | Ga0395898_1106446_24_557 | 177 |
| 534 | 3300037471 | Ga0395905_0700236 | Ga0395905_0700236_301_834 | 177 |
| 535 | 3300037853 | Ga0436364_0599685 | Ga0436364_0599685_295_870 | 177 |
| 536 | 3300038443 | Ga0395901_0161249 | Ga0395901_0161249_301_834 | 177 |
| 537 | 3300038443 | Ga0395901_0571535 | Ga0395901_0571535_542_1075 | 177 |
| 538 | 3300039438 | Ga0436360_1013902 | Ga0436360_1013902_1719_2258 | 177 |
| 539 | 3300039447 | Ga0436361_0766437 | Ga0436361_0766437_704_1243 | 177 |
| 540 | 3300039450 | Ga0436363_1151979 | Ga0436363_1151979_96_629 | 177 |
| 541 | 3300041411 | Ga0439466_0031680 | Ga0439466_0031680_785_1318 | 177 |
| 542 | 3300042136 | Ga0450900_023776 | Ga0450900_023776_132_665 | 177 |
| 543 | 3300044656 | Ga0466969_0003758 | Ga0466969_0003758_4828_5361 | 177 |
| 544 | 3300044656 | Ga0466969_0064936 | Ga0466969_0064936_722_1255 | 177 |
| 545 | 3300044656 | Ga0466969_0198983 | Ga0466969_0198983_37_570 | 177 |
| 546 | 3300044683 | Ga0466965_0077701 | Ga0466965_0077701_383_916 | 177 |
| 547 | 3300044684 | Ga0466966_0034146 | Ga0466966_0034146_588_1121 | 177 |
| 548 | 3300044684 | Ga0466966_0044853 | Ga0466966_0044853_869_1402 | 177 |
| 549 | 3300044693 | Ga0466961_0000463 | Ga0466961_0000463_2310_2843 | 177 |
| 550 | 3300044693 | Ga0466961_0015787 | Ga0466961_0015787_1537_2070 | 177 |
| 551 | 3300044693 | Ga0466961_0060307 | Ga0466961_0060307_917_1450 | 177 |
| 552 | 3300044693 | Ga0466961_0077983 | Ga0466961_0077983_945_1478 | 177 |
| 553 | 3300044693 | Ga0466961_0085051 | Ga0466961_0085051_395_928 | 177 |
| 554 | 3300044694 | Ga0466963_0000055 | Ga0466963_0000055_35646_36179 | 177 |
| 555 | 3300044694 | Ga0466963_0002044 | Ga0466963_0002044_3417_3950 | 177 |
| 556 | 3300044694 | Ga0466963_0004340 | Ga0466963_0004340_2399_2932 | 177 |
| 557 | 3300044694 | Ga0466963_0006350 | Ga0466963_0006350_2842_3375 | 177 |
| 558 | 3300044694 | Ga0466963_0006417 | Ga0466963_0006417_3846_4379 | 177 |
| 559 | 3300044694 | Ga0466963_0017674 | Ga0466963_0017674_2208_2741 | 177 |
| 560 | 3300044694 | Ga0466963_0026186 | Ga0466963_0026186_1501_2034 | 177 |
| 561 | 3300044694 | Ga0466963_0048563 | Ga0466963_0048563_1815_2348 | 177 |
| 562 | 3300044694 | Ga0466963_0092269 | Ga0466963_0092269_1216_1749 | 177 |
| 563 | 3300044694 | Ga0466963_0097328 | Ga0466963_0097328_1391_1924 | 177 |
| 564 | 3300044694 | Ga0466963_0135655 | Ga0466963_0135655_908_1441 | 177 |
| 565 | 3300044694 | Ga0466963_0593879 | Ga0466963_0593879_17_550 | 177 |
| 566 | 3300044694 | Ga0466963_0638521 | Ga0466963_0638521_132_665 | 177 |
| 567 | 3300044706 | Ga0466964_0033993 | Ga0466964_0033993_1090_1623 | 177 |
| 568 | 3300044706 | Ga0466964_0073886 | Ga0466964_0073886_206_739 | 177 |
| 569 | 3300044706 | Ga0466964_0095241 | Ga0466964_0095241_473_1006 | 177 |
| 570 | 3300044712 | Ga0453684_0734803 | Ga0453684_0734803_251_790 | 177 |
| 571 | 3300044719 | Ga0466971_0009943 | Ga0466971_0009943_2668_3201 | 177 |
| 572 | 3300044719 | Ga0466971_0011670 | Ga0466971_0011670_1881_2414 | 177 |
| 573 | 3300044719 | Ga0466971_0028795 | Ga0466971_0028795_176_709 | 177 |
| 574 | 3300044719 | Ga0466971_0142487 | Ga0466971_0142487_167_700 | 177 |
| 575 | 3300044735 | Ga0466968_0008743 | Ga0466968_0008743_3116_3649 | 177 |
| 576 | 3300044735 | Ga0466968_0028416 | Ga0466968_0028416_1331_1864 | 177 |
| 577 | 3300044735 | Ga0466968_0031656 | Ga0466968_0031656_1198_1731 | 177 |
| 578 | 3300044735 | Ga0466968_0103594 | Ga0466968_0103594_571_1104 | 177 |
| 579 | 3300044735 | Ga0466968_0126664 | Ga0466968_0126664_355_888 | 177 |
| 580 | 3300044735 | Ga0466968_0161488 | Ga0466968_0161488_135_668 | 177 |
| 581 | 3300044765 | Ga0466970_0007299 | Ga0466970_0007299_2004_2537 | 177 |
| 582 | 3300044765 | Ga0466970_0070016 | Ga0466970_0070016_702_1235 | 177 |
| 583 | 3300044765 | Ga0466970_0371652 | Ga0466970_0371652_91_624 | 177 |
| 584 | 3300044842 | Ga0466957_0005217 | Ga0466957_0005217_634_1167 | 177 |
| 585 | 3300044842 | Ga0466957_0016697 | Ga0466957_0016697_3275_3808 | 177 |
| 586 | 3300044842 | Ga0466957_0029951 | Ga0466957_0029951_2175_2708 | 177 |
| 587 | 3300044842 | Ga0466957_0193152 | Ga0466957_0193152_353_886 | 177 |
| 588 | 3300044842 | Ga0466957_0349714 | Ga0466957_0349714_246_779 | 177 |
| 589 | 3300044901 | Ga0466960_0021506 | Ga0466960_0021506_241_774 | 177 |
| 590 | 3300044901 | Ga0466960_0056340 | Ga0466960_0056340_590_1123 | 177 |
| 591 | 3300045049 | Ga0466959_0000761 | Ga0466959_0000761_11898_12431 | 177 |
| 592 | 3300045049 | Ga0466959_0004174 | Ga0466959_0004174_6819_7352 | 177 |
| 593 | 3300045049 | Ga0466959_0006516 | Ga0466959_0006516_4240_4773 | 177 |
| 594 | 3300045049 | Ga0466959_0022832 | Ga0466959_0022832_1715_2248 | 177 |
| 595 | 3300045049 | Ga0466959_0168935 | Ga0466959_0168935_912_1445 | 177 |
| 596 | 3300045049 | Ga0466959_0264676 | Ga0466959_0264676_286_819 | 177 |
| 597 | 3300045836 | Ga0466958_0006835 | Ga0466958_0006835_4679_5212 | 177 |
| 598 | 3300045836 | Ga0466958_0010924 | Ga0466958_0010924_4027_4560 | 177 |
| 599 | 3300045836 | Ga0466958_0013846 | Ga0466958_0013846_659_1192 | 177 |
| 600 | 3300045836 | Ga0466958_0031826 | Ga0466958_0031826_1198_1731 | 177 |
| 601 | 3300045836 | Ga0466958_0205627 | Ga0466958_0205627_307_840 | 177 |
| 602 | 3300045836 | Ga0466958_0345198 | Ga0466958_0345198_315_848 | 177 |
| 603 | 3300045836 | Ga0466958_0375338 | Ga0466958_0375338_178_711 | 177 |
| 604 | 3300045836 | Ga0466958_0459671 | Ga0466958_0459671_265_798 | 177 |
| 605 | 3300045976 | Ga0466967_0002348 | Ga0466967_0002348_3225_3758 | 177 |
| 606 | 3300045976 | Ga0466967_0053112 | Ga0466967_0053112_1367_1900 | 177 |
| 607 | 3300045976 | Ga0466967_0065217 | Ga0466967_0065217_1104_1637 | 177 |
| 608 | 3300045976 | Ga0466967_0078419 | Ga0466967_0078419_777_1310 | 177 |
| 609 | 3300045976 | Ga0466967_0099841 | Ga0466967_0099841_1332_1865 | 177 |
| 610 | 3300045976 | Ga0466967_0116175 | Ga0466967_0116175_71_604 | 177 |
| 611 | 3300045976 | Ga0466967_0189810 | Ga0466967_0189810_1132_1665 | 177 |
| 612 | 3300045976 | Ga0466967_0212598 | Ga0466967_0212598_69_602 | 177 |
| 613 | 3300045976 | Ga0466967_0223460 | Ga0466967_0223460_1165_1698 | 177 |
