F490924

General Info

Members Datasets Scaffolds Average Seq Length
1155 385 1152 171

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0599685|Ga0436364_0599685_295_870
Length 191
Sequence MSRIGRQPIPVPAGVDITVDGGQITVKGPKGTLSRPLRPEVSIRRENGTLYVDRNGDNKTERAMHGLSRTLVNNMVVGVTQGYQKVLEISGVGYRATKQGSDLQLSVGYSHPVLIAPRPGIEFEVGQDVNTRAPIITVRGIDKEVVGQTAAEVRSVRKPEPYKGKGIRYQGEIIRRKAGKSAKAGGKGGKK

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
178 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
184 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
219 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
229 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
230 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
231 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
232 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
233 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
234 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
235 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
361 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
385 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.61
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 6.32
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c012431 3300000043 Bacteria 718
2 ARSoilOldRDRAFT_c001158 3300000044 Bacteria 2527
3 ARCol0yngRDRAFT_1001005 3300000652 Bacteria 2475
4 JGI24739J22299_10031625 3300001989 Unclassified 1827
5 JGI24735J21928_10171835 3300002067 Unclassified 627
6 JGI25407J50210_10006859 3300003373 Bacteria 2845
7 Ga0070683_100053944 3300005329 Bacteria 3726
8 Ga0070683_100184472 3300005329 Bacteria 1980
9 Ga0070683_100308906 3300005329 Bacteria 1504
10 Ga0070683_101062045 3300005329 Bacteria 778
11 Ga0070670_100002726 3300005331 Bacteria 14597
12 Ga0070670_100091757 3300005331 Bacteria 2611
13 Ga0068869_100022221 3300005334 Bacteria 4369
14 Ga0068869_100491812 3300005334 Bacteria 1023
15 Ga0070680_100098314 3300005336 Bacteria 2427
16 Ga0070680_100123282 3300005336 Bacteria 2164
17 Ga0070682_100189583 3300005337 Bacteria 1443
18 Ga0070682_100226337 3300005337 Bacteria 1334
19 Ga0070682_100727505 3300005337 Bacteria 799
20 Ga0068868_100098882 3300005338 Bacteria 2360
21 Ga0068868_100523321 3300005338 Bacteria 1041
22 Ga0070660_100518276 3300005339 Bacteria 993
23 Ga0070660_100766323 3300005339 Bacteria 811
24 Ga0070691_10030122 3300005341 Bacteria 2541
25 Ga0070687_100073999 3300005343 Bacteria 1838
26 Ga0070661_100040522 3300005344 Bacteria 3398
27 Ga0070661_100370265 3300005344 Bacteria 1128
28 Ga0070661_100633240 3300005344 Bacteria 867
29 Ga0070692_10022707 3300005345 Bacteria 3067
30 Ga0070668_100969449 3300005347 Bacteria 763
31 Ga0070669_100458555 3300005353 Bacteria 1052
32 Ga0070675_100054439 3300005354 Bacteria 3292
33 Ga0070675_100106705 3300005354 Bacteria 2364
34 Ga0070675_100929320 3300005354 Bacteria 798
35 Ga0070671_100068504 3300005355 Bacteria 2960
36 Ga0070671_100107077 3300005355 Bacteria 2347
37 Ga0070671_100894008 3300005355 Bacteria 776
38 Ga0070674_100106394 3300005356 Bacteria 2053
39 Ga0070674_100336072 3300005356 Bacteria 1215
40 Ga0070674_100604946 3300005356 Bacteria 927
41 Ga0070673_100009174 3300005364 Bacteria 6630
42 Ga0070688_100010080 3300005365 Bacteria 5195
43 Ga0070659_100116007 3300005366 Bacteria 2165
44 Ga0070659_100461407 3300005366 Bacteria 1079
45 Ga0070709_10017436 3300005434 Bacteria 4119
46 Ga0070714_100023042 3300005435 Bacteria 5111
47 Ga0070714_100138461 3300005435 Bacteria 2182
48 Ga0070714_100171566 3300005435 Bacteria 1968
49 Ga0070714_100542659 3300005435 Bacteria 1112
50 Ga0070714_101254020 3300005435 Bacteria 723
51 Ga0070713_100001889 3300005436 Bacteria 13509
52 Ga0070713_100035918 3300005436 Bacteria 3994
53 Ga0070713_100163538 3300005436 Bacteria 1988
54 Ga0070710_10010919 3300005437 Bacteria 4473
55 Ga0070710_10055055 3300005437 Bacteria 2246
56 Ga0070711_100175072 3300005439 Bacteria 1638
57 Ga0070711_100258287 3300005439 Bacteria 1369
58 Ga0070711_100961031 3300005439 Bacteria 731
59 Ga0070705_100023560 3300005440 Bacteria 3308
60 Ga0070700_100048730 3300005441 Bacteria 2627
61 Ga0070694_100095994 3300005444 Bacteria 2089
62 Ga0070694_100461334 3300005444 Bacteria 1005
63 Ga0070708_100361595 3300005445 Bacteria 1368
64 Ga0070678_100162368 3300005456 Bacteria 1811
65 Ga0070678_100651518 3300005456 Bacteria 945
66 Ga0070678_100691956 3300005456 Bacteria 918
67 Ga0070678_100943477 3300005456 Bacteria 791
68 Ga0070662_100144820 3300005457 Bacteria 1845
69 Ga0070662_100290847 3300005457 Bacteria 1325
70 Ga0070662_100377263 3300005457 Bacteria 1167
71 Ga0070662_101042223 3300005457 Bacteria 701
72 Ga0070681_10015900 3300005458 Bacteria 7503
73 Ga0070681_10154710 3300005458 Bacteria 2218
74 Ga0068867_100768082 3300005459 Bacteria 857
75 Ga0070685_10005868 3300005466 Bacteria 6247
76 Ga0070707_100001557 3300005468 Bacteria 22299
77 Ga0070699_100149836 3300005518 Bacteria 2062
78 Ga0070679_100029555 3300005530 Bacteria 5407
79 Ga0070679_100337405 3300005530 Bacteria 1455
80 Ga0070684_100022860 3300005535 Bacteria 5220
81 Ga0070684_100089974 3300005535 Bacteria 2728
82 Ga0070684_100156385 3300005535 Bacteria 2067
83 Ga0070684_100240626 3300005535 Bacteria 1653
84 Ga0070684_100402869 3300005535 Bacteria 1261
85 Ga0068853_100214281 3300005539 Bacteria 1756
86 Ga0068853_100284547 3300005539 Bacteria 1525
87 Ga0070672_100064211 3300005543 Bacteria 2900
88 Ga0070672_100132695 3300005543 Bacteria 2048
89 Ga0070686_100434402 3300005544 Bacteria 1006
90 Ga0070695_100001595 3300005545 Bacteria 12688
91 Ga0070696_100198203 3300005546 Bacteria 1498
92 Ga0070693_100107157 3300005547 Bacteria 1712
93 Ga0070704_100191887 3300005549 Bacteria 1643
94 Ga0070704_100340969 3300005549 Bacteria 1262
95 Ga0068855_100939809 3300005563 Bacteria 911
96 Ga0070664_100007134 3300005564 Bacteria 9012
97 Ga0068857_100035784 3300005577 Bacteria 4398
98 Ga0068857_100138893 3300005577 Bacteria 2196
99 Ga0068857_100222749 3300005577 Bacteria 1723
100 Ga0068856_100056684 3300005614 Bacteria 3867
101 Ga0068856_100432985 3300005614 Bacteria 1335
102 Ga0068856_100601606 3300005614 Bacteria 1120
103 Ga0070702_100014750 3300005615 Bacteria 3972
104 Ga0070702_100242311 3300005615 Bacteria 1217
105 Ga0068852_100215349 3300005616 Bacteria 1824
106 Ga0068859_100194972 3300005617 Bacteria 2110
107 Ga0068864_100008046 3300005618 Bacteria 8696
108 Ga0068864_100145545 3300005618 Bacteria 2142
109 Ga0068866_10047907 3300005718 Bacteria 2158
110 Ga0068851_10085219 3300005834 Bacteria 1656
111 Ga0068870_10040559 3300005840 Bacteria 2414
112 Ga0068870_10052187 3300005840 Bacteria 2167
113 Ga0068870_10073954 3300005840 Bacteria 1865
114 Ga0068870_10129624 3300005840 Bacteria 1463
115 Ga0068863_100246016 3300005841 Bacteria 1727
116 Ga0068862_100860677 3300005844 Bacteria 889
117 Ga0081455_10013977 3300005937 Bacteria 7890
118 Ga0081455_10040463 3300005937 Bacteria 4109
119 Ga0081455_10050855 3300005937 Bacteria 3559
120 Ga0081455_10207841 3300005937 Bacteria 1461
121 Ga0081455_10280757 3300005937 Bacteria 1203
122 Ga0081538_10000515 3300005981 Bacteria 43219
123 Ga0081538_10139009 3300005981 Bacteria 1124
124 Ga0081539_10000433 3300005985 Bacteria 89118
125 Ga0070717_10012019 3300006028 Bacteria 6593
126 Ga0070717_10024999 3300006028 Bacteria 4744
127 Ga0070717_10032247 3300006028 Bacteria 4221
128 Ga0070717_10069262 3300006028 Bacteria 2938
129 Ga0070717_10190202 3300006028 Bacteria 1793
130 Ga0070717_10575879 3300006028 Bacteria 1020
131 Ga0075365_10179639 3300006038 Bacteria 1479
132 Ga0075365_10515393 3300006038 Bacteria 845
133 Ga0075365_10618456 3300006038 Bacteria 766
134 Ga0075364_10044999 3300006051 Bacteria 2872
135 Ga0075432_10001059 3300006058 Bacteria 8769
136 Ga0070715_10009632 3300006163 Bacteria 3412
137 Ga0070716_100028679 3300006173 Bacteria 3001
138 Ga0070716_100047618 3300006173 Bacteria 2419
139 Ga0070712_100093717 3300006175 Bacteria 2205
140 Ga0070712_100107998 3300006175 Bacteria 2071
141 Ga0070712_100196031 3300006175 Bacteria 1583
142 Ga0097621_100382488 3300006237 Bacteria 1257
143 Ga0075428_100006916 3300006844 Bacteria 12599
144 Ga0075428_100634603 3300006844 Bacteria 1140
145 Ga0075428_100662417 3300006844 Bacteria 1113
146 Ga0075428_101513565 3300006844 Bacteria 703
147 Ga0075430_100236322 3300006846 Bacteria 1515
148 Ga0075431_100004224 3300006847 Bacteria 14071
149 Ga0075431_100145840 3300006847 Bacteria 2439
150 Ga0075433_10061868 3300006852 Bacteria 3279
151 Ga0075433_10453679 3300006852 Bacteria 1130
152 Ga0075429_100011161 3300006880 Bacteria 7778
153 Ga0075429_100122353 3300006880 Bacteria 2275
154 Ga0075429_100140179 3300006880 Bacteria 2116
155 Ga0068865_100076824 3300006881 Bacteria 2385
156 Ga0075436_100438644 3300006914 Bacteria 950
157 Ga0097620_100194983 3300006931 Bacteria 2110
158 Ga0105240_10134085 3300009093 Bacteria 2967
159 Ga0105240_10689056 3300009093 Bacteria 1116
160 Ga0111539_10008690 3300009094 Bacteria 12890
161 Ga0111539_10065262 3300009094 Bacteria 4302
162 Ga0111539_10074113 3300009094 Bacteria 4011
163 Ga0111539_10665582 3300009094 Bacteria 1212
164 Ga0111539_10998168 3300009094 Bacteria 973
165 Ga0111539_11085749 3300009094 Bacteria 930
166 Ga0105245_10050741 3300009098 Bacteria 3719
167 Ga0105245_10106734 3300009098 Bacteria 2599
168 Ga0105245_10302976 3300009098 Bacteria 1569
169 Ga0105247_10331647 3300009101 Bacteria 1064
170 Ga0114129_10035990 3300009147 Bacteria 6992
171 Ga0114129_10104282 3300009147 Bacteria 3918
172 Ga0114129_10154347 3300009147 Bacteria 3141
173 Ga0114129_10211509 3300009147 Bacteria 2621
174 Ga0114129_10220001 3300009147 Bacteria 2562
175 Ga0114129_10771180 3300009147 Bacteria 1229
176 Ga0105243_10120150 3300009148 Bacteria 2214
177 Ga0105243_10223874 3300009148 Bacteria 1665
178 Ga0105243_10244316 3300009148 Bacteria 1599
179 Ga0105242_10017261 3300009176 Bacteria 5621
180 Ga0105242_10019594 3300009176 Bacteria 5302
181 Ga0105242_10137109 3300009176 Bacteria 2119
182 Ga0105242_10156053 3300009176 Bacteria 1994
183 Ga0105248_10206586 3300009177 Bacteria 2213
184 Ga0105248_10266891 3300009177 Bacteria 1927
185 Ga0105248_10914761 3300009177 Bacteria 991
186 Ga0105237_10429166 3300009545 Bacteria 1327
187 Ga0105238_10270169 3300009551 Bacteria 1681
188 Ga0105249_10198350 3300009553 Bacteria 1963
189 Ga0105030_106641 3300009987 Bacteria 983
190 Ga0105239_10048544 3300010375 Bacteria 4655
191 Ga0105239_10256295 3300010375 Bacteria 1965
192 Ga0105239_10294777 3300010375 Bacteria 1826
193 Ga0105239_10815453 3300010375 Bacteria 1069
194 Ga0105239_11633232 3300010375 Bacteria 746
195 Ga0105246_10260717 3300011119 Bacteria 1381
196 Ga0105246_10349304 3300011119 Bacteria 1211
197 Ga0105246_10353928 3300011119 Bacteria 1204
198 Ga0105246_10984773 3300011119 Bacteria 762
199 Ga0157315_1004064 3300012508 Bacteria 1025
200 Ga0157373_10450061 3300013100 Bacteria 927
201 Ga0157369_10035022 3300013105 Bacteria 5506
202 Ga0157374_10575437 3300013296 Bacteria 1135
203 Ga0157374_10738143 3300013296 Bacteria 999
204 Ga0157374_11753115 3300013296 Bacteria 646
205 Ga0157378_10363416 3300013297 Bacteria 1417
206 Ga0163162_10580982 3300013306 Bacteria 1247
207 Ga0163162_10879949 3300013306 Bacteria 1010
208 Ga0163162_11547895 3300013306 Bacteria 756
209 Ga0157372_10048166 3300013307 Bacteria 4737
210 Ga0157372_10370753 3300013307 Bacteria 1668
211 Ga0157372_10412731 3300013307 Bacteria 1573
212 Ga0157372_10483699 3300013307 Bacteria 1443
213 Ga0157372_11145923 3300013307 Bacteria 899
214 Ga0157375_10047233 3300013308 Bacteria 4203
215 Ga0157375_10485398 3300013308 Bacteria 1400
216 Ga0163163_10356316 3300014325 Bacteria 1519
217 Ga0157380_10094813 3300014326 Bacteria 2471
218 Ga0157380_10433743 3300014326 Bacteria 1257
219 Ga0157380_10462836 3300014326 Bacteria 1221
220 Ga0182008_10247557 3300014497 Bacteria 919
221 Ga0182008_10618451 3300014497 Bacteria 610
222 Ga0157377_10045735 3300014745 Bacteria 2446
223 Ga0157377_10600473 3300014745 Bacteria 785
224 Ga0157377_10692806 3300014745 Bacteria 739
225 Ga0157379_10174406 3300014968 Bacteria 1941
226 Ga0157379_10689001 3300014968 Bacteria 959
227 Ga0157376_10126357 3300014969 Bacteria 2275
228 Ga0157376_10470591 3300014969 Bacteria 1229
229 Ga0157376_10709745 3300014969 Bacteria 1011
230 Ga0163161_10391273 3300017792 Bacteria 1113
231 Ga0206356_10473551 3300020070 Bacteria 1155
232 Ga0213871_10031694 3300021441 Bacteria 1382
233 Ga0224712_10064454 3300022467 Bacteria 1470
234 Ga0224712_10168148 3300022467 Bacteria 982
235 Ga0207692_10034920 3300025898 Bacteria 2438
236 Ga0207692_10420172 3300025898 Bacteria 837
237 Ga0207692_10455059 3300025898 Bacteria 806
238 Ga0207642_10033564 3300025899 Bacteria 2173
239 Ga0207642_10511485 3300025899 Bacteria 737
240 Ga0207710_10269904 3300025900 Bacteria 854
241 Ga0207688_10000094 3300025901 Bacteria 34655
242 Ga0207685_10421115 3300025905 Bacteria 689
243 Ga0207699_10022230 3300025906 Bacteria 3433
244 Ga0207699_10933990 3300025906 Bacteria 640
245 Ga0207645_10124230 3300025907 Bacteria 1677
246 Ga0207643_10012632 3300025908 Bacteria 4561
247 Ga0207643_10018007 3300025908 Bacteria 3868
248 Ga0207643_10019179 3300025908 Bacteria 3747
249 Ga0207643_10052899 3300025908 Bacteria 2307
250 Ga0207684_10061237 3300025910 Bacteria 3196
251 Ga0207707_10108421 3300025912 Bacteria 2428
252 Ga0207707_10214293 3300025912 Bacteria 1677
253 Ga0207695_10443156 3300025913 Bacteria 1182
254 Ga0207695_10608670 3300025913 Bacteria 974
255 Ga0207695_10758460 3300025913 Bacteria 850
256 Ga0207671_10102167 3300025914 Bacteria 2173
257 Ga0207693_10009230 3300025915 Bacteria 8052
258 Ga0207693_10163875 3300025915 Bacteria 1750
259 Ga0207693_10245231 3300025915 Bacteria 1406
260 Ga0207663_10007294 3300025916 Bacteria 5724
261 Ga0207663_10137312 3300025916 Bacteria 1699
262 Ga0207662_10016896 3300025918 Bacteria 4122
263 Ga0207662_10484022 3300025918 Bacteria 850
264 Ga0207657_10009472 3300025919 Bacteria 9785
265 Ga0207657_10032320 3300025919 Bacteria 4730
266 Ga0207649_10324113 3300025920 Bacteria 1133
267 Ga0207649_10737867 3300025920 Bacteria 766
268 Ga0207652_10096320 3300025921 Bacteria 2607
269 Ga0207652_10861220 3300025921 Bacteria 802
270 Ga0207646_10000851 3300025922 Bacteria 39515
271 Ga0207681_10144022 3300025923 Bacteria 1778
272 Ga0207694_10075978 3300025924 Bacteria 2630
273 Ga0207650_10018684 3300025925 Bacteria 4867
274 Ga0207650_10030694 3300025925 Bacteria 3874
275 Ga0207659_10046963 3300025926 Bacteria 3052
276 Ga0207687_10109632 3300025927 Bacteria 2045
277 Ga0207687_10294726 3300025927 Bacteria 1305
278 Ga0207687_10371103 3300025927 Bacteria 1170
279 Ga0207687_10614904 3300025927 Bacteria 917
280 Ga0207700_10000001 3300025928 Bacteria 1122509
281 Ga0207700_10045665 3300025928 Bacteria 3234
282 Ga0207700_10047734 3300025928 Bacteria 3175
283 Ga0207664_10025458 3300025929 Bacteria 4459
284 Ga0207664_10038854 3300025929 Bacteria 3692
285 Ga0207664_10096443 3300025929 Bacteria 2434
286 Ga0207664_10137050 3300025929 Bacteria 2066
287 Ga0207664_10194359 3300025929 Bacteria 1748
288 Ga0207664_10204157 3300025929 Bacteria 1707
289 Ga0207644_10164705 3300025931 Bacteria 1726
290 Ga0207644_10822363 3300025931 Bacteria 777
291 Ga0207690_10163415 3300025932 Bacteria 1662
292 Ga0207690_10697385 3300025932 Bacteria 834
293 Ga0207706_10174250 3300025933 Bacteria 1890
294 Ga0207706_10230165 3300025933 Bacteria 1622
295 Ga0207686_10121872 3300025934 Bacteria 1776
296 Ga0207686_10144148 3300025934 Bacteria 1650
297 Ga0207709_10006045 3300025935 Bacteria 6820
298 Ga0207709_10056512 3300025935 Bacteria 2429
299 Ga0207709_10260242 3300025935 Bacteria 1272
300 Ga0207669_10075819 3300025937 Bacteria 2132
301 Ga0207669_10327646 3300025937 Bacteria 1175
302 Ga0207669_10428016 3300025937 Bacteria 1043
303 Ga0207704_10071929 3300025938 Bacteria 2196
304 Ga0207704_10335079 3300025938 Bacteria 1172
305 Ga0207704_10376060 3300025938 Bacteria 1114
306 Ga0207665_10000058 3300025939 Bacteria 72882
307 Ga0207665_10549878 3300025939 Bacteria 897
308 Ga0207691_10071530 3300025940 Bacteria 3130
309 Ga0207691_10781154 3300025940 Bacteria 803
310 Ga0207711_10110013 3300025941 Bacteria 2449
311 Ga0207711_10254679 3300025941 Bacteria 1613
312 Ga0207711_10342546 3300025941 Bacteria 1384