| 614 | 3300045976 | Ga0466967_0225253 | Ga0466967_0225253_184_717 | 177 |
| 615 | 3300045976 | Ga0466967_0336155 | Ga0466967_0336155_178_711 | 177 |
| 616 | 3300045976 | Ga0466967_0466266 | Ga0466967_0466266_100_633 | 177 |
| 617 | 3300045976 | Ga0466967_0527842 | Ga0466967_0527842_296_829 | 177 |
| 618 | 3300045976 | Ga0466967_0626652 | Ga0466967_0626652_200_733 | 177 |
| 619 | 3300045976 | Ga0466967_0829701 | Ga0466967_0829701_334_867 | 177 |
| 620 | 3300045976 | Ga0466967_1157853 | Ga0466967_1157853_21_554 | 177 |
| 621 | 3300045976 | Ga0466967_1372260 | Ga0466967_1372260_27_560 | 177 |
| 622 | 3300046454 | Ga0495592_0000082 | Ga0495592_0000082_22026_22559 | 177 |
| 623 | 3300046454 | Ga0495592_0005470 | Ga0495592_0005470_8287_8820 | 177 |
| 624 | 3300046454 | Ga0495592_0074198 | Ga0495592_0074198_1116_1649 | 177 |
| 625 | 3300046454 | Ga0495592_0475797 | Ga0495592_0475797_10_543 | 177 |
| 626 | 3300046455 | Ga0495603_0032804 | Ga0495603_0032804_1806_2339 | 177 |
| 627 | 3300046455 | Ga0495603_0189160 | Ga0495603_0189160_246_779 | 177 |
| 628 | 3300046459 | Ga0495629_0107062 | Ga0495629_0107062_558_1091 | 177 |
| 629 | 3300046459 | Ga0495629_0496358 | Ga0495629_0496358_177_710 | 177 |
| 630 | 3300046459 | Ga0495629_0732121 | Ga0495629_0732121_49_582 | 177 |
| 631 | 3300046461 | Ga0495641_0003735 | Ga0495641_0003735_5197_5730 | 177 |
| 632 | 3300046461 | Ga0495641_0013465 | Ga0495641_0013465_726_1259 | 177 |
| 633 | 3300046461 | Ga0495641_0016679 | Ga0495641_0016679_979_1512 | 177 |
| 634 | 3300046461 | Ga0495641_0168032 | Ga0495641_0168032_250_783 | 177 |
| 635 | 3300046461 | Ga0495641_0262499 | Ga0495641_0262499_206_739 | 177 |
| 636 | 3300046462 | Ga0495651_0000254 | Ga0495651_0000254_29528_30061 | 177 |
| 637 | 3300046462 | Ga0495651_0222455 | Ga0495651_0222455_753_1286 | 177 |
| 638 | 3300046463 | Ga0495653_0023292 | Ga0495653_0023292_4258_4791 | 177 |
| 639 | 3300046463 | Ga0495653_0168599 | Ga0495653_0168599_435_968 | 177 |
| 640 | 3300046463 | Ga0495653_0206095 | Ga0495653_0206095_577_1110 | 177 |
| 641 | 3300046472 | Ga0495580_0009973 | Ga0495580_0009973_3970_4503 | 177 |
| 642 | 3300046473 | Ga0495582_0001703 | Ga0495582_0001703_5911_6444 | 177 |
| 643 | 3300046473 | Ga0495582_0265163 | Ga0495582_0265163_395_928 | 177 |
| 644 | 3300046473 | Ga0495582_0358266 | Ga0495582_0358266_254_787 | 177 |
| 645 | 3300046473 | Ga0495582_0412425 | Ga0495582_0412425_194_727 | 177 |
| 646 | 3300046474 | Ga0495605_0054527 | Ga0495605_0054527_1118_1651 | 177 |
| 647 | 3300046475 | Ga0495639_0000828 | Ga0495639_0000828_7665_8198 | 177 |
| 648 | 3300046476 | Ga0495662_0002737 | Ga0495662_0002737_1658_2191 | 177 |
| 649 | 3300046476 | Ga0495662_0111106 | Ga0495662_0111106_645_1178 | 177 |
| 650 | 3300046477 | Ga0495664_0018869 | Ga0495664_0018869_1211_1744 | 177 |
| 651 | 3300046477 | Ga0495664_0073142 | Ga0495664_0073142_843_1376 | 177 |
| 652 | 3300046492 | Ga0495585_0025984 | Ga0495585_0025984_28_561 | 177 |
| 653 | 3300046499 | Ga0495594_0378856 | Ga0495594_0378856_187_720 | 177 |
| 654 | 3300046500 | Ga0495596_0085594 | Ga0495596_0085594_647_1180 | 177 |
| 655 | 3300046511 | Ga0495608_0003029 | Ga0495608_0003029_2197_2730 | 177 |
| 656 | 3300046511 | Ga0495608_0019774 | Ga0495608_0019774_41_574 | 177 |
| 657 | 3300046511 | Ga0495608_0301504 | Ga0495608_0301504_347_880 | 177 |
| 658 | 3300046514 | Ga0495618_0010074 | Ga0495618_0010074_1211_1744 | 177 |
| 659 | 3300046514 | Ga0495618_0011530 | Ga0495618_0011530_4234_4767 | 177 |
| 660 | 3300046514 | Ga0495618_0079738 | Ga0495618_0079738_1325_1858 | 177 |
| 661 | 3300046514 | Ga0495618_0130632 | Ga0495618_0130632_290_823 | 177 |
| 662 | 3300046514 | Ga0495618_0224637 | Ga0495618_0224637_319_852 | 177 |
| 663 | 3300046514 | Ga0495618_0604342 | Ga0495618_0604342_90_623 | 177 |
| 664 | 3300046516 | Ga0495628_0008466 | Ga0495628_0008466_834_1367 | 177 |
| 665 | 3300046516 | Ga0495628_0013181 | Ga0495628_0013181_5102_5635 | 177 |
| 666 | 3300046516 | Ga0495628_0037042 | Ga0495628_0037042_2051_2584 | 177 |
| 667 | 3300046516 | Ga0495628_0255320 | Ga0495628_0255320_366_899 | 177 |
| 668 | 3300046517 | Ga0495630_0018065 | Ga0495630_0018065_341_874 | 177 |
| 669 | 3300046517 | Ga0495630_0059957 | Ga0495630_0059957_1010_1543 | 177 |
| 670 | 3300046517 | Ga0495630_0081900 | Ga0495630_0081900_1782_2315 | 177 |
| 671 | 3300046517 | Ga0495630_0742766 | Ga0495630_0742766_26_559 | 177 |
| 672 | 3300046518 | Ga0495631_0048561 | Ga0495631_0048561_712_1245 | 177 |
| 673 | 3300046523 | Ga0495644_0072868 | Ga0495644_0072868_122_655 | 177 |
| 674 | 3300046526 | Ga0495666_0000309 | Ga0495666_0000309_7087_7620 | 177 |
| 675 | 3300046528 | Ga0495642_0037952 | Ga0495642_0037952_890_1423 | 177 |
| 676 | 3300046529 | Ga0495652_0000144 | Ga0495652_0000144_79473_80006 | 177 |
| 677 | 3300046529 | Ga0495652_0005095 | Ga0495652_0005095_4831_5364 | 177 |
| 678 | 3300046531 | Ga0495665_0003045 | Ga0495665_0003045_3223_3756 | 177 |
| 679 | 3300046533 | Ga0495640_0002828 | Ga0495640_0002828_5580_6113 | 177 |
| 680 | 3300046533 | Ga0495640_0016017 | Ga0495640_0016017_4304_4837 | 177 |
| 681 | 3300046535 | Ga0495586_0035224 | Ga0495586_0035224_1786_2319 | 177 |
| 682 | 3300046535 | Ga0495586_0596015 | Ga0495586_0596015_87_620 | 177 |
| 683 | 3300046536 | Ga0495587_0000060 | Ga0495587_0000060_42129_42662 | 177 |
| 684 | 3300046536 | Ga0495587_0042989 | Ga0495587_0042989_1622_2155 | 177 |
| 685 | 3300046536 | Ga0495587_0267091 | Ga0495587_0267091_218_751 | 177 |
| 686 | 3300046538 | Ga0495609_0082219 | Ga0495609_0082219_528_1061 | 177 |
| 687 | 3300046543 | Ga0495645_0000038 | Ga0495645_0000038_76148_76681 | 177 |
| 688 | 3300046543 | Ga0495645_0039870 | Ga0495645_0039870_681_1214 | 177 |
| 689 | 3300046543 | Ga0495645_0112646 | Ga0495645_0112646_100_633 | 177 |
| 690 | 3300046559 | Ga0495667_0008738 | Ga0495667_0008738_3053_3586 | 177 |
| 691 | 3300046559 | Ga0495667_0173797 | Ga0495667_0173797_227_760 | 177 |
| 692 | 3300046559 | Ga0495667_0308668 | Ga0495667_0308668_97_630 | 177 |
| 693 | 3300046615 | Ga0495656_0001194 | Ga0495656_0001194_6016_6549 | 177 |
| 694 | 3300046615 | Ga0495656_0163686 | Ga0495656_0163686_295_831 | 177 |
| 695 | 3300046642 | Ga0495634_0004455 | Ga0495634_0004455_5765_6298 | 177 |
| 696 | 3300046642 | Ga0495634_0159950 | Ga0495634_0159950_89_622 | 177 |
| 697 | 3300046642 | Ga0495634_0175161 | Ga0495634_0175161_541_1074 | 177 |
| 698 | 3300046648 | Ga0495611_0037229 | Ga0495611_0037229_1105_1638 | 177 |
| 699 | 3300046663 | Ga0495635_0209839 | Ga0495635_0209839_465_998 | 177 |
| 700 | 3300046663 | Ga0495635_0221470 | Ga0495635_0221470_558_1091 | 177 |
| 701 | 3300046664 | Ga0495659_0010631 | Ga0495659_0010631_1359_1892 | 177 |
| 702 | 3300046675 | Ga0495657_0021956 | Ga0495657_0021956_2234_2767 | 177 |
| 703 | 3300046675 | Ga0495657_0029234 | Ga0495657_0029234_1785_2318 | 177 |
| 704 | 3300046675 | Ga0495657_0074859 | Ga0495657_0074859_438_971 | 177 |
| 705 | 3300046678 | Ga0495599_0003010 | Ga0495599_0003010_5359_5892 | 177 |
| 706 | 3300046678 | Ga0495599_0042619 | Ga0495599_0042619_1501_2034 | 177 |
| 707 | 3300046678 | Ga0495599_0251432 | Ga0495599_0251432_82_615 | 177 |
| 708 | 3300046679 | Ga0495623_0003795 | Ga0495623_0003795_4321_4854 | 177 |
| 709 | 3300046679 | Ga0495623_0301324 | Ga0495623_0301324_216_749 | 177 |
| 710 | 3300046680 | Ga0495646_0016747 | Ga0495646_0016747_1754_2287 | 177 |
| 711 | 3300046680 | Ga0495646_0027797 | Ga0495646_0027797_2471_3004 | 177 |
| 712 | 3300046680 | Ga0495646_0075159 | Ga0495646_0075159_337_870 | 177 |
| 713 | 3300046680 | Ga0495646_0167143 | Ga0495646_0167143_351_884 | 177 |
| 714 | 3300046681 | Ga0495647_0013196 | Ga0495647_0013196_2224_2757 | 177 |
| 715 | 3300046681 | Ga0495647_0274276 | Ga0495647_0274276_158_691 | 177 |
| 716 | 3300046683 | Ga0495658_0000498 | Ga0495658_0000498_5753_6286 | 177 |
| 717 | 3300046683 | Ga0495658_0117774 | Ga0495658_0117774_544_1077 | 177 |
| 718 | 3300046689 | Ga0495613_0061335 | Ga0495613_0061335_563_1096 | 177 |
| 719 | 3300046689 | Ga0495613_0141595 | Ga0495613_0141595_152_685 | 177 |
| 720 | 3300046689 | Ga0495613_0157507 | Ga0495613_0157507_37_570 | 177 |
| 721 | 3300046690 | Ga0495624_0007698 | Ga0495624_0007698_6881_7414 | 177 |
| 722 | 3300046690 | Ga0495624_0034041 | Ga0495624_0034041_2007_2540 | 177 |
| 723 | 3300046691 | Ga0495670_0056634 | Ga0495670_0056634_520_1053 | 177 |
| 724 | 3300046809 | Ga0495600_0062127 | Ga0495600_0062127_206_739 | 177 |
| 725 | 3300047315 | Ga0495581_0017975 | Ga0495581_0017975_1658_2191 | 177 |
| 726 | 3300047315 | Ga0495581_0230668 | Ga0495581_0230668_256_789 | 177 |
| 727 | 3300047317 | Ga0495604_0000043 | Ga0495604_0000043_71739_72272 | 177 |
| 728 | 3300047317 | Ga0495604_0148730 | Ga0495604_0148730_391_924 | 177 |
| 729 | 3300047317 | Ga0495604_0220666 | Ga0495604_0220666_702_1235 | 177 |
| 730 | 3300047317 | Ga0495604_0254304 | Ga0495604_0254304_40_573 | 177 |
| 731 | 3300047319 | Ga0495674_0007325 | Ga0495674_0007325_1790_2323 | 177 |
| 732 | 3300047319 | Ga0495674_0019407 | Ga0495674_0019407_4419_4952 | 177 |
| 733 | 3300047319 | Ga0495674_0227405 | Ga0495674_0227405_46_579 | 177 |
| 734 | 3300047319 | Ga0495674_0493327 | Ga0495674_0493327_261_794 | 177 |
| 735 | 3300047321 | Ga0495676_0036425 | Ga0495676_0036425_1790_2323 | 177 |
| 736 | 3300047321 | Ga0495676_0355612 | Ga0495676_0355612_54_587 | 177 |
| 737 | 3300047321 | Ga0495676_0472150 | Ga0495676_0472150_185_718 | 177 |
| 738 | 3300047322 | Ga0495680_0005229 | Ga0495680_0005229_7648_8181 | 177 |
| 739 | 3300047322 | Ga0495680_0009827 | Ga0495680_0009827_4785_5318 | 177 |
| 740 | 3300047322 | Ga0495680_0010993 | Ga0495680_0010993_6929_7462 | 177 |
| 741 | 3300047444 | Ga0495675_0000413 | Ga0495675_0000413_23518_24051 | 177 |
| 742 | 3300047447 | Ga0495685_043204 | Ga0495685_043204_749_1282 | 177 |
| 743 | 3300047471 | Ga0495684_0001111 | Ga0495684_0001111_12422_12955 | 177 |
| 744 | 3300047471 | Ga0495684_0129709 | Ga0495684_0129709_1321_1854 | 177 |
| 745 | 3300047471 | Ga0495684_0274597 | Ga0495684_0274597_311_844 | 177 |
| 746 | 3300047471 | Ga0495684_0435114 | Ga0495684_0435114_12_545 | 177 |
| 747 | 3300047673 | Ga0495593_0001256 | Ga0495593_0001256_10268_10801 | 177 |
| 748 | 3300048088 | Ga0495602_0022762 | Ga0495602_0022762_5135_5668 | 177 |
| 749 | 3300048089 | Ga0495614_0002476 | Ga0495614_0002476_6664_7197 | 177 |
| 750 | 3300048089 | Ga0495614_0296538 | Ga0495614_0296538_123_656 | 177 |
| 751 | 3300048903 | Ga0496100_0001629 | Ga0496100_0001629_317_850 | 177 |
| 752 | 3300048903 | Ga0496100_0053677 | Ga0496100_0053677_829_1362 | 177 |
| 753 | 3300048903 | Ga0496100_0272426 | Ga0496100_0272426_28_561 | 177 |
| 754 | 3300048903 | Ga0496100_0444036 | Ga0496100_0444036_401_934 | 177 |
| 755 | 3300048904 | Ga0496101_0006702 | Ga0496101_0006702_1601_2134 | 177 |
| 756 | 3300048904 | Ga0496101_0149061 | Ga0496101_0149061_680_1213 | 177 |
| 757 | 3300048904 | Ga0496101_0457958 | Ga0496101_0457958_232_765 | 177 |
| 758 | 3300048905 | Ga0496102_0008253 | Ga0496102_0008253_7794_8327 | 177 |
| 759 | 3300048905 | Ga0496102_0063343 | Ga0496102_0063343_1988_2521 | 177 |
| 760 | 3300048905 | Ga0496102_0181949 | Ga0496102_0181949_440_973 | 177 |
| 761 | 3300048906 | Ga0496103_0014004 | Ga0496103_0014004_2629_3162 | 177 |
| 762 | 3300048906 | Ga0496103_0057089 | Ga0496103_0057089_1789_2322 | 177 |
| 763 | 3300048907 | Ga0496104_0007021 | Ga0496104_0007021_8755_9288 | 177 |
| 764 | 3300048907 | Ga0496104_0307271 | Ga0496104_0307271_174_707 | 177 |
| 765 | 3300048907 | Ga0496104_0597812 | Ga0496104_0597812_157_690 | 177 |
| 766 | 3300048908 | Ga0496105_0029069 | Ga0496105_0029069_2154_2687 | 177 |
| 767 | 3300048908 | Ga0496105_0118125 | Ga0496105_0118125_1457_1990 | 177 |
| 768 | 3300048909 | Ga0496106_0031105 | Ga0496106_0031105_1138_1671 | 177 |
| 769 | 3300048909 | Ga0496106_0530873 | Ga0496106_0530873_198_731 | 177 |
| 770 | 3300048909 | Ga0496106_0853683 | Ga0496106_0853683_130_663 | 177 |
| 771 | 3300048910 | Ga0496107_0017701 | Ga0496107_0017701_2175_2708 | 177 |
| 772 | 3300048910 | Ga0496107_0180696 | Ga0496107_0180696_454_987 | 177 |
| 773 | 3300048910 | Ga0496107_0727413 | Ga0496107_0727413_22_555 | 177 |