313 Ga0207689_10032263 3300025942 Bacteria 4358
314 Ga0207689_10663114 3300025942 Bacteria 879
315 Ga0207661_10029243 3300025944 Bacteria 4230
316 Ga0207661_10190988 3300025944 Bacteria 1795
317 Ga0207661_10546301 3300025944 Bacteria 1061
318 Ga0207661_10863333 3300025944 Bacteria 833
319 Ga0207679_10050795 3300025945 Bacteria 3032
320 Ga0207679_10054481 3300025945 Bacteria 2945
321 Ga0207679_10092595 3300025945 Bacteria 2342
322 Ga0207667_10381044 3300025949 Bacteria 1437
323 Ga0207651_10313135 3300025960 Bacteria 1310
324 Ga0207668_10201977 3300025972 Bacteria 1584
325 Ga0207668_10345582 3300025972 Bacteria 1242
326 Ga0207640_10191544 3300025981 Bacteria 1542
327 Ga0207677_10468320 3300026023 Bacteria 1083
328 Ga0207677_10550610 3300026023 Bacteria 1005
329 Ga0207677_11573873 3300026023 Bacteria 608
330 Ga0207639_10084823 3300026041 Bacteria 2517
331 Ga0207639_11048843 3300026041 Bacteria 764
332 Ga0207678_10039202 3300026067 Bacteria 4112
333 Ga0207708_10039177 3300026075 Bacteria 3610
334 Ga0207708_10490920 3300026075 Bacteria 1028
335 Ga0207702_11047895 3300026078 Bacteria 809
336 Ga0207641_10235360 3300026088 Bacteria 1704
337 Ga0207641_11482352 3300026088 Bacteria 680
338 Ga0207648_10042703 3300026089 Bacteria 3980
339 Ga0207648_10780212 3300026089 Bacteria 889
340 Ga0207648_10891679 3300026089 Bacteria 830
341 Ga0207676_10113884 3300026095 Bacteria 2268
342 Ga0207674_10055770 3300026116 Bacteria 4016
343 Ga0207674_10153021 3300026116 Bacteria 2263
344 Ga0207675_100553554 3300026118 Bacteria 1150
345 Ga0207683_10058879 3300026121 Bacteria 3373
346 Ga0207683_10161304 3300026121 Bacteria 2027
347 Ga0207683_10221925 3300026121 Bacteria 1722
348 Ga0207698_10741602 3300026142 Bacteria 980
349 Ga0207698_11902535 3300026142 Bacteria 610
350 Ga0207428_10000181 3300027907 Bacteria 88299
351 Ga0207428_10019256 3300027907 Bacteria 5820
352 Ga0207428_10320405 3300027907 Bacteria 1145
353 Ga0207428_10512868 3300027907 Bacteria 870
354 Ga0268266_10043001 3300028379 Bacteria 3860
355 Ga0268265_10526911 3300028380 Bacteria 1118
356 Ga0265337_1061382 3300028556 Bacteria 1042
357 Ga0265334_10010285 3300028573 Bacteria 3949
358 Ga0265322_10062119 3300028654 Bacteria 1060
359 Ga0265336_10001318 3300028666 Bacteria 11596
360 Ga0265338_10012206 3300028800 Bacteria 9811
361 Ga0265327_10035110 3300031251 Bacteria 2776
362 Ga0265313_10050529 3300031595 Bacteria 1994
363 Ga0307406_10132712 3300031901 Bacteria 1751
364 Ga0316583_10026202 3300032133 Bacteria 2081
365 Ga0316593_10010384 3300032168 Bacteria 2668
366 Ga0316596_1017568 3300033541 Bacteria 1801
367 Ga0373926_0005643 3300035083 Bacteria 4127
368 Ga0373926_0086955 3300035083 Bacteria 1160
369 Ga0373928_0016089 3300035084 Bacteria 1528
370 Ga0373934_0023921 3300035086 Bacteria 2362
371 Ga0373949_0014842 3300035090 Bacteria 1737
372 Ga0373952_0036322 3300035092 Bacteria 1119
373 Ga0373923_0165417 3300035111 Bacteria 1011
374 Ga0373936_0015763 3300035113 Bacteria 2899
375 Ga0373939_0031302 3300035114 Bacteria 1537
376 Ga0373945_0027844 3300035116 Bacteria 1976
377 Ga0373953_0116309 3300035117 Bacteria 1134
378 Ga0373956_0062256 3300035119 Bacteria 1691
379 Ga0373960_0021225 3300035121 Bacteria 1725
380 Ga0373943_0007053 3300035170 Bacteria 5040
381 Ga0373943_0053897 3300035170 Bacteria 1987
382 Ga0373943_0057742 3300035170 Bacteria 1929
383 Ga0373946_0014684 3300035171 Bacteria 2956
384 Ga0373946_0063508 3300035171 Bacteria 1577
385 Ga0373955_0026984 3300035172 Bacteria 2964
386 Ga0373961_0049540 3300035241 Bacteria 1242
387 Ga0373962_0174743 3300035242 Bacteria 715
388 Ga0316574_0171894 3300035398 Bacteria 1395
389 Ga0373924_0081084 3300035410 Bacteria 1380
390 Ga0373931_0017440 3300035691 Bacteria 3552
391 Ga0373935_0042154 3300035692 Bacteria 2869
392 Ga0373935_0079916 3300035692 Bacteria 2123
393 Ga0373935_0319526 3300035692 Bacteria 1101
394 Ga0373935_0591751 3300035692 Bacteria 811
395 Ga0373927_0048850 3300035695 Bacteria 2737
396 Ga0373927_0361397 3300035695 Bacteria 957
397 Ga0373933_0021469 3300035724 Bacteria 3668
398 Ga0373947_0017628 3300035725 Bacteria 4108
399 Ga0373947_0021201 3300035725 Bacteria 3760
400 Ga0373947_0321031 3300035725 Bacteria 1035
401 Ga0373937_0001944 3300036401 Bacteria 17289
402 Ga0373937_0720054 3300036401 Bacteria 945
403 Ga0373925_0002218 3300037068 Bacteria 15763
404 Ga0373925_0062170 3300037068 Bacteria 2807
405 Ga0373925_0177521 3300037068 Bacteria 1684
406 Ga0395899_0153589 3300037312 Bacteria 1630
407 Ga0395899_0190775 3300037312 Bacteria 1434
408 Ga0395899_0207337 3300037312 Bacteria 1364
409 Ga0395900_0011178 3300037418 Bacteria 9178
410 Ga0395900_0167439 3300037418 Bacteria 2239
411 Ga0395900_0284549 3300037418 Bacteria 1644
412 Ga0395900_0752662 3300037418 Bacteria 904
413 Ga0395900_1214729 3300037418 Bacteria 669
414 Ga0395898_0091882 3300037466 Bacteria 2919
415 Ga0395898_0297972 3300037466 Bacteria 1538
416 Ga0395898_1106446 3300037466 Bacteria 725
417 Ga0395905_0055653 3300037471 Bacteria 3702
418 Ga0395905_0342344 3300037471 Bacteria 1386
419 Ga0395905_0700236 3300037471 Bacteria 915
420 Ga0436364_0599685 3300037853 Bacteria 3313
421 Ga0395901_0019091 3300038443 Bacteria 7010
422 Ga0395901_0074476 3300038443 Bacteria 3542
423 Ga0395901_0161249 3300038443 Bacteria 2355
424 Ga0395901_0212831 3300038443 Bacteria 2022
425 Ga0395901_0571535 3300038443 Bacteria 1143
426 Ga0400490_17491 3300038726 Bacteria 28094
427 Ga0400491_12215 3300038727 Bacteria 7556
428 Ga0436365_1358796 3300039437 Bacteria 845
429 Ga0436360_1013902 3300039438 Bacteria 3542
430 Ga0436361_0766437 3300039447 Bacteria 2031
431 Ga0436363_1151979 3300039450 Bacteria 1043
432 Ga0436362_1022308 3300039453 Bacteria 958
433 Ga0439466_0031680 3300041411 Bacteria 1807
434 Ga0451793_1286489 3300041452 Bacteria 990
435 Ga0451795_0086528 3300041456 Bacteria 795
436 Ga0451798_0303405 3300041458 Bacteria 871
437 Ga0451800_0225302 3300041459 Bacteria 1400
438 Ga0450920_002132 3300042122 Bacteria 3348
439 Ga0450920_003850 3300042122 Bacteria 2614
440 Ga0450900_023776 3300042136 Bacteria 867
441 Ga0450902_032249 3300042137 Bacteria 883
442 Ga0450903_024523 3300042138 Bacteria 925
443 Ga0450907_001870 3300042146 Bacteria 4312
444 Ga0450910_013079 3300042147 Bacteria 1205
445 Ga0466969_0003758 3300044656 Bacteria 8068
446 Ga0466969_0064936 3300044656 Bacteria 1766
447 Ga0466969_0198983 3300044656 Bacteria 914
448 Ga0453683_0088991 3300044673 Bacteria 1935
449 Ga0466965_0077701 3300044683 Bacteria 1676
450 Ga0466965_0923505 3300044683 Bacteria 510
451 Ga0466966_0034146 3300044684 Bacteria 3291
452 Ga0466966_0044853 3300044684 Bacteria 2828
453 Ga0466961_0000463 3300044693 Bacteria 25666
454 Ga0466961_0015787 3300044693 Bacteria 4846
455 Ga0466961_0060307 3300044693 Bacteria 2412
456 Ga0466961_0077983 3300044693 Bacteria 2098
457 Ga0466961_0085051 3300044693 Bacteria 2000
458 Ga0466963_0000055 3300044694 Bacteria 37968
459 Ga0466963_0002044 3300044694 Bacteria 11114
460 Ga0466963_0004340 3300044694 Bacteria 8227
461 Ga0466963_0006350 3300044694 Bacteria 6990
462 Ga0466963_0006417 3300044694 Bacteria 6956
463 Ga0466963_0017674 3300044694 Bacteria 4447
464 Ga0466963_0026186 3300044694 Bacteria 3728
465 Ga0466963_0048563 3300044694 Bacteria 2804
466 Ga0466963_0092269 3300044694 Bacteria 2063
467 Ga0466963_0097328 3300044694 Bacteria 2010
468 Ga0466963_0135655 3300044694 Bacteria 1702
469 Ga0466963_0184877 3300044694 Bacteria 1455
470 Ga0466963_0593879 3300044694 Bacteria 782
471 Ga0466963_0638521 3300044694 Bacteria 751
472 Ga0466964_0031729 3300044706 Bacteria 2097
473 Ga0466964_0033993 3300044706 Bacteria 2033
474 Ga0466964_0073886 3300044706 Bacteria 1448
475 Ga0466964_0095241 3300044706 Bacteria 1302
476 Ga0453684_0734803 3300044712 Bacteria 1070
477 Ga0466971_0009943 3300044719 Bacteria 4155
478 Ga0466971_0011670 3300044719 Bacteria 3847
479 Ga0466971_0028795 3300044719 Bacteria 2484
480 Ga0466971_0142487 3300044719 Bacteria 1116
481 Ga0466968_0008743 3300044735 Bacteria 3882
482 Ga0466968_0028416 3300044735 Bacteria 2306
483 Ga0466968_0031656 3300044735 Bacteria 2195
484 Ga0466968_0103594 3300044735 Bacteria 1273
485 Ga0466968_0126664 3300044735 Bacteria 1159
486 Ga0466968_0161488 3300044735 Bacteria 1034
487 Ga0466970_0007299 3300044765 Bacteria 5538
488 Ga0466970_0070016 3300044765 Bacteria 1886
489 Ga0466970_0371652 3300044765 Bacteria 813
490 Ga0466957_0005217 3300044842 Bacteria 7271
491 Ga0466957_0016697 3300044842 Bacteria 4294
492 Ga0466957_0029951 3300044842 Bacteria 3248
493 Ga0466957_0193152 3300044842 Bacteria 1334
494 Ga0466957_0349714 3300044842 Bacteria 1002
495 Ga0466960_0021506 3300044901 Bacteria 2873
496 Ga0466960_0056340 3300044901 Bacteria 1913
497 Ga0466959_0000761 3300045049 Bacteria 18843
498 Ga0466959_0004174 3300045049 Bacteria 9625
499 Ga0466959_0006516 3300045049 Bacteria 8094
500 Ga0466959_0022832 3300045049 Bacteria 4624
501 Ga0466959_0168935 3300045049 Bacteria 1534
502 Ga0466959_0264676 3300045049 Bacteria 1183
503 Ga0466958_0006835 3300045836 Bacteria 6239
504 Ga0466958_0010924 3300045836 Bacteria 5100
505 Ga0466958_0013846 3300045836 Bacteria 4599
506 Ga0466958_0031826 3300045836 Bacteria 3135
507 Ga0466958_0205627 3300045836 Bacteria 1253
508 Ga0466958_0345198 3300045836 Bacteria 958
509 Ga0466958_0375338 3300045836 Bacteria 916
510 Ga0466958_0459671 3300045836 Bacteria 824
511 Ga0466967_0002348 3300045976 Bacteria 11708
512 Ga0466967_0039139 3300045976 Bacteria 4073
513 Ga0466967_0046458 3300045976 Bacteria 3780
514 Ga0466967_0053112 3300045976 Bacteria 3560
515 Ga0466967_0065217 3300045976 Bacteria 3240
516 Ga0466967_0075823 3300045976 Bacteria 3023
517 Ga0466967_0078419 3300045976 Bacteria 2975
518 Ga0466967_0099841 3300045976 Bacteria 2651
519 Ga0466967_0116175 3300045976 Bacteria 2465
520 Ga0466967_0189810 3300045976 Bacteria 1941
521 Ga0466967_0212598 3300045976 Bacteria 1835
522 Ga0466967_0223460 3300045976 Bacteria 1790
523 Ga0466967_0225253 3300045976 Bacteria 1783
524 Ga0466967_0336155 3300045976 Bacteria 1459
525 Ga0466967_0466266 3300045976 Bacteria 1236
526 Ga0466967_0527842 3300045976 Bacteria 1160
527 Ga0466967_0626652 3300045976 Bacteria 1062
528 Ga0466967_0829701 3300045976 Bacteria 918
529 Ga0466967_1157853 3300045976 Bacteria 770
530 Ga0466967_1372260 3300045976 Bacteria 704
531 Ga0466967_1471974 3300045976 Bacteria 678
532 Ga0495592_0000082 3300046454 Bacteria 83312
533 Ga0495592_0005470 3300046454 Bacteria 9382
534 Ga0495592_0074198 3300046454 Bacteria 2471
535 Ga0495592_0475797 3300046454 Bacteria 779
536 Ga0495592_0770835 3300046454 Bacteria 573
537 Ga0495603_0032804 3300046455 Bacteria 3124
538 Ga0495603_0040839 3300046455 Bacteria 2776
539 Ga0495603_0043193 3300046455 Bacteria 2693
540 Ga0495603_0189160 3300046455 Bacteria 1190
541 Ga0495603_0440952 3300046455 Bacteria 746
542 Ga0495629_0001157 3300046459 Bacteria 20835
543 Ga0495629_0107062 3300046459 Bacteria 1950
544 Ga0495629_0458389 3300046459 Bacteria 863
545 Ga0495629_0496358 3300046459 Bacteria 823
546 Ga0495629_0732121 3300046459 Bacteria 655
547 Ga0495641_0002322 3300046461 Bacteria 15128
548 Ga0495641_0003735 3300046461 Bacteria 11202
549 Ga0495641_0013465 3300046461 Bacteria 4492
550 Ga0495641_0016679 3300046461 Bacteria 3859
551 Ga0495641_0168032 3300046461 Bacteria 981
552 Ga0495641_0262499 3300046461 Bacteria 777
553 Ga0495641_0324433 3300046461 Bacteria 695
554 Ga0495651_0000254 3300046462 Bacteria 41379
555 Ga0495651_0222455 3300046462 Bacteria 1305
556 Ga0495651_0285830 3300046462 Bacteria 1112
557 Ga0495653_0023292 3300046463 Bacteria 5006
558 Ga0495653_0110292 3300046463 Bacteria 1978
559 Ga0495653_0168599 3300046463 Bacteria 1513
560 Ga0495653_0206095 3300046463 Bacteria 1331
561 Ga0495580_0009973 3300046472 Bacteria 7427
562 Ga0495582_0000808 3300046473 Bacteria 17389
563 Ga0495582_0001703 3300046473 Bacteria 12403
564 Ga0495582_0265163 3300046473 Bacteria 985
565 Ga0495582_0358266 3300046473 Bacteria 840
566 Ga0495582_0412425 3300046473 Bacteria 779
567 Ga0495582_0484312 3300046473 Bacteria 715
568 Ga0495605_0054527 3300046474 Bacteria 1936
569 Ga0495639_0000659 3300046475 Bacteria 15963
570 Ga0495639_0000828 3300046475 Bacteria 14100
571 Ga0495662_0002737 3300046476 Bacteria 8908
572 Ga0495662_0111106 3300046476 Bacteria 1343
573 Ga0495662_0163504 3300046476 Bacteria 1097
574 Ga0495662_0206358 3300046476 Bacteria 968
575 Ga0495664_0018869 3300046477 Bacteria 3958
576 Ga0495664_0073142 3300046477 Bacteria 2049
577 Ga0495664_0073533 3300046477 Bacteria 2044
578 Ga0495585_0025984 3300046492 Bacteria 3349
579 Ga0495594_0037202 3300046499 Bacteria 2655
580 Ga0495594_0284652 3300046499 Bacteria 942
581 Ga0495594_0378856 3300046499 Bacteria 805
582 Ga0495594_0603824 3300046499 Bacteria 622
583 Ga0495596_0071343 3300046500 Bacteria 1349
584 Ga0495596_0085594 3300046500 Bacteria 1223
585 Ga0495608_0003029 3300046511 Bacteria 11991
586 Ga0495608_0019774 3300046511 Bacteria 4631
587 Ga0495608_0076168 3300046511 Bacteria 2186
588 Ga0495608_0301504 3300046511 Bacteria 992
589 Ga0495618_0010074 3300046514 Bacteria 5714
590 Ga0495618_0011530 3300046514 Bacteria 5362
591 Ga0495618_0079738 3300046514 Bacteria 2088
592 Ga0495618_0130632 3300046514 Bacteria 1607
593 Ga0495618_0224637 3300046514 Bacteria 1184
594 Ga0495618_0285957 3300046514 Bacteria 1027
595 Ga0495618_0604342 3300046514 Bacteria 652
596 Ga0495628_0008466 3300046516 Bacteria 8819
597 Ga0495628_0013181 3300046516 Bacteria 6956
598 Ga0495628_0037042 3300046516 Bacteria 3911
599 Ga0495628_0255320 3300046516 Bacteria 1307
600 Ga0495628_0693428 3300046516 Bacteria 720
601 Ga0495630_0018065 3300046517 Bacteria 5175
602 Ga0495630_0059957 3300046517 Bacteria 2855
603 Ga0495630_0081900 3300046517 Bacteria 2435
604 Ga0495630_0207836 3300046517 Bacteria 1494
605 Ga0495630_0627798 3300046517 Bacteria 823
606 Ga0495630_0742766 3300046517 Bacteria 750
607 Ga0495631_0048561 3300046518 Bacteria 1861
608 Ga0495631_0259748 3300046518 Bacteria 740
609 Ga0495644_0072868 3300046523 Bacteria 1291
610 Ga0495644_0223804 3300046523 Bacteria 728
611 Ga0495663_0025814 3300046525 Bacteria 1716
612 Ga0495666_0000309 3300046526 Bacteria 21203
613 Ga0495666_0008288 3300046526 Bacteria 5208
614 Ga0495642_0037952 3300046528 Bacteria 1950
615 Ga0495642_0354807 3300046528 Bacteria 645
616 Ga0495652_0000144 3300046529 Bacteria 80486
617 Ga0495652_0005095 3300046529 Bacteria 12426
618 Ga0495665_0001383 3300046531 Bacteria 12998
619 Ga0495665_0003045 3300046531 Bacteria 9054
620 Ga0495640_0002828 3300046533 Bacteria 13955
621 Ga0495640_0016017 3300046533 Bacteria 5621
622 Ga0495640_0188659 3300046533 Bacteria 1311
623 Ga0495640_0255781 3300046533 Bacteria 1095
624 Ga0495586_0035224 3300046535 Bacteria 2688
625 Ga0495586_0259235 3300046535 Bacteria 993
626 Ga0495586_0596015 3300046535 Bacteria 638
627 Ga0495587_0000060 3300046536 Bacteria 93780
628 Ga0495587_0042989 3300046536 Bacteria 2692
629 Ga0495587_0267091 3300046536 Bacteria 960
630 Ga0495609_0082219 3300046538 Bacteria 1407
631 Ga0495645_0000038 3300046543 Bacteria 96124
632 Ga0495645_0039870 3300046543 Bacteria 3425
633 Ga0495645_0112646 3300046543 Bacteria 1923
634 Ga0495667_0008738 3300046559 Bacteria 6882
635 Ga0495667_0117024 3300046559 Bacteria 1722
636 Ga0495667_0149217 3300046559 Bacteria 1505
637 Ga0495667_0173797 3300046559 Bacteria 1384
638 Ga0495667_0308668 3300046559 Bacteria 1002
639 Ga0495656_0001194 3300046615 Bacteria 8463
640 Ga0495656_0163686 3300046615 Bacteria 1083
641 Ga0495634_0004455 3300046642 Bacteria 10990
642 Ga0495634_0031559 3300046642 Bacteria 3648
643 Ga0495634_0159950 3300046642 Bacteria 1420
644 Ga0495634_0175161 3300046642 Bacteria 1346
645 Ga0495611_0037229 3300046648 Bacteria 2161
646 Ga0495635_0059021 3300046663 Bacteria 2638
647 Ga0495635_0209839 3300046663 Bacteria 1319
648 Ga0495635_0221470 3300046663 Bacteria 1279
649 Ga0495659_0010631 3300046664 Bacteria 2959
650 Ga0495588_0260965 3300046674 Bacteria 913
651 Ga0495657_0021956 3300046675 Bacteria 4576
652 Ga0495657_0026518 3300046675 Bacteria 4103
653 Ga0495657_0029234 3300046675 Bacteria 3867
654 Ga0495657_0074859 3300046675 Bacteria 2202
655 Ga0495657_0192428 3300046675 Bacteria 1246
656 Ga0495599_0003010 3300046678 Bacteria 9810
657 Ga0495599_0042619 3300046678 Bacteria 2848