| 774 | 3300048911 | Ga0496108_0058486 | Ga0496108_0058486_1107_1640 | 177 |
| 775 | 3300048911 | Ga0496108_0107249 | Ga0496108_0107249_1234_1767 | 177 |
| 776 | 3300048911 | Ga0496108_0568902 | Ga0496108_0568902_95_628 | 177 |
| 777 | 3300048912 | Ga0496109_0082695 | Ga0496109_0082695_1995_2528 | 177 |
| 778 | 3300048912 | Ga0496109_0099702 | Ga0496109_0099702_1305_1838 | 177 |
| 779 | 3300048912 | Ga0496109_0113923 | Ga0496109_0113923_419_952 | 177 |
| 780 | 3300048912 | Ga0496109_0384105 | Ga0496109_0384105_86_619 | 177 |
| 781 | 3300048912 | Ga0496109_0518190 | Ga0496109_0518190_383_916 | 177 |
| 782 | 3300048912 | Ga0496109_1393720 | Ga0496109_1393720_14_547 | 177 |
| 783 | 3300048913 | Ga0496110_0030835 | Ga0496110_0030835_2663_3196 | 177 |
| 784 | 3300048913 | Ga0496110_0160468 | Ga0496110_0160468_1209_1742 | 177 |
| 785 | 3300048914 | Ga0496111_0011827 | Ga0496111_0011827_2980_3513 | 177 |
| 786 | 3300048914 | Ga0496111_0373134 | Ga0496111_0373134_339_872 | 177 |
| 787 | 3300048915 | Ga0496112_0185242 | Ga0496112_0185242_25_558 | 177 |
| 788 | 3300048916 | Ga0496113_0088698 | Ga0496113_0088698_908_1441 | 177 |
| 789 | 3300048917 | Ga0496114_0005056 | Ga0496114_0005056_7252_7785 | 177 |
| 790 | 3300048917 | Ga0496114_0006185 | Ga0496114_0006185_7049_7582 | 177 |
| 791 | 3300048917 | Ga0496114_0172351 | Ga0496114_0172351_216_749 | 177 |
| 792 | 3300048917 | Ga0496114_0194655 | Ga0496114_0194655_1098_1631 | 177 |
| 793 | 3300048918 | Ga0496115_0033907 | Ga0496115_0033907_455_988 | 177 |
| 794 | 3300048918 | Ga0496115_0123165 | Ga0496115_0123165_530_1063 | 177 |
| 795 | 3300049568 | Ga0501031_0001922 | Ga0501031_0001922_3901_4434 | 177 |
| 796 | 3300049568 | Ga0501031_0209414 | Ga0501031_0209414_35_568 | 177 |
| 797 | 3300049568 | Ga0501031_0475227 | Ga0501031_0475227_248_781 | 177 |
| 798 | 3300049569 | Ga0501032_0023340 | Ga0501032_0023340_921_1454 | 177 |
| 799 | 3300049570 | Ga0501033_0020491 | Ga0501033_0020491_3547_4080 | 177 |
| 800 | 3300049570 | Ga0501033_0207271 | Ga0501033_0207271_847_1380 | 177 |
| 801 | 3300049571 | Ga0501034_0036580 | Ga0501034_0036580_1772_2305 | 177 |
| 802 | 3300049572 | Ga0501036_0015282 | Ga0501036_0015282_4844_5377 | 177 |
| 803 | 3300049573 | Ga0501037_0001718 | Ga0501037_0001718_1370_1903 | 177 |
| 804 | 3300049574 | Ga0501038_0019828 | Ga0501038_0019828_4106_4639 | 177 |
| 805 | 3300049575 | Ga0501039_0022477 | Ga0501039_0022477_1248_1781 | 177 |
| 806 | 3300049575 | Ga0501039_0115948 | Ga0501039_0115948_1401_1934 | 177 |
| 807 | 3300049575 | Ga0501039_0258374 | Ga0501039_0258374_139_672 | 177 |
| 808 | 3300049576 | Ga0501040_0176929 | Ga0501040_0176929_63_596 | 177 |
| 809 | 3300049576 | Ga0501040_0213523 | Ga0501040_0213523_86_619 | 177 |
| 810 | 3300049576 | Ga0501040_0314193 | Ga0501040_0314193_548_1081 | 177 |
| 811 | 3300049576 | Ga0501040_0326816 | Ga0501040_0326816_384_917 | 177 |
| 812 | 3300049577 | Ga0501041_0001929 | Ga0501041_0001929_2376_2909 | 177 |
| 813 | 3300049578 | Ga0501042_0007635 | Ga0501042_0007635_6129_6662 | 177 |
| 814 | 3300049579 | Ga0501043_0008410 | Ga0501043_0008410_4106_4639 | 177 |
| 815 | 3300049580 | Ga0501046_0008923 | Ga0501046_0008923_5793_6326 | 177 |
| 816 | 3300049581 | Ga0501047_0136800 | Ga0501047_0136800_779_1312 | 177 |
| 817 | 3300049582 | Ga0501048_0026749 | Ga0501048_0026749_2424_2957 | 177 |
| 818 | 3300049582 | Ga0501048_0034066 | Ga0501048_0034066_2896_3429 | 177 |
| 819 | 3300049583 | Ga0501067_0026731 | Ga0501067_0026731_330_863 | 177 |
| 820 | 3300049584 | Ga0501068_0016129 | Ga0501068_0016129_2824_3357 | 177 |
| 821 | 3300049585 | Ga0501069_0000281 | Ga0501069_0000281_19283_19816 | 177 |
| 822 | 3300049585 | Ga0501069_0073093 | Ga0501069_0073093_938_1471 | 177 |
| 823 | 3300049585 | Ga0501069_0214449 | Ga0501069_0214449_276_809 | 177 |
| 824 | 3300049585 | Ga0501069_0381137 | Ga0501069_0381137_275_808 | 177 |
| 825 | 3300049586 | Ga0501070_0010802 | Ga0501070_0010802_3977_4510 | 177 |
| 826 | 3300049586 | Ga0501070_0234063 | Ga0501070_0234063_934_1467 | 177 |
| 827 | 3300049587 | Ga0501071_0006860 | Ga0501071_0006860_561_1094 | 177 |
| 828 | 3300049587 | Ga0501071_0057394 | Ga0501071_0057394_1610_2143 | 177 |
| 829 | 3300049587 | Ga0501071_0157353 | Ga0501071_0157353_920_1453 | 177 |
| 830 | 3300049587 | Ga0501071_0250313 | Ga0501071_0250313_536_1069 | 177 |
| 831 | 3300049587 | Ga0501071_0513484 | Ga0501071_0513484_253_786 | 177 |
| 832 | 3300049588 | Ga0501072_0001268 | Ga0501072_0001268_7996_8529 | 177 |
| 833 | 3300049588 | Ga0501072_0107030 | Ga0501072_0107030_731_1264 | 177 |
| 834 | 3300049588 | Ga0501072_0273938 | Ga0501072_0273938_364_897 | 177 |
| 835 | 3300049588 | Ga0501072_0289965 | Ga0501072_0289965_440_973 | 177 |
| 836 | 3300049588 | Ga0501072_0807292 | Ga0501072_0807292_52_585 | 177 |
| 837 | 3300049589 | Ga0501073_0012210 | Ga0501073_0012210_1291_1824 | 177 |
| 838 | 3300049590 | Ga0501074_0023738 | Ga0501074_0023738_63_596 | 177 |
| 839 | 3300049590 | Ga0501074_0197734 | Ga0501074_0197734_385_918 | 177 |
| 840 | 3300049591 | Ga0501075_0015752 | Ga0501075_0015752_3984_4517 | 177 |
| 841 | 3300049591 | Ga0501075_0035626 | Ga0501075_0035626_909_1442 | 177 |
| 842 | 3300049591 | Ga0501075_0493070 | Ga0501075_0493070_23_556 | 177 |
| 843 | 3300049592 | Ga0501076_0005603 | Ga0501076_0005603_5155_5688 | 177 |
| 844 | 3300049592 | Ga0501076_0059670 | Ga0501076_0059670_1659_2192 | 177 |
| 845 | 3300049592 | Ga0501076_0813538 | Ga0501076_0813538_94_627 | 177 |
| 846 | 3300049593 | Ga0501077_0010312 | Ga0501077_0010312_3352_3885 | 177 |
| 847 | 3300049593 | Ga0501077_0138018 | Ga0501077_0138018_254_787 | 177 |
| 848 | 3300049593 | Ga0501077_0213669 | Ga0501077_0213669_305_838 | 177 |
| 849 | 3300049741 | Ga0501079_0026369 | Ga0501079_0026369_433_966 | 177 |
| 850 | 3300049741 | Ga0501079_0027015 | Ga0501079_0027015_1072_1605 | 177 |
| 851 | 3300049741 | Ga0501079_0312217 | Ga0501079_0312217_598_1131 | 177 |
| 852 | 3300049742 | Ga0501080_0012586 | Ga0501080_0012586_6097_6630 | 177 |
| 853 | 3300049742 | Ga0501080_0204327 | Ga0501080_0204327_1206_1739 | 177 |
| 854 | 3300049742 | Ga0501080_0320739 | Ga0501080_0320739_799_1332 | 177 |
| 855 | 3300049743 | Ga0501081_0155437 | Ga0501081_0155437_513_1046 | 177 |
| 856 | 3300049743 | Ga0501081_0935705 | Ga0501081_0935705_42_575 | 177 |
| 857 | 3300049744 | Ga0501083_0005072 | Ga0501083_0005072_5950_6483 | 177 |
| 858 | 3300049744 | Ga0501083_0251137 | Ga0501083_0251137_279_812 | 177 |
| 859 | 3300049822 | Ga0501035_0003302 | Ga0501035_0003302_13744_14277 | 177 |
| 860 | 3300049822 | Ga0501035_0308733 | Ga0501035_0308733_167_700 | 177 |
| 861 | 3300049823 | Ga0501044_0153340 | Ga0501044_0153340_1192_1725 | 177 |
| 862 | 3300049824 | Ga0501045_0021888 | Ga0501045_0021888_3481_4014 | 177 |
| 863 | 3300049824 | Ga0501045_0042172 | Ga0501045_0042172_1200_1733 | 177 |
| 864 | 3300050507 | nmdc:mga05p37_47021_c1 | nmdc:mga05p37_47021_c1_1509_2042 | 177 |
| 865 | 3300050507 | nmdc:mga05p37_63542_c1 | nmdc:mga05p37_63542_c1_2052_2585 | 177 |
| 866 | 3300050508 | nmdc:mga09592_94219_c1 | nmdc:mga09592_94219_c1_1779_2312 | 177 |
| 867 | 3300050509 | nmdc:mga0qj67_27322_c1 | nmdc:mga0qj67_27322_c1_1265_1798 | 177 |
| 868 | 3300050511 | nmdc:mga08y16_398239_c1 | nmdc:mga08y16_398239_c1_327_860 | 177 |
| 869 | 3300050511 | nmdc:mga08y16_481751_c1 | nmdc:mga08y16_481751_c1_525_1058 | 177 |
| 870 | 3300050512 | nmdc:mga0n895_106199_c1 | nmdc:mga0n895_106199_c1_325_858 | 177 |
| 871 | 3300050513 | nmdc:mga0rr50_521970_c1 | nmdc:mga0rr50_521970_c1_264_797 | 177 |
| 872 | 3300050514 | nmdc:mga08x19_261282_c1 | nmdc:mga08x19_261282_c1_623_1156 | 177 |
| 873 | 3300050514 | nmdc:mga08x19_691122_c1 | nmdc:mga08x19_691122_c1_107_646 | 177 |
| 874 | 3300053077 | Ga0495601_0012252 | Ga0495601_0012252_454_987 | 177 |
| 875 | 3300053077 | Ga0495601_0015676 | Ga0495601_0015676_3334_3867 | 177 |
| 876 | 3300053077 | Ga0495601_0167766 | Ga0495601_0167766_510_1043 | 177 |
| 877 | 3300053077 | Ga0495601_0244147 | Ga0495601_0244147_348_881 | 177 |
| 878 | 3300053077 | Ga0495601_0297604 | Ga0495601_0297604_162_695 | 177 |
| 879 | 3300053078 | Ga0495612_0095619 | Ga0495612_0095619_360_893 | 177 |
| 880 | 3300053078 | Ga0495612_0110195 | Ga0495612_0110195_491_1024 | 177 |
| 881 | 3300053083 | Ga0495655_0035009 | Ga0495655_0035009_60_593 | 177 |
| 882 | 3300053084 | Ga0495595_0026564 | Ga0495595_0026564_146_679 | 177 |
| 883 | 3300053084 | Ga0495595_0031260 | Ga0495595_0031260_796_1329 | 177 |
| 884 | 3300053085 | Ga0495619_0003592 | Ga0495619_0003592_8981_9514 | 177 |
| 885 | 3300053085 | Ga0495619_0036099 | Ga0495619_0036099_414_947 | 177 |
| 886 | 3300053085 | Ga0495619_0216230 | Ga0495619_0216230_369_902 | 177 |
| 887 | 3300053094 | Ga0500566_0089234 | Ga0500566_0089234_326_859 | 177 |
| 888 | 3300054114 | Ga0501084_0012078 | Ga0501084_0012078_3771_4304 | 177 |
| 889 | 3300054114 | Ga0501084_0040131 | Ga0501084_0040131_1420_1953 | 177 |
| 890 | 3300054114 | Ga0501084_0159974 | Ga0501084_0159974_105_638 | 177 |
| 891 | 3300054114 | Ga0501084_0442662 | Ga0501084_0442662_71_604 | 177 |
| 892 | 3300054114 | Ga0501084_0600101 | Ga0501084_0600101_146_679 | 177 |
| 893 | 3300059424 | Ga0590075_014407 | Ga0590075_014407_231_764 | 177 |
| 894 | 3300059511 | Ga0587091_014186 | Ga0587091_014186_21_554 | 177 |
| 895 | 3300059626 | Ga0587115_049326 | Ga0587115_049326_71_604 | 177 |
| 896 | 3300060353 | Ga0501082_0031405 | Ga0501082_0031405_3984_4517 | 177 |
| 897 | 3300060353 | Ga0501082_0282268 | Ga0501082_0282268_514_1047 | 177 |
| 898 | 3300060353 | Ga0501082_0399182 | Ga0501082_0399182_29_562 | 177 |
| 899 | 3300061719 | Ga0466962_0052638 | Ga0466962_0052638_960_1493 | 177 |
| 900 | 3300061719 | Ga0466962_0061050 | Ga0466962_0061050_745_1278 | 177 |
| 901 | 3300061719 | Ga0466962_0067913 | Ga0466962_0067913_854_1387 | 177 |
| 902 | 3300061719 | Ga0466962_0327486 | Ga0466962_0327486_139_672 | 177 |
| 903 | 3300061734 | Ga0530510_0010209 | Ga0530510_0010209_3352_3885 | 177 |
| 904 | 3300061734 | Ga0530510_0052620 | Ga0530510_0052620_2159_2692 | 177 |
| 905 | 3300061734 | Ga0530510_0130624 | Ga0530510_0130624_938_1471 | 177 |
| 906 | 3300000043 | ARcpr5yngRDRAFT_c012431 | ARcpr5yngRDRAFT_0124312 | 178 |
| 907 | 3300000044 | ARSoilOldRDRAFT_c001158 | ARSoilOldRDRAFT_0011586 | 178 |
| 908 | 3300000652 | ARCol0yngRDRAFT_1001005 | ARCol0yngRDRAFT_10010056 | 178 |
| 909 | 3300001989 | JGI24739J22299_10031625 | JGI24739J22299_100316255 | 178 |
| 910 | 3300002067 | JGI24735J21928_10171835 | JGI24735J21928_101718351 | 178 |
| 911 | 3300005329 | Ga0070683_100184472 | Ga0070683_1001844722 | 178 |
| 912 | 3300005329 | Ga0070683_100308906 | Ga0070683_1003089062 | 178 |
| 913 | 3300005334 | Ga0068869_100491812 | Ga0068869_1004918122 | 178 |
| 914 | 3300005337 | Ga0070682_100226337 | Ga0070682_1002263372 | 178 |
| 915 | 3300005338 | Ga0068868_100523321 | Ga0068868_1005233212 | 178 |
| 916 | 3300005339 | Ga0070660_100518276 | Ga0070660_1005182762 | 178 |
| 917 | 3300005344 | Ga0070661_100370265 | Ga0070661_1003702652 | 178 |
| 918 | 3300005344 | Ga0070661_100633240 | Ga0070661_1006332402 | 178 |
| 919 | 3300005345 | Ga0070692_10022707 | Ga0070692_100227073 | 178 |
| 920 | 3300005347 | Ga0070668_100969449 | Ga0070668_1009694491 | 178 |
| 921 | 3300005353 | Ga0070669_100458555 | Ga0070669_1004585552 | 178 |
| 922 | 3300005354 | Ga0070675_100054439 | Ga0070675_1000544396 | 178 |
| 923 | 3300005354 | Ga0070675_100106705 | Ga0070675_1001067054 | 178 |
| 924 | 3300005354 | Ga0070675_100929320 | Ga0070675_1009293201 | 178 |
| 925 | 3300005366 | Ga0070659_100116007 | Ga0070659_1001160073 | 178 |
| 926 | 3300005444 | Ga0070694_100461334 | Ga0070694_1004613342 | 178 |
| 927 | 3300005456 | Ga0070678_100162368 | Ga0070678_1001623681 | 178 |
| 928 | 3300005457 | Ga0070662_100144820 | Ga0070662_1001448203 | 178 |
| 929 | 3300005457 | Ga0070662_100290847 | Ga0070662_1002908473 | 178 |
| 930 | 3300005530 | Ga0070679_100337405 | Ga0070679_1003374051 | 178 |
| 931 | 3300005535 | Ga0070684_100089974 | Ga0070684_1000899746 | 178 |
| 932 | 3300005535 | Ga0070684_100240626 | Ga0070684_1002406263 | 178 |
| 933 | 3300005539 | Ga0068853_100214281 | Ga0068853_1002142814 | 178 |