658 Ga0495599_0251432 3300046678 Bacteria 1075
659 Ga0495623_0003795 3300046679 Bacteria 9954
660 Ga0495623_0301324 3300046679 Bacteria 885
661 Ga0495646_0016747 3300046680 Bacteria 4654
662 Ga0495646_0027797 3300046680 Bacteria 3546
663 Ga0495646_0075159 3300046680 Bacteria 1981
664 Ga0495646_0167143 3300046680 Bacteria 1214
665 Ga0495647_0010914 3300046681 Bacteria 3103
666 Ga0495647_0013196 3300046681 Bacteria 2859
667 Ga0495647_0112595 3300046681 Bacteria 1137
668 Ga0495647_0274276 3300046681 Bacteria 755
669 Ga0495658_0000498 3300046683 Bacteria 21575
670 Ga0495658_0001453 3300046683 Bacteria 12469
671 Ga0495658_0117774 3300046683 Bacteria 1603
672 Ga0495613_0061335 3300046689 Bacteria 2753
673 Ga0495613_0141595 3300046689 Bacteria 1718
674 Ga0495613_0157507 3300046689 Bacteria 1617
675 Ga0495613_0168864 3300046689 Bacteria 1553
676 Ga0495624_0007698 3300046690 Bacteria 7557
677 Ga0495624_0011808 3300046690 Bacteria 5993
678 Ga0495624_0034041 3300046690 Bacteria 3298
679 Ga0495624_0079393 3300046690 Bacteria 2035
680 Ga0495624_0109404 3300046690 Bacteria 1700
681 Ga0495624_0495574 3300046690 Bacteria 731
682 Ga0495670_0056634 3300046691 Bacteria 1967
683 Ga0495600_0062127 3300046809 Bacteria 2440
684 Ga0495600_0366427 3300046809 Bacteria 901
685 Ga0495581_0001143 3300047315 Bacteria 14507
686 Ga0495581_0017975 3300047315 Bacteria 4108
687 Ga0495581_0230668 3300047315 Bacteria 1083
688 Ga0495604_0000043 3300047317 Bacteria 116335
689 Ga0495604_0148730 3300047317 Bacteria 1666
690 Ga0495604_0220666 3300047317 Bacteria 1305
691 Ga0495604_0254304 3300047317 Bacteria 1196
692 Ga0495674_0007325 3300047319 Bacteria 10549
693 Ga0495674_0019407 3300047319 Bacteria 6310
694 Ga0495674_0138750 3300047319 Bacteria 2044
695 Ga0495674_0227405 3300047319 Bacteria 1540
696 Ga0495674_0493327 3300047319 Bacteria 980
697 Ga0495676_0016334 3300047321 Bacteria 6592
698 Ga0495676_0036425 3300047321 Bacteria 4108
699 Ga0495676_0070005 3300047321 Bacteria 2705
700 Ga0495676_0072781 3300047321 Bacteria 2638
701 Ga0495676_0118846 3300047321 Bacteria 1927
702 Ga0495676_0355612 3300047321 Bacteria 978
703 Ga0495676_0472150 3300047321 Bacteria 826
704 Ga0495680_0005229 3300047322 Bacteria 12252
705 Ga0495680_0009827 3300047322 Bacteria 8578
706 Ga0495680_0010993 3300047322 Bacteria 8042
707 Ga0495680_0286568 3300047322 Bacteria 1159
708 Ga0495675_0000413 3300047444 Bacteria 29216
709 Ga0495685_043204 3300047447 Bacteria 1538
710 Ga0495684_0001111 3300047471 Bacteria 21659
711 Ga0495684_0076140 3300047471 Bacteria 2548
712 Ga0495684_0129709 3300047471 Bacteria 1894
713 Ga0495684_0274597 3300047471 Bacteria 1218
714 Ga0495684_0280426 3300047471 Bacteria 1202
715 Ga0495684_0435114 3300047471 Bacteria 914
716 Ga0495593_0001256 3300047673 Bacteria 14872
717 Ga0495593_0004784 3300047673 Bacteria 8036
718 Ga0495593_0092131 3300047673 Bacteria 1560
719 Ga0495602_0022762 3300048088 Bacteria 6126
720 Ga0495614_0002476 3300048089 Bacteria 8212
721 Ga0495614_0004362 3300048089 Bacteria 6373
722 Ga0495614_0296538 3300048089 Bacteria 746
723 Ga0496100_0001629 3300048903 Bacteria 11110
724 Ga0496100_0053677 3300048903 Bacteria 2625
725 Ga0496100_0272426 3300048903 Bacteria 1259
726 Ga0496100_0276059 3300048903 Bacteria 1251
727 Ga0496100_0444036 3300048903 Bacteria 994
728 Ga0496101_0006702 3300048904 Bacteria 7426
729 Ga0496101_0149061 3300048904 Bacteria 1788
730 Ga0496101_0149940 3300048904 Bacteria 1783
731 Ga0496101_0285472 3300048904 Bacteria 1291
732 Ga0496101_0457958 3300048904 Bacteria 1006
733 Ga0496102_0008253 3300048905 Bacteria 8919
734 Ga0496102_0063343 3300048905 Bacteria 3385
735 Ga0496102_0181949 3300048905 Bacteria 1980
736 Ga0496102_0523215 3300048905 Bacteria 1109
737 Ga0496102_1297569 3300048905 Bacteria 647
738 Ga0496103_0014004 3300048906 Bacteria 4761
739 Ga0496103_0057089 3300048906 Bacteria 2423
740 Ga0496104_0007021 3300048907 Bacteria 9931
741 Ga0496104_0307271 3300048907 Bacteria 1498
742 Ga0496104_0382082 3300048907 Bacteria 1321
743 Ga0496104_0597812 3300048907 Bacteria 1013
744 Ga0496105_0029069 3300048908 Bacteria 4523
745 Ga0496105_0118125 3300048908 Bacteria 2187
746 Ga0496105_0198444 3300048908 Bacteria 1638
747 Ga0496105_0678076 3300048908 Bacteria 793
748 Ga0496106_0031105 3300048909 Bacteria 3977
749 Ga0496106_0232204 3300048909 Bacteria 1473
750 Ga0496106_0530873 3300048909 Bacteria 945
751 Ga0496106_0853683 3300048909 Bacteria 720
752 Ga0496107_0017701 3300048910 Bacteria 5013
753 Ga0496107_0180696 3300048910 Bacteria 1566
754 Ga0496107_0571075 3300048910 Bacteria 837
755 Ga0496107_0727413 3300048910 Bacteria 729
756 Ga0496108_0058486 3300048911 Bacteria 3240
757 Ga0496108_0107249 3300048911 Bacteria 2385
758 Ga0496108_0568902 3300048911 Bacteria 988
759 Ga0496109_0082695 3300048912 Bacteria 2959
760 Ga0496109_0089833 3300048912 Bacteria 2841
761 Ga0496109_0099702 3300048912 Bacteria 2694
762 Ga0496109_0113923 3300048912 Bacteria 2515
763 Ga0496109_0384105 3300048912 Bacteria 1326
764 Ga0496109_0480016 3300048912 Bacteria 1174
765 Ga0496109_0518190 3300048912 Bacteria 1125
766 Ga0496109_1028350 3300048912 Bacteria 761
767 Ga0496109_1393720 3300048912 Bacteria 636
768 Ga0496110_0023971 3300048913 Bacteria 5197
769 Ga0496110_0030835 3300048913 Bacteria 4624
770 Ga0496110_0160468 3300048913 Bacteria 2038
771 Ga0496110_0169073 3300048913 Bacteria 1983
772 Ga0496110_0241280 3300048913 Bacteria 1644
773 Ga0496110_0302419 3300048913 Bacteria 1457
774 Ga0496111_0011827 3300048914 Bacteria 5892
775 Ga0496111_0033779 3300048914 Bacteria 3649
776 Ga0496111_0257450 3300048914 Bacteria 1295
777 Ga0496111_0373134 3300048914 Bacteria 1055
778 Ga0496111_0508613 3300048914 Bacteria 886
779 Ga0496112_0059463 3300048915 Bacteria 3766
780 Ga0496112_0185242 3300048915 Bacteria 2045
781 Ga0496113_0088698 3300048916 Bacteria 2379
782 Ga0496113_0483302 3300048916 Bacteria 995
783 Ga0496114_0005056 3300048917 Bacteria 10281
784 Ga0496114_0006185 3300048917 Bacteria 9424
785 Ga0496114_0151150 3300048917 Bacteria 2014
786 Ga0496114_0172351 3300048917 Bacteria 1886
787 Ga0496114_0194655 3300048917 Bacteria 1774
788 Ga0496114_0361856 3300048917 Bacteria 1283
789 Ga0496114_0386754 3300048917 Bacteria 1239
790 Ga0496115_0033907 3300048918 Bacteria 4033
791 Ga0496115_0123165 3300048918 Bacteria 2134
792 Ga0501031_0001922 3300049568 Bacteria 13097
793 Ga0501031_0002118 3300049568 Bacteria 12520
794 Ga0501031_0005180 3300049568 Bacteria 8498
795 Ga0501031_0068501 3300049568 Bacteria 2312
796 Ga0501031_0091203 3300049568 Bacteria 1987
797 Ga0501031_0114103 3300049568 Bacteria 1764
798 Ga0501031_0209414 3300049568 Bacteria 1271
799 Ga0501031_0340727 3300049568 Bacteria 970
800 Ga0501031_0475227 3300049568 Bacteria 807
801 Ga0501032_0004421 3300049569 Bacteria 10604
802 Ga0501032_0023340 3300049569 Bacteria 4276
803 Ga0501032_0044036 3300049569 Bacteria 3021
804 Ga0501032_0079859 3300049569 Bacteria 2177
805 Ga0501032_0093895 3300049569 Bacteria 1989
806 Ga0501032_0239962 3300049569 Bacteria 1178
807 Ga0501033_0003063 3300049570 Bacteria 13899
808 Ga0501033_0008979 3300049570 Bacteria 7718
809 Ga0501033_0020491 3300049570 Bacteria 4995
810 Ga0501033_0032660 3300049570 Bacteria 3909
811 Ga0501033_0075805 3300049570 Bacteria 2468
812 Ga0501033_0207271 3300049570 Bacteria 1399
813 Ga0501033_0219796 3300049570 Bacteria 1353
814 Ga0501034_0036580 3300049571 Bacteria 4972
815 Ga0501036_0003710 3300049572 Bacteria 12240
816 Ga0501036_0009021 3300049572 Bacteria 8199
817 Ga0501036_0015282 3300049572 Bacteria 6408
818 Ga0501036_0057668 3300049572 Bacteria 3289
819 Ga0501036_0086042 3300049572 Bacteria 2657
820 Ga0501036_0148825 3300049572 Bacteria 1975
821 Ga0501037_0001718 3300049573 Bacteria 15893
822 Ga0501037_0013457 3300049573 Bacteria 6025
823 Ga0501037_0018672 3300049573 Bacteria 5111
824 Ga0501037_0040595 3300049573 Bacteria 3424
825 Ga0501037_0059507 3300049573 Bacteria 2786
826 Ga0501037_0275252 3300049573 Bacteria 1174
827 Ga0501037_0329506 3300049573 Bacteria 1056
828 Ga0501037_0334181 3300049573 Bacteria 1047
829 Ga0501038_0002469 3300049574 Bacteria 17199
830 Ga0501038_0012658 3300049574 Bacteria 7710
831 Ga0501038_0019828 3300049574 Bacteria 6053
832 Ga0501038_0096442 3300049574 Bacteria 2468
833 Ga0501038_0255487 3300049574 Bacteria 1387
834 Ga0501038_0695045 3300049574 Bacteria 762
835 Ga0501038_0733596 3300049574 Bacteria 738
836 Ga0501039_0004772 3300049575 Bacteria 10271
837 Ga0501039_0007709 3300049575 Bacteria 8218
838 Ga0501039_0010859 3300049575 Bacteria 6941
839 Ga0501039_0015250 3300049575 Bacteria 5881
840 Ga0501039_0022477 3300049575 Bacteria 4841
841 Ga0501039_0115948 3300049575 Bacteria 2097
842 Ga0501039_0132026 3300049575 Bacteria 1960
843 Ga0501039_0223910 3300049575 Bacteria 1478
844 Ga0501039_0258374 3300049575 Bacteria 1369
845 Ga0501039_0340275 3300049575 Bacteria 1179
846 Ga0501039_0467126 3300049575 Bacteria 991
847 Ga0501040_0000912 3300049576 Bacteria 18528
848 Ga0501040_0011832 3300049576 Bacteria 5709
849 Ga0501040_0014970 3300049576 Bacteria 5123
850 Ga0501040_0015710 3300049576 Bacteria 5005
851 Ga0501040_0023663 3300049576 Bacteria 4119
852 Ga0501040_0119856 3300049576 Bacteria 1846
853 Ga0501040_0176929 3300049576 Bacteria 1511
854 Ga0501040_0191955 3300049576 Bacteria 1449
855 Ga0501040_0213523 3300049576 Bacteria 1372
856 Ga0501040_0269412 3300049576 Bacteria 1216
857 Ga0501040_0314193 3300049576 Bacteria 1120
858 Ga0501040_0326816 3300049576 Bacteria 1097
859 Ga0501040_0602148 3300049576 Bacteria 794
860 Ga0501041_0001188 3300049577 Bacteria 14191
861 Ga0501041_0001660 3300049577 Bacteria 12450
862 Ga0501041_0001929 3300049577 Bacteria 11642
863 Ga0501041_0002244 3300049577 Bacteria 10922
864 Ga0501041_0004355 3300049577 Bacteria 8192
865 Ga0501041_0012382 3300049577 Bacteria 5052
866 Ga0501041_0036262 3300049577 Bacteria 2988
867 Ga0501041_0401617 3300049577 Bacteria 868
868 Ga0501042_0000667 3300049578 Bacteria 18449
869 Ga0501042_0007635 3300049578 Bacteria 7094
870 Ga0501042_0015136 3300049578 Bacteria 5275
871 Ga0501042_0019313 3300049578 Bacteria 4730
872 Ga0501042_0020347 3300049578 Bacteria 4618
873 Ga0501042_0031825 3300049578 Bacteria 3732
874 Ga0501042_0035028 3300049578 Bacteria 3561
875 Ga0501042_0076737 3300049578 Bacteria 2392
876 Ga0501043_0008410 3300049579 Bacteria 8128
877 Ga0501043_0020037 3300049579 Bacteria 5249
878 Ga0501043_0084192 3300049579 Bacteria 2499
879 Ga0501043_0216269 3300049579 Bacteria 1484
880 Ga0501043_0217764 3300049579 Bacteria 1478
881 Ga0501043_0281015 3300049579 Bacteria 1276
882 Ga0501043_0832755 3300049579 Bacteria 666
883 Ga0501046_0004156 3300049580 Bacteria 13179
884 Ga0501046_0006661 3300049580 Bacteria 10200
885 Ga0501046_0006809 3300049580 Bacteria 10086
886 Ga0501046_0008923 3300049580 Bacteria 8705
887 Ga0501046_0020980 3300049580 Bacteria 5394
888 Ga0501046_0057062 3300049580 Bacteria 3064
889 Ga0501046_0325560 3300049580 Bacteria 1119
890 Ga0501047_0021018 3300049581 Bacteria 6269
891 Ga0501047_0023307 3300049581 Bacteria 5944
892 Ga0501047_0136800 3300049581 Bacteria 2330
893 Ga0501047_0479348 3300049581 Bacteria 1072
894 Ga0501047_1210379 3300049581 Bacteria 569
895 Ga0501048_0004215 3300049582 Bacteria 10958
896 Ga0501048_0006265 3300049582 Bacteria 9047
897 Ga0501048_0015470 3300049582 Bacteria 5636
898 Ga0501048_0023093 3300049582 Bacteria 4546
899 Ga0501048_0026749 3300049582 Bacteria 4198
900 Ga0501048_0034066 3300049582 Bacteria 3677
901 Ga0501048_0039880 3300049582 Bacteria 3366
902 Ga0501048_0052687 3300049582 Bacteria 2896
903 Ga0501048_0092533 3300049582 Bacteria 2132
904 Ga0501048_0367479 3300049582 Bacteria 1027
905 Ga0501048_0675448 3300049582 Bacteria 742
906 Ga0501067_0026731 3300049583 Bacteria 3195
907 Ga0501067_0031044 3300049583 Bacteria 2965
908 Ga0501067_0069254 3300049583 Bacteria 1953
909 Ga0501067_0126627 3300049583 Bacteria 1421
910 Ga0501068_0002839 3300049584 Bacteria 9214
911 Ga0501068_0003273 3300049584 Bacteria 8682
912 Ga0501068_0010460 3300049584 Bacteria 5214
913 Ga0501068_0016129 3300049584 Bacteria 4302
914 Ga0501068_0017184 3300049584 Bacteria 4180
915 Ga0501068_0017701 3300049584 Bacteria 4122
916 Ga0501068_0029609 3300049584 Bacteria 3243
917 Ga0501068_0170713 3300049584 Bacteria 1372
918 Ga0501069_0000281 3300049585 Bacteria 23211
919 Ga0501069_0003229 3300049585 Bacteria 8360
920 Ga0501069_0022228 3300049585 Bacteria 3447
921 Ga0501069_0036892 3300049585 Bacteria 2697
922 Ga0501069_0073093 3300049585 Bacteria 1922
923 Ga0501069_0085775 3300049585 Bacteria 1777
924 Ga0501069_0088552 3300049585 Bacteria 1749
925 Ga0501069_0214449 3300049585 Bacteria 1118
926 Ga0501069_0362565 3300049585 Bacteria 855
927 Ga0501069_0381137 3300049585 Bacteria 833
928 Ga0501070_0007966 3300049586 Bacteria 8974
929 Ga0501070_0010802 3300049586 Bacteria 7714
930 Ga0501070_0035611 3300049586 Bacteria 4159
931 Ga0501070_0094901 3300049586 Bacteria 2468
932 Ga0501070_0181280 3300049586 Bacteria 1733
933 Ga0501070_0234063 3300049586 Bacteria 1505
934 Ga0501071_0001083 3300049587 Bacteria 15121
935 Ga0501071_0004817 3300049587 Bacteria 8596
936 Ga0501071_0006860 3300049587 Bacteria 7420
937 Ga0501071_0010486 3300049587 Bacteria 6211
938 Ga0501071_0057394 3300049587 Bacteria 2813
939 Ga0501071_0064544 3300049587 Bacteria 2656
940 Ga0501071_0074357 3300049587 Bacteria 2479
941 Ga0501071_0157353 3300049587 Bacteria 1697
942 Ga0501071_0172866 3300049587 Bacteria 1617
943 Ga0501071_0250313 3300049587 Bacteria 1337
944 Ga0501071_0513484 3300049587 Bacteria 919
945 Ga0501072_0001268 3300049588 Bacteria 18858
946 Ga0501072_0010632 3300049588 Bacteria 7009
947 Ga0501072_0012923 3300049588 Bacteria 6386
948 Ga0501072_0016036 3300049588 Bacteria 5745
949 Ga0501072_0033633 3300049588 Bacteria 4017
950 Ga0501072_0053837 3300049588 Bacteria 3170
951 Ga0501072_0087000 3300049588 Bacteria 2479
952 Ga0501072_0107030 3300049588 Bacteria 2224
953 Ga0501072_0188856 3300049588 Bacteria 1643
954 Ga0501072_0273938 3300049588 Bacteria 1343
955 Ga0501072_0276702 3300049588 Bacteria 1335
956 Ga0501072_0289965 3300049588 Bacteria 1301
957 Ga0501072_0807292 3300049588 Bacteria 735
958 Ga0501073_0008765 3300049589 Bacteria 7485
959 Ga0501073_0012210 3300049589 Bacteria 6272
960 Ga0501073_0013552 3300049589 Bacteria 5929
961 Ga0501073_0141779 3300049589 Bacteria 1665
962 Ga0501074_0001000 3300049590 Bacteria 18378
963 Ga0501074_0002634 3300049590 Bacteria 12568
964 Ga0501074_0003320 3300049590 Bacteria 11387
965 Ga0501074_0023738 3300049590 Bacteria 4457
966 Ga0501074_0036342 3300049590 Bacteria 3568
967 Ga0501074_0040628 3300049590 Bacteria 3368
968 Ga0501074_0070993 3300049590 Bacteria 2503
969 Ga0501074_0197734 3300049590 Bacteria 1433
970 Ga0501075_0001943 3300049591 Bacteria 13629
971 Ga0501075_0002651 3300049591 Bacteria 11960
972 Ga0501075_0003018 3300049591 Bacteria 11243
973 Ga0501075_0008555 3300049591 Bacteria 7135
974 Ga0501075_0015752 3300049591 Bacteria 5432
975 Ga0501075_0035626 3300049591 Bacteria 3712
976 Ga0501075_0138840 3300049591 Bacteria 1852
977 Ga0501075_0146035 3300049591 Bacteria 1802
978 Ga0501075_0284160 3300049591 Bacteria 1260
979 Ga0501075_0493070 3300049591 Bacteria 935
980 Ga0501075_0583917 3300049591 Bacteria 852
981 Ga0501076_0001626 3300049592 Bacteria 15152
982 Ga0501076_0005603 3300049592 Bacteria 9045
983 Ga0501076_0007318 3300049592 Bacteria 8030
984 Ga0501076_0008207 3300049592 Bacteria 7649
985 Ga0501076_0009171 3300049592 Bacteria 7291
986 Ga0501076_0010290 3300049592 Bacteria 6933
987 Ga0501076_0018971 3300049592 Bacteria 5249
988 Ga0501076_0040146 3300049592 Bacteria 3676
989 Ga0501076_0059670 3300049592 Bacteria 3034
990 Ga0501076_0813538 3300049592 Bacteria 771
991 Ga0501077_0001393 3300049593 Bacteria 14562
992 Ga0501077_0001912 3300049593 Bacteria 12613
993 Ga0501077_0002204 3300049593 Bacteria 11750
994 Ga0501077_0005398 3300049593 Bacteria 7771
995 Ga0501077_0007498 3300049593 Bacteria 6731
996 Ga0501077_0010312 3300049593 Bacteria 5813
997 Ga0501077_0018672 3300049593 Bacteria 4385
998 Ga0501077_0138018 3300049593 Bacteria 1546
999 Ga0501077_0213669 3300049593 Bacteria 1226
1000 Ga0501077_0221186 3300049593 Bacteria 1203
1001 Ga0501077_0307363 3300049593 Bacteria 1010