| 934 | 3300005543 | Ga0070672_100132695 | Ga0070672_1001326953 | 178 |
| 935 | 3300005544 | Ga0070686_100434402 | Ga0070686_1004344022 | 178 |
| 936 | 3300005547 | Ga0070693_100107157 | Ga0070693_1001071574 | 178 |
| 937 | 3300005834 | Ga0068851_10085219 | Ga0068851_100852193 | 178 |
| 938 | 3300005840 | Ga0068870_10052187 | Ga0068870_100521874 | 178 |
| 939 | 3300005937 | Ga0081455_10040463 | Ga0081455_100404639 | 178 |
| 940 | 3300005937 | Ga0081455_10207841 | Ga0081455_102078413 | 178 |
| 941 | 3300005937 | Ga0081455_10280757 | Ga0081455_102807572 | 178 |
| 942 | 3300005985 | Ga0081539_10000433 | Ga0081539_1000043379 | 178 |
| 943 | 3300006038 | Ga0075365_10179639 | Ga0075365_101796393 | 178 |
| 944 | 3300006038 | Ga0075365_10515393 | Ga0075365_105153932 | 178 |
| 945 | 3300006051 | Ga0075364_10044999 | Ga0075364_100449995 | 178 |
| 946 | 3300006058 | Ga0075432_10001059 | Ga0075432_1000105911 | 178 |
| 947 | 3300006237 | Ga0097621_100382488 | Ga0097621_1003824882 | 178 |
| 948 | 3300006844 | Ga0075428_100006916 | Ga0075428_1000069167 | 178 |
| 949 | 3300006844 | Ga0075428_101513565 | Ga0075428_1015135651 | 178 |
| 950 | 3300006852 | Ga0075433_10061868 | Ga0075433_100618686 | 178 |
| 951 | 3300006880 | Ga0075429_100122353 | Ga0075429_1001223531 | 178 |
| 952 | 3300009094 | Ga0111539_10008690 | Ga0111539_1000869014 | 178 |
| 953 | 3300009094 | Ga0111539_10074113 | Ga0111539_100741133 | 178 |
| 954 | 3300009094 | Ga0111539_11085749 | Ga0111539_110857491 | 178 |
| 955 | 3300009098 | Ga0105245_10106734 | Ga0105245_101067345 | 178 |
| 956 | 3300009098 | Ga0105245_10302976 | Ga0105245_103029763 | 178 |
| 957 | 3300009147 | Ga0114129_10104282 | Ga0114129_101042824 | 178 |
| 958 | 3300009147 | Ga0114129_10771180 | Ga0114129_107711803 | 178 |
| 959 | 3300009148 | Ga0105243_10223874 | Ga0105243_102238743 | 178 |
| 960 | 3300009176 | Ga0105242_10137109 | Ga0105242_101371093 | 178 |
| 961 | 3300009176 | Ga0105242_10156053 | Ga0105242_101560533 | 178 |
| 962 | 3300009177 | Ga0105248_10206586 | Ga0105248_102065864 | 178 |
| 963 | 3300009553 | Ga0105249_10198350 | Ga0105249_101983503 | 178 |
| 964 | 3300009987 | Ga0105030_106641 | Ga0105030_1066412 | 178 |
| 965 | 3300010375 | Ga0105239_10048544 | Ga0105239_100485447 | 178 |
| 966 | 3300010375 | Ga0105239_10256295 | Ga0105239_102562954 | 178 |
| 967 | 3300010375 | Ga0105239_10815453 | Ga0105239_108154532 | 178 |
| 968 | 3300011119 | Ga0105246_10984773 | Ga0105246_109847731 | 178 |
| 969 | 3300013100 | Ga0157373_10450061 | Ga0157373_104500611 | 178 |
| 970 | 3300013296 | Ga0157374_10738143 | Ga0157374_107381432 | 178 |
| 971 | 3300013297 | Ga0157378_10363416 | Ga0157378_103634163 | 178 |
| 972 | 3300013306 | Ga0163162_10580982 | Ga0163162_105809822 | 178 |
| 973 | 3300013306 | Ga0163162_10879949 | Ga0163162_108799492 | 178 |
| 974 | 3300013307 | Ga0157372_10412731 | Ga0157372_104127313 | 178 |
| 975 | 3300013307 | Ga0157372_10483699 | Ga0157372_104836993 | 178 |
| 976 | 3300013308 | Ga0157375_10485398 | Ga0157375_104853982 | 178 |
| 977 | 3300014326 | Ga0157380_10433743 | Ga0157380_104337433 | 178 |
| 978 | 3300014745 | Ga0157377_10600473 | Ga0157377_106004732 | 178 |
| 979 | 3300014745 | Ga0157377_10692806 | Ga0157377_106928062 | 178 |
| 980 | 3300014968 | Ga0157379_10174406 | Ga0157379_101744064 | 178 |
| 981 | 3300014969 | Ga0157376_10470591 | Ga0157376_104705911 | 178 |
| 982 | 3300025899 | Ga0207642_10511485 | Ga0207642_105114851 | 178 |
| 983 | 3300025907 | Ga0207645_10124230 | Ga0207645_101242302 | 178 |
| 984 | 3300025908 | Ga0207643_10052899 | Ga0207643_100528992 | 178 |
| 985 | 3300025919 | Ga0207657_10032320 | Ga0207657_100323209 | 178 |
| 986 | 3300025920 | Ga0207649_10324113 | Ga0207649_103241132 | 178 |
| 987 | 3300025920 | Ga0207649_10737867 | Ga0207649_107378672 | 178 |
| 988 | 3300025921 | Ga0207652_10861220 | Ga0207652_108612202 | 178 |
| 989 | 3300025923 | Ga0207681_10144022 | Ga0207681_101440221 | 178 |
| 990 | 3300025927 | Ga0207687_10294726 | Ga0207687_102947263 | 178 |
| 991 | 3300025927 | Ga0207687_10371103 | Ga0207687_103711032 | 178 |
| 992 | 3300025932 | Ga0207690_10163415 | Ga0207690_101634154 | 178 |
| 993 | 3300025933 | Ga0207706_10174250 | Ga0207706_101742503 | 178 |
| 994 | 3300025933 | Ga0207706_10230165 | Ga0207706_102301653 | 178 |
| 995 | 3300025934 | Ga0207686_10121872 | Ga0207686_101218723 | 178 |
| 996 | 3300025934 | Ga0207686_10144148 | Ga0207686_101441482 | 178 |
| 997 | 3300025935 | Ga0207709_10006045 | Ga0207709_100060458 | 178 |
| 998 | 3300025937 | Ga0207669_10327646 | Ga0207669_103276461 | 178 |
| 999 | 3300025938 | Ga0207704_10376060 | Ga0207704_103760601 | 178 |
| 1000 | 3300025940 | Ga0207691_10071530 | Ga0207691_100715306 | 178 |
| 1001 | 3300025941 | Ga0207711_10342546 | Ga0207711_103425463 | 178 |
| 1002 | 3300025944 | Ga0207661_10029243 | Ga0207661_100292439 | 178 |
| 1003 | 3300025944 | Ga0207661_10190988 | Ga0207661_101909884 | 178 |
| 1004 | 3300025944 | Ga0207661_10546301 | Ga0207661_105463012 | 178 |
| 1005 | 3300025945 | Ga0207679_10050795 | Ga0207679_100507954 | 178 |
| 1006 | 3300025960 | Ga0207651_10313135 | Ga0207651_103131352 | 178 |
| 1007 | 3300025972 | Ga0207668_10201977 | Ga0207668_102019774 | 178 |
| 1008 | 3300025972 | Ga0207668_10345582 | Ga0207668_103455821 | 178 |
| 1009 | 3300026023 | Ga0207677_10550610 | Ga0207677_105506102 | 178 |
| 1010 | 3300026023 | Ga0207677_11573873 | Ga0207677_115738731 | 178 |
| 1011 | 3300026041 | Ga0207639_10084823 | Ga0207639_100848235 | 178 |
| 1012 | 3300026067 | Ga0207678_10039202 | Ga0207678_100392027 | 178 |
| 1013 | 3300026075 | Ga0207708_10039177 | Ga0207708_100391775 | 178 |
| 1014 | 3300026078 | Ga0207702_11047895 | Ga0207702_110478952 | 178 |
| 1015 | 3300026089 | Ga0207648_10891679 | Ga0207648_108916792 | 178 |
| 1016 | 3300026121 | Ga0207683_10058879 | Ga0207683_100588797 | 178 |
| 1017 | 3300026142 | Ga0207698_10741602 | Ga0207698_107416022 | 178 |
| 1018 | 3300027907 | Ga0207428_10000181 | Ga0207428_1000018184 | 178 |
| 1019 | 3300031901 | Ga0307406_10132712 | Ga0307406_101327121 | 178 |
| 1020 | 3300041452 | Ga0451793_1286489 | Ga0451793_1286489_47_583 | 178 |
| 1021 | 3300041456 | Ga0451795_0086528 | Ga0451795_0086528_52_588 | 178 |
| 1022 | 3300041458 | Ga0451798_0303405 | Ga0451798_0303405_43_579 | 178 |
| 1023 | 3300041459 | Ga0451800_0225302 | Ga0451800_0225302_299_835 | 178 |
| 1024 | 3300042122 | Ga0450920_003850 | Ga0450920_003850_371_907 | 178 |
| 1025 | 3300042137 | Ga0450902_032249 | Ga0450902_032249_124_660 | 178 |
| 1026 | 3300042138 | Ga0450903_024523 | Ga0450903_024523_315_851 | 178 |
| 1027 | 3300042147 | Ga0450910_013079 | Ga0450910_013079_414_950 | 178 |
| 1028 | 3300046455 | Ga0495603_0440952 | Ga0495603_0440952_164_700 | 178 |
| 1029 | 3300046459 | Ga0495629_0458389 | Ga0495629_0458389_309_845 | 178 |
| 1030 | 3300046461 | Ga0495641_0324433 | Ga0495641_0324433_95_631 | 178 |
| 1031 | 3300046473 | Ga0495582_0484312 | Ga0495582_0484312_147_683 | 178 |
| 1032 | 3300046476 | Ga0495662_0163504 | Ga0495662_0163504_405_941 | 178 |
| 1033 | 3300046477 | Ga0495664_0073533 | Ga0495664_0073533_1327_1863 | 178 |
| 1034 | 3300046499 | Ga0495594_0603824 | Ga0495594_0603824_11_547 | 178 |
| 1035 | 3300046500 | Ga0495596_0071343 | Ga0495596_0071343_446_982 | 178 |
| 1036 | 3300046511 | Ga0495608_0076168 | Ga0495608_0076168_1567_2103 | 178 |
| 1037 | 3300046517 | Ga0495630_0627798 | Ga0495630_0627798_232_768 | 178 |
| 1038 | 3300046518 | Ga0495631_0259748 | Ga0495631_0259748_109_645 | 178 |
| 1039 | 3300046523 | Ga0495644_0223804 | Ga0495644_0223804_81_617 | 178 |
| 1040 | 3300046533 | Ga0495640_0188659 | Ga0495640_0188659_763_1299 | 178 |
| 1041 | 3300046559 | Ga0495667_0117024 | Ga0495667_0117024_1024_1560 | 178 |
| 1042 | 3300046675 | Ga0495657_0026518 | Ga0495657_0026518_2427_2963 | 178 |
| 1043 | 3300046681 | Ga0495647_0112595 | Ga0495647_0112595_443_979 | 178 |
| 1044 | 3300046690 | Ga0495624_0109404 | Ga0495624_0109404_1035_1571 | 178 |
| 1045 | 3300046690 | Ga0495624_0495574 | Ga0495624_0495574_80_616 | 178 |
| 1046 | 3300046809 | Ga0495600_0366427 | Ga0495600_0366427_14_550 | 178 |
| 1047 | 3300047321 | Ga0495676_0072781 | Ga0495676_0072781_1672_2208 | 178 |
| 1048 | 3300047321 | Ga0495676_0118846 | Ga0495676_0118846_99_635 | 178 |
| 1049 | 3300048904 | Ga0496101_0149940 | Ga0496101_0149940_323_859 | 178 |
| 1050 | 3300048904 | Ga0496101_0285472 | Ga0496101_0285472_305_841 | 178 |
| 1051 | 3300048905 | Ga0496102_0523215 | Ga0496102_0523215_33_569 | 178 |
| 1052 | 3300048907 | Ga0496104_0382082 | Ga0496104_0382082_40_576 | 178 |
| 1053 | 3300048908 | Ga0496105_0198444 | Ga0496105_0198444_566_1102 | 178 |
| 1054 | 3300048908 | Ga0496105_0678076 | Ga0496105_0678076_191_727 | 178 |
| 1055 | 3300048909 | Ga0496106_0232204 | Ga0496106_0232204_419_955 | 178 |
| 1056 | 3300048912 | Ga0496109_0089833 | Ga0496109_0089833_746_1282 | 178 |
| 1057 | 3300048912 | Ga0496109_0480016 | Ga0496109_0480016_71_607 | 178 |
| 1058 | 3300048912 | Ga0496109_1028350 | Ga0496109_1028350_164_700 | 178 |
| 1059 | 3300048913 | Ga0496110_0241280 | Ga0496110_0241280_514_1050 | 178 |
| 1060 | 3300048913 | Ga0496110_0302419 | Ga0496110_0302419_279_815 | 178 |
| 1061 | 3300048914 | Ga0496111_0257450 | Ga0496111_0257450_333_869 | 178 |
| 1062 | 3300048914 | Ga0496111_0508613 | Ga0496111_0508613_138_674 | 178 |
| 1063 | 3300048916 | Ga0496113_0483302 | Ga0496113_0483302_191_727 | 178 |
| 1064 | 3300048917 | Ga0496114_0151150 | Ga0496114_0151150_25_561 | 178 |
| 1065 | 3300048917 | Ga0496114_0361856 | Ga0496114_0361856_518_1054 | 178 |
| 1066 | 3300048917 | Ga0496114_0386754 | Ga0496114_0386754_425_961 | 178 |
| 1067 | 3300049568 | Ga0501031_0068501 | Ga0501031_0068501_1276_1812 | 178 |
| 1068 | 3300049568 | Ga0501031_0091203 | Ga0501031_0091203_994_1530 | 178 |
| 1069 | 3300049569 | Ga0501032_0079859 | Ga0501032_0079859_1260_1796 | 178 |
| 1070 | 3300049570 | Ga0501033_0008979 | Ga0501033_0008979_2811_3347 | 178 |
| 1071 | 3300049570 | Ga0501033_0219796 | Ga0501033_0219796_116_652 | 178 |
| 1072 | 3300049572 | Ga0501036_0057668 | Ga0501036_0057668_1654_2190 | 178 |
| 1073 | 3300049572 | Ga0501036_0148825 | Ga0501036_0148825_1029_1565 | 178 |
| 1074 | 3300049573 | Ga0501037_0018672 | Ga0501037_0018672_1707_2243 | 178 |
| 1075 | 3300049573 | Ga0501037_0334181 | Ga0501037_0334181_18_554 | 178 |
| 1076 | 3300049574 | Ga0501038_0255487 | Ga0501038_0255487_10_546 | 178 |
| 1077 | 3300049574 | Ga0501038_0733596 | Ga0501038_0733596_56_592 | 178 |
| 1078 | 3300049575 | Ga0501039_0007709 | Ga0501039_0007709_1874_2410 | 178 |
| 1079 | 3300049575 | Ga0501039_0467126 | Ga0501039_0467126_24_560 | 178 |
| 1080 | 3300049576 | Ga0501040_0011832 | Ga0501040_0011832_423_959 | 178 |
| 1081 | 3300049576 | Ga0501040_0015710 | Ga0501040_0015710_3791_4327 | 178 |
| 1082 | 3300049576 | Ga0501040_0191955 | Ga0501040_0191955_848_1384 | 178 |
| 1083 | 3300049577 | Ga0501041_0002244 | Ga0501041_0002244_9367_9903 | 178 |
| 1084 | 3300049577 | Ga0501041_0012382 | Ga0501041_0012382_1855_2391 | 178 |
| 1085 | 3300049578 | Ga0501042_0015136 | Ga0501042_0015136_3082_3618 | 178 |
| 1086 | 3300049578 | Ga0501042_0019313 | Ga0501042_0019313_1659_2195 | 178 |
| 1087 | 3300049578 | Ga0501042_0031825 | Ga0501042_0031825_1366_1902 | 178 |
| 1088 | 3300049579 | Ga0501043_0217764 | Ga0501043_0217764_523_1059 | 178 |
| 1089 | 3300049579 | Ga0501043_0281015 | Ga0501043_0281015_662_1198 | 178 |
| 1090 | 3300049580 | Ga0501046_0020980 | Ga0501046_0020980_780_1316 | 178 |
| 1091 | 3300049580 | Ga0501046_0057062 | Ga0501046_0057062_562_1098 | 178 |
| 1092 | 3300049580 | Ga0501046_0325560 | Ga0501046_0325560_401_937 | 178 |
| 1093 | 3300049581 | Ga0501047_0479348 | Ga0501047_0479348_391_927 | 178 |
| 1094 | 3300049582 | Ga0501048_0015470 | Ga0501048_0015470_23_559 | 178 |
| 1095 | 3300049582 | Ga0501048_0039880 | Ga0501048_0039880_1113_1649 | 178 |
| 1096 | 3300049582 | Ga0501048_0052687 | Ga0501048_0052687_279_815 | 178 |
| 1097 | 3300049584 | Ga0501068_0002839 | Ga0501068_0002839_6277_6813 | 178 |
| 1098 | 3300049584 | Ga0501068_0029609 | Ga0501068_0029609_388_924 | 178 |
| 1099 | 3300049584 | Ga0501068_0170713 | Ga0501068_0170713_347_883 | 178 |