1002 Ga0501077_0330346 3300049593 Bacteria 972
1003 Ga0501079_0000076 3300049741 Bacteria 46459
1004 Ga0501079_0003409 3300049741 Bacteria 11673
1005 Ga0501079_0006042 3300049741 Bacteria 9074
1006 Ga0501079_0008393 3300049741 Bacteria 7829
1007 Ga0501079_0026369 3300049741 Bacteria 4455
1008 Ga0501079_0027015 3300049741 Bacteria 4400
1009 Ga0501079_0051929 3300049741 Bacteria 3166
1010 Ga0501079_0062704 3300049741 Bacteria 2867
1011 Ga0501079_0079460 3300049741 Bacteria 2536
1012 Ga0501079_0312217 3300049741 Bacteria 1230
1013 Ga0501079_0360704 3300049741 Bacteria 1139
1014 Ga0501079_1230235 3300049741 Bacteria 590
1015 Ga0501080_0012586 3300049742 Bacteria 7757
1016 Ga0501080_0012861 3300049742 Bacteria 7679
1017 Ga0501080_0016472 3300049742 Bacteria 6827
1018 Ga0501080_0029054 3300049742 Bacteria 5146
1019 Ga0501080_0030844 3300049742 Bacteria 4995
1020 Ga0501080_0032304 3300049742 Bacteria 4880
1021 Ga0501080_0048644 3300049742 Bacteria 3946
1022 Ga0501080_0105638 3300049742 Bacteria 2611
1023 Ga0501080_0204327 3300049742 Bacteria 1813
1024 Ga0501080_0320739 3300049742 Bacteria 1403
1025 Ga0501081_0004393 3300049743 Bacteria 9040
1026 Ga0501081_0006383 3300049743 Bacteria 7649
1027 Ga0501081_0017769 3300049743 Bacteria 4713
1028 Ga0501081_0024644 3300049743 Bacteria 4041
1029 Ga0501081_0028999 3300049743 Bacteria 3737
1030 Ga0501081_0084466 3300049743 Bacteria 2227
1031 Ga0501081_0140333 3300049743 Bacteria 1731
1032 Ga0501081_0155437 3300049743 Bacteria 1645
1033 Ga0501081_0243867 3300049743 Bacteria 1310
1034 Ga0501081_0475259 3300049743 Bacteria 930
1035 Ga0501081_0935705 3300049743 Bacteria 654
1036 Ga0501083_0005072 3300049744 Bacteria 9327
1037 Ga0501083_0006583 3300049744 Bacteria 8244
1038 Ga0501083_0011542 3300049744 Bacteria 6196
1039 Ga0501083_0023084 3300049744 Bacteria 4317
1040 Ga0501083_0035316 3300049744 Bacteria 3415
1041 Ga0501083_0251137 3300049744 Bacteria 1151
1042 Ga0501035_0003302 3300049822 Bacteria 15457
1043 Ga0501035_0021361 3300049822 Bacteria 5950
1044 Ga0501035_0034996 3300049822 Bacteria 4562
1045 Ga0501035_0045094 3300049822 Bacteria 3967
1046 Ga0501035_0308733 3300049822 Bacteria 1331
1047 Ga0501035_0773721 3300049822 Bacteria 769
1048 Ga0501044_0018755 3300049823 Bacteria 7410
1049 Ga0501044_0122766 3300049823 Bacteria 2596
1050 Ga0501044_0126002 3300049823 Bacteria 2559
1051 Ga0501044_0153340 3300049823 Bacteria 2285
1052 Ga0501044_0400241 3300049823 Bacteria 1285
1053 Ga0501045_0000077 3300049824 Bacteria 46550
1054 Ga0501045_0001835 3300049824 Bacteria 14347
1055 Ga0501045_0009478 3300049824 Bacteria 6814
1056 Ga0501045_0021888 3300049824 Bacteria 4574
1057 Ga0501045_0028964 3300049824 Bacteria 3997
1058 Ga0501045_0042172 3300049824 Bacteria 3322
1059 Ga0501045_0049099 3300049824 Bacteria 3076
1060 Ga0501045_0070095 3300049824 Bacteria 2578
1061 Ga0501045_0077628 3300049824 Bacteria 2447
1062 nmdc:mga00v17_29338_c1 3300050491 Bacteria 2255
1063 nmdc:mga0yw44_147904_c1 3300050492 Bacteria 1531
1064 nmdc:mga06z11_49760_c1 3300050494 Bacteria 2139
1065 nmdc:mga05p37_10099_c1 3300050507 Bacteria 11207
1066 nmdc:mga05p37_183984_c1 3300050507 Bacteria 2541
1067 nmdc:mga05p37_200451_c1 3300050507 Bacteria 2418
1068 nmdc:mga05p37_47021_c1 3300050507 Bacteria 5307
1069 nmdc:mga05p37_48463_c1 3300050507 Bacteria 5225
1070 nmdc:mga05p37_555413_c1 3300050507 Bacteria 1306
1071 nmdc:mga05p37_63542_c1 3300050507 Bacteria 4543
1072 nmdc:mga05p37_639709_c1 3300050507 Bacteria 1193
1073 nmdc:mga05p37_681750_c1 3300050507 Bacteria 1145
1074 nmdc:mga09592_45593_c1 3300050508 Bacteria 3693
1075 nmdc:mga09592_5692_c1 3300050508 Bacteria 10165
1076 nmdc:mga09592_94219_c1 3300050508 Bacteria 2561
1077 nmdc:mga0qj67_1148600_c1 3300050509 Bacteria 605
1078 nmdc:mga0qj67_27322_c1 3300050509 Bacteria 4422
1079 nmdc:mga06r32_153768_c1 3300050510 Bacteria 2280
1080 nmdc:mga06r32_210913_c1 3300050510 Bacteria 1930
1081 nmdc:mga08y16_1089817_c1 3300050511 Bacteria 774
1082 nmdc:mga08y16_125036_c1 3300050511 Bacteria 2676
1083 nmdc:mga08y16_131091_c1 3300050511 Bacteria 2607
1084 nmdc:mga08y16_398239_c1 3300050511 Bacteria 1409
1085 nmdc:mga08y16_481751_c1 3300050511 Bacteria 1262
1086 nmdc:mga0n895_106199_c1 3300050512 Bacteria 2821
1087 nmdc:mga0rr50_521970_c1 3300050513 Bacteria 1010
1088 nmdc:mga08x19_261282_c1 3300050514 Bacteria 1197
1089 nmdc:mga08x19_691122_c1 3300050514 Bacteria 724
1090 nmdc:mga0a205_62900_c1 3300050515 Bacteria 3585
1091 Ga0495601_0012252 3300053077 Bacteria 5141
1092 Ga0495601_0015676 3300053077 Bacteria 4582
1093 Ga0495601_0167766 3300053077 Bacteria 1434
1094 Ga0495601_0244147 3300053077 Bacteria 1172
1095 Ga0495601_0297604 3300053077 Bacteria 1051
1096 Ga0495612_0030648 3300053078 Bacteria 2166
1097 Ga0495612_0095619 3300053078 Bacteria 1261
1098 Ga0495612_0098364 3300053078 Bacteria 1244
1099 Ga0495612_0110195 3300053078 Bacteria 1177
1100 Ga0495655_0021716 3300053083 Bacteria 1457
1101 Ga0495655_0035009 3300053083 Bacteria 1246
1102 Ga0495595_0026564 3300053084 Bacteria 2573
1103 Ga0495595_0031260 3300053084 Bacteria 2392
1104 Ga0495595_0158127 3300053084 Bacteria 1117
1105 Ga0495619_0003592 3300053085 Bacteria 9996
1106 Ga0495619_0036099 3300053085 Bacteria 3217
1107 Ga0495619_0115933 3300053085 Bacteria 1833
1108 Ga0495619_0216230 3300053085 Bacteria 1327
1109 Ga0500566_0089234 3300053094 Bacteria 1705
1110 Ga0501084_0000125 3300054114 Bacteria 57691
1111 Ga0501084_0003582 3300054114 Bacteria 12609
1112 Ga0501084_0005571 3300054114 Bacteria 10338
1113 Ga0501084_0012078 3300054114 Bacteria 7152
1114 Ga0501084_0040131 3300054114 Bacteria 3915
1115 Ga0501084_0046874 3300054114 Bacteria 3620
1116 Ga0501084_0060248 3300054114 Bacteria 3177
1117 Ga0501084_0067888 3300054114 Bacteria 2985
1118 Ga0501084_0159974 3300054114 Bacteria 1900
1119 Ga0501084_0305995 3300054114 Bacteria 1342
1120 Ga0501084_0308775 3300054114 Bacteria 1336
1121 Ga0501084_0442662 3300054114 Bacteria 1098
1122 Ga0501084_0450992 3300054114 Bacteria 1087
1123 Ga0501084_0600101 3300054114 Bacteria 930
1124 Ga0501084_0798072 3300054114 Bacteria 795
1125 Ga0590075_014407 3300059424 Bacteria 1933
1126 Ga0587091_014186 3300059511 Bacteria 1293
1127 Ga0587115_049326 3300059626 Bacteria 680
1128 Ga0501082_0011395 3300060353 Bacteria 7649
1129 Ga0501082_0016042 3300060353 Bacteria 6444
1130 Ga0501082_0021659 3300060353 Bacteria 5541
1131 Ga0501082_0030512 3300060353 Bacteria 4645
1132 Ga0501082_0031405 3300060353 Bacteria 4579
1133 Ga0501082_0032987 3300060353 Bacteria 4465
1134 Ga0501082_0049398 3300060353 Bacteria 3627
1135 Ga0501082_0070390 3300060353 Bacteria 3012
1136 Ga0501082_0079300 3300060353 Bacteria 2833
1137 Ga0501082_0084830 3300060353 Bacteria 2731
1138 Ga0501082_0282268 3300060353 Bacteria 1445
1139 Ga0501082_0399182 3300060353 Bacteria 1200
1140 Ga0466962_0052638 3300061719 Bacteria 1945
1141 Ga0466962_0061050 3300061719 Bacteria 1799
1142 Ga0466962_0067913 3300061719 Bacteria 1702
1143 Ga0466962_0233146 3300061719 Bacteria 903
1144 Ga0466962_0327486 3300061719 Bacteria 760
1145 Ga0530510_0001850 3300061734 Bacteria 14459
1146 Ga0530510_0001934 3300061734 Bacteria 14165
1147 Ga0530510_0006651 3300061734 Bacteria 8063
1148 Ga0530510_0010209 3300061734 Bacteria 6580
1149 Ga0530510_0032518 3300061734 Bacteria 3754
1150 Ga0530510_0052620 3300061734 Bacteria 2942
1151 Ga0530510_0130624 3300061734 Bacteria 1848
1152 Ga0530510_0874729 3300061734 Bacteria 686

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100377263 Ga0070662_1003772632 142
2 3300005543 Ga0070672_100064211 Ga0070672_1000642112 142
3 3300009098 Ga0105245_10050741 Ga0105245_100507413 142
4 3300009176 Ga0105242_10017261 Ga0105242_100172618 142
5 3300005338 Ga0068868_100098882 Ga0068868_1000988824 143
6 3300005343 Ga0070687_100073999 Ga0070687_1000739994 143
7 3300005356 Ga0070674_100336072 Ga0070674_1003360721 143
8 3300005546 Ga0070696_100198203 Ga0070696_1001982034 143
9 3300009147 Ga0114129_10220001 Ga0114129_102200015 143
10 3300014326 Ga0157380_10094813 Ga0157380_100948132 143
11 3300017792 Ga0163161_10391273 Ga0163161_103912733 143
12 3300025908 Ga0207643_10012632 Ga0207643_100126327 143
13 3300025918 Ga0207662_10016896 Ga0207662_100168967 143
14 3300025937 Ga0207669_10428016 Ga0207669_104280162 143
15 3300025941 Ga0207711_10254679 Ga0207711_102546793 143
16 3300025981 Ga0207640_10191544 Ga0207640_101915442 143
17 3300026023 Ga0207677_10468320 Ga0207677_104683202 143
18 3300026089 Ga0207648_10042703 Ga0207648_100427036 143
19 3300026142 Ga0207698_11902535 Ga0207698_119025351 143
20 3300045976 Ga0466967_1471974 Ga0466967_1471974_20_553 143
21 3300050507 nmdc:mga05p37_555413_c1 nmdc:mga05p37_555413_c1_653_1186 143
22 3300050509 nmdc:mga0qj67_1148600_c1 nmdc:mga0qj67_1148600_c1_10_543 143
23 3300035170 Ga0373943_0053897 Ga0373943_0053897_1288_1821 144
24 3300035692 Ga0373935_0079916 Ga0373935_0079916_201_734 144
25 3300035695 Ga0373927_0048850 Ga0373927_0048850_1894_2427 144
26 3300035725 Ga0373947_0321031 Ga0373947_0321031_384_917 144
27 3300037068 Ga0373925_0062170 Ga0373925_0062170_1015_1548 144
28 3300046455 Ga0495603_0040839 Ga0495603_0040839_1045_1578 144
29 3300046459 Ga0495629_0001157 Ga0495629_0001157_18639_19172 144
30 3300046461 Ga0495641_0002322 Ga0495641_0002322_4393_4926 144
31 3300046462 Ga0495651_0285830 Ga0495651_0285830_493_1026 144
32 3300046463 Ga0495653_0110292 Ga0495653_0110292_1409_1942 144
33 3300046473 Ga0495582_0000808 Ga0495582_0000808_16372_16905 144
34 3300046475 Ga0495639_0000659 Ga0495639_0000659_579_1112 144
35 3300046476 Ga0495662_0206358 Ga0495662_0206358_384_917 144
36 3300046499 Ga0495594_0037202 Ga0495594_0037202_1404_1937 144
37 3300046514 Ga0495618_0285957 Ga0495618_0285957_86_619 144
38 3300046526 Ga0495666_0008288 Ga0495666_0008288_4092_4625 144
39 3300046531 Ga0495665_0001383 Ga0495665_0001383_8311_8844 144
40 3300046533 Ga0495640_0255781 Ga0495640_0255781_54_587 144
41 3300046535 Ga0495586_0259235 Ga0495586_0259235_119_652 144
42 3300046559 Ga0495667_0149217 Ga0495667_0149217_898_1431 144
43 3300046642 Ga0495634_0031559 Ga0495634_0031559_384_917 144
44 3300046663 Ga0495635_0059021 Ga0495635_0059021_1727_2260 144
45 3300046675 Ga0495657_0192428 Ga0495657_0192428_460_993 144
46 3300046681 Ga0495647_0010914 Ga0495647_0010914_774_1307 144
47 3300046683 Ga0495658_0001453 Ga0495658_0001453_7946_8479 144
48 3300046689 Ga0495613_0168864 Ga0495613_0168864_485_1018 144
49 3300046690 Ga0495624_0011808 Ga0495624_0011808_4976_5509 144
50 3300047315 Ga0495581_0001143 Ga0495581_0001143_11792_12325 144
51 3300047319 Ga0495674_0138750 Ga0495674_0138750_976_1509 144
52 3300047321 Ga0495676_0016334 Ga0495676_0016334_4274_4807 144
53 3300047322 Ga0495680_0286568 Ga0495680_0286568_72_605 144
54 3300047471 Ga0495684_0076140 Ga0495684_0076140_1940_2473 144
55 3300047673 Ga0495593_0004784 Ga0495593_0004784_3360_3893 144
56 3300048089 Ga0495614_0004362 Ga0495614_0004362_4211_4744 144
57 3300053078 Ga0495612_0030648 Ga0495612_0030648_1587_2120 144
58 3300053084 Ga0495595_0158127 Ga0495595_0158127_79_612 144
59 3300053085 Ga0495619_0115933 Ga0495619_0115933_1245_1778 144
60 3300005331 Ga0070670_100002726 Ga0070670_10000272616 145
61 3300005334 Ga0068869_100022221 Ga0068869_1000222217 145
62 3300005355 Ga0070671_100107077 Ga0070671_1001070775 145
63 3300005365 Ga0070688_100010080 Ga0070688_1000100809 145
64 3300005366 Ga0070659_100461407 Ga0070659_1004614073 145
65 3300005466 Ga0070685_10005868 Ga0070685_100058688 145
66 3300005535 Ga0070684_100022860 Ga0070684_10002286010 145
67 3300005549 Ga0070704_100340969 Ga0070704_1003409693 145
68 3300005615 Ga0070702_100014750 Ga0070702_1000147507 145
69 3300005617 Ga0068859_100194972 Ga0068859_1001949722 145
70 3300005618 Ga0068864_100008046 Ga0068864_1000080461 145
71 3300005840 Ga0068870_10129624 Ga0068870_101296243 145
72 3300006931 Ga0097620_100194983 Ga0097620_1001949832 145
73 3300009177 Ga0105248_10266891 Ga0105248_102668912 145
74 3300011119 Ga0105246_10260717 Ga0105246_102607173 145
75 3300013308 Ga0157375_10047233 Ga0157375_100472336 145
76 3300014745 Ga0157377_10045735 Ga0157377_100457355 145
77 3300025925 Ga0207650_10018684 Ga0207650_1001868410 145
78 3300025926 Ga0207659_10046963 Ga0207659_100469634 145
79 3300025942 Ga0207689_10032263 Ga0207689_100322632 145
80 3300025945 Ga0207679_10092595 Ga0207679_100925954 145
81 3300026095 Ga0207676_10113884 Ga0207676_101138845 145
82 3300028379 Ga0268266_10043001 Ga0268266_100430015 145
83 3300048913 Ga0496110_0169073 Ga0496110_0169073_32_565 145
84 3300049575 Ga0501039_0340275 Ga0501039_0340275_46_579 145
85 3300049576 Ga0501040_0269412 Ga0501040_0269412_347_880 145
86 3300049577 Ga0501041_0401617 Ga0501041_0401617_93_626 145
87 3300049588 Ga0501072_0188856 Ga0501072_0188856_210_743 145
88 3300049591 Ga0501075_0583917 Ga0501075_0583917_47_580 145
89 3300049592 Ga0501076_0018971 Ga0501076_0018971_301_834 145
90 3300049741 Ga0501079_0062704 Ga0501079_0062704_461_994 145
91 3300049743 Ga0501081_0017769 Ga0501081_0017769_873_1406 145
92 3300049824 Ga0501045_0077628 Ga0501045_0077628_654_1187 145
93 3300060353 Ga0501082_0070390 Ga0501082_0070390_800_1333 145
94 3300061734 Ga0530510_0006651 Ga0530510_0006651_3923_4456 145
95 3300048910 Ga0496107_0571075 Ga0496107_0571075_292_825 147
96 3300049585 Ga0501069_0362565 Ga0501069_0362565_68_601 147
97 3300035083 Ga0373926_0086955 Ga0373926_0086955_414_947 148
98 3300035170 Ga0373943_0057742 Ga0373943_0057742_719_1252 148
99 3300035171 Ga0373946_0063508 Ga0373946_0063508_870_1403 148
100 3300035692 Ga0373935_0319526 Ga0373935_0319526_502_1035 148
101 3300035725 Ga0373947_0021201 Ga0373947_0021201_799_1332 148
102 3300037068 Ga0373925_0177521 Ga0373925_0177521_966_1499 148
103 3300046455 Ga0495603_0043193 Ga0495603_0043193_1095_1628 148
104 3300046499 Ga0495594_0284652 Ga0495594_0284652_27_560 148
105 3300046517 Ga0495630_0207836 Ga0495630_0207836_428_961 148
106 3300046674 Ga0495588_0260965 Ga0495588_0260965_368_901 148
107 3300046690 Ga0495624_0079393 Ga0495624_0079393_502_1035 148
108 3300047321 Ga0495676_0070005 Ga0495676_0070005_420_953 148
109 3300047673 Ga0495593_0092131 Ga0495593_0092131_431_964 148
110 3300025899 Ga0207642_10033564 Ga0207642_100335642 149
111 3300049575 Ga0501039_0132026 Ga0501039_0132026_588_1121 149
112 3300049576 Ga0501040_0602148 Ga0501040_0602148_167_700 149
113 3300049579 Ga0501043_0832755 Ga0501043_0832755_43_576 149
114 3300044694 Ga0466963_0184877 Ga0466963_0184877_725_1258 150
115 3300044706 Ga0466964_0031729 Ga0466964_0031729_925_1458 150
116 3300045976 Ga0466967_0046458 Ga0466967_0046458_2233_2766 150
117 3300045976 Ga0466967_0075823 Ga0466967_0075823_1243_1776 150
118 3300011119 Ga0105246_10353928 Ga0105246_103539282 152
119 3300038726 Ga0400490_17491 Ga0400490_17491_6522_7061 152
120 3300038727 Ga0400491_12215 Ga0400491_12215_6561_7100 152
121 3300044683 Ga0466965_0923505 Ga0466965_0923505_32_490 152
122 3300046454 Ga0495592_0770835 Ga0495592_0770835_103_561 152
123 3300050507 nmdc:mga05p37_10099_c1 nmdc:mga05p37_10099_c1_2470_3003 152
124 3300050511 nmdc:mga08y16_1089817_c1 nmdc:mga08y16_1089817_c1_154_687 152
125 3300061719 Ga0466962_0233146 Ga0466962_0233146_175_708 152
126 3300003373 JGI25407J50210_10006859 JGI25407J50210_100068594 153
127 3300005981 Ga0081538_10000515 Ga0081538_1000051546 153
128 3300006847 Ga0075431_100145840 Ga0075431_1001458404 153
129 3300006880 Ga0075429_100140179 Ga0075429_1001401792 153
130 3300014497 Ga0182008_10618451 Ga0182008_106184511 153
131 3300048905 Ga0496102_1297569 Ga0496102_1297569_171_632 153
132 3300049568 Ga0501031_0002118 Ga0501031_0002118_7486_7947 153
133 3300049568 Ga0501031_0005180 Ga0501031_0005180_7217_7750 153
134 3300049569 Ga0501032_0044036 Ga0501032_0044036_1949_2410 153
135 3300049569 Ga0501032_0239962 Ga0501032_0239962_205_738 153
136 3300049570 Ga0501033_0003063 Ga0501033_0003063_11492_11953 153
137 3300049572 Ga0501036_0086042 Ga0501036_0086042_81_542 153
138 3300049573 Ga0501037_0040595 Ga0501037_0040595_2749_3210 153
139 3300049573 Ga0501037_0275252 Ga0501037_0275252_358_891 153
140 3300049574 Ga0501038_0012658 Ga0501038_0012658_3424_3885 153
141 3300049574 Ga0501038_0695045 Ga0501038_0695045_182_715 153
142 3300049575 Ga0501039_0010859 Ga0501039_0010859_6266_6727 153
143 3300049575 Ga0501039_0223910 Ga0501039_0223910_818_1351 153
144 3300049576 Ga0501040_0014970 Ga0501040_0014970_1921_2382 153
145 3300049577 Ga0501041_0001660 Ga0501041_0001660_4596_5057 153
146 3300049577 Ga0501041_0036262 Ga0501041_0036262_1249_1782 153
147 3300049578 Ga0501042_0020347 Ga0501042_0020347_2244_2705 153
148 3300049578 Ga0501042_0076737 Ga0501042_0076737_1240_1773 153
149 3300049579 Ga0501043_0020037 Ga0501043_0020037_215_676 153
150 3300049579 Ga0501043_0216269 Ga0501043_0216269_38_499 153
151 3300049580 Ga0501046_0006809 Ga0501046_0006809_5615_6076 153
152 3300049581 Ga0501047_0023307 Ga0501047_0023307_911_1372 153
153 3300049582 Ga0501048_0006265 Ga0501048_0006265_4574_5035 153
154 3300049582 Ga0501048_0092533 Ga0501048_0092533_696_1229 153
155 3300049583 Ga0501067_0031044 Ga0501067_0031044_1924_2385 153
156 3300049584 Ga0501068_0003273 Ga0501068_0003273_5358_5819 153
157 3300049585 Ga0501069_0003229 Ga0501069_0003229_5954_6415 153
158 3300049586 Ga0501070_0181280 Ga0501070_0181280_1173_1706 153
159 3300049587 Ga0501071_0010486 Ga0501071_0010486_3830_4291 153
160 3300049588 Ga0501072_0053837 Ga0501072_0053837_581_1114 153
161 3300049589 Ga0501073_0013552 Ga0501073_0013552_4568_5029 153
162 3300049590 Ga0501074_0002634 Ga0501074_0002634_2742_3203 153
163 3300049591 Ga0501075_0008555 Ga0501075_0008555_2849_3310 153
164 3300049591 Ga0501075_0138840 Ga0501075_0138840_352_885 153
165 3300049592 Ga0501076_0009171 Ga0501076_0009171_6652_7185 153
166 3300049592 Ga0501076_0010290 Ga0501076_0010290_169_630 153
167 3300049593 Ga0501077_0002204 Ga0501077_0002204_5260_5721 153
168 3300049593 Ga0501077_0221186 Ga0501077_0221186_39_500 153
169 3300049593 Ga0501077_0307363 Ga0501077_0307363_511_972 153
170 3300049593 Ga0501077_0330346 Ga0501077_0330346_209_742 153
171 3300049741 Ga0501079_0000076 Ga0501079_0000076_41983_42444 153
172 3300049742 Ga0501080_0029054 Ga0501080_0029054_4471_4932 153
173 3300049742 Ga0501080_0105638 Ga0501080_0105638_616_1149 153
174 3300049743 Ga0501081_0140333 Ga0501081_0140333_169_630 153
175 3300049743 Ga0501081_0243867 Ga0501081_0243867_811_1272 153
176 3300049743 Ga0501081_0475259 Ga0501081_0475259_446_907 153
177 3300049744 Ga0501083_0006583 Ga0501083_0006583_5891_6352 153
178 3300049822 Ga0501035_0045094 Ga0501035_0045094_519_980 153
179 3300049823 Ga0501044_0018755 Ga0501044_0018755_787_1248 153
180 3300049824 Ga0501045_0000077 Ga0501045_0000077_11637_12098 153
181 3300049824 Ga0501045_0070095 Ga0501045_0070095_34_495 153
182 3300050507 nmdc:mga05p37_200451_c1 nmdc:mga05p37_200451_c1_656_1117 153
183 3300050508 nmdc:mga09592_5692_c1 nmdc:mga09592_5692_c1_4058_4519 153
184 3300050510 nmdc:mga06r32_210913_c1 nmdc:mga06r32_210913_c1_494_955 153
185 3300054114 Ga0501084_0000125 Ga0501084_0000125_48412_48873 153
186 3300060353 Ga0501082_0016042 Ga0501082_0016042_5946_6407 153
187 3300060353 Ga0501082_0030512 Ga0501082_0030512_4016_4477 153
188 3300060353 Ga0501082_0079300 Ga0501082_0079300_2182_2715 153
189 3300061734 Ga0530510_0001934 Ga0530510_0001934_7682_8143 153
190 3300037418 Ga0395900_0752662 Ga0395900_0752662_60_524 154
191 3300037466 Ga0395898_0091882 Ga0395898_0091882_2373_2837 154
192 3300038443 Ga0395901_0212831 Ga0395901_0212831_546_1010 154
193 3300045976 Ga0466967_0039139 Ga0466967_0039139_11_475 154
194 3300049581 Ga0501047_1210379 Ga0501047_1210379_50_532 154
195 3300049582 Ga0501048_0367479 Ga0501048_0367479_547_1011 154
196 3300046528 Ga0495642_0354807 Ga0495642_0354807_52_585 155
197 3300047471 Ga0495684_0280426 Ga0495684_0280426_367_900 155
198 3300005364 Ga0070673_100009174 Ga0070673_1000091748 157
199 3300005441 Ga0070700_100048730 Ga0070700_1000487301 157
200 3300005718 Ga0068866_10047907 Ga0068866_100479075 157
201 3300025901 Ga0207688_10000094 Ga0207688_1000009443 157
202 3300025929 Ga0207664_10025458 Ga0207664_100254583 157
203 3300025938 Ga0207704_10335079 Ga0207704_103350792 157
204 3300026088 Ga0207641_11482352 Ga0207641_114823522 157
205 3300050511 nmdc:mga08y16_131091_c1 nmdc:mga08y16_131091_c1_1423_1956 158
206 3300048915 Ga0496112_0059463 Ga0496112_0059463_654_1157 159
207 3300049583 Ga0501067_0069254 Ga0501067_0069254_1054_1587 159
208 3300049584 Ga0501068_0017184 Ga0501068_0017184_1570_2103 159
209 3300049585 Ga0501069_0088552 Ga0501069_0088552_388_921 159
210 3300061734 Ga0530510_0874729 Ga0530510_0874729_121_654 159
211 3300048903 Ga0496100_0276059 Ga0496100_0276059_739_1221 160
212 3300035398 Ga0316574_0171894 Ga0316574_0171894_714_1217 161
213 3300039453 Ga0436362_1022308 Ga0436362_1022308_246_779 161
214 3300005331 Ga0070670_100091757 Ga0070670_1000917575 162
215 3300005356 Ga0070674_100106394 Ga0070674_1001063944 162
216 3300005356 Ga0070674_100604946 Ga0070674_1006049461 162
217 3300005456 Ga0070678_100943477 Ga0070678_1009434771 162
218 3300005457 Ga0070662_101042223 Ga0070662_1010422231 162
219 3300005459 Ga0068867_100768082 Ga0068867_1007680821 162
220 3300005518 Ga0070699_100149836 Ga0070699_1001498365 162
221 3300005577 Ga0068857_100035784 Ga0068857_1000357847 162
222 3300005840 Ga0068870_10040559 Ga0068870_100405595 162
223 3300005840 Ga0068870_10073954 Ga0068870_100739543 162
224 3300005937 Ga0081455_10013977 Ga0081455_1001397713 162
225 3300005981 Ga0081538_10139009 Ga0081538_101390092 162
226 3300006844 Ga0075428_100634603 Ga0075428_1006346032 162
227 3300006881 Ga0068865_100076824 Ga0068865_1000768245 162
228 3300009148 Ga0105243_10120150 Ga0105243_101201503 162
229 3300014969 Ga0157376_10709745 Ga0157376_107097452 162
230 3300025908 Ga0207643_10018007 Ga0207643_100180075 162
231 3300025908 Ga0207643_10019179 Ga0207643_100191792 162
232 3300025925 Ga0207650_10030694 Ga0207650_100306946 162
233 3300025935 Ga0207709_10056512 Ga0207709_100565125 162
234 3300025935 Ga0207709_10260242 Ga0207709_102602422 162
235 3300025937 Ga0207669_10075819 Ga0207669_100758191 162
236 3300025938 Ga0207704_10071929 Ga0207704_100719292 162
237 3300025940 Ga0207691_10781154 Ga0207691_107811542 162
238 3300026089 Ga0207648_10780212 Ga0207648_107802122 162
239 3300026116 Ga0207674_10055770 Ga0207674_100557705 162
240 3300026121 Ga0207683_10161304 Ga0207683_101613042 162
241 3300038443 Ga0395901_0074476 Ga0395901_0074476_1041_1529 162
242 3300042122 Ga0450920_002132 Ga0450920_002132_235_723 162
243 3300042146 Ga0450907_001870 Ga0450907_001870_2711_3199 162
244 3300049568 Ga0501031_0340727 Ga0501031_0340727_196_684 162
245 3300049569 Ga0501032_0093895 Ga0501032_0093895_1217_1705 162
246 3300049570 Ga0501033_0032660 Ga0501033_0032660_606_1094 162
247 3300049572 Ga0501036_0009021 Ga0501036_0009021_5821_6309 162
248 3300049573 Ga0501037_0013457 Ga0501037_0013457_3645_4133 162
249 3300049573 Ga0501037_0329506 Ga0501037_0329506_407_895 162
250 3300049574 Ga0501038_0002469 Ga0501038_0002469_15370_15858 162
251 3300049575 Ga0501039_0004772 Ga0501039_0004772_7866_8354 162
252 3300049576 Ga0501040_0023663 Ga0501040_0023663_3323_3811 162
253 3300049576 Ga0501040_0119856 Ga0501040_0119856_991_1479 162
254 3300049577 Ga0501041_0004355 Ga0501041_0004355_6172_6660 162
255 3300049578 Ga0501042_0000667 Ga0501042_0000667_3525_4013 162
256 3300049580 Ga0501046_0006661 Ga0501046_0006661_7865_8353 162
257 3300049582 Ga0501048_0004215 Ga0501048_0004215_1724_2212 162
258 3300049584 Ga0501068_0017701 Ga0501068_0017701_1722_2210 162
259 3300049586 Ga0501070_0007966 Ga0501070_0007966_1364_1852 162
260 3300049587 Ga0501071_0172866 Ga0501071_0172866_265_753 162
261 3300049588 Ga0501072_0012923 Ga0501072_0012923_2465_2953 162
262 3300049589 Ga0501073_0141779 Ga0501073_0141779_1123_1611 162
263 3300049590 Ga0501074_0001000 Ga0501074_0001000_8186_8674 162
264 3300049591 Ga0501075_0284160 Ga0501075_0284160_287_775 162
265 3300049592 Ga0501076_0007318 Ga0501076_0007318_4617_5105 162
266 3300049593 Ga0501077_0007498 Ga0501077_0007498_6057_6545 162
267 3300049741 Ga0501079_0006042 Ga0501079_0006042_4800_5288 162
268 3300049741 Ga0501079_0360704 Ga0501079_0360704_262_750 162
269 3300049742 Ga0501080_0012861 Ga0501080_0012861_1833_2321 162
270 3300049743 Ga0501081_0024644 Ga0501081_0024644_2192_2680 162
271 3300049744 Ga0501083_0023084 Ga0501083_0023084_2103_2591 162
272 3300049822 Ga0501035_0021361 Ga0501035_0021361_4187_4675 162
273 3300049823 Ga0501044_0126002 Ga0501044_0126002_896_1384 162
274 3300049824 Ga0501045_0001835 Ga0501045_0001835_9297_9785 162
275 3300050507 nmdc:mga05p37_183984_c1 nmdc:mga05p37_183984_c1_1673_2161 162
276 3300054114 Ga0501084_0060248 Ga0501084_0060248_2140_2628 162
277 3300054114 Ga0501084_0450992 Ga0501084_0450992_62_550 162
278 3300060353 Ga0501082_0032987 Ga0501082_0032987_3768_4256 162
279 3300005436 Ga0070713_100163538 Ga0070713_1001635385 163
280 3300005444 Ga0070694_100095994 Ga0070694_1000959944 163
281 3300006173 Ga0070716_100028679 Ga0070716_1000286792 163
282 3300006846 Ga0075430_100236322 Ga0075430_1002363222 163
283 3300013105 Ga0157369_10035022 Ga0157369_100350228 163
284 3300025928 Ga0207700_10000001 Ga0207700_1000000188 163
285 3300026121 Ga0207683_10221925 Ga0207683_102219254 163
286 3300027907 Ga0207428_10512868 Ga0207428_105128682 163
287 3300037312 Ga0395899_0153589 Ga0395899_0153589_221_712 163
288 3300037471 Ga0395905_0342344 Ga0395905_0342344_418_909 163
289 3300046525 Ga0495663_0025814 Ga0495663_0025814_1187_1678 163
290 3300048913 Ga0496110_0023971 Ga0496110_0023971_737_1228 163
291 3300048914 Ga0496111_0033779 Ga0496111_0033779_1307_1798 163
292 3300049568 Ga0501031_0114103 Ga0501031_0114103_30_521 163
293 3300049569 Ga0501032_0004421 Ga0501032_0004421_3348_3839 163
294 3300049570 Ga0501033_0075805 Ga0501033_0075805_30_521 163
295 3300049572 Ga0501036_0003710 Ga0501036_0003710_8402_8893 163
296 3300049573 Ga0501037_0059507 Ga0501037_0059507_348_839 163
297 3300049574 Ga0501038_0096442 Ga0501038_0096442_30_521 163
298 3300049575 Ga0501039_0015250 Ga0501039_0015250_30_521 163
299 3300049576 Ga0501040_0000912 Ga0501040_0000912_16794_17285 163
300 3300049577 Ga0501041_0001188 Ga0501041_0001188_8825_9316 163
301 3300049578 Ga0501042_0035028 Ga0501042_0035028_2252_2743 163
302 3300049579 Ga0501043_0084192 Ga0501043_0084192_118_609 163
303 3300049580 Ga0501046_0004156 Ga0501046_0004156_4694_5185 163
304 3300049581 Ga0501047_0021018 Ga0501047_0021018_861_1352 163
305 3300049582 Ga0501048_0023093 Ga0501048_0023093_2976_3467 163
306 3300049583 Ga0501067_0126627 Ga0501067_0126627_521_1054 163
307 3300049584 Ga0501068_0010460 Ga0501068_0010460_30_521 163
308 3300049585 Ga0501069_0022228 Ga0501069_0022228_1321_1812 163
309 3300049586 Ga0501070_0094901 Ga0501070_0094901_30_521 163
310 3300049587 Ga0501071_0074357 Ga0501071_0074357_1201_1692 163
311 3300049588 Ga0501072_0033633 Ga0501072_0033633_788_1279 163
312 3300049590 Ga0501074_0040628 Ga0501074_0040628_1798_2289 163
313 3300049591 Ga0501075_0001943 Ga0501075_0001943_5361_5852 163
314 3300049592 Ga0501076_0008207 Ga0501076_0008207_1798_2289 163
315 3300049593 Ga0501077_0001912 Ga0501077_0001912_4471_4962 163
316 3300049741 Ga0501079_0003409 Ga0501079_0003409_4876_5367 163
317 3300049742 Ga0501080_0032304 Ga0501080_0032304_2592_3083 163
318 3300049743 Ga0501081_0006383 Ga0501081_0006383_1798_2289 163
319 3300049744 Ga0501083_0011542 Ga0501083_0011542_345_836 163
320 3300049822 Ga0501035_0034996 Ga0501035_0034996_1948_2439 163
321 3300049823 Ga0501044_0122766 Ga0501044_0122766_30_521 163
322 3300049824 Ga0501045_0049099 Ga0501045_0049099_788_1279 163
323 3300054114 Ga0501084_0003582 Ga0501084_0003582_9380_9871 163
324 3300060353 Ga0501082_0011395 Ga0501082_0011395_1798_2289 163
325 3300061734 Ga0530510_0001850 Ga0530510_0001850_8608_9099 163
326 3300009148 Ga0105243_10244316 Ga0105243_102443163 164
327 3300049582 Ga0501048_0675448 Ga0501048_0675448_19_552 165
328 3300049588 Ga0501072_0276702 Ga0501072_0276702_286_819 165
329 3300054114 Ga0501084_0798072 Ga0501084_0798072_245_778 165
330 3300025918 Ga0207662_10484022 Ga0207662_104840222 166
331 3300035242 Ga0373962_0174743 Ga0373962_0174743_198_704 166
332 3300006852 Ga0075433_10453679 Ga0075433_104536792 167
333 3300039437 Ga0436365_1358796 Ga0436365_1358796_179_712 167
334 3300046516 Ga0495628_0693428 Ga0495628_0693428_25_528 167
335 3300054114 Ga0501084_0067888 Ga0501084_0067888_20_523 167
336 3300037312 Ga0395899_0190775 Ga0395899_0190775_488_1021 170
337 3300037418 Ga0395900_0011178 Ga0395900_0011178_7207_7740 170
338 3300037466 Ga0395898_0297972 Ga0395898_0297972_670_1203 170
339 3300037471 Ga0395905_0055653 Ga0395905_0055653_322_855 170
340 3300038443 Ga0395901_0019091 Ga0395901_0019091_2216_2749 170
341 3300044673 Ga0453683_0088991 Ga0453683_0088991_484_1005 171
342 3300006028 Ga0070717_10069262 Ga0070717_100692623 172
343 3300031251 Ga0265327_10035110 Ga0265327_100351103 172
344 iso_pu_bacteria 2524614857 2526062871 173
345 iso_pu_bacteria 2739367875 2740063893 173
346 iso_pu_bacteria 8055588893 8055591283 174
347 3300005329 Ga0070683_100053944 Ga0070683_1000539444 177
348 3300005329 Ga0070683_101062045 Ga0070683_1010620452 177
349 3300005336 Ga0070680_100098314 Ga0070680_1000983144 177
350 3300005336 Ga0070680_100123282 Ga0070680_1001232823 177
351 3300005337 Ga0070682_100189583 Ga0070682_1001895832 177
352 3300005337 Ga0070682_100727505 Ga0070682_1007275051 177
353 3300005339 Ga0070660_100766323 Ga0070660_1007663232 177
354 3300005341 Ga0070691_10030122 Ga0070691_100301225 177
355 3300005344 Ga0070661_100040522 Ga0070661_1000405227 177
356 3300005355 Ga0070671_100068504 Ga0070671_1000685043 177
357 3300005355 Ga0070671_100894008 Ga0070671_1008940081 177
358 3300005434 Ga0070709_10017436 Ga0070709_100174367 177
359 3300005435 Ga0070714_100023042 Ga0070714_1000230428 177
360 3300005435 Ga0070714_100138461 Ga0070714_1001384613 177
361 3300005435 Ga0070714_100171566 Ga0070714_1001715662 177
362 3300005435 Ga0070714_100542659 Ga0070714_1005426592 177
363 3300005435 Ga0070714_101254020 Ga0070714_1012540201 177
364 3300005436 Ga0070713_100001889 Ga0070713_10000188912 177
365 3300005436 Ga0070713_100035918 Ga0070713_1000359183 177
366 3300005437 Ga0070710_10010919 Ga0070710_100109197 177
367 3300005437 Ga0070710_10055055 Ga0070710_100550552 177
368 3300005439 Ga0070711_100175072 Ga0070711_1001750723 177
369 3300005439 Ga0070711_100258287 Ga0070711_1002582872 177
370 3300005439 Ga0070711_100961031 Ga0070711_1009610311 177
371 3300005440 Ga0070705_100023560 Ga0070705_1000235607 177
372 3300005445 Ga0070708_100361595 Ga0070708_1003615953 177
373 3300005456 Ga0070678_100651518 Ga0070678_1006515181 177
374 3300005456 Ga0070678_100691956 Ga0070678_1006919562 177
375 3300005458 Ga0070681_10015900 Ga0070681_100159004 177
376 3300005458 Ga0070681_10154710 Ga0070681_101547102 177
377 3300005468 Ga0070707_100001557 Ga0070707_1000015576 177
378 3300005530 Ga0070679_100029555 Ga0070679_1000295555 177
379 3300005535 Ga0070684_100156385 Ga0070684_1001563852 177
380 3300005535 Ga0070684_100402869 Ga0070684_1004028691 177
381 3300005539 Ga0068853_100284547 Ga0068853_1002845473 177
382 3300005545 Ga0070695_100001595 Ga0070695_1000015959 177
383 3300005549 Ga0070704_100191887 Ga0070704_1001918872 177
384 3300005563 Ga0068855_100939809 Ga0068855_1009398092 177
385 3300005564 Ga0070664_100007134 Ga0070664_10000713415 177
386 3300005577 Ga0068857_100138893 Ga0068857_1001388931 177
387 3300005577 Ga0068857_100222749 Ga0068857_1002227494 177
388 3300005614 Ga0068856_100056684 Ga0068856_1000566842 177
389 3300005614 Ga0068856_100432985 Ga0068856_1004329852 177
390 3300005614 Ga0068856_100601606 Ga0068856_1006016062 177
391 3300005615 Ga0070702_100242311 Ga0070702_1002423112 177
392 3300005616 Ga0068852_100215349 Ga0068852_1002153494 177
393 3300005618 Ga0068864_100145545 Ga0068864_1001455453 177
394 3300005841 Ga0068863_100246016 Ga0068863_1002460162 177
395 3300005844 Ga0068862_100860677 Ga0068862_1008606772 177
396 3300005937 Ga0081455_10050855 Ga0081455_100508552 177
397 3300006028 Ga0070717_10012019 Ga0070717_100120192 177
398 3300006028 Ga0070717_10024999 Ga0070717_100249995 177
399 3300006028 Ga0070717_10032247 Ga0070717_100322473 177
400 3300006028 Ga0070717_10190202 Ga0070717_101902024 177
401 3300006028 Ga0070717_10575879 Ga0070717_105758792 177
402 3300006038 Ga0075365_10618456 Ga0075365_106184562 177
403 3300006163 Ga0070715_10009632 Ga0070715_100096323 177
404 3300006173 Ga0070716_100047618 Ga0070716_1000476182 177
405 3300006175 Ga0070712_100093717 Ga0070712_1000937172 177
406 3300006175 Ga0070712_100107998 Ga0070712_1001079982 177
407 3300006175 Ga0070712_100196031 Ga0070712_1001960313 177
408 3300006844 Ga0075428_100662417 Ga0075428_1006624173 177
409 3300006847 Ga0075431_100004224 Ga0075431_10000422418 177
410 3300006880 Ga0075429_100011161 Ga0075429_1000111616 177
411 3300006914 Ga0075436_100438644 Ga0075436_1004386441 177
412 3300009093 Ga0105240_10134085 Ga0105240_101340857 177
413 3300009093 Ga0105240_10689056 Ga0105240_106890562 177
414 3300009094 Ga0111539_10065262 Ga0111539_100652626 177
415 3300009094 Ga0111539_10665582 Ga0111539_106655823 177
416 3300009094 Ga0111539_10998168 Ga0111539_109981682 177
417 3300009101 Ga0105247_10331647 Ga0105247_103316472 177
418 3300009147 Ga0114129_10035990 Ga0114129_100359904 177
419 3300009147 Ga0114129_10154347 Ga0114129_101543473 177
420 3300009147 Ga0114129_10211509 Ga0114129_102115093 177
421 3300009176 Ga0105242_10019594 Ga0105242_100195943 177
422 3300009177 Ga0105248_10914761 Ga0105248_109147613 177
423 3300009545 Ga0105237_10429166 Ga0105237_104291661 177
424 3300009551 Ga0105238_10270169 Ga0105238_102701693 177
425 3300010375 Ga0105239_10294777 Ga0105239_102947773 177
426 3300010375 Ga0105239_11633232 Ga0105239_116332322 177
427 3300011119 Ga0105246_10349304 Ga0105246_103493042 177
428 3300012508 Ga0157315_1004064 Ga0157315_10040642 177
429 3300013296 Ga0157374_10575437 Ga0157374_105754372 177
430 3300013296 Ga0157374_11753115 Ga0157374_117531151 177
431 3300013306 Ga0163162_11547895 Ga0163162_115478951 177
432 3300013307 Ga0157372_10048166 Ga0157372_100481664 177
433 3300013307 Ga0157372_10370753 Ga0157372_103707533 177
434 3300013307 Ga0157372_11145923 Ga0157372_111459232 177
435 3300014325 Ga0163163_10356316 Ga0163163_103563162 177
436 3300014326 Ga0157380_10462836 Ga0157380_104628362 177
437 3300014497 Ga0182008_10247557 Ga0182008_102475572 177
438 3300014968 Ga0157379_10689001 Ga0157379_106890012 177
439 3300014969 Ga0157376_10126357 Ga0157376_101263572 177
440 3300020070 Ga0206356_10473551 Ga0206356_104735512 177
441 3300021441 Ga0213871_10031694 Ga0213871_100316942 177
442 3300022467 Ga0224712_10064454 Ga0224712_100644543 177
443 3300022467 Ga0224712_10168148 Ga0224712_101681482 177
444 3300025898 Ga0207692_10034920 Ga0207692_100349205 177
445 3300025898 Ga0207692_10420172 Ga0207692_104201722 177
446 3300025898 Ga0207692_10455059 Ga0207692_104550591 177
447 3300025900 Ga0207710_10269904 Ga0207710_102699041 177
448 3300025905 Ga0207685_10421115 Ga0207685_104211152 177
449 3300025906 Ga0207699_10022230 Ga0207699_100222305 177
450 3300025906 Ga0207699_10933990 Ga0207699_109339901 177
451 3300025910 Ga0207684_10061237 Ga0207684_100612374 177
452 3300025912 Ga0207707_10108421 Ga0207707_101084214 177
453 3300025912 Ga0207707_10214293 Ga0207707_102142932 177
454 3300025913 Ga0207695_10443156 Ga0207695_104431562 177
455 3300025913 Ga0207695_10608670 Ga0207695_106086702 177
456 3300025913 Ga0207695_10758460 Ga0207695_107584602 177
457 3300025914 Ga0207671_10102167 Ga0207671_101021675 177
458 3300025915 Ga0207693_10009230 Ga0207693_1000923013 177
459 3300025915 Ga0207693_10163875 Ga0207693_101638752 177
460 3300025915 Ga0207693_10245231 Ga0207693_102452313 177
461 3300025916 Ga0207663_10007294 Ga0207663_100072947 177
462 3300025916 Ga0207663_10137312 Ga0207663_101373122 177
463 3300025919 Ga0207657_10009472 Ga0207657_100094729 177
464 3300025921 Ga0207652_10096320 Ga0207652_100963205 177
465 3300025922 Ga0207646_10000851 Ga0207646_1000085116 177
466 3300025924 Ga0207694_10075978 Ga0207694_100759784 177
467 3300025927 Ga0207687_10109632 Ga0207687_101096323 177
468 3300025927 Ga0207687_10614904 Ga0207687_106149041 177
469 3300025928 Ga0207700_10045665 Ga0207700_100456653 177
470 3300025928 Ga0207700_10047734 Ga0207700_100477343 177
471 3300025929 Ga0207664_10038854 Ga0207664_100388546 177
472 3300025929 Ga0207664_10096443 Ga0207664_100964434 177
473 3300025929 Ga0207664_10137050 Ga0207664_101370504 177
474 3300025929 Ga0207664_10194359 Ga0207664_101943593 177
475 3300025929 Ga0207664_10204157 Ga0207664_102041572 177
476 3300025931 Ga0207644_10164705 Ga0207644_101647053 177
477 3300025931 Ga0207644_10822363 Ga0207644_108223632 177
478 3300025932 Ga0207690_10697385 Ga0207690_106973852 177
479 3300025939 Ga0207665_10000058 Ga0207665_100000582 177
480 3300025939 Ga0207665_10549878 Ga0207665_105498781 177
481 3300025941 Ga0207711_10110013 Ga0207711_101100134 177
482 3300025942 Ga0207689_10663114 Ga0207689_106631142 177
483 3300025944 Ga0207661_10863333 Ga0207661_108633332 177
484 3300025945 Ga0207679_10054481 Ga0207679_100544813 177
485 3300025949 Ga0207667_10381044 Ga0207667_103810442 177
486 3300026041 Ga0207639_11048843 Ga0207639_110488431 177
487 3300026075 Ga0207708_10490920 Ga0207708_104909202 177
488 3300026088 Ga0207641_10235360 Ga0207641_102353603 177
489 3300026116 Ga0207674_10153021 Ga0207674_101530215 177
490 3300026118 Ga0207675_100553554 Ga0207675_1005535542 177
491 3300027907 Ga0207428_10019256 Ga0207428_100192566 177
492 3300027907 Ga0207428_10320405 Ga0207428_103204052 177
493 3300028380 Ga0268265_10526911 Ga0268265_105269112 177
494 3300028556 Ga0265337_1061382 Ga0265337_10613822 177
495 3300028573 Ga0265334_10010285 Ga0265334_100102853 177
496 3300028654 Ga0265322_10062119 Ga0265322_100621192 177
497 3300028666 Ga0265336_10001318 Ga0265336_100013188 177
498 3300028800 Ga0265338_10012206 Ga0265338_1001220610 177
499 3300031595 Ga0265313_10050529 Ga0265313_100505293 177
500 3300032133 Ga0316583_10026202 Ga0316583_100262024 177
501 3300032168 Ga0316593_10010384 Ga0316593_100103843 177
502 3300033541 Ga0316596_1017568 Ga0316596_10175682 177
503 3300035083 Ga0373926_0005643 Ga0373926_0005643_876_1409 177
504 3300035084 Ga0373928_0016089 Ga0373928_0016089_283_816 177
505 3300035086 Ga0373934_0023921 Ga0373934_0023921_954_1487 177
506 3300035090 Ga0373949_0014842 Ga0373949_0014842_305_838 177
507 3300035092 Ga0373952_0036322 Ga0373952_0036322_443_976 177
508 3300035111 Ga0373923_0165417 Ga0373923_0165417_355_888 177
509 3300035113 Ga0373936_0015763 Ga0373936_0015763_283_816 177
510 3300035114 Ga0373939_0031302 Ga0373939_0031302_55_588 177
511 3300035116 Ga0373945_0027844 Ga0373945_0027844_831_1364 177
512 3300035117 Ga0373953_0116309 Ga0373953_0116309_16_549 177
513 3300035119 Ga0373956_0062256 Ga0373956_0062256_411_944 177
514 3300035121 Ga0373960_0021225 Ga0373960_0021225_182_715 177
515 3300035170 Ga0373943_0007053 Ga0373943_0007053_362_895 177
516 3300035171 Ga0373946_0014684 Ga0373946_0014684_1012_1545 177
517 3300035172 Ga0373955_0026984 Ga0373955_0026984_223_756 177
518 3300035241 Ga0373961_0049540 Ga0373961_0049540_287_820 177
519 3300035410 Ga0373924_0081084 Ga0373924_0081084_699_1232 177
520 3300035691 Ga0373931_0017440 Ga0373931_0017440_1934_2467 177
521 3300035692 Ga0373935_0042154 Ga0373935_0042154_1535_2068 177
522 3300035692 Ga0373935_0591751 Ga0373935_0591751_100_633 177
523 3300035695 Ga0373927_0361397 Ga0373927_0361397_413_946 177
524 3300035724 Ga0373933_0021469 Ga0373933_0021469_3019_3552 177
525 3300035725 Ga0373947_0017628 Ga0373947_0017628_1790_2323 177
526 3300036401 Ga0373937_0001944 Ga0373937_0001944_863_1396 177
527 3300036401 Ga0373937_0720054 Ga0373937_0720054_219_752 177
528 3300037068 Ga0373925_0002218 Ga0373925_0002218_4516_5049 177
529 3300037312 Ga0395899_0207337 Ga0395899_0207337_786_1319 177
530 3300037418 Ga0395900_0167439 Ga0395900_0167439_1528_2061 177
531 3300037418 Ga0395900_0284549 Ga0395900_0284549_62_595 177
532 3300037418 Ga0395900_1214729 Ga0395900_1214729_98_631 177
533 3300037466 Ga0395898_1106446 Ga0395898_1106446_24_557 177
534 3300037471 Ga0395905_0700236 Ga0395905_0700236_301_834 177
535 3300037853 Ga0436364_0599685 Ga0436364_0599685_295_870 177
536 3300038443 Ga0395901_0161249 Ga0395901_0161249_301_834 177
537 3300038443 Ga0395901_0571535 Ga0395901_0571535_542_1075 177
538 3300039438 Ga0436360_1013902 Ga0436360_1013902_1719_2258 177
539 3300039447 Ga0436361_0766437 Ga0436361_0766437_704_1243 177
540 3300039450 Ga0436363_1151979 Ga0436363_1151979_96_629 177
541 3300041411 Ga0439466_0031680 Ga0439466_0031680_785_1318 177
542 3300042136 Ga0450900_023776 Ga0450900_023776_132_665 177
543 3300044656 Ga0466969_0003758 Ga0466969_0003758_4828_5361 177
544 3300044656 Ga0466969_0064936 Ga0466969_0064936_722_1255 177
545 3300044656 Ga0466969_0198983 Ga0466969_0198983_37_570 177
546 3300044683 Ga0466965_0077701 Ga0466965_0077701_383_916 177
547 3300044684 Ga0466966_0034146 Ga0466966_0034146_588_1121 177
548 3300044684 Ga0466966_0044853 Ga0466966_0044853_869_1402 177
549 3300044693 Ga0466961_0000463 Ga0466961_0000463_2310_2843 177
550 3300044693 Ga0466961_0015787 Ga0466961_0015787_1537_2070 177
551 3300044693 Ga0466961_0060307 Ga0466961_0060307_917_1450 177
552 3300044693 Ga0466961_0077983 Ga0466961_0077983_945_1478 177
553 3300044693 Ga0466961_0085051 Ga0466961_0085051_395_928 177
554 3300044694 Ga0466963_0000055 Ga0466963_0000055_35646_36179 177
555 3300044694 Ga0466963_0002044 Ga0466963_0002044_3417_3950 177
556 3300044694 Ga0466963_0004340 Ga0466963_0004340_2399_2932 177
557 3300044694 Ga0466963_0006350 Ga0466963_0006350_2842_3375 177
558 3300044694 Ga0466963_0006417 Ga0466963_0006417_3846_4379 177
559 3300044694 Ga0466963_0017674 Ga0466963_0017674_2208_2741 177
560 3300044694 Ga0466963_0026186 Ga0466963_0026186_1501_2034 177
561 3300044694 Ga0466963_0048563 Ga0466963_0048563_1815_2348 177
562 3300044694 Ga0466963_0092269 Ga0466963_0092269_1216_1749 177
563 3300044694 Ga0466963_0097328 Ga0466963_0097328_1391_1924 177
564 3300044694 Ga0466963_0135655 Ga0466963_0135655_908_1441 177
565 3300044694 Ga0466963_0593879 Ga0466963_0593879_17_550 177
566 3300044694 Ga0466963_0638521 Ga0466963_0638521_132_665 177
567 3300044706 Ga0466964_0033993 Ga0466964_0033993_1090_1623 177
568 3300044706 Ga0466964_0073886 Ga0466964_0073886_206_739 177
569 3300044706 Ga0466964_0095241 Ga0466964_0095241_473_1006 177
570 3300044712 Ga0453684_0734803 Ga0453684_0734803_251_790 177
571 3300044719 Ga0466971_0009943 Ga0466971_0009943_2668_3201 177
572 3300044719 Ga0466971_0011670 Ga0466971_0011670_1881_2414 177
573 3300044719 Ga0466971_0028795 Ga0466971_0028795_176_709 177
574 3300044719 Ga0466971_0142487 Ga0466971_0142487_167_700 177
575 3300044735 Ga0466968_0008743 Ga0466968_0008743_3116_3649 177
576 3300044735 Ga0466968_0028416 Ga0466968_0028416_1331_1864 177
577 3300044735 Ga0466968_0031656 Ga0466968_0031656_1198_1731 177
578 3300044735 Ga0466968_0103594 Ga0466968_0103594_571_1104 177
579 3300044735 Ga0466968_0126664 Ga0466968_0126664_355_888 177
580 3300044735 Ga0466968_0161488 Ga0466968_0161488_135_668 177
581 3300044765 Ga0466970_0007299 Ga0466970_0007299_2004_2537 177
582 3300044765 Ga0466970_0070016 Ga0466970_0070016_702_1235 177
583 3300044765 Ga0466970_0371652 Ga0466970_0371652_91_624 177
584 3300044842 Ga0466957_0005217 Ga0466957_0005217_634_1167 177
585 3300044842 Ga0466957_0016697 Ga0466957_0016697_3275_3808 177
586 3300044842 Ga0466957_0029951 Ga0466957_0029951_2175_2708 177
587 3300044842 Ga0466957_0193152 Ga0466957_0193152_353_886 177
588 3300044842 Ga0466957_0349714 Ga0466957_0349714_246_779 177
589 3300044901 Ga0466960_0021506 Ga0466960_0021506_241_774 177
590 3300044901 Ga0466960_0056340 Ga0466960_0056340_590_1123 177
591 3300045049 Ga0466959_0000761 Ga0466959_0000761_11898_12431 177
592 3300045049 Ga0466959_0004174 Ga0466959_0004174_6819_7352 177
593 3300045049 Ga0466959_0006516 Ga0466959_0006516_4240_4773 177
594 3300045049 Ga0466959_0022832 Ga0466959_0022832_1715_2248 177
595 3300045049 Ga0466959_0168935 Ga0466959_0168935_912_1445 177
596 3300045049 Ga0466959_0264676 Ga0466959_0264676_286_819 177
597 3300045836 Ga0466958_0006835 Ga0466958_0006835_4679_5212 177
598 3300045836 Ga0466958_0010924 Ga0466958_0010924_4027_4560 177
599 3300045836 Ga0466958_0013846 Ga0466958_0013846_659_1192 177
600 3300045836 Ga0466958_0031826 Ga0466958_0031826_1198_1731 177
601 3300045836 Ga0466958_0205627 Ga0466958_0205627_307_840 177
602 3300045836 Ga0466958_0345198 Ga0466958_0345198_315_848 177
603 3300045836 Ga0466958_0375338 Ga0466958_0375338_178_711 177
604 3300045836 Ga0466958_0459671 Ga0466958_0459671_265_798 177
605 3300045976 Ga0466967_0002348 Ga0466967_0002348_3225_3758 177
606 3300045976 Ga0466967_0053112 Ga0466967_0053112_1367_1900 177
607 3300045976 Ga0466967_0065217 Ga0466967_0065217_1104_1637 177
608 3300045976 Ga0466967_0078419 Ga0466967_0078419_777_1310 177
609 3300045976 Ga0466967_0099841 Ga0466967_0099841_1332_1865 177
610 3300045976 Ga0466967_0116175 Ga0466967_0116175_71_604 177
611 3300045976 Ga0466967_0189810 Ga0466967_0189810_1132_1665 177
612 3300045976 Ga0466967_0212598 Ga0466967_0212598_69_602 177
613 3300045976 Ga0466967_0223460 Ga0466967_0223460_1165_1698 177
614 3300045976 Ga0466967_0225253 Ga0466967_0225253_184_717 177
615 3300045976 Ga0466967_0336155 Ga0466967_0336155_178_711 177
616 3300045976 Ga0466967_0466266 Ga0466967_0466266_100_633 177
617 3300045976 Ga0466967_0527842 Ga0466967_0527842_296_829 177
618 3300045976 Ga0466967_0626652 Ga0466967_0626652_200_733 177
619 3300045976 Ga0466967_0829701 Ga0466967_0829701_334_867 177
620 3300045976 Ga0466967_1157853 Ga0466967_1157853_21_554 177
621 3300045976 Ga0466967_1372260 Ga0466967_1372260_27_560 177
622 3300046454 Ga0495592_0000082 Ga0495592_0000082_22026_22559 177
623 3300046454 Ga0495592_0005470 Ga0495592_0005470_8287_8820 177
624 3300046454 Ga0495592_0074198 Ga0495592_0074198_1116_1649 177
625 3300046454 Ga0495592_0475797 Ga0495592_0475797_10_543 177
626 3300046455 Ga0495603_0032804 Ga0495603_0032804_1806_2339 177
627 3300046455 Ga0495603_0189160 Ga0495603_0189160_246_779 177
628 3300046459 Ga0495629_0107062 Ga0495629_0107062_558_1091 177
629 3300046459 Ga0495629_0496358 Ga0495629_0496358_177_710 177
630 3300046459 Ga0495629_0732121 Ga0495629_0732121_49_582 177
631 3300046461 Ga0495641_0003735 Ga0495641_0003735_5197_5730 177
632 3300046461 Ga0495641_0013465 Ga0495641_0013465_726_1259 177
633 3300046461 Ga0495641_0016679 Ga0495641_0016679_979_1512 177
634 3300046461 Ga0495641_0168032 Ga0495641_0168032_250_783 177
635 3300046461 Ga0495641_0262499 Ga0495641_0262499_206_739 177
636 3300046462 Ga0495651_0000254 Ga0495651_0000254_29528_30061 177
637 3300046462 Ga0495651_0222455 Ga0495651_0222455_753_1286 177
638 3300046463 Ga0495653_0023292 Ga0495653_0023292_4258_4791 177
639 3300046463 Ga0495653_0168599 Ga0495653_0168599_435_968 177
640 3300046463 Ga0495653_0206095 Ga0495653_0206095_577_1110 177
641 3300046472 Ga0495580_0009973 Ga0495580_0009973_3970_4503 177
642 3300046473 Ga0495582_0001703 Ga0495582_0001703_5911_6444 177
643 3300046473 Ga0495582_0265163 Ga0495582_0265163_395_928 177
644 3300046473 Ga0495582_0358266 Ga0495582_0358266_254_787 177
645 3300046473 Ga0495582_0412425 Ga0495582_0412425_194_727 177
646 3300046474 Ga0495605_0054527 Ga0495605_0054527_1118_1651 177
647 3300046475 Ga0495639_0000828 Ga0495639_0000828_7665_8198 177
648 3300046476 Ga0495662_0002737 Ga0495662_0002737_1658_2191 177
649 3300046476 Ga0495662_0111106 Ga0495662_0111106_645_1178 177
650 3300046477 Ga0495664_0018869 Ga0495664_0018869_1211_1744 177
651 3300046477 Ga0495664_0073142 Ga0495664_0073142_843_1376 177
652 3300046492 Ga0495585_0025984 Ga0495585_0025984_28_561 177
653 3300046499 Ga0495594_0378856 Ga0495594_0378856_187_720 177
654 3300046500 Ga0495596_0085594 Ga0495596_0085594_647_1180 177
655 3300046511 Ga0495608_0003029 Ga0495608_0003029_2197_2730 177
656 3300046511 Ga0495608_0019774 Ga0495608_0019774_41_574 177
657 3300046511 Ga0495608_0301504 Ga0495608_0301504_347_880 177
658 3300046514 Ga0495618_0010074 Ga0495618_0010074_1211_1744 177
659 3300046514 Ga0495618_0011530 Ga0495618_0011530_4234_4767 177
660 3300046514 Ga0495618_0079738 Ga0495618_0079738_1325_1858 177
661 3300046514 Ga0495618_0130632 Ga0495618_0130632_290_823 177
662 3300046514 Ga0495618_0224637 Ga0495618_0224637_319_852 177
663 3300046514 Ga0495618_0604342 Ga0495618_0604342_90_623 177
664 3300046516 Ga0495628_0008466 Ga0495628_0008466_834_1367 177
665 3300046516 Ga0495628_0013181 Ga0495628_0013181_5102_5635 177
666 3300046516 Ga0495628_0037042 Ga0495628_0037042_2051_2584 177
667 3300046516 Ga0495628_0255320 Ga0495628_0255320_366_899 177
668 3300046517 Ga0495630_0018065 Ga0495630_0018065_341_874 177
669 3300046517 Ga0495630_0059957 Ga0495630_0059957_1010_1543 177
670 3300046517 Ga0495630_0081900 Ga0495630_0081900_1782_2315 177
671 3300046517 Ga0495630_0742766 Ga0495630_0742766_26_559 177
672 3300046518 Ga0495631_0048561 Ga0495631_0048561_712_1245 177
673 3300046523 Ga0495644_0072868 Ga0495644_0072868_122_655 177
674 3300046526 Ga0495666_0000309 Ga0495666_0000309_7087_7620 177
675 3300046528 Ga0495642_0037952 Ga0495642_0037952_890_1423 177
676 3300046529 Ga0495652_0000144 Ga0495652_0000144_79473_80006 177
677 3300046529 Ga0495652_0005095 Ga0495652_0005095_4831_5364 177
678 3300046531 Ga0495665_0003045 Ga0495665_0003045_3223_3756 177
679 3300046533 Ga0495640_0002828 Ga0495640_0002828_5580_6113 177
680 3300046533 Ga0495640_0016017 Ga0495640_0016017_4304_4837 177
681 3300046535 Ga0495586_0035224 Ga0495586_0035224_1786_2319 177
682 3300046535 Ga0495586_0596015 Ga0495586_0596015_87_620 177
683 3300046536 Ga0495587_0000060 Ga0495587_0000060_42129_42662 177
684 3300046536 Ga0495587_0042989 Ga0495587_0042989_1622_2155 177
685 3300046536 Ga0495587_0267091 Ga0495587_0267091_218_751 177
686 3300046538 Ga0495609_0082219 Ga0495609_0082219_528_1061 177
687 3300046543 Ga0495645_0000038 Ga0495645_0000038_76148_76681 177
688 3300046543 Ga0495645_0039870 Ga0495645_0039870_681_1214 177
689 3300046543 Ga0495645_0112646 Ga0495645_0112646_100_633 177
690 3300046559 Ga0495667_0008738 Ga0495667_0008738_3053_3586 177
691 3300046559 Ga0495667_0173797 Ga0495667_0173797_227_760 177
692 3300046559 Ga0495667_0308668 Ga0495667_0308668_97_630 177
693 3300046615 Ga0495656_0001194 Ga0495656_0001194_6016_6549 177
694 3300046615 Ga0495656_0163686 Ga0495656_0163686_295_831 177
695 3300046642 Ga0495634_0004455 Ga0495634_0004455_5765_6298 177
696 3300046642 Ga0495634_0159950 Ga0495634_0159950_89_622 177
697 3300046642 Ga0495634_0175161 Ga0495634_0175161_541_1074 177
698 3300046648 Ga0495611_0037229 Ga0495611_0037229_1105_1638 177
699 3300046663 Ga0495635_0209839 Ga0495635_0209839_465_998 177
700 3300046663 Ga0495635_0221470 Ga0495635_0221470_558_1091 177
701 3300046664 Ga0495659_0010631 Ga0495659_0010631_1359_1892 177
702 3300046675 Ga0495657_0021956 Ga0495657_0021956_2234_2767 177
703 3300046675 Ga0495657_0029234 Ga0495657_0029234_1785_2318 177
704 3300046675 Ga0495657_0074859 Ga0495657_0074859_438_971 177
705 3300046678 Ga0495599_0003010 Ga0495599_0003010_5359_5892 177
706 3300046678 Ga0495599_0042619 Ga0495599_0042619_1501_2034 177
707 3300046678 Ga0495599_0251432 Ga0495599_0251432_82_615 177
708 3300046679 Ga0495623_0003795 Ga0495623_0003795_4321_4854 177
709 3300046679 Ga0495623_0301324 Ga0495623_0301324_216_749 177
710 3300046680 Ga0495646_0016747 Ga0495646_0016747_1754_2287 177
711 3300046680 Ga0495646_0027797 Ga0495646_0027797_2471_3004 177
712 3300046680 Ga0495646_0075159 Ga0495646_0075159_337_870 177
713 3300046680 Ga0495646_0167143 Ga0495646_0167143_351_884 177
714 3300046681 Ga0495647_0013196 Ga0495647_0013196_2224_2757 177
715 3300046681 Ga0495647_0274276 Ga0495647_0274276_158_691 177
716 3300046683 Ga0495658_0000498 Ga0495658_0000498_5753_6286 177
717 3300046683 Ga0495658_0117774 Ga0495658_0117774_544_1077 177
718 3300046689 Ga0495613_0061335 Ga0495613_0061335_563_1096 177
719 3300046689 Ga0495613_0141595 Ga0495613_0141595_152_685 177
720 3300046689 Ga0495613_0157507 Ga0495613_0157507_37_570 177
721 3300046690 Ga0495624_0007698 Ga0495624_0007698_6881_7414 177
722 3300046690 Ga0495624_0034041 Ga0495624_0034041_2007_2540 177
723 3300046691 Ga0495670_0056634 Ga0495670_0056634_520_1053 177
724 3300046809 Ga0495600_0062127 Ga0495600_0062127_206_739 177
725 3300047315 Ga0495581_0017975 Ga0495581_0017975_1658_2191 177
726 3300047315 Ga0495581_0230668 Ga0495581_0230668_256_789 177
727 3300047317 Ga0495604_0000043 Ga0495604_0000043_71739_72272 177
728 3300047317 Ga0495604_0148730 Ga0495604_0148730_391_924 177
729 3300047317 Ga0495604_0220666 Ga0495604_0220666_702_1235 177
730 3300047317 Ga0495604_0254304 Ga0495604_0254304_40_573 177
731 3300047319 Ga0495674_0007325 Ga0495674_0007325_1790_2323 177
732 3300047319 Ga0495674_0019407 Ga0495674_0019407_4419_4952 177
733 3300047319 Ga0495674_0227405 Ga0495674_0227405_46_579 177
734 3300047319 Ga0495674_0493327 Ga0495674_0493327_261_794 177
735 3300047321 Ga0495676_0036425 Ga0495676_0036425_1790_2323 177
736 3300047321 Ga0495676_0355612 Ga0495676_0355612_54_587 177
737 3300047321 Ga0495676_0472150 Ga0495676_0472150_185_718 177
738 3300047322 Ga0495680_0005229 Ga0495680_0005229_7648_8181 177
739 3300047322 Ga0495680_0009827 Ga0495680_0009827_4785_5318 177
740 3300047322 Ga0495680_0010993 Ga0495680_0010993_6929_7462 177
741 3300047444 Ga0495675_0000413 Ga0495675_0000413_23518_24051 177
742 3300047447 Ga0495685_043204 Ga0495685_043204_749_1282 177
743 3300047471 Ga0495684_0001111 Ga0495684_0001111_12422_12955 177
744 3300047471 Ga0495684_0129709 Ga0495684_0129709_1321_1854 177
745 3300047471 Ga0495684_0274597 Ga0495684_0274597_311_844 177
746 3300047471 Ga0495684_0435114 Ga0495684_0435114_12_545 177
747 3300047673 Ga0495593_0001256 Ga0495593_0001256_10268_10801 177
748 3300048088 Ga0495602_0022762 Ga0495602_0022762_5135_5668 177
749 3300048089 Ga0495614_0002476 Ga0495614_0002476_6664_7197 177
750 3300048089 Ga0495614_0296538 Ga0495614_0296538_123_656 177
751 3300048903 Ga0496100_0001629 Ga0496100_0001629_317_850 177
752 3300048903 Ga0496100_0053677 Ga0496100_0053677_829_1362 177
753 3300048903 Ga0496100_0272426 Ga0496100_0272426_28_561 177
754 3300048903 Ga0496100_0444036 Ga0496100_0444036_401_934 177
755 3300048904 Ga0496101_0006702 Ga0496101_0006702_1601_2134 177
756 3300048904 Ga0496101_0149061 Ga0496101_0149061_680_1213 177
757 3300048904 Ga0496101_0457958 Ga0496101_0457958_232_765 177
758 3300048905 Ga0496102_0008253 Ga0496102_0008253_7794_8327 177
759 3300048905 Ga0496102_0063343 Ga0496102_0063343_1988_2521 177
760 3300048905 Ga0496102_0181949 Ga0496102_0181949_440_973 177
761 3300048906 Ga0496103_0014004 Ga0496103_0014004_2629_3162 177
762 3300048906 Ga0496103_0057089 Ga0496103_0057089_1789_2322 177
763 3300048907 Ga0496104_0007021 Ga0496104_0007021_8755_9288 177
764 3300048907 Ga0496104_0307271 Ga0496104_0307271_174_707 177
765 3300048907 Ga0496104_0597812 Ga0496104_0597812_157_690 177
766 3300048908 Ga0496105_0029069 Ga0496105_0029069_2154_2687 177
767 3300048908 Ga0496105_0118125 Ga0496105_0118125_1457_1990 177
768 3300048909 Ga0496106_0031105 Ga0496106_0031105_1138_1671 177
769 3300048909 Ga0496106_0530873 Ga0496106_0530873_198_731 177
770 3300048909 Ga0496106_0853683 Ga0496106_0853683_130_663 177
771 3300048910 Ga0496107_0017701 Ga0496107_0017701_2175_2708 177
772 3300048910 Ga0496107_0180696 Ga0496107_0180696_454_987 177
773 3300048910 Ga0496107_0727413 Ga0496107_0727413_22_555 177
774 3300048911 Ga0496108_0058486 Ga0496108_0058486_1107_1640 177
775 3300048911 Ga0496108_0107249 Ga0496108_0107249_1234_1767 177
776 3300048911 Ga0496108_0568902 Ga0496108_0568902_95_628 177
777 3300048912 Ga0496109_0082695 Ga0496109_0082695_1995_2528 177
778 3300048912 Ga0496109_0099702 Ga0496109_0099702_1305_1838 177
779 3300048912 Ga0496109_0113923 Ga0496109_0113923_419_952 177
780 3300048912 Ga0496109_0384105 Ga0496109_0384105_86_619 177
781 3300048912 Ga0496109_0518190 Ga0496109_0518190_383_916 177
782 3300048912 Ga0496109_1393720 Ga0496109_1393720_14_547 177
783 3300048913 Ga0496110_0030835 Ga0496110_0030835_2663_3196 177
784 3300048913 Ga0496110_0160468 Ga0496110_0160468_1209_1742 177
785 3300048914 Ga0496111_0011827 Ga0496111_0011827_2980_3513 177
786 3300048914 Ga0496111_0373134 Ga0496111_0373134_339_872 177
787 3300048915 Ga0496112_0185242 Ga0496112_0185242_25_558 177
788 3300048916 Ga0496113_0088698 Ga0496113_0088698_908_1441 177
789 3300048917 Ga0496114_0005056 Ga0496114_0005056_7252_7785 177
790 3300048917 Ga0496114_0006185 Ga0496114_0006185_7049_7582 177
791 3300048917 Ga0496114_0172351 Ga0496114_0172351_216_749 177
792 3300048917 Ga0496114_0194655 Ga0496114_0194655_1098_1631 177
793 3300048918 Ga0496115_0033907 Ga0496115_0033907_455_988 177
794 3300048918 Ga0496115_0123165 Ga0496115_0123165_530_1063 177
795 3300049568 Ga0501031_0001922 Ga0501031_0001922_3901_4434 177
796 3300049568 Ga0501031_0209414 Ga0501031_0209414_35_568 177
797 3300049568 Ga0501031_0475227 Ga0501031_0475227_248_781 177
798 3300049569 Ga0501032_0023340 Ga0501032_0023340_921_1454 177
799 3300049570 Ga0501033_0020491 Ga0501033_0020491_3547_4080 177
800 3300049570 Ga0501033_0207271 Ga0501033_0207271_847_1380 177
801 3300049571 Ga0501034_0036580 Ga0501034_0036580_1772_2305 177
802 3300049572 Ga0501036_0015282 Ga0501036_0015282_4844_5377 177
803 3300049573 Ga0501037_0001718 Ga0501037_0001718_1370_1903 177
804 3300049574 Ga0501038_0019828 Ga0501038_0019828_4106_4639 177
805 3300049575 Ga0501039_0022477 Ga0501039_0022477_1248_1781 177
806 3300049575 Ga0501039_0115948 Ga0501039_0115948_1401_1934 177
807 3300049575 Ga0501039_0258374 Ga0501039_0258374_139_672 177
808 3300049576 Ga0501040_0176929 Ga0501040_0176929_63_596 177
809 3300049576 Ga0501040_0213523 Ga0501040_0213523_86_619 177
810 3300049576 Ga0501040_0314193 Ga0501040_0314193_548_1081 177
811 3300049576 Ga0501040_0326816 Ga0501040_0326816_384_917 177
812 3300049577 Ga0501041_0001929 Ga0501041_0001929_2376_2909 177
813 3300049578 Ga0501042_0007635 Ga0501042_0007635_6129_6662 177
814 3300049579 Ga0501043_0008410 Ga0501043_0008410_4106_4639 177
815 3300049580 Ga0501046_0008923 Ga0501046_0008923_5793_6326 177
816 3300049581 Ga0501047_0136800 Ga0501047_0136800_779_1312 177
817 3300049582 Ga0501048_0026749 Ga0501048_0026749_2424_2957 177
818 3300049582 Ga0501048_0034066 Ga0501048_0034066_2896_3429 177
819 3300049583 Ga0501067_0026731 Ga0501067_0026731_330_863 177
820 3300049584 Ga0501068_0016129 Ga0501068_0016129_2824_3357 177
821 3300049585 Ga0501069_0000281 Ga0501069_0000281_19283_19816 177
822 3300049585 Ga0501069_0073093 Ga0501069_0073093_938_1471 177
823 3300049585 Ga0501069_0214449 Ga0501069_0214449_276_809 177
824 3300049585 Ga0501069_0381137 Ga0501069_0381137_275_808 177
825 3300049586 Ga0501070_0010802 Ga0501070_0010802_3977_4510 177
826 3300049586 Ga0501070_0234063 Ga0501070_0234063_934_1467 177
827 3300049587 Ga0501071_0006860 Ga0501071_0006860_561_1094 177
828 3300049587 Ga0501071_0057394 Ga0501071_0057394_1610_2143 177
829 3300049587 Ga0501071_0157353 Ga0501071_0157353_920_1453 177
830 3300049587 Ga0501071_0250313 Ga0501071_0250313_536_1069 177
831 3300049587 Ga0501071_0513484 Ga0501071_0513484_253_786 177
832 3300049588 Ga0501072_0001268 Ga0501072_0001268_7996_8529 177
833 3300049588 Ga0501072_0107030 Ga0501072_0107030_731_1264 177
834 3300049588 Ga0501072_0273938 Ga0501072_0273938_364_897 177
835 3300049588 Ga0501072_0289965 Ga0501072_0289965_440_973 177
836 3300049588 Ga0501072_0807292 Ga0501072_0807292_52_585 177
837 3300049589 Ga0501073_0012210 Ga0501073_0012210_1291_1824 177
838 3300049590 Ga0501074_0023738 Ga0501074_0023738_63_596 177
839 3300049590 Ga0501074_0197734 Ga0501074_0197734_385_918 177
840 3300049591 Ga0501075_0015752 Ga0501075_0015752_3984_4517 177
841 3300049591 Ga0501075_0035626 Ga0501075_0035626_909_1442 177
842 3300049591 Ga0501075_0493070 Ga0501075_0493070_23_556 177
843 3300049592 Ga0501076_0005603 Ga0501076_0005603_5155_5688 177
844 3300049592 Ga0501076_0059670 Ga0501076_0059670_1659_2192 177
845 3300049592 Ga0501076_0813538 Ga0501076_0813538_94_627 177
846 3300049593 Ga0501077_0010312 Ga0501077_0010312_3352_3885 177
847 3300049593 Ga0501077_0138018 Ga0501077_0138018_254_787 177
848 3300049593 Ga0501077_0213669 Ga0501077_0213669_305_838 177
849 3300049741 Ga0501079_0026369 Ga0501079_0026369_433_966 177
850 3300049741 Ga0501079_0027015 Ga0501079_0027015_1072_1605 177
851 3300049741 Ga0501079_0312217 Ga0501079_0312217_598_1131 177
852 3300049742 Ga0501080_0012586 Ga0501080_0012586_6097_6630 177
853 3300049742 Ga0501080_0204327 Ga0501080_0204327_1206_1739 177
854 3300049742 Ga0501080_0320739 Ga0501080_0320739_799_1332 177
855 3300049743 Ga0501081_0155437 Ga0501081_0155437_513_1046 177
856 3300049743 Ga0501081_0935705 Ga0501081_0935705_42_575 177
857 3300049744 Ga0501083_0005072 Ga0501083_0005072_5950_6483 177
858 3300049744 Ga0501083_0251137 Ga0501083_0251137_279_812 177
859 3300049822 Ga0501035_0003302 Ga0501035_0003302_13744_14277 177
860 3300049822 Ga0501035_0308733 Ga0501035_0308733_167_700 177
861 3300049823 Ga0501044_0153340 Ga0501044_0153340_1192_1725 177
862 3300049824 Ga0501045_0021888 Ga0501045_0021888_3481_4014 177
863 3300049824 Ga0501045_0042172 Ga0501045_0042172_1200_1733 177
864 3300050507 nmdc:mga05p37_47021_c1 nmdc:mga05p37_47021_c1_1509_2042 177
865 3300050507 nmdc:mga05p37_63542_c1 nmdc:mga05p37_63542_c1_2052_2585 177
866 3300050508 nmdc:mga09592_94219_c1 nmdc:mga09592_94219_c1_1779_2312 177
867 3300050509 nmdc:mga0qj67_27322_c1 nmdc:mga0qj67_27322_c1_1265_1798 177
868 3300050511 nmdc:mga08y16_398239_c1 nmdc:mga08y16_398239_c1_327_860 177
869 3300050511 nmdc:mga08y16_481751_c1 nmdc:mga08y16_481751_c1_525_1058 177
870 3300050512 nmdc:mga0n895_106199_c1 nmdc:mga0n895_106199_c1_325_858 177
871 3300050513 nmdc:mga0rr50_521970_c1 nmdc:mga0rr50_521970_c1_264_797 177
872 3300050514 nmdc:mga08x19_261282_c1 nmdc:mga08x19_261282_c1_623_1156 177
873 3300050514 nmdc:mga08x19_691122_c1 nmdc:mga08x19_691122_c1_107_646 177
874 3300053077 Ga0495601_0012252 Ga0495601_0012252_454_987 177
875 3300053077 Ga0495601_0015676 Ga0495601_0015676_3334_3867 177
876 3300053077 Ga0495601_0167766 Ga0495601_0167766_510_1043 177
877 3300053077 Ga0495601_0244147 Ga0495601_0244147_348_881 177
878 3300053077 Ga0495601_0297604 Ga0495601_0297604_162_695 177
879 3300053078 Ga0495612_0095619 Ga0495612_0095619_360_893 177
880 3300053078 Ga0495612_0110195 Ga0495612_0110195_491_1024 177
881 3300053083 Ga0495655_0035009 Ga0495655_0035009_60_593 177
882 3300053084 Ga0495595_0026564 Ga0495595_0026564_146_679 177
883 3300053084 Ga0495595_0031260 Ga0495595_0031260_796_1329 177
884 3300053085 Ga0495619_0003592 Ga0495619_0003592_8981_9514 177
885 3300053085 Ga0495619_0036099 Ga0495619_0036099_414_947 177
886 3300053085 Ga0495619_0216230 Ga0495619_0216230_369_902 177
887 3300053094 Ga0500566_0089234 Ga0500566_0089234_326_859 177
888 3300054114 Ga0501084_0012078 Ga0501084_0012078_3771_4304 177
889 3300054114 Ga0501084_0040131 Ga0501084_0040131_1420_1953 177
890 3300054114 Ga0501084_0159974 Ga0501084_0159974_105_638 177
891 3300054114 Ga0501084_0442662 Ga0501084_0442662_71_604 177
892 3300054114 Ga0501084_0600101 Ga0501084_0600101_146_679 177
893 3300059424 Ga0590075_014407 Ga0590075_014407_231_764 177
894 3300059511 Ga0587091_014186 Ga0587091_014186_21_554 177
895 3300059626 Ga0587115_049326 Ga0587115_049326_71_604 177
896 3300060353 Ga0501082_0031405 Ga0501082_0031405_3984_4517 177
897 3300060353 Ga0501082_0282268 Ga0501082_0282268_514_1047 177
898 3300060353 Ga0501082_0399182 Ga0501082_0399182_29_562 177
899 3300061719 Ga0466962_0052638 Ga0466962_0052638_960_1493 177
900 3300061719 Ga0466962_0061050 Ga0466962_0061050_745_1278 177
901 3300061719 Ga0466962_0067913 Ga0466962_0067913_854_1387 177
902 3300061719 Ga0466962_0327486 Ga0466962_0327486_139_672 177
903 3300061734 Ga0530510_0010209 Ga0530510_0010209_3352_3885 177
904 3300061734 Ga0530510_0052620 Ga0530510_0052620_2159_2692 177
905 3300061734 Ga0530510_0130624 Ga0530510_0130624_938_1471 177
906 3300000043 ARcpr5yngRDRAFT_c012431 ARcpr5yngRDRAFT_0124312 178
907 3300000044 ARSoilOldRDRAFT_c001158 ARSoilOldRDRAFT_0011586 178
908 3300000652 ARCol0yngRDRAFT_1001005 ARCol0yngRDRAFT_10010056 178
909 3300001989 JGI24739J22299_10031625 JGI24739J22299_100316255 178
910 3300002067 JGI24735J21928_10171835 JGI24735J21928_101718351 178
911 3300005329 Ga0070683_100184472 Ga0070683_1001844722 178
912 3300005329 Ga0070683_100308906 Ga0070683_1003089062 178
913 3300005334 Ga0068869_100491812 Ga0068869_1004918122 178
914 3300005337 Ga0070682_100226337 Ga0070682_1002263372 178
915 3300005338 Ga0068868_100523321 Ga0068868_1005233212 178
916 3300005339 Ga0070660_100518276 Ga0070660_1005182762 178
917 3300005344 Ga0070661_100370265 Ga0070661_1003702652 178
918 3300005344 Ga0070661_100633240 Ga0070661_1006332402 178
919 3300005345 Ga0070692_10022707 Ga0070692_100227073 178
920 3300005347 Ga0070668_100969449 Ga0070668_1009694491 178
921 3300005353 Ga0070669_100458555 Ga0070669_1004585552 178
922 3300005354 Ga0070675_100054439 Ga0070675_1000544396 178
923 3300005354 Ga0070675_100106705 Ga0070675_1001067054 178
924 3300005354 Ga0070675_100929320 Ga0070675_1009293201 178
925 3300005366 Ga0070659_100116007 Ga0070659_1001160073 178
926 3300005444 Ga0070694_100461334 Ga0070694_1004613342 178
927 3300005456 Ga0070678_100162368 Ga0070678_1001623681 178
928 3300005457 Ga0070662_100144820 Ga0070662_1001448203 178
929 3300005457 Ga0070662_100290847 Ga0070662_1002908473 178
930 3300005530 Ga0070679_100337405 Ga0070679_1003374051 178
931 3300005535 Ga0070684_100089974 Ga0070684_1000899746 178
932 3300005535 Ga0070684_100240626 Ga0070684_1002406263 178
933 3300005539 Ga0068853_100214281 Ga0068853_1002142814 178
934 3300005543 Ga0070672_100132695 Ga0070672_1001326953 178
935 3300005544 Ga0070686_100434402 Ga0070686_1004344022 178
936 3300005547 Ga0070693_100107157 Ga0070693_1001071574 178
937 3300005834 Ga0068851_10085219 Ga0068851_100852193 178
938 3300005840 Ga0068870_10052187 Ga0068870_100521874 178
939 3300005937 Ga0081455_10040463 Ga0081455_100404639 178
940 3300005937 Ga0081455_10207841 Ga0081455_102078413 178
941 3300005937 Ga0081455_10280757 Ga0081455_102807572 178
942 3300005985 Ga0081539_10000433 Ga0081539_1000043379 178
943 3300006038 Ga0075365_10179639 Ga0075365_101796393 178
944 3300006038 Ga0075365_10515393 Ga0075365_105153932 178
945 3300006051 Ga0075364_10044999 Ga0075364_100449995 178
946 3300006058 Ga0075432_10001059 Ga0075432_1000105911 178
947 3300006237 Ga0097621_100382488 Ga0097621_1003824882 178
948 3300006844 Ga0075428_100006916 Ga0075428_1000069167 178
949 3300006844 Ga0075428_101513565 Ga0075428_1015135651 178
950 3300006852 Ga0075433_10061868 Ga0075433_100618686 178
951 3300006880 Ga0075429_100122353 Ga0075429_1001223531 178
952 3300009094 Ga0111539_10008690 Ga0111539_1000869014 178
953 3300009094 Ga0111539_10074113 Ga0111539_100741133 178
954 3300009094 Ga0111539_11085749 Ga0111539_110857491 178
955 3300009098 Ga0105245_10106734 Ga0105245_101067345 178
956 3300009098 Ga0105245_10302976 Ga0105245_103029763 178
957 3300009147 Ga0114129_10104282 Ga0114129_101042824 178
958 3300009147 Ga0114129_10771180 Ga0114129_107711803 178
959 3300009148 Ga0105243_10223874 Ga0105243_102238743 178
960 3300009176 Ga0105242_10137109 Ga0105242_101371093 178
961 3300009176 Ga0105242_10156053 Ga0105242_101560533 178
962 3300009177 Ga0105248_10206586 Ga0105248_102065864 178
963 3300009553 Ga0105249_10198350 Ga0105249_101983503 178
964 3300009987 Ga0105030_106641 Ga0105030_1066412 178
965 3300010375 Ga0105239_10048544 Ga0105239_100485447 178
966 3300010375 Ga0105239_10256295 Ga0105239_102562954 178
967 3300010375 Ga0105239_10815453 Ga0105239_108154532 178
968 3300011119 Ga0105246_10984773 Ga0105246_109847731 178
969 3300013100 Ga0157373_10450061 Ga0157373_104500611 178
970 3300013296 Ga0157374_10738143 Ga0157374_107381432 178
971 3300013297 Ga0157378_10363416 Ga0157378_103634163 178
972 3300013306 Ga0163162_10580982 Ga0163162_105809822 178
973 3300013306 Ga0163162_10879949 Ga0163162_108799492 178
974 3300013307 Ga0157372_10412731 Ga0157372_104127313 178
975 3300013307 Ga0157372_10483699 Ga0157372_104836993 178
976 3300013308 Ga0157375_10485398 Ga0157375_104853982 178
977 3300014326 Ga0157380_10433743 Ga0157380_104337433 178
978 3300014745 Ga0157377_10600473 Ga0157377_106004732 178
979 3300014745 Ga0157377_10692806 Ga0157377_106928062 178
980 3300014968 Ga0157379_10174406 Ga0157379_101744064 178
981 3300014969 Ga0157376_10470591 Ga0157376_104705911 178
982 3300025899 Ga0207642_10511485 Ga0207642_105114851 178
983 3300025907 Ga0207645_10124230 Ga0207645_101242302 178
984 3300025908 Ga0207643_10052899 Ga0207643_100528992 178
985 3300025919 Ga0207657_10032320 Ga0207657_100323209 178
986 3300025920 Ga0207649_10324113 Ga0207649_103241132 178
987 3300025920 Ga0207649_10737867 Ga0207649_107378672 178
988 3300025921 Ga0207652_10861220 Ga0207652_108612202 178
989 3300025923 Ga0207681_10144022 Ga0207681_101440221 178
990 3300025927 Ga0207687_10294726 Ga0207687_102947263 178
991 3300025927 Ga0207687_10371103 Ga0207687_103711032 178
992 3300025932 Ga0207690_10163415 Ga0207690_101634154 178
993 3300025933 Ga0207706_10174250 Ga0207706_101742503 178
994 3300025933 Ga0207706_10230165 Ga0207706_102301653 178
995 3300025934 Ga0207686_10121872 Ga0207686_101218723 178
996 3300025934 Ga0207686_10144148 Ga0207686_101441482 178
997 3300025935 Ga0207709_10006045 Ga0207709_100060458 178
998 3300025937 Ga0207669_10327646 Ga0207669_103276461 178
999 3300025938 Ga0207704_10376060 Ga0207704_103760601 178
1000 3300025940 Ga0207691_10071530 Ga0207691_100715306 178
1001 3300025941 Ga0207711_10342546 Ga0207711_103425463 178
1002 3300025944 Ga0207661_10029243 Ga0207661_100292439 178
1003 3300025944 Ga0207661_10190988 Ga0207661_101909884 178
1004 3300025944 Ga0207661_10546301 Ga0207661_105463012 178
1005 3300025945 Ga0207679_10050795 Ga0207679_100507954 178
1006 3300025960 Ga0207651_10313135 Ga0207651_103131352 178
1007 3300025972 Ga0207668_10201977 Ga0207668_102019774 178
1008 3300025972 Ga0207668_10345582 Ga0207668_103455821 178
1009 3300026023 Ga0207677_10550610 Ga0207677_105506102 178
1010 3300026023 Ga0207677_11573873 Ga0207677_115738731 178
1011 3300026041 Ga0207639_10084823 Ga0207639_100848235 178
1012 3300026067 Ga0207678_10039202 Ga0207678_100392027 178
1013 3300026075 Ga0207708_10039177 Ga0207708_100391775 178
1014 3300026078 Ga0207702_11047895 Ga0207702_110478952 178
1015 3300026089 Ga0207648_10891679 Ga0207648_108916792 178
1016 3300026121 Ga0207683_10058879 Ga0207683_100588797 178
1017 3300026142 Ga0207698_10741602 Ga0207698_107416022 178
1018 3300027907 Ga0207428_10000181 Ga0207428_1000018184 178
1019 3300031901 Ga0307406_10132712 Ga0307406_101327121 178
1020 3300041452 Ga0451793_1286489 Ga0451793_1286489_47_583 178
1021 3300041456 Ga0451795_0086528 Ga0451795_0086528_52_588 178
1022 3300041458 Ga0451798_0303405 Ga0451798_0303405_43_579 178
1023 3300041459 Ga0451800_0225302 Ga0451800_0225302_299_835 178
1024 3300042122 Ga0450920_003850 Ga0450920_003850_371_907 178
1025 3300042137 Ga0450902_032249 Ga0450902_032249_124_660 178
1026 3300042138 Ga0450903_024523 Ga0450903_024523_315_851 178
1027 3300042147 Ga0450910_013079 Ga0450910_013079_414_950 178
1028 3300046455 Ga0495603_0440952 Ga0495603_0440952_164_700 178
1029 3300046459 Ga0495629_0458389 Ga0495629_0458389_309_845 178
1030 3300046461 Ga0495641_0324433 Ga0495641_0324433_95_631 178
1031 3300046473 Ga0495582_0484312 Ga0495582_0484312_147_683 178
1032 3300046476 Ga0495662_0163504 Ga0495662_0163504_405_941 178
1033 3300046477 Ga0495664_0073533 Ga0495664_0073533_1327_1863 178
1034 3300046499 Ga0495594_0603824 Ga0495594_0603824_11_547 178
1035 3300046500 Ga0495596_0071343 Ga0495596_0071343_446_982 178
1036 3300046511 Ga0495608_0076168 Ga0495608_0076168_1567_2103 178
1037 3300046517 Ga0495630_0627798 Ga0495630_0627798_232_768 178
1038 3300046518 Ga0495631_0259748 Ga0495631_0259748_109_645 178
1039 3300046523 Ga0495644_0223804 Ga0495644_0223804_81_617 178
1040 3300046533 Ga0495640_0188659 Ga0495640_0188659_763_1299 178
1041 3300046559 Ga0495667_0117024 Ga0495667_0117024_1024_1560 178
1042 3300046675 Ga0495657_0026518 Ga0495657_0026518_2427_2963 178
1043 3300046681 Ga0495647_0112595 Ga0495647_0112595_443_979 178
1044 3300046690 Ga0495624_0109404 Ga0495624_0109404_1035_1571 178
1045 3300046690 Ga0495624_0495574 Ga0495624_0495574_80_616 178
1046 3300046809 Ga0495600_0366427 Ga0495600_0366427_14_550 178
1047 3300047321 Ga0495676_0072781 Ga0495676_0072781_1672_2208 178
1048 3300047321 Ga0495676_0118846 Ga0495676_0118846_99_635 178
1049 3300048904 Ga0496101_0149940 Ga0496101_0149940_323_859 178
1050 3300048904 Ga0496101_0285472 Ga0496101_0285472_305_841 178
1051 3300048905 Ga0496102_0523215 Ga0496102_0523215_33_569 178
1052 3300048907 Ga0496104_0382082 Ga0496104_0382082_40_576 178
1053 3300048908 Ga0496105_0198444 Ga0496105_0198444_566_1102 178
1054 3300048908 Ga0496105_0678076 Ga0496105_0678076_191_727 178
1055 3300048909 Ga0496106_0232204 Ga0496106_0232204_419_955 178
1056 3300048912 Ga0496109_0089833 Ga0496109_0089833_746_1282 178
1057 3300048912 Ga0496109_0480016 Ga0496109_0480016_71_607 178
1058 3300048912 Ga0496109_1028350 Ga0496109_1028350_164_700 178
1059 3300048913 Ga0496110_0241280 Ga0496110_0241280_514_1050 178
1060 3300048913 Ga0496110_0302419 Ga0496110_0302419_279_815 178
1061 3300048914 Ga0496111_0257450 Ga0496111_0257450_333_869 178
1062 3300048914 Ga0496111_0508613 Ga0496111_0508613_138_674 178
1063 3300048916 Ga0496113_0483302 Ga0496113_0483302_191_727 178
1064 3300048917 Ga0496114_0151150 Ga0496114_0151150_25_561 178
1065 3300048917 Ga0496114_0361856 Ga0496114_0361856_518_1054 178
1066 3300048917 Ga0496114_0386754 Ga0496114_0386754_425_961 178
1067 3300049568 Ga0501031_0068501 Ga0501031_0068501_1276_1812 178
1068 3300049568 Ga0501031_0091203 Ga0501031_0091203_994_1530 178
1069 3300049569 Ga0501032_0079859 Ga0501032_0079859_1260_1796 178
1070 3300049570 Ga0501033_0008979 Ga0501033_0008979_2811_3347 178
1071 3300049570 Ga0501033_0219796 Ga0501033_0219796_116_652 178
1072 3300049572 Ga0501036_0057668 Ga0501036_0057668_1654_2190 178
1073 3300049572 Ga0501036_0148825 Ga0501036_0148825_1029_1565 178
1074 3300049573 Ga0501037_0018672 Ga0501037_0018672_1707_2243 178
1075 3300049573 Ga0501037_0334181 Ga0501037_0334181_18_554 178
1076 3300049574 Ga0501038_0255487 Ga0501038_0255487_10_546 178
1077 3300049574 Ga0501038_0733596 Ga0501038_0733596_56_592 178
1078 3300049575 Ga0501039_0007709 Ga0501039_0007709_1874_2410 178
1079 3300049575 Ga0501039_0467126 Ga0501039_0467126_24_560 178
1080 3300049576 Ga0501040_0011832 Ga0501040_0011832_423_959 178
1081 3300049576 Ga0501040_0015710 Ga0501040_0015710_3791_4327 178
1082 3300049576 Ga0501040_0191955 Ga0501040_0191955_848_1384 178
1083 3300049577 Ga0501041_0002244 Ga0501041_0002244_9367_9903 178
1084 3300049577 Ga0501041_0012382 Ga0501041_0012382_1855_2391 178
1085 3300049578 Ga0501042_0015136 Ga0501042_0015136_3082_3618 178
1086 3300049578 Ga0501042_0019313 Ga0501042_0019313_1659_2195 178
1087 3300049578 Ga0501042_0031825 Ga0501042_0031825_1366_1902 178
1088 3300049579 Ga0501043_0217764 Ga0501043_0217764_523_1059 178
1089 3300049579 Ga0501043_0281015 Ga0501043_0281015_662_1198 178
1090 3300049580 Ga0501046_0020980 Ga0501046_0020980_780_1316 178
1091 3300049580 Ga0501046_0057062 Ga0501046_0057062_562_1098 178
1092 3300049580 Ga0501046_0325560 Ga0501046_0325560_401_937 178
1093 3300049581 Ga0501047_0479348 Ga0501047_0479348_391_927 178
1094 3300049582 Ga0501048_0015470 Ga0501048_0015470_23_559 178
1095 3300049582 Ga0501048_0039880 Ga0501048_0039880_1113_1649 178
1096 3300049582 Ga0501048_0052687 Ga0501048_0052687_279_815 178
1097 3300049584 Ga0501068_0002839 Ga0501068_0002839_6277_6813 178
1098 3300049584 Ga0501068_0029609 Ga0501068_0029609_388_924 178
1099 3300049584 Ga0501068_0170713 Ga0501068_0170713_347_883 178
1100 3300049585 Ga0501069_0036892 Ga0501069_0036892_1108_1644 178
1101 3300049585 Ga0501069_0085775 Ga0501069_0085775_438_974 178
1102 3300049586 Ga0501070_0035611 Ga0501070_0035611_1682_2218 178
1103 3300049587 Ga0501071_0001083 Ga0501071_0001083_6471_7007 178
1104 3300049587 Ga0501071_0004817 Ga0501071_0004817_7631_8167 178
1105 3300049587 Ga0501071_0064544 Ga0501071_0064544_1241_1777 178
1106 3300049588 Ga0501072_0010632 Ga0501072_0010632_4645_5181 178
1107 3300049588 Ga0501072_0016036 Ga0501072_0016036_560_1096 178
1108 3300049588 Ga0501072_0087000 Ga0501072_0087000_1716_2252 178
1109 3300049589 Ga0501073_0008765 Ga0501073_0008765_552_1088 178
1110 3300049590 Ga0501074_0003320 Ga0501074_0003320_1727_2263 178
1111 3300049590 Ga0501074_0036342 Ga0501074_0036342_467_1003 178
1112 3300049590 Ga0501074_0070993 Ga0501074_0070993_1378_1914 178
1113 3300049591 Ga0501075_0002651 Ga0501075_0002651_6079_6615 178
1114 3300049591 Ga0501075_0003018 Ga0501075_0003018_9753_10289 178
1115 3300049591 Ga0501075_0146035 Ga0501075_0146035_837_1373 178
1116 3300049592 Ga0501076_0001626 Ga0501076_0001626_1280_1816 178
1117 3300049592 Ga0501076_0040146 Ga0501076_0040146_863_1399 178
1118 3300049593 Ga0501077_0001393 Ga0501077_0001393_5721_6257 178
1119 3300049593 Ga0501077_0005398 Ga0501077_0005398_4769_5305 178
1120 3300049593 Ga0501077_0018672 Ga0501077_0018672_140_676 178
1121 3300049741 Ga0501079_0008393 Ga0501079_0008393_5858_6394 178
1122 3300049741 Ga0501079_0051929 Ga0501079_0051929_972_1508 178
1123 3300049741 Ga0501079_0079460 Ga0501079_0079460_941_1477 178
1124 3300049741 Ga0501079_1230235 Ga0501079_1230235_42_578 178
1125 3300049742 Ga0501080_0016472 Ga0501080_0016472_1697_2233 178
1126 3300049742 Ga0501080_0030844 Ga0501080_0030844_2739_3275 178
1127 3300049742 Ga0501080_0048644 Ga0501080_0048644_2205_2741 178
1128 3300049743 Ga0501081_0004393 Ga0501081_0004393_1645_2181 178
1129 3300049743 Ga0501081_0028999 Ga0501081_0028999_676_1212 178
1130 3300049743 Ga0501081_0084466 Ga0501081_0084466_1028_1564 178
1131 3300049744 Ga0501083_0035316 Ga0501083_0035316_313_849 178
1132 3300049822 Ga0501035_0773721 Ga0501035_0773721_211_747 178
1133 3300049823 Ga0501044_0400241 Ga0501044_0400241_193_729 178
1134 3300049824 Ga0501045_0009478 Ga0501045_0009478_4554_5090 178
1135 3300049824 Ga0501045_0028964 Ga0501045_0028964_827_1363 178
1136 3300050491 nmdc:mga00v17_29338_c1 nmdc:mga00v17_29338_c1_1679_2215 178
1137 3300050492 nmdc:mga0yw44_147904_c1 nmdc:mga0yw44_147904_c1_822_1358 178
1138 3300050494 nmdc:mga06z11_49760_c1 nmdc:mga06z11_49760_c1_822_1358 178
1139 3300050507 nmdc:mga05p37_48463_c1 nmdc:mga05p37_48463_c1_918_1454 178
1140 3300050507 nmdc:mga05p37_639709_c1 nmdc:mga05p37_639709_c1_294_830 178
1141 3300050507 nmdc:mga05p37_681750_c1 nmdc:mga05p37_681750_c1_578_1114 178
1142 3300050508 nmdc:mga09592_45593_c1 nmdc:mga09592_45593_c1_1111_1647 178
1143 3300050510 nmdc:mga06r32_153768_c1 nmdc:mga06r32_153768_c1_745_1281 178
1144 3300050511 nmdc:mga08y16_125036_c1 nmdc:mga08y16_125036_c1_712_1248 178
1145 3300050515 nmdc:mga0a205_62900_c1 nmdc:mga0a205_62900_c1_2533_3069 178
1146 3300053078 Ga0495612_0098364 Ga0495612_0098364_391_927 178
1147 3300053083 Ga0495655_0021716 Ga0495655_0021716_596_1132 178
1148 3300054114 Ga0501084_0005571 Ga0501084_0005571_1486_2022 178
1149 3300054114 Ga0501084_0046874 Ga0501084_0046874_1818_2354 178
1150 3300054114 Ga0501084_0305995 Ga0501084_0305995_131_667 178
1151 3300054114 Ga0501084_0308775 Ga0501084_0308775_155_691 178
1152 3300060353 Ga0501082_0021659 Ga0501082_0021659_3146_3682 178
1153 3300060353 Ga0501082_0049398 Ga0501082_0049398_1480_2016 178
1154 3300060353 Ga0501082_0084830 Ga0501082_0084830_1520_2056 178
1155 3300061734 Ga0530510_0032518 Ga0530510_0032518_1557_2093 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

11

82

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

90

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9734 9 173
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9685 9 172
4v9b-assembly1.cif.gz_BH crystal structure of the 70s ribosome with tigecycline. 0.9639 2 171
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9635 2 176
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9619 9 173
ID Description Score Start End Superfamily
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9618 84 169 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9569 84 174 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9514 84 171 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.951 84 169 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.941 2 80 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9962 82 162 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9938 52 162 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-X1G5X1-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9916 83 155 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.9803 74 169
AF-A0A2J6L7U4-F1-model_v4 deleted 0.9802 83 165

Feature Viewer

pLDDT pTM Quality
88.85 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map