| 1100 | 3300049585 | Ga0501069_0036892 | Ga0501069_0036892_1108_1644 | 178 |
| 1101 | 3300049585 | Ga0501069_0085775 | Ga0501069_0085775_438_974 | 178 |
| 1102 | 3300049586 | Ga0501070_0035611 | Ga0501070_0035611_1682_2218 | 178 |
| 1103 | 3300049587 | Ga0501071_0001083 | Ga0501071_0001083_6471_7007 | 178 |
| 1104 | 3300049587 | Ga0501071_0004817 | Ga0501071_0004817_7631_8167 | 178 |
| 1105 | 3300049587 | Ga0501071_0064544 | Ga0501071_0064544_1241_1777 | 178 |
| 1106 | 3300049588 | Ga0501072_0010632 | Ga0501072_0010632_4645_5181 | 178 |
| 1107 | 3300049588 | Ga0501072_0016036 | Ga0501072_0016036_560_1096 | 178 |
| 1108 | 3300049588 | Ga0501072_0087000 | Ga0501072_0087000_1716_2252 | 178 |
| 1109 | 3300049589 | Ga0501073_0008765 | Ga0501073_0008765_552_1088 | 178 |
| 1110 | 3300049590 | Ga0501074_0003320 | Ga0501074_0003320_1727_2263 | 178 |
| 1111 | 3300049590 | Ga0501074_0036342 | Ga0501074_0036342_467_1003 | 178 |
| 1112 | 3300049590 | Ga0501074_0070993 | Ga0501074_0070993_1378_1914 | 178 |
| 1113 | 3300049591 | Ga0501075_0002651 | Ga0501075_0002651_6079_6615 | 178 |
| 1114 | 3300049591 | Ga0501075_0003018 | Ga0501075_0003018_9753_10289 | 178 |
| 1115 | 3300049591 | Ga0501075_0146035 | Ga0501075_0146035_837_1373 | 178 |
| 1116 | 3300049592 | Ga0501076_0001626 | Ga0501076_0001626_1280_1816 | 178 |
| 1117 | 3300049592 | Ga0501076_0040146 | Ga0501076_0040146_863_1399 | 178 |
| 1118 | 3300049593 | Ga0501077_0001393 | Ga0501077_0001393_5721_6257 | 178 |
| 1119 | 3300049593 | Ga0501077_0005398 | Ga0501077_0005398_4769_5305 | 178 |
| 1120 | 3300049593 | Ga0501077_0018672 | Ga0501077_0018672_140_676 | 178 |
| 1121 | 3300049741 | Ga0501079_0008393 | Ga0501079_0008393_5858_6394 | 178 |
| 1122 | 3300049741 | Ga0501079_0051929 | Ga0501079_0051929_972_1508 | 178 |
| 1123 | 3300049741 | Ga0501079_0079460 | Ga0501079_0079460_941_1477 | 178 |
| 1124 | 3300049741 | Ga0501079_1230235 | Ga0501079_1230235_42_578 | 178 |
| 1125 | 3300049742 | Ga0501080_0016472 | Ga0501080_0016472_1697_2233 | 178 |
| 1126 | 3300049742 | Ga0501080_0030844 | Ga0501080_0030844_2739_3275 | 178 |
| 1127 | 3300049742 | Ga0501080_0048644 | Ga0501080_0048644_2205_2741 | 178 |
| 1128 | 3300049743 | Ga0501081_0004393 | Ga0501081_0004393_1645_2181 | 178 |
| 1129 | 3300049743 | Ga0501081_0028999 | Ga0501081_0028999_676_1212 | 178 |
| 1130 | 3300049743 | Ga0501081_0084466 | Ga0501081_0084466_1028_1564 | 178 |
| 1131 | 3300049744 | Ga0501083_0035316 | Ga0501083_0035316_313_849 | 178 |
| 1132 | 3300049822 | Ga0501035_0773721 | Ga0501035_0773721_211_747 | 178 |
| 1133 | 3300049823 | Ga0501044_0400241 | Ga0501044_0400241_193_729 | 178 |
| 1134 | 3300049824 | Ga0501045_0009478 | Ga0501045_0009478_4554_5090 | 178 |
| 1135 | 3300049824 | Ga0501045_0028964 | Ga0501045_0028964_827_1363 | 178 |
| 1136 | 3300050491 | nmdc:mga00v17_29338_c1 | nmdc:mga00v17_29338_c1_1679_2215 | 178 |
| 1137 | 3300050492 | nmdc:mga0yw44_147904_c1 | nmdc:mga0yw44_147904_c1_822_1358 | 178 |
| 1138 | 3300050494 | nmdc:mga06z11_49760_c1 | nmdc:mga06z11_49760_c1_822_1358 | 178 |
| 1139 | 3300050507 | nmdc:mga05p37_48463_c1 | nmdc:mga05p37_48463_c1_918_1454 | 178 |
| 1140 | 3300050507 | nmdc:mga05p37_639709_c1 | nmdc:mga05p37_639709_c1_294_830 | 178 |
| 1141 | 3300050507 | nmdc:mga05p37_681750_c1 | nmdc:mga05p37_681750_c1_578_1114 | 178 |
| 1142 | 3300050508 | nmdc:mga09592_45593_c1 | nmdc:mga09592_45593_c1_1111_1647 | 178 |
| 1143 | 3300050510 | nmdc:mga06r32_153768_c1 | nmdc:mga06r32_153768_c1_745_1281 | 178 |
| 1144 | 3300050511 | nmdc:mga08y16_125036_c1 | nmdc:mga08y16_125036_c1_712_1248 | 178 |
| 1145 | 3300050515 | nmdc:mga0a205_62900_c1 | nmdc:mga0a205_62900_c1_2533_3069 | 178 |
| 1146 | 3300053078 | Ga0495612_0098364 | Ga0495612_0098364_391_927 | 178 |
| 1147 | 3300053083 | Ga0495655_0021716 | Ga0495655_0021716_596_1132 | 178 |
| 1148 | 3300054114 | Ga0501084_0005571 | Ga0501084_0005571_1486_2022 | 178 |
| 1149 | 3300054114 | Ga0501084_0046874 | Ga0501084_0046874_1818_2354 | 178 |
| 1150 | 3300054114 | Ga0501084_0305995 | Ga0501084_0305995_131_667 | 178 |
| 1151 | 3300054114 | Ga0501084_0308775 | Ga0501084_0308775_155_691 | 178 |
| 1152 | 3300060353 | Ga0501082_0021659 | Ga0501082_0021659_3146_3682 | 178 |
| 1153 | 3300060353 | Ga0501082_0049398 | Ga0501082_0049398_1480_2016 | 178 |
| 1154 | 3300060353 | Ga0501082_0084830 | Ga0501082_0084830_1520_2056 | 178 |
| 1155 | 3300061734 | Ga0530510_0032518 | Ga0530510_0032518_1557_2093 | 178 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nhn-assembly1.cif.gz_K | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9734 | 9 | 173 |
| 5li0-assembly1.cif.gz_H | 70s ribosome from staphylococcus aureus | 0.9685 | 9 | 172 |
| 4v9b-assembly1.cif.gz_BH | crystal structure of the 70s ribosome with tigecycline. | 0.9639 | 2 | 171 |
| 6boh-assembly2.cif.gz_NB | antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome | 0.9635 | 2 | 176 |
| 7nhn-assembly1.cif.gz_K | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9619 | 9 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3knmH02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9618 | 84 | 169 | 3.90.930.12 |
| af_Q09865_118_210_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9569 | 84 | 174 | 3.90.930.12 |
| 1vw4F02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9514 | 84 | 171 | 3.90.930.12 |
| 3knmH02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.951 | 84 | 169 | 3.90.930.12 |
| 4qcxH01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.941 | 2 | 80 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A358FVP3-F1-model_v4 | 50S ribosomal protein L6 | 0.9962 | 82 | 162 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A357CQG9-F1-model_v4 | 50S ribosomal protein L6 | 0.9938 | 52 | 162 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-X1G5X1-F1-model_v4 | Large ribosomal subunit protein uL6 alpha-beta domain-containing protein | 0.9916 | 83 | 155 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A2J1D431-F1-model_v4 | deleted | 0.9803 | 74 | 169 |
|
| AF-A0A2J6L7U4-F1-model_v4 | deleted | 0.9802 | 83 | 165 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar