F490929

General Info

Members Datasets Scaffolds Average Seq Length
1155 465 2310 225

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0424088|Ga0496126_0424088_300_995
Length 231
Sequence MPAAGPQPDTTTRISRFITVEGGEGGGKSTQLRRLAELLQAQGEVVCLTREPGGAPGAEDIRRLLVEGDPGRWTPESEALLHFAARADHLARVIRPALTAGQWVLCDRFADSTIAYQGYGHGLDMAWLQALRRQIVGPTEPGLTIILDLPIEVGLARAAKRQQPNAAAPQAAEDRYERMDRGFHQRLRDGFLAIAAAEPGRCKVVDADRPVDEIASDLLSVMNRRFALKLF

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
203 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
204 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
217 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
218 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
219 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
220 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
248 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
249 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
250 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
311 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
314 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
317 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
318 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
319 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
330 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
331 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
396 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
397 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
398 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
401 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
402 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
403 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
404 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
405 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
406 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
407 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
408 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
411 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
412 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
413 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
414 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
417 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
418 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
419 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
420 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
421 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
422 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
423 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
424 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
425 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
426 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
427 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
428 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
431 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
432 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
433 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
434 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
435 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
436 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
437 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
438 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
439 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
440 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
441 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
442 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
443 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
444 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
445 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
446 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
447 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
448 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
449 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
450 2643221576 Nocardioides sp. Root614 Isolate Unclassified
451 2643221590 Nocardioides sp. Root682 Isolate Unclassified
452 2643221604 Nocardioides sp. Root190 Isolate Unclassified
453 2643221617 Nocardioides sp. Root79 Isolate Unclassified
454 2643221620 Nocardioides sp. Root240 Isolate Unclassified
455 2738541305 Nocardioides sp. CF167 Isolate Unclassified
456 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
457 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
458 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
459 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
460 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
461 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
462 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
463 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
464 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
465 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0.26
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.95
Nodule 0.17
Rhizoplane 6.32
Rhizosphere 78.53
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0424088 3300048929 Bacteria 1075
2 JGI24752J21851_1007459 3300001976 Bacteria 1427
3 JGI24737J22298_10012530 3300001990 Bacteria 2765
4 JGI24743J22301_10000134 3300001991 Bacteria 7428
5 JGI24750J21931_1000851 3300002070 Bacteria 4209
6 JGI24745J21846_1001252 3300002073 Bacteria 2447
7 JGI24748J21848_1001597 3300002074 Bacteria 2522
8 JGI24749J21850_1000509 3300002076 Bacteria 5726
9 JGI24744J21845_10002294 3300002077 Bacteria 3897
10 JGI24034J26672_10002367 3300002239 Bacteria 2584
11 JGI24751J29686_10001980 3300002459 Bacteria 4179
12 JGI25153J46596_10006534 3300003215 Bacteria 5878
13 rootH1_10021619 3300003316 Bacteria 1264
14 rootH2_10032559 3300003320 Bacteria 12792
15 rootL2_10291390 3300003322 Bacteria 1056
16 JGI25160J50197_1001950 3300003354 Bacteria 9853
17 Ga0065165_1028635 3300005262 Bacteria 1796
18 Ga0070683_100269295 3300005329 Bacteria 1620
19 Ga0070690_100028892 3300005330 Bacteria 3437
20 Ga0070670_100013394 3300005331 Bacteria 7024
21 Ga0070670_100020400 3300005331 Bacteria 5697
22 Ga0068869_100028205 3300005334 Bacteria 3921
23 Ga0070680_100002406 3300005336 Bacteria 13858
24 Ga0070680_100022351 3300005336 Bacteria 5037
25 Ga0070680_100343800 3300005336 Bacteria 1268
26 Ga0070680_100698473 3300005336 Unclassified 873
27 Ga0070682_100008050 3300005337 Bacteria 5937
28 Ga0068868_100007445 3300005338 Bacteria 7795
29 Ga0070660_100222309 3300005339 Bacteria 1535
30 Ga0070689_100075714 3300005340 Bacteria 2636
31 Ga0070691_10120209 3300005341 Bacteria 1322
32 Ga0070687_100001322 3300005343 Bacteria 8663
33 Ga0070687_100079089 3300005343 Bacteria 1789
34 Ga0070661_100077062 3300005344 Bacteria 2457
35 Ga0070668_100012197 3300005347 Bacteria 6401
36 Ga0070669_100065344 3300005353 Bacteria 2680
37 Ga0070669_100086295 3300005353 Bacteria 2345
38 Ga0070669_100324818 3300005353 Bacteria 1243
39 Ga0070669_100331888 3300005353 Bacteria 1230
40 Ga0070675_100035184 3300005354 Bacteria 4068
41 Ga0070671_100013663 3300005355 Bacteria 6548
42 Ga0070671_100162171 3300005355 Bacteria 1890
43 Ga0070671_100178959 3300005355 Bacteria 1795
44 Ga0070671_100390424 3300005355 Bacteria 1190
45 Ga0070671_100497137 3300005355 Unclassified 1049
46 Ga0070674_100002023 3300005356 Bacteria 11113
47 Ga0070674_100116254 3300005356 Bacteria 1973
48 Ga0070674_100413441 3300005356 Bacteria 1105
49 Ga0070673_100012244 3300005364 Bacteria 5884
50 Ga0070673_100078176 3300005364 Bacteria 2676
51 Ga0070673_100081066 3300005364 Bacteria 2631
52 Ga0070688_100006730 3300005365 Bacteria 6160
53 Ga0070688_100020200 3300005365 Bacteria 3869
54 Ga0070688_100044398 3300005365 Bacteria 2743
55 Ga0070659_100043352 3300005366 Bacteria 3519
56 Ga0070659_100311580 3300005366 Bacteria 1314
57 Ga0070667_100006086 3300005367 Bacteria 10016
58 Ga0070667_100084771 3300005367 Bacteria 2716
59 Ga0070714_100000556 3300005435 Bacteria 26845
60 Ga0070713_101169477 3300005436 Bacteria 744
61 Ga0070710_10002571 3300005437 Bacteria 8617
62 Ga0070710_10018625 3300005437 Bacteria 3574
63 Ga0070701_10000544 3300005438 Bacteria 12999
64 Ga0070711_100017293 3300005439 Bacteria 4590
65 Ga0070711_100179886 3300005439 Bacteria 1619
66 Ga0070711_100477130 3300005439 Bacteria 1025
67 Ga0070700_100014905 3300005441 Bacteria 4396
68 Ga0070663_100099777 3300005455 Bacteria 2165
69 Ga0070663_100522804 3300005455 Bacteria 988
70 Ga0070678_100033394 3300005456 Bacteria 3572
71 Ga0070678_100042057 3300005456 Bacteria 3245
72 Ga0070678_100065144 3300005456 Bacteria 2704
73 Ga0070681_10030828 3300005458 Bacteria 5382
74 Ga0070681_10036642 3300005458 Bacteria 4924
75 Ga0068867_100006600 3300005459 Bacteria 8201
76 Ga0068867_100112569 3300005459 Bacteria 2093
77 Ga0070685_10001171 3300005466 Bacteria 14029
78 Ga0070698_100407018 3300005471 Bacteria 1294
79 Ga0070679_100010449 3300005530 Bacteria 8806
80 Ga0070679_100016290 3300005530 Bacteria 7163
81 Ga0070684_100111632 3300005535 Bacteria 2452
82 Ga0070697_100039437 3300005536 Bacteria 3819
83 Ga0068853_100011139 3300005539 Bacteria 7295
84 Ga0068853_100028508 3300005539 Bacteria 4697
85 Ga0068853_100037050 3300005539 Bacteria 4149
86 Ga0070672_100007959 3300005543 Bacteria 7240
87 Ga0070686_100242105 3300005544 Bacteria 1314
88 Ga0070686_100615599 3300005544 Bacteria 857
89 Ga0070695_100008588 3300005545 Bacteria 6068
90 Ga0070696_100007312 3300005546 Bacteria 7374
91 Ga0070693_100012903 3300005547 Bacteria 4243
92 Ga0070665_100031361 3300005548 Bacteria 5349
93 Ga0070704_100002394 3300005549 Bacteria 10529
94 Ga0070704_100081333 3300005549 Bacteria 2386
95 Ga0070704_100103455 3300005549 Bacteria 2151
96 Ga0070704_100334507 3300005549 Bacteria 1273
97 Ga0068855_100074040 3300005563 Bacteria 3956
98 Ga0068855_100136130 3300005563 Bacteria 2803
99 Ga0068855_100144161 3300005563 Bacteria 2713
100 Ga0070664_100051607 3300005564 Bacteria 3482
101 Ga0068857_100156103 3300005577 Bacteria 2069
102 Ga0068854_100103200 3300005578 Bacteria 2140
103 Ga0068856_100110413 3300005614 Bacteria 2747
104 Ga0068856_100246984 3300005614 Bacteria 1800
105 Ga0070702_100036072 3300005615 Bacteria 2736
106 Ga0070702_100218091 3300005615 Bacteria 1274
107 Ga0070702_100259079 3300005615 Bacteria 1183
108 Ga0070702_100346934 3300005615 Bacteria 1044
109 Ga0068859_100149112 3300005617 Bacteria 2415
110 Ga0068859_100193521 3300005617 Bacteria 2118
111 Ga0068864_100397581 3300005618 Bacteria 1309
112 Ga0068864_100418600 3300005618 Bacteria 1276
113 Ga0068870_10005222 3300005840 Bacteria 5652
114 Ga0068863_100007012 3300005841 Bacteria 11043
115 Ga0068863_100155966 3300005841 Bacteria 2186
116 Ga0068863_100500957 3300005841 Bacteria 1196
117 Ga0068858_100016071 3300005842 Bacteria 7031
118 Ga0068858_100383926 3300005842 Bacteria 1348
119 Ga0068860_100040442 3300005843 Bacteria 4455
120 Ga0068860_100216486 3300005843 Bacteria 1859
121 Ga0068862_100011484 3300005844 Bacteria 7311
122 Ga0068862_100029912 3300005844 Bacteria 4589
123 Ga0068862_100840405 3300005844 Bacteria 899
124 Ga0068862_101167701 3300005844 Bacteria 767
125 Ga0081455_10010899 3300005937 Bacteria 9174
126 Ga0081455_10033604 3300005937 Bacteria 4607
127 Ga0081455_10469817 3300005937 Bacteria 854
128 Ga0081538_10029065 3300005981 Bacteria 3785
129 Ga0081538_10034984 3300005981 Bacteria 3309
130 Ga0081538_10078950 3300005981 Bacteria 1763
131 Ga0081540_1017139 3300005983 Bacteria 4497
132 Ga0081539_10015587 3300005985 Bacteria 5512
133 Ga0070717_10022811 3300006028 Bacteria 4951
134 Ga0070717_10057188 3300006028 Bacteria 3224
135 Ga0070717_10059609 3300006028 Bacteria 3159
136 Ga0070717_10167415 3300006028 Bacteria 1910
137 Ga0070717_10310901 3300006028 Bacteria 1402
138 Ga0075365_10001017 3300006038 Bacteria 12044
139 Ga0075365_10007361 3300006038 Bacteria 6157
140 Ga0075365_10026251 3300006038 Bacteria 3696
141 Ga0075365_10041020 3300006038 Bacteria 3021
142 Ga0075365_10047027 3300006038 Bacteria 2835
143 Ga0075365_10078435 3300006038 Bacteria 2233
144 Ga0075365_10141855 3300006038 Bacteria 1668
145 Ga0075365_10333070 3300006038 Bacteria 1069
146 Ga0075365_10386415 3300006038 Bacteria 987
147 Ga0075368_10065813 3300006042 Bacteria 1456
148 Ga0075368_10194856 3300006042 Bacteria 856
149 Ga0075363_100076097 3300006048 Bacteria 1829
150 Ga0075363_100137181 3300006048 Bacteria 1375
151 Ga0075363_100151318 3300006048 Bacteria 1310
152 Ga0075363_100288731 3300006048 Bacteria 950
153 Ga0075364_10033452 3300006051 Bacteria 3311
154 Ga0075364_10083572 3300006051 Bacteria 2113
155 Ga0070715_10127066 3300006163 Bacteria 1222
156 Ga0070715_10174973 3300006163 Bacteria 1072
157 Ga0070716_100022930 3300006173 Bacteria 3305
158 Ga0070712_100004847 3300006175 Bacteria 8318
159 Ga0070712_100033476 3300006175 Bacteria 3478
160 Ga0070712_100088621 3300006175 Bacteria 2261
161 Ga0075362_10013531 3300006177 Bacteria 3268
162 Ga0075362_10051552 3300006177 Bacteria 1842
163 Ga0075367_10047397 3300006178 Bacteria 2528
164 Ga0075367_10140312 3300006178 Bacteria 1497
165 Ga0075367_10172944 3300006178 Bacteria 1346
166 Ga0075367_10218491 3300006178 Bacteria 1192
167 Ga0075367_10305587 3300006178 Bacteria 1001
168 Ga0075369_10005025 3300006186 Bacteria 4926
169 Ga0075369_10047996 3300006186 Bacteria 1842
170 Ga0075369_10189107 3300006186 Bacteria 948
171 Ga0075366_10008616 3300006195 Bacteria 5679
172 Ga0075366_10013786 3300006195 Bacteria 4607
173 Ga0075366_10036925 3300006195 Bacteria 2882
174 Ga0075366_10193129 3300006195 Bacteria 1237
175 Ga0075366_10404603 3300006195 Bacteria 840
176 Ga0075370_10027696 3300006353 Bacteria 3147
177 Ga0075370_10099290 3300006353 Bacteria 1684
178 Ga0068871_100067335 3300006358 Bacteria 2937
179 Ga0068871_100113778 3300006358 Bacteria 2279
180 Ga0075428_100001218 3300006844 Bacteria 27549
181 Ga0075428_100022676 3300006844 Bacteria 6949
182 Ga0075428_100573027 3300006844 Bacteria 1206
183 Ga0075428_100624086 3300006844 Bacteria 1150
184 Ga0075430_100000152 3300006846 Bacteria 44881
185 Ga0075430_100025527 3300006846 Bacteria 5027
186 Ga0075430_100045037 3300006846 Bacteria 3729
187 Ga0075430_100198426 3300006846 Bacteria 1667
188 Ga0075431_100000613 3300006847 Bacteria 30137
189 Ga0075431_100010947 3300006847 Bacteria 9128
190 Ga0075431_100062491 3300006847 Bacteria 3843
191 Ga0075431_100064062 3300006847 Bacteria 3795
192 Ga0075431_100582744 3300006847 Bacteria 1104
193 Ga0075431_101208336 3300006847 Bacteria 719
194 Ga0075433_10059850 3300006852 Bacteria 3333
195 Ga0075433_10298209 3300006852 Bacteria 1427
196 Ga0075434_100017361 3300006871 Bacteria 6930
197 Ga0075434_100056047 3300006871 Bacteria 3916
198 Ga0075434_100269646 3300006871 Bacteria 1721
199 Ga0075429_100004424 3300006880 Bacteria 12075
200 Ga0075429_100274586 3300006880 Bacteria 1476
201 Ga0075429_100429975 3300006880 Bacteria 1157
202 Ga0068865_100098503 3300006881 Bacteria 2136
203 Ga0068865_100403720 3300006881 Bacteria 1120
204 Ga0075436_100000477 3300006914 Bacteria 26044
205 Ga0075436_100028761 3300006914 Bacteria 3823
206 Ga0075436_100520032 3300006914 Bacteria 872
207 Ga0097620_100149123 3300006931 Bacteria 2415
208 Ga0097620_100193536 3300006931 Bacteria 2118
209 Ga0075435_100076627 3300007076 Bacteria 2741
210 Ga0075435_100079110 3300007076 Bacteria 2697
211 Ga0099794_10089867 3300007265 Bacteria 1523
212 Ga0099795_10001007 3300007788 Bacteria 5787
213 Ga0099795_10025722 3300007788 Bacteria 1976
214 Ga0105251_10054542 3300009011 Bacteria 1898
215 Ga0105240_10026738 3300009093 Bacteria 7568
216 Ga0111539_10000840 3300009094 Bacteria 39968
217 Ga0111539_10044534 3300009094 Bacteria 5317
218 Ga0111539_10083183 3300009094 Bacteria 3764
219 Ga0111539_10089489 3300009094 Bacteria 3617
220 Ga0111539_10106273 3300009094 Bacteria 3293
221 Ga0111539_10168821 3300009094 Bacteria 2557
222 Ga0111539_10241880 3300009094 Bacteria 2101
223 Ga0105245_10028096 3300009098 Bacteria 4958
224 Ga0105245_10201889 3300009098 Bacteria 1910
225 Ga0105247_10110832 3300009101 Bacteria 1766
226 Ga0105247_10228451 3300009101 Bacteria 1263
227 Ga0114129_10000320 3300009147 Bacteria 56319
228 Ga0114129_10002097 3300009147 Bacteria 27432
229 Ga0114129_10051669 3300009147 Bacteria 5770
230 Ga0114129_10061592 3300009147 Bacteria 5244
231 Ga0114129_11430534 3300009147 Bacteria 852
232 Ga0105243_10023744 3300009148 Bacteria 4674
233 Ga0105243_10221733 3300009148 Bacteria 1672
234 Ga0105241_10024393 3300009174 Bacteria 4490
235 Ga0105241_10075452 3300009174 Bacteria 2627
236 Ga0105241_10116553 3300009174 Bacteria 2145
237 Ga0105241_10639123 3300009174 Bacteria 965
238 Ga0105242_10102353 3300009176 Bacteria 2429
239 Ga0105242_10390973 3300009176 Bacteria 1295
240 Ga0105248_10039516 3300009177 Bacteria 5285
241 Ga0105248_10629824 3300009177 Bacteria 1210
242 Ga0105237_10047128 3300009545 Bacteria 4334
243 Ga0105237_10092024 3300009545 Bacteria 3022
244 Ga0105237_10640661 3300009545 Bacteria 1070
245 Ga0105238_10080512 3300009551 Bacteria 3246
246 Ga0105238_10277946 3300009551 Bacteria 1655
247 Ga0105238_10855019 3300009551 Bacteria 927
248 Ga0099796_10006006 3300010159 Bacteria 3078
249 Ga0099796_10043499 3300010159 Bacteria 1530
250 Ga0099796_10048748 3300010159 Bacteria 1462
251 Ga0105239_10007779 3300010375 Bacteria 12264
252 Ga0105239_10307471 3300010375 Bacteria 1786
253 Ga0105246_10076930 3300011119 Bacteria 2366
254 Ga0105246_10103701 3300011119 Bacteria 2076
255 Ga0105246_10241714 3300011119 Bacteria 1428
256 Ga0105246_10557154 3300011119 Bacteria 983
257 Ga0157373_10015435 3300013100 Bacteria 5584
258 Ga0157373_10242012 3300013100 Bacteria 1275
259 Ga0157374_10144995 3300013296 Bacteria 2306
260 Ga0157378_10142728 3300013297 Bacteria 2225
261 Ga0157378_10430782 3300013297 Bacteria 1305
262 Ga0157378_11203288 3300013297 Bacteria 797
263 Ga0163162_10090461 3300013306 Bacteria 3142
264 Ga0163162_10736081 3300013306 Bacteria 1106
265 Ga0157372_10016504 3300013307 Bacteria 7925
266 Ga0157372_11029520 3300013307 Bacteria 953
267 Ga0157375_10369079 3300013308 Bacteria 1601
268 Ga0163163_10039625 3300014325 Bacteria 4599
269 Ga0163163_10623628 3300014325 Bacteria 1142
270 Ga0157380_10084701 3300014326 Bacteria 2600
271 Ga0157380_10137661 3300014326 Bacteria 2092
272 Ga0157377_10005862 3300014745 Bacteria 5811
273 Ga0157379_10056034 3300014968 Bacteria 3523
274 Ga0157379_10144281 3300014968 Bacteria 2147
275 Ga0157376_10111300 3300014969 Bacteria 2411
276 Ga0157376_10571090 3300014969 Bacteria 1122
277 Ga0163161_10009501 3300017792 Bacteria 6729
278 Ga0224572_1001576 3300024225 Bacteria 3423
279 Ga0209148_1000274 3300025254 Bacteria 81201
280 Ga0209148_1001585 3300025254 Bacteria 10738
281 Ga0209758_1000059 3300025297 Bacteria 328458
282 Ga0209758_1001730 3300025297 Bacteria 24307
283 Ga0209758_1001908 3300025297 Bacteria 22695
284 Ga0209758_1036239 3300025297 Bacteria 1929
285 Ga0209758_1046740 3300025297 Bacteria 1556
286 Ga0209050_1002314 3300025298 Bacteria 16763
287 Ga0209256_1068092 3300025299 Bacteria 809
288 Ga0207426_1000143 3300025302 Bacteria 192948
289 Ga0209257_1000114 3300025304 Bacteria 233013
290 Ga0209257_1019160 3300025304 Bacteria 2592
291 Ga0209257_1030530 3300025304 Bacteria 1739
292 Ga0207692_10009902 3300025898 Bacteria 3996
293 Ga0207692_10029373 3300025898 Bacteria 2612
294 Ga0207642_10000663 3300025899 Bacteria 10572
295 Ga0207642_10138146 3300025899 Bacteria 1281
296 Ga0207710_10023256 3300025900 Bacteria 2663
297 Ga0207688_10000130 3300025901 Bacteria 31681
298 Ga0207688_10068808 3300025901 Bacteria 2006
299 Ga0207688_10273334 3300025901 Bacteria 1028
300 Ga0207647_10002385 3300025904 Bacteria 14262
301 Ga0207685_10061678 3300025905 Bacteria 1487
302 Ga0207699_10001003 3300025906 Bacteria 13374
303 Ga0207645_10049854 3300025907 Bacteria 2674
304 Ga0207643_10001981 3300025908 Bacteria 11312
305 Ga0207705_10315453 3300025909 Bacteria 1201
306 Ga0207654_10063597 3300025911 Bacteria 2166
307 Ga0207707_10045123 3300025912 Bacteria 3841
308 Ga0207707_10121547 3300025912 Bacteria 2283
309 Ga0207695_10050992 3300025913 Bacteria 4348
310 Ga0207671_10087282 3300025914 Unclassified 2346
311 Ga0207693_10004368 3300025915 Bacteria 11957
312 Ga0207693_10045948 3300025915 Bacteria 3431
313 Ga0207693_10062706 3300025915 Bacteria 2913
314 Ga0207693_10080870 3300025915 Bacteria 2543
315 Ga0207693_10253175 3300025915 Bacteria 1382
316 Ga0207663_10012503 3300025916 Bacteria 4591
317 Ga0207663_10046371 3300025916 Bacteria 2677
318 Ga0207660_10174649 3300025917 Bacteria 1665
319 Ga0207660_10294967 3300025917 Bacteria 1290
320 Ga0207662_10147737 3300025918 Bacteria 1493
321 Ga0207657_10032651 3300025919 Bacteria 4701
322 Ga0207652_10043743 3300025921 Bacteria 3813
323 Ga0207652_10102515 3300025921 Bacteria 2529
324 Ga0207652_10413202 3300025921 Bacteria 1217
325 Ga0207681_10054305 3300025923 Bacteria 2723
326 Ga0207681_10364887 3300025923 Bacteria 1159
327 Ga0207694_10127645 3300025924 Bacteria 2036
328 Ga0207694_10175041 3300025924 Bacteria 1739
329 Ga0207650_10004418 3300025925 Bacteria 9604
330 Ga0207650_10014049 3300025925 Bacteria 5559
331 Ga0207650_10025768 3300025925 Bacteria 4190
332 Ga0207659_10012143 3300025926 Bacteria 5464
333 Ga0207659_10066708 3300025926 Bacteria 2612
334 Ga0207659_10099922 3300025926 Bacteria 2185
335 Ga0207687_10005289 3300025927 Bacteria 8555
336 Ga0207687_10061597 3300025927 Bacteria 2650
337 Ga0207700_10058615 3300025928 Bacteria 2909
338 Ga0207700_10084407 3300025928 Bacteria 2489
339 Ga0207700_10452787 3300025928 Bacteria 1131
340 Ga0207700_10977642 3300025928 Bacteria 758
341 Ga0207664_10030708 3300025929 Bacteria 4105
342 Ga0207664_10156957 3300025929 Bacteria 1938
343 Ga0207664_10182416 3300025929 Bacteria 1803
344 Ga0207644_10006827 3300025931 Bacteria 7440
345 Ga0207644_10025164 3300025931 Bacteria 4091
346 Ga0207644_10102456 3300025931 Bacteria 2153
347 Ga0207706_10002801 3300025933 Bacteria 16940
348 Ga0207686_10054100 3300025934 Bacteria 2513
349 Ga0207709_10015455 3300025935 Bacteria 4233
350 Ga0207709_10177333 3300025935 Bacteria 1501
351 Ga0207670_10021754 3300025936 Bacteria 3962
352 Ga0207670_10052934 3300025936 Bacteria 2732
353 Ga0207670_10076670 3300025936 Bacteria 2327
354 Ga0207670_10305155 3300025936 Bacteria 1248
355 Ga0207669_10007567 3300025937 Bacteria 5035
356 Ga0207704_10196064 3300025938 Bacteria 1473
357 Ga0207665_10029125 3300025939 Bacteria 3651
358 Ga0207665_10281471 3300025939 Bacteria 1238
359 Ga0207691_10011407 3300025940 Bacteria 8528
360 Ga0207691_10540575 3300025940 Bacteria 988
361 Ga0207711_10016266 3300025941 Bacteria 6178
362 Ga0207711_10090712 3300025941 Bacteria 2687
363 Ga0207689_10000756 3300025942 Bacteria 31021
364 Ga0207679_10024806 3300025945 Bacteria 4115
365 Ga0207667_10354994 3300025949 Bacteria 1495
366 Ga0207667_10358477 3300025949 Bacteria 1487
367 Ga0207651_10003263 3300025960 Bacteria 7943
368 Ga0207651_10007290 3300025960 Bacteria 5879
369 Ga0207651_10072681 3300025960 Bacteria 2443
370 Ga0207651_10799889 3300025960 Bacteria 836
371 Ga0207712_10017551 3300025961 Bacteria 4650
372 Ga0207668_10028885 3300025972 Bacteria 3630
373 Ga0207668_10485434 3300025972 Bacteria 1060
374 Ga0207668_10767144 3300025972 Bacteria 852
375 Ga0207640_10015569 3300025981 Bacteria 4406
376 Ga0207677_10006114 3300026023 Bacteria 6574
377 Ga0207703_10011569 3300026035 Bacteria 6861
378 Ga0207703_10783315 3300026035 Bacteria 910
379 Ga0207639_10012134 3300026041 Bacteria 5994
380 Ga0207639_10143515 3300026041 Bacteria 1992
381 Ga0207678_10038702 3300026067 Bacteria 4142
382 Ga0207678_10042400 3300026067 Bacteria 3942
383 Ga0207678_10121665 3300026067 Bacteria 2227
384 Ga0207708_10004345 3300026075 Bacteria 10438
385 Ga0207702_10543101 3300026078 Bacteria 1136
386 Ga0207641_10058535 3300026088 Bacteria 3279
387 Ga0207641_10162421 3300026088 Bacteria 2032
388 Ga0207641_10991663 3300026088 Bacteria 836
389 Ga0207648_10009209 3300026089 Bacteria 9483
390 Ga0207648_10060490 3300026089 Bacteria 3303
391 Ga0207676_10007771 3300026095 Bacteria 7625
392 Ga0207676_10132024 3300026095 Bacteria 2125
393 Ga0207676_10308045 3300026095 Bacteria 1449
394 Ga0207674_10184805 3300026116 Bacteria 2035
395 Ga0207675_100004438 3300026118 Bacteria 13564
396 Ga0207683_10015749 3300026121 Bacteria 6434
397 Ga0207683_10049872 3300026121 Bacteria 3665
398 Ga0207683_10090523 3300026121 Bacteria 2725
399 Ga0207683_10572721 3300026121 Unclassified 1044
400 Ga0207698_10115378 3300026142 Bacteria 2261
401 Ga0209813_10005872 3300027866 Bacteria 3006
402 Ga0209813_10039324 3300027866 Bacteria 1433
403 Ga0209813_10074582 3300027866 Bacteria 1110
404 Ga0207428_10017604 3300027907 Bacteria 6127
405 Ga0207428_10066313 3300027907 Bacteria 2845
406 Ga0207428_10123330 3300027907 Bacteria 1985
407 Ga0268266_10209882 3300028379 Bacteria 1785
408 Ga0268266_10319538 3300028379 Bacteria 1453
409 Ga0268265_10015994 3300028380 Bacteria 5148
410 Ga0268264_10244109 3300028381 Bacteria 1665
411 Ga0268264_10733889 3300028381 Bacteria 983
412 Ga0307515_10091636 3300028794 Bacteria 3795
413 Ga0265324_10060633 3300029957 Bacteria 1293
414 Ga0307512_10186941 3300030522 Bacteria 1151
415 Ga0265762_1004526 3300030760 Bacteria 2488
416 Ga0265763_1001918 3300030763 Bacteria 1545
417 Ga0265328_10012454 3300031239 Bacteria 3384
418 Ga0265325_10014052 3300031241 Bacteria 4539
419 Ga0265340_10034405 3300031247 Bacteria 2520
420 Ga0265331_10000333 3300031250 Bacteria 50586
421 Ga0265327_10000775 3300031251 Bacteria 49295
422 Ga0265327_10091170 3300031251 Bacteria 1486
423 Ga0265316_10374520 3300031344 Bacteria 1028
424 Ga0307513_10451469 3300031456 Bacteria 1010
425 Ga0307408_100242164 3300031548 Bacteria 1483
426 Ga0265313_10073434 3300031595 Bacteria 1570
427 Ga0307508_10047520 3300031616 Bacteria 3827
428 Ga0316215_1000920 3300033544 Bacteria 2876
429 Ga0373926_0006659 3300035083 Bacteria 3836
430 Ga0373926_0162366 3300035083 Bacteria 853
431 Ga0373929_0010236 3300035085 Bacteria 1751
432 Ga0373940_0007997 3300035088 Bacteria 2410
433 Ga0373944_0001173 3300035089 Bacteria 6541
434 Ga0373923_0002035 3300035111 Bacteria 6094
435 Ga0373936_0001796 3300035113 Bacteria 7889
436 Ga0373936_0047960 3300035113 Bacteria 1724
437 Ga0373936_0165075 3300035113 Bacteria 966
438 Ga0373939_0001290 3300035114 Bacteria 6094
439 Ga0373945_0005121 3300035116 Bacteria 4184
440 Ga0373945_0007492 3300035116 Bacteria 3538
441 Ga0373945_0007797 3300035116 Bacteria 3473
442 Ga0373945_0017489 3300035116 Bacteria 2428
443 Ga0373953_0032305 3300035117 Bacteria 2041
444 Ga0373956_0012955 3300035119 Bacteria 3464
445 Ga0373956_0037590 3300035119 Bacteria 2140
446 Ga0373943_0000381 3300035170 Bacteria 18615
447 Ga0373943_0002159 3300035170 Bacteria 8946
448 Ga0373943_0015098 3300035170 Bacteria 3506
449 Ga0373943_0031493 3300035170 Bacteria 2516
450 Ga0373943_0077253 3300035170 Bacteria 1700
451 Ga0373943_0224374 3300035170 Bacteria 1047
452 Ga0373946_0002070 3300035171 Bacteria 7041
453 Ga0373946_0036439 3300035171 Bacteria 1995
454 Ga0373946_0052451 3300035171 Unclassified 1711
455 Ga0373955_0002179 3300035172 Bacteria 8483
456 Ga0373955_0007537 3300035172 Bacteria 5007
457 Ga0373962_0041982 3300035242 Bacteria 1292
458 Ga0373924_0015268 3300035410 Bacteria 2917
459 Ga0373924_0031708 3300035410 Bacteria 2127
460 Ga0373924_0102603 3300035410 Bacteria 1231
461 Ga0373931_0086002 3300035691 Bacteria 1744
462 Ga0373935_0000006 3300035692 Bacteria 121726
463 Ga0373935_0034107 3300035692 Bacteria 3171
464 Ga0373935_0049660 3300035692 Bacteria 2660
465 Ga0373935_0053179 3300035692 Bacteria 2576
466 Ga0373935_0105630 3300035692 Bacteria 1862
467 Ga0373935_0170453 3300035692 Bacteria 1489
468 Ga0373927_0003706 3300035695 Bacteria 10864
469 Ga0373927_0013209 3300035695 Bacteria 5492
470 Ga0373927_0015339 3300035695 Bacteria 5061
471 Ga0373927_0015712 3300035695 Bacteria 4998
472 Ga0373927_0018500 3300035695 Bacteria 4578
473 Ga0373927_0029730 3300035695 Bacteria 3563
474 Ga0373927_0171463 3300035695 Bacteria 1422
475 Ga0373927_0238671 3300035695 Bacteria 1194
476 Ga0373927_0547269 3300035695 Bacteria 765
477 Ga0373933_0000007 3300035724 Bacteria 123599
478 Ga0373933_0004171 3300035724 Bacteria 7960
479 Ga0373933_0056949 3300035724 Bacteria 2348
480 Ga0373947_0000419 3300035725 Bacteria 24144
481 Ga0373947_0001498 3300035725 Bacteria 14333
482 Ga0373947_0003146 3300035725 Bacteria 9827
483 Ga0373947_0006728 3300035725 Bacteria 6668
484 Ga0373947_0016255 3300035725 Bacteria 4277
485 Ga0373947_0019872 3300035725 Bacteria 3877
486 Ga0373947_0033265 3300035725 Bacteria 3042
487 Ga0373947_0105033 3300035725 Bacteria 1779
488 Ga0373947_0139717 3300035725 Bacteria 1553
489 Ga0373937_0000124 3300036401 Bacteria 73933
490 Ga0373937_0018439 3300036401 Bacteria 6233
491 Ga0373937_0025281 3300036401 Bacteria 5361
492 Ga0373937_0047656 3300036401 Bacteria 3922
493 Ga0372808_000937 3300036459 Bacteria 2747
494 Ga0373925_0000210 3300037068 Bacteria 63621
495 Ga0373925_0004278 3300037068 Bacteria 10818
496 Ga0373925_0006000 3300037068 Bacteria 8997
497 Ga0373925_0006086 3300037068 Bacteria 8923
498 Ga0373925_0026431 3300037068 Bacteria 4247
499 Ga0373925_0032271 3300037068 Bacteria 3854
500 Ga0373925_0083949 3300037068 Bacteria 2426
501 Ga0373925_0284217 3300037068 Bacteria 1333
502 Ga0373925_0594639 3300037068 Bacteria 911
503 Ga0395900_0534211 3300037418 Bacteria 1119
504 Ga0395898_0179458 3300037466 Bacteria 2024
505 Ga0395901_0266328 3300038443 Bacteria 1783
506 Ga0436365_0368397 3300039437 Bacteria 2822
507 Ga0436365_1370429 3300039437 Bacteria 3332
508 Ga0436360_0320708 3300039438 Bacteria 3652
509 Ga0436361_0622258 3300039447 Bacteria 7351
510 Ga0451800_0784539 3300041459 Bacteria 1043
511 Ga0451807_2166610 3300041486 Bacteria 950
512 Ga0451849_0087101 3300041505 Bacteria 725
513 Ga0439448_0084842 3300042005 Bacteria 1066
514 Ga0439456_078854 3300042013 Unclassified 734
515 Ga0453683_0473469 3300044673 Unclassified 811
516 Ga0466965_0102315 3300044683 Bacteria 1466
517 Ga0466963_0017811 3300044694 Bacteria 4432
518 Ga0466964_0163810 3300044706 Bacteria 1041
519 Ga0453684_0000006 3300044712 Bacteria 1364191
520 Ga0453684_0000031 3300044712 Bacteria 752632
521 Ga0453684_0008102 3300044712 Bacteria 18989
522 Ga0453684_0112756 3300044712 Unclassified 3300
523 Ga0453684_0313101 3300044712 Bacteria 1780
524 Ga0453684_1220544 3300044712 Bacteria 788
525 Ga0466970_0243946 3300044765 Bacteria 1006
526 Ga0466967_0024864 3300045976 Bacteria 4931
527 Ga0466967_0069388 3300045976 Bacteria 3150
528 Ga0495617_078930 3300046452 Bacteria 1079
529 Ga0495592_0000020 3300046454 Bacteria 140576
530 Ga0495592_0026318 3300046454 Bacteria 4411
531 Ga0495592_0034109 3300046454 Bacteria 3837
532 Ga0495592_0095454 3300046454 Unclassified 2127
533 Ga0495603_0001017 3300046455 Bacteria 16170
534 Ga0495629_0001626 3300046459 Bacteria 17663
535 Ga0495629_0006124 3300046459 Bacteria 8936
536 Ga0495629_0008249 3300046459 Bacteria 7659
537 Ga0495629_0044612 3300046459 Bacteria 3111
538 Ga0495629_0258401 3300046459 Bacteria 1197
539 Ga0495629_0444729 3300046459 Bacteria 878
540 Ga0495638_0011195 3300046460 Bacteria 6192
541 Ga0495641_0114372 3300046461 Bacteria 1203
542 Ga0495651_0000282 3300046462 Bacteria 39576
543 Ga0495651_0001410 3300046462 Bacteria 18660
544 Ga0495653_0000046 3300046463 Bacteria 113893
545 Ga0495653_0001155 3300046463 Bacteria 20322
546 Ga0495653_0092433 3300046463 Bacteria 2209
547 Ga0495580_0000806 3300046472 Bacteria 27108
548 Ga0495580_0147371 3300046472 Bacteria 1631
549 Ga0495582_0001348 3300046473 Bacteria 13795
550 Ga0495582_0059585 3300046473 Bacteria 2106
551 Ga0495582_0096554 3300046473 Bacteria 1652
552 Ga0495639_0001292 3300046475 Bacteria 11259
553 Ga0495639_0133006 3300046475 Bacteria 1192
554 Ga0495639_0146341 3300046475 Bacteria 1138
555 Ga0495639_0307503 3300046475 Bacteria 791
556 Ga0495662_0001018 3300046476 Bacteria 13751
557 Ga0495662_0130074 3300046476 Bacteria 1237
558 Ga0495662_0139554 3300046476 Bacteria 1193
559 Ga0495664_0000017 3300046477 Bacteria 172210
560 Ga0495664_0000670 3300046477 Bacteria 17396
561 Ga0495664_0064886 3300046477 Bacteria 2176
562 Ga0495584_0008719 3300046491 Bacteria 5244
563 Ga0495584_0032467 3300046491 Bacteria 2643
564 Ga0495584_0187068 3300046491 Bacteria 1052
565 Ga0495594_0000401 3300046499 Bacteria 21822
566 Ga0495607_0103777 3300046501 Bacteria 1518
567 Ga0495607_0104439 3300046501 Bacteria 1512
568 Ga0495607_0233215 3300046501 Bacteria 894
569 Ga0495606_0110584 3300046507 Bacteria 1658
570 Ga0495608_0000250 3300046511 Bacteria 39000
571 Ga0495608_0010843 3300046511 Bacteria 6352
572 Ga0495608_0081432 3300046511 Bacteria 2103
573 Ga0495610_0021653 3300046512 Bacteria 3529
574 Ga0495616_0071391 3300046513 Bacteria 1679
575 Ga0495616_0191170 3300046513 Bacteria 905
576 Ga0495618_0000059 3300046514 Bacteria 79623
577 Ga0495618_0002157 3300046514 Bacteria 12882
578 Ga0495618_0002703 3300046514 Bacteria 11302
579 Ga0495618_0237435 3300046514 Unclassified 1146
580 Ga0495620_0064800 3300046515 Bacteria 1510
581 Ga0495628_0000022 3300046516 Bacteria 140362
582 Ga0495628_0015475 3300046516 Bacteria 6370
583 Ga0495628_0056961 3300046516 Bacteria 3075
584 Ga0495628_0245684 3300046516 Bacteria 1337
585 Ga0495630_0000758 3300046517 Bacteria 22647
586 Ga0495630_0011807 3300046517 Bacteria 6330
587 Ga0495630_0104242 3300046517 Bacteria 2147
588 Ga0495630_0310229 3300046517 Bacteria 1206
589 Ga0495630_0347433 3300046517 Bacteria 1135
590 Ga0495631_0020740 3300046518 Bacteria 3067
591 Ga0495637_0135961 3300046520 Bacteria 936
592 Ga0495643_0215295 3300046522 Bacteria 914
593 Ga0495644_0095070 3300046523 Bacteria 1126
594 Ga0495648_0082144 3300046524 Bacteria 1830
595 Ga0495663_0063692 3300046525 Bacteria 1163
596 Ga0495666_0114782 3300046526 Bacteria 1264
597 Ga0495666_0204169 3300046526 Bacteria 908
598 Ga0495652_0000008 3300046529 Bacteria 343637
599 Ga0495652_0001912 3300046529 Bacteria 22147
600 Ga0495652_0026195 3300046529 Bacteria 5154
601 Ga0495652_0153943 3300046529 Bacteria 1792
602 Ga0495652_0365284 3300046529 Bacteria 1030
603 Ga0495665_0123950 3300046531 Bacteria 1353
604 Ga0495665_0137291 3300046531 Bacteria 1279
605 Ga0495665_0269460 3300046531 Bacteria 875
606 Ga0495640_0000029 3300046533 Bacteria 79567
607 Ga0495640_0008277 3300046533 Bacteria 8158
608 Ga0495640_0012288 3300046533 Bacteria 6548
609 Ga0495640_0033432 3300046533 Bacteria 3652
610 Ga0495640_0092337 3300046533 Bacteria 1996
611 Ga0495586_0010651 3300046535 Bacteria 4890
612 Ga0495587_0000019 3300046536 Bacteria 161972
613 Ga0495587_0006011 3300046536 Bacteria 7910
614 Ga0495598_0010537 3300046537 Bacteria 2216
615 Ga0495645_0000006 3300046543 Bacteria 382503
616 Ga0495645_0008317 3300046543 Bacteria 7243
617 Ga0495645_0175214 3300046543 Bacteria 1473
618 Ga0495645_0204885 3300046543 Bacteria 1335
619 Ga0495622_0046788 3300046557 Bacteria 2010
620 Ga0495622_0118276 3300046557 Bacteria 1211
621 Ga0495633_0061264 3300046558 Bacteria 1762
622 Ga0495667_0000061 3300046559 Bacteria 94650
623 Ga0495667_0000879 3300046559 Bacteria 19393
624 Ga0495656_0001123 3300046615 Bacteria 8705
625 Ga0495656_0034826 3300046615 Bacteria 2065
626 Ga0495668_0053325 3300046616 Bacteria 2236
627 Ga0495634_0001212 3300046642 Bacteria 23807
628 Ga0495634_0001468 3300046642 Bacteria 20895
629 Ga0495634_0007204 3300046642 Bacteria 8386
630 Ga0495634_0007643 3300046642 Bacteria 8097
631 Ga0495634_0189376 3300046642 Bacteria 1284
632 Ga0495634_0297489 3300046642 Bacteria 976
633 Ga0495611_0251504 3300046648 Bacteria 819
634 Ga0495625_0034767 3300046660 Bacteria 3717
635 Ga0495625_0325743 3300046660 Bacteria 977
636 Ga0495625_0346003 3300046660 Unclassified 941
637 Ga0495635_0000023 3300046663 Bacteria 153429
638 Ga0495635_0009308 3300046663 Bacteria 6862
639 Ga0495635_0050714 3300046663 Bacteria 2860
640 Ga0495635_0135616 3300046663 Bacteria 1678
641 Ga0495635_0169013 3300046663 Bacteria 1487
642 Ga0495661_0016354 3300046665 Bacteria 4920
643 Ga0495661_0018986 3300046665 Bacteria 4511
644 Ga0495588_0005816 3300046674 Bacteria 5516
645 Ga0495657_0000099 3300046675 Bacteria 76617
646 Ga0495657_0031948 3300046675 Bacteria 3677
647 Ga0495599_0000039 3300046678 Bacteria 98345
648 Ga0495599_0068733 3300046678 Bacteria 2211
649 Ga0495599_0183154 3300046678 Bacteria 1290
650 Ga0495623_0000253 3300046679 Bacteria 34266
651 Ga0495623_0002814 3300046679 Bacteria 11476
652 Ga0495623_0163132 3300046679 Bacteria 1308
653 Ga0495646_0000017 3300046680 Bacteria 123549
654 Ga0495646_0010331 3300046680 Bacteria 5936
655 Ga0495646_0115426 3300046680 Bacteria 1525
656 Ga0495646_0156346 3300046680 Bacteria 1265
657 Ga0495647_0006744 3300046681 Bacteria 3822
658 Ga0495647_0068679 3300046681 Bacteria 1414
659 Ga0495658_0003498 3300046683 Bacteria 7772
660 Ga0495658_0036061 3300046683 Bacteria 2726
661 Ga0495658_0046803 3300046683 Bacteria 2433
662 Ga0495658_0069182 3300046683 Bacteria 2046
663 Ga0495658_0082845 3300046683 Bacteria 1885
664 Ga0495658_0165063 3300046683 Unclassified 1368
665 Ga0495669_0090032 3300046684 Bacteria 1416
666 Ga0495613_0000508 3300046689 Bacteria 32835
667 Ga0495613_0026976 3300046689 Bacteria 4276
668 Ga0495613_0049670 3300046689 Bacteria 3095
669 Ga0495613_0597593 3300046689 Bacteria 735
670 Ga0495624_0032723 3300046690 Bacteria 3370
671 Ga0495624_0036798 3300046690 Bacteria 3153
672 Ga0495624_0047972 3300046690 Bacteria 2712
673 Ga0495624_0107846 3300046690 Bacteria 1713
674 Ga0495624_0208057 3300046690 Bacteria 1187
675 Ga0495670_0005031 3300046691 Bacteria 6504
676 Ga0495671_0088284 3300046692 Bacteria 1518
677 Ga0495649_0073715 3300046694 Bacteria 1829
678 Ga0495649_0100214 3300046694 Bacteria 1540
679 Ga0495589_0282080 3300046794 Bacteria 772
680 Ga0495600_0000030 3300046809 Bacteria 89424
681 Ga0495581_0015077 3300047315 Bacteria 4487
682 Ga0495581_0071686 3300047315 Bacteria 2005
683 Ga0495581_0078613 3300047315 Bacteria 1909
684 Ga0495581_0163574 3300047315 Bacteria 1301
685 Ga0495604_0000030 3300047317 Bacteria 138597
686 Ga0495604_0000662 3300047317 Bacteria 29274
687 Ga0495604_0515409 3300047317 Bacteria 774
688 Ga0495674_0000009 3300047319 Bacteria 310479
689 Ga0495674_0002163 3300047319 Bacteria 19301
690 Ga0495674_0013531 3300047319 Bacteria 7669
691 Ga0495674_0479164 3300047319 Bacteria 997
692 Ga0495676_0104282 3300047321 Bacteria 2093
693 Ga0495676_0116718 3300047321 Bacteria 1948
694 Ga0495676_0120623 3300047321 Bacteria 1908
695 Ga0495676_0192362 3300047321 Bacteria 1422
696 Ga0495676_0200553 3300047321 Bacteria 1387
697 Ga0495676_0241159 3300047321 Unclassified 1237
698 Ga0495680_0000359 3300047322 Bacteria 51000
699 Ga0495680_0001209 3300047322 Bacteria 28308
700 Ga0495680_0040382 3300047322 Bacteria 3719
701 Ga0495680_0238091 3300047322 Unclassified 1294
702 Ga0495680_0339882 3300047322 Bacteria 1047
703 Ga0495675_0000056 3300047444 Bacteria 77625
704 Ga0495675_0008977 3300047444 Bacteria 6217
705 Ga0495684_0000056 3300047471 Bacteria 79718
706 Ga0495684_0001278 3300047471 Bacteria 20227
707 Ga0495684_0074981 3300047471 Bacteria 2570
708 Ga0495686_0214595 3300047472 Bacteria 1098
709 Ga0495686_0262390 3300047472 Bacteria 966
710 Ga0495593_0003363 3300047673 Bacteria 9582
711 Ga0495593_0003599 3300047673 Bacteria 9257
712 Ga0495593_0127986 3300047673 Bacteria 1290
713 Ga0495602_0000006 3300048088 Bacteria 322593
714 Ga0495602_0000539 3300048088 Bacteria 35239
715 Ga0495602_0244967 3300048088 Bacteria 1339
716 Ga0495602_0549334 3300048088 Bacteria 801
717 Ga0495614_0137271 3300048089 Bacteria 1085
718 Ga0495614_0299412 3300048089 Bacteria 743
719 Ga0496100_0000926 3300048903 Bacteria 14006
720 Ga0496100_0007931 3300048903 Bacteria 5899
721 Ga0496100_0010730 3300048903 Bacteria 5194
722 Ga0496100_0116252 3300048903 Bacteria 1866
723 Ga0496100_0209142 3300048903 Bacteria 1426
724 Ga0496101_0004497 3300048904 Bacteria 8790
725 Ga0496101_0020299 3300048904 Bacteria 4545
726 Ga0496101_0032008 3300048904 Bacteria 3700
727 Ga0496102_0002933 3300048905 Bacteria 14466
728 Ga0496102_0005716 3300048905 Bacteria 10564
729 Ga0496104_0008179 3300048907 Bacteria 9288
730 Ga0496104_0010922 3300048907 Bacteria 8124
731 Ga0496104_0039756 3300048907 Bacteria 4404
732 Ga0496104_0077661 3300048907 Bacteria 3163
733 Ga0496104_0222826 3300048907 Bacteria 1798
734 Ga0496105_0005555 3300048908 Bacteria 9575
735 Ga0496105_0020686 3300048908 Bacteria 5319
736 Ga0496105_0029456 3300048908 Bacteria 4493
737 Ga0496105_0031349 3300048908 Bacteria 4358
738 Ga0496105_0267976 3300048908 Bacteria 1380
739 Ga0496105_0322327 3300048908 Bacteria 1238
740 Ga0496106_0004750 3300048909 Bacteria 10048
741 Ga0496106_0015351 3300048909 Bacteria 5668
742 Ga0496106_0016428 3300048909 Bacteria 5476
743 Ga0496106_0117374 3300048909 Bacteria 2077
744 Ga0496106_0174483 3300048909 Bacteria 1705
745 Ga0496107_0007435 3300048910 Bacteria 7552
746 Ga0496107_0010058 3300048910 Bacteria 6562
747 Ga0496107_0091732 3300048910 Bacteria 2220
748 Ga0496108_0001187 3300048911 Bacteria 20358
749 Ga0496108_0022989 3300048911 Bacteria 5129
750 Ga0496108_0037474 3300048911 Bacteria 4038
751 Ga0496108_0057975 3300048911 Bacteria 3253
752 Ga0496108_0481587 3300048911 Bacteria 1084
753 Ga0496109_0003628 3300048912 Bacteria 12895
754 Ga0496109_0005207 3300048912 Bacteria 10863
755 Ga0496109_0005449 3300048912 Bacteria 10641
756 Ga0496109_0014804 3300048912 Bacteria 6787
757 Ga0496109_0233656 3300048912 Bacteria 1730
758 Ga0496109_0644463 3300048912 Bacteria 996
759 Ga0496110_0001389 3300048913 Bacteria 17461
760 Ga0496110_0002156 3300048913 Bacteria 14686
761 Ga0496110_0008745 3300048913 Bacteria 8155
762 Ga0496110_0012668 3300048913 Bacteria 6939
763 Ga0496110_0184014 3300048913 Bacteria 1897
764 Ga0496110_0238597 3300048913 Bacteria 1654
765 Ga0496111_0001694 3300048914 Bacteria 12851
766 Ga0496111_0018942 3300048914 Bacteria 4772
767 Ga0496111_0023129 3300048914 Bacteria 4360
768 Ga0496111_0034140 3300048914 Bacteria 3631
769 Ga0496112_0001346 3300048915 Bacteria 18695
770 Ga0496112_0001940 3300048915 Bacteria 16337
771 Ga0496112_0020476 3300048915 Bacteria 6272
772 Ga0496112_0057488 3300048915 Bacteria 3829
773 Ga0496112_0306561 3300048915 Bacteria 1533
774 Ga0496113_0001229 3300048916 Bacteria 14079
775 Ga0496113_0003069 3300048916 Bacteria 9911
776 Ga0496113_0009756 3300048916 Bacteria 6311
777 Ga0496113_0046514 3300048916 Bacteria 3221
778 Ga0496113_0421480 3300048916 Bacteria 1072
779 Ga0496113_0710337 3300048916 Bacteria 802
780 Ga0496114_0017584 3300048917 Bacteria 5774
781 Ga0496114_0067775 3300048917 Bacteria 2994
782 Ga0496114_0093566 3300048917 Bacteria 2555
783 Ga0496114_0393844 3300048917 Bacteria 1227
784 Ga0496115_0003119 3300048918 Bacteria 11913
785 Ga0496115_0010171 3300048918 Bacteria 7020
786 Ga0496115_0030851 3300048918 Bacteria 4220
787 Ga0496115_0037797 3300048918 Bacteria 3827
788 Ga0496115_0061881 3300048918 Bacteria 3019
789 Ga0496116_0001851 3300048919 Bacteria 22897
790 Ga0496117_0121378 3300048920 Bacteria 1604
791 Ga0496120_0300990 3300048923 Bacteria 734
792 Ga0496121_0013940 3300048924 Bacteria 8589
793 Ga0496122_0054736 3300048925 Bacteria 2993
794 Ga0496123_0226992 3300048926 Bacteria 937
795 Ga0496125_0029721 3300048928 Bacteria 4904
796 Ga0496125_0090833 3300048928 Bacteria 2290
797 Ga0501031_0045287 3300049568 Bacteria 2870
798 Ga0501031_0048768 3300049568 Bacteria 2760
799 Ga0501031_0092149 3300049568 Bacteria 1977
800 Ga0501032_0013003 3300049569 Bacteria 5928
801 Ga0501032_0022105 3300049569 Bacteria 4414
802 Ga0501032_0048876 3300049569 Bacteria 2855
803 Ga0501032_0055122 3300049569 Bacteria 2675
804 Ga0501032_0093051 3300049569 Bacteria 1999
805 Ga0501033_0017990 3300049570 Bacteria 5336
806 Ga0501033_0033329 3300049570 Bacteria 3867
807 Ga0501033_0127122 3300049570 Bacteria 1848
808 Ga0501034_0002201 3300049571 Bacteria 24114
809 Ga0501034_0023489 3300049571 Bacteria 6283
810 Ga0501034_0031875 3300049571 Bacteria 5355
811 Ga0501034_0050893 3300049571 Bacteria 4177
812 Ga0501034_0056596 3300049571 Bacteria 3945
813 Ga0501034_0081474 3300049571 Bacteria 3239
814 Ga0501034_0093059 3300049571 Bacteria 3011
815 Ga0501034_0127324 3300049571 Bacteria 2531
816 Ga0501034_0158572 3300049571 Bacteria 2235
817 Ga0501034_0269075 3300049571 Bacteria 1645
818 Ga0501034_0283883 3300049571 Bacteria 1595
819 Ga0501034_0345771 3300049571 Bacteria 1416
820 Ga0501034_0708855 3300049571 Bacteria 904
821 Ga0501036_0007818 3300049572 Bacteria 8746
822 Ga0501036_0016265 3300049572 Bacteria 6213
823 Ga0501036_0058284 3300049572 Bacteria 3271
824 Ga0501036_0062481 3300049572 Bacteria 3154
825 Ga0501036_0069973 3300049572 Bacteria 2967
826 Ga0501036_0124437 3300049572 Bacteria 2177
827 Ga0501036_0136118 3300049572 Bacteria 2073
828 Ga0501037_0005054 3300049573 Bacteria 9600
829 Ga0501037_0009480 3300049573 Bacteria 7146
830 Ga0501037_0126480 3300049573 Bacteria 1834
831 Ga0501037_0417485 3300049573 Bacteria 919
832 Ga0501038_0018363 3300049574 Bacteria 6313
833 Ga0501038_0037433 3300049574 Bacteria 4253
834 Ga0501038_0047640 3300049574 Bacteria 3712
835 Ga0501038_0137111 3300049574 Bacteria 2004
836 Ga0501038_0173305 3300049574 Bacteria 1745
837 Ga0501038_0224760 3300049574 Bacteria 1496
838 Ga0501038_0310331 3300049574 Bacteria 1236
839 Ga0501038_0342794 3300049574 Bacteria 1165
840 Ga0501039_0088736 3300049575 Bacteria 2408
841 Ga0501039_0126551 3300049575 Bacteria 2004
842 Ga0501039_0180494 3300049575 Bacteria 1660
843 Ga0501039_0195945 3300049575 Bacteria 1588
844 Ga0501039_0356505 3300049575 Bacteria 1149
845 Ga0501040_0066629 3300049576 Bacteria 2481
846 Ga0501040_0093026 3300049576 Bacteria 2097
847 Ga0501040_0451038 3300049576 Bacteria 926
848 Ga0501041_0054388 3300049577 Bacteria 2442
849 Ga0501042_0039496 3300049578 Bacteria 3354
850 Ga0501042_0199294 3300049578 Bacteria 1444
851 Ga0501043_0001843 3300049579 Bacteria 18180
852 Ga0501043_0028972 3300049579 Bacteria 4347
853 Ga0501043_0049051 3300049579 Bacteria 3319
854 Ga0501043_0052764 3300049579 Bacteria 3193
855 Ga0501043_0145326 3300049579 Bacteria 1857
856 Ga0501043_0149423 3300049579 Bacteria 1828
857 Ga0501043_0230029 3300049579 Bacteria 1432
858 Ga0501043_0346698 3300049579 Bacteria 1129
859 Ga0501043_0539355 3300049579 Bacteria 868
860 Ga0501043_0832478 3300049579 Unclassified 666
861 Ga0501046_0029021 3300049580 Bacteria 4502
862 Ga0501046_0042972 3300049580 Bacteria 3600
863 Ga0501046_0046372 3300049580 Bacteria 3449
864 Ga0501046_0213269 3300049580 Bacteria 1432
865 Ga0501046_0267391 3300049580 Bacteria 1255
866 Ga0501047_0000010 3300049581 Bacteria 429357
867 Ga0501047_0001775 3300049581 Bacteria 20844
868 Ga0501047_0014495 3300049581 Bacteria 7497
869 Ga0501047_0095778 3300049581 Bacteria 2847
870 Ga0501047_0127392 3300049581 Bacteria 2426
871 Ga0501047_0289149 3300049581 Bacteria 1483
872 Ga0501047_0327509 3300049581 Bacteria 1371
873 Ga0501048_0004920 3300049582 Bacteria 10191
874 Ga0501048_0016921 3300049582 Bacteria 5375
875 Ga0501048_0111287 3300049582 Bacteria 1933
876 Ga0501048_0578936 3300049582 Unclassified 806
877 Ga0501067_0089828 3300049583 Bacteria 1705
878 Ga0501067_0165649 3300049583 Bacteria 1231
879 Ga0501067_0325256 3300049583 Bacteria 856
880 Ga0501068_0005782 3300049584 Bacteria 6783
881 Ga0501068_0103009 3300049584 Bacteria 1770
882 Ga0501068_0111004 3300049584 Bacteria 1705
883 Ga0501068_0154246 3300049584 Bacteria 1445
884 Ga0501068_0191423 3300049584 Bacteria 1295
885 Ga0501068_0325772 3300049584 Bacteria 985
886 Ga0501068_0327630 3300049584 Unclassified 982
887 Ga0501069_0035200 3300049585 Bacteria 2758
888 Ga0501069_0051069 3300049585 Bacteria 2301
889 Ga0501069_0102789 3300049585 Bacteria 1623
890 Ga0501069_0108775 3300049585 Bacteria 1577
891 Ga0501069_0124177 3300049585 Bacteria 1475
892 Ga0501069_0246239 3300049585 Unclassified 1042
893 Ga0501070_0044484 3300049586 Bacteria 3694
894 Ga0501070_0056695 3300049586 Bacteria 3247
895 Ga0501070_0102058 3300049586 Bacteria 2372
896 Ga0501070_0123635 3300049586 Bacteria 2138
897 Ga0501070_0132694 3300049586 Bacteria 2057
898 Ga0501070_0154409 3300049586 Bacteria 1893
899 Ga0501070_0191252 3300049586 Bacteria 1682
900 Ga0501070_0202789 3300049586 Bacteria 1628
901 Ga0501070_0242180 3300049586 Bacteria 1476
902 Ga0501070_0245748 3300049586 Bacteria 1464
903 Ga0501070_0256771 3300049586 Bacteria 1429
904 Ga0501071_0083235 3300049587 Bacteria 2344
905 Ga0501071_0155413 3300049587 Bacteria 1708
906 Ga0501072_0033081 3300049588 Bacteria 4051
907 Ga0501072_0062220 3300049588 Bacteria 2944
908 Ga0501072_0086538 3300049588 Bacteria 2487
909 Ga0501072_0258493 3300049588 Bacteria 1386
910 Ga0501072_0327898 3300049588 Bacteria 1216
911 Ga0501072_0461682 3300049588 Bacteria 1005
912 Ga0501073_0004541 3300049589 Bacteria 10438
913 Ga0501073_0016110 3300049589 Bacteria 5419
914 Ga0501073_0033338 3300049589 Bacteria 3667
915 Ga0501073_0072315 3300049589 Bacteria 2402
916 Ga0501073_0124554 3300049589 Bacteria 1786
917 Ga0501073_0183423 3300049589 Bacteria 1448
918 Ga0501073_0334461 3300049589 Unclassified 1045
919 Ga0501073_0377293 3300049589 Bacteria 979
920 Ga0501073_0382846 3300049589 Unclassified 972
921 Ga0501074_0009189 3300049590 Bacteria 7181
922 Ga0501074_0010349 3300049590 Bacteria 6768
923 Ga0501074_0046562 3300049590 Bacteria 3136
924 Ga0501074_0180689 3300049590 Unclassified 1505
925 Ga0501074_0192647 3300049590 Bacteria 1453
926 Ga0501075_0010200 3300049591 Bacteria 6596
927 Ga0501075_0040287 3300049591 Bacteria 3498
928 Ga0501075_0600613 3300049591 Bacteria 839
929 Ga0501076_0009793 3300049592 Bacteria 7079
930 Ga0501076_0078679 3300049592 Bacteria 2646
931 Ga0501076_0247431 3300049592 Bacteria 1459
932 Ga0501076_0337393 3300049592 Bacteria 1237
933 Ga0501076_0400388 3300049592 Bacteria 1129
934 Ga0501077_0118183 3300049593 Bacteria 1680
935 Ga0501079_0020198 3300049741 Bacteria 5091
936 Ga0501079_0042950 3300049741 Bacteria 3490
937 Ga0501079_0066627 3300049741 Bacteria 2779
938 Ga0501079_0291895 3300049741 Bacteria 1275
939 Ga0501079_0312730 3300049741 Bacteria 1229
940 Ga0501080_0000314 3300049742 Bacteria 37074
941 Ga0501080_0006102 3300049742 Bacteria 10802
942 Ga0501080_0008717 3300049742 Bacteria 9209
943 Ga0501080_0009753 3300049742 Bacteria 8771
944 Ga0501080_0011995 3300049742 Bacteria 7937
945 Ga0501080_0022269 3300049742 Bacteria 5871
946 Ga0501080_0023180 3300049742 Bacteria 5756
947 Ga0501080_0035262 3300049742 Bacteria 4670
948 Ga0501080_0045183 3300049742 Bacteria 4100
949 Ga0501080_0081340 3300049742 Bacteria 3010
950 Ga0501080_0177989 3300049742 Bacteria 1958
951 Ga0501080_0236493 3300049742 Bacteria 1669
952 Ga0501080_0254933 3300049742 Bacteria 1599
953 Ga0501080_0504689 3300049742 Bacteria 1081
954 Ga0501080_0540662 3300049742 Bacteria 1038
955 Ga0501081_0018902 3300049743 Bacteria 4580
956 Ga0501081_0027216 3300049743 Bacteria 3858
957 Ga0501081_0148981 3300049743 Bacteria 1680
958 Ga0501081_0533896 3300049743 Bacteria 876
959 Ga0501083_0005058 3300049744 Bacteria 9342
960 Ga0501083_0030007 3300049744 Bacteria 3737
961 Ga0501083_0144139 3300049744 Bacteria 1559
962 Ga0501083_0181223 3300049744 Bacteria 1375
963 Ga0501083_0418990 3300049744 Bacteria 871
964 Ga0501035_0004729 3300049822 Bacteria 12925
965 Ga0501035_0011561 3300049822 Bacteria 8181
966 Ga0501035_0030708 3300049822 Bacteria 4898
967 Ga0501035_0036440 3300049822 Bacteria 4458
968 Ga0501035_0330562 3300049822 Unclassified 1279
969 Ga0501035_0620731 3300049822 Bacteria 879
970 Ga0501044_0000116 3300049823 Bacteria 96626
971 Ga0501044_0002291 3300049823 Bacteria 21805
972 Ga0501044_0003610 3300049823 Bacteria 17403
973 Ga0501044_0078352 3300049823 Bacteria 3349
974 Ga0501044_0093602 3300049823 Bacteria 3030
975 Ga0501044_0125313 3300049823 Bacteria 2566
976 Ga0501044_0262961 3300049823 Bacteria 1663
977 Ga0501044_0404528 3300049823 Bacteria 1277
978 Ga0501045_0038834 3300049824 Bacteria 3463
979 Ga0501045_0361097 3300049824 Bacteria 1081
980 Ga0501045_0520249 3300049824 Bacteria 883
981 nmdc:mga03683_1213_c2 3300050489 Bacteria 5469
982 nmdc:mga03683_44154_c1 3300050489 Bacteria 1841
983 nmdc:mga03n38_331637_c1 3300050490 Bacteria 824
984 nmdc:mga03n38_59258_c1 3300050490 Bacteria 1737
985 nmdc:mga03n38_9563_c1 3300050490 Bacteria 3533
986 nmdc:mga00v17_149620_c1 3300050491 Bacteria 1500
987 nmdc:mga00v17_24709_c1 3300050491 Bacteria 2178
988 nmdc:mga00v17_28997_c1 3300050491 Bacteria 3245
989 nmdc:mga00v17_4955_c1 3300050491 Bacteria 6983
990 nmdc:mga00v17_79322_c1 3300050491 Bacteria 2047
991 nmdc:mga0yw44_11062_c1 3300050492 Bacteria 4638
992 nmdc:mga0yw44_116513_c1 3300050492 Bacteria 1717
993 nmdc:mga0yw44_4079_c1 3300050492 Bacteria 6620
994 nmdc:mga0yw44_54507_c1 3300050492 Bacteria 2430
995 nmdc:mga0yw44_580_c1 3300050492 Bacteria 13256
996 nmdc:mga0yw44_63973_c1 3300050492 Bacteria 2263
997 nmdc:mga0yw44_69664_c1 3300050492 Bacteria 2179
998 nmdc:mga0yw44_98989_c1 3300050492 Bacteria 1855
999 nmdc:mga0k408_142046_c1 3300050493 Bacteria 1428
1000 nmdc:mga0k408_47462_c1 3300050493 Bacteria 2482
1001 nmdc:mga06z11_15735_c2 3300050494 Bacteria 2987
1002 nmdc:mga06z11_169845_c1 3300050494 Bacteria 1251
1003 nmdc:mga06z11_33677_c1 3300050494 Bacteria 2508
1004 nmdc:mga06z11_44729_c1 3300050494 Bacteria 2234
1005 nmdc:mga04h51_121630_c1 3300050495 Bacteria 973
1006 nmdc:mga04h51_148960_c1 3300050495 Bacteria 893
1007 nmdc:mga04h51_19183_c1 3300050495 Bacteria 1474
1008 nmdc:mga04h51_6680_c1 3300050495 Bacteria 3005
1009 nmdc:mga07m45_12481_c1 3300050496 Bacteria 4491
1010 nmdc:mga07m45_46338_c1 3300050496 Bacteria 2442
1011 nmdc:mga05p37_11744_c1 3300050507 Bacteria 10440
1012 nmdc:mga05p37_374_c1 3300050507 Bacteria 48074
1013 nmdc:mga05p37_47092_c1 3300050507 Bacteria 5303
1014 nmdc:mga05p37_512131_c1 3300050507 Bacteria 1374
1015 nmdc:mga09592_20752_c1 3300050508 Bacteria 5407
1016 nmdc:mga09592_2601_c1 3300050508 Bacteria 14611
1017 nmdc:mga0qj67_134130_c1 3300050509 Bacteria 2006
1018 nmdc:mga0qj67_50765_c1 3300050509 Bacteria 3280
1019 nmdc:mga0qj67_551023_c1 3300050509 Bacteria 925
1020 nmdc:mga0qj67_65941_c1 3300050509 Bacteria 2883
1021 nmdc:mga06r32_250622_c2 3300050510 Bacteria 1011
1022 nmdc:mga06r32_307479_c1 3300050510 Bacteria 1571
1023 nmdc:mga06r32_349126_c1 3300050510 Bacteria 1464
1024 nmdc:mga06r32_397_c1 3300050510 Bacteria 36835
1025 nmdc:mga08y16_122069_c1 3300050511 Bacteria 2711
1026 nmdc:mga08y16_124566_c1 3300050511 Bacteria 2681
1027 nmdc:mga08y16_155771_c1 3300050511 Bacteria 2374
1028 nmdc:mga08y16_184_c1 3300050511 Bacteria 55479
1029 nmdc:mga08y16_270713_c1 3300050511 Bacteria 1753
1030 nmdc:mga08y16_321525_c1 3300050511 Bacteria 1593
1031 nmdc:mga08y16_90408_c1 3300050511 Bacteria 3191
1032 nmdc:mga0n895_381227_c1 3300050512 Bacteria 1427
1033 nmdc:mga0n895_445606_c1 3300050512 Bacteria 1307
1034 nmdc:mga0n895_834709_c1 3300050512 Bacteria 910
1035 nmdc:mga0n895_96376_c1 3300050512 Bacteria 2963
1036 nmdc:mga0rr50_282808_c1 3300050513 Bacteria 1384
1037 nmdc:mga0rr50_64490_c1 3300050513 Bacteria 2771
1038 nmdc:mga0rr50_70704_c1 3300050513 Bacteria 2660
1039 nmdc:mga08x19_103158_c1 3300050514 Bacteria 1894
1040 nmdc:mga08x19_138367_c1 3300050514 Bacteria 1643
1041 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
1042 nmdc:mga0a205_203406_c1 3300050515 Bacteria 1870
1043 nmdc:mga0sz30_19112_c1 3300050516 Bacteria 842
1044 nmdc:mga0sz30_38510_c1 3300050516 Bacteria 1162
1045 nmdc:mga0sz30_56787_c1 3300050516 Bacteria 1668
1046 Ga0495601_0000007 3300053077 Bacteria 365972
1047 Ga0495601_0005541 3300053077 Bacteria 7365
1048 Ga0495601_0012397 3300053077 Bacteria 5114
1049 Ga0495601_0301767 3300053077 Bacteria 1043
1050 Ga0495612_0000053 3300053078 Bacteria 52880
1051 Ga0495612_0001301 3300053078 Bacteria 10300
1052 Ga0495612_0002727 3300053078 Bacteria 7308
1053 Ga0495612_0271565 3300053078 Bacteria 757
1054 Ga0495655_0034961 3300053083 Bacteria 1247
1055 Ga0495595_0000031 3300053084 Bacteria 89199
1056 Ga0495595_0005529 3300053084 Bacteria 5117
1057 Ga0495595_0010781 3300053084 Bacteria 3808
1058 Ga0495595_0030894 3300053084 Bacteria 2405
1059 Ga0495595_0088479 3300053084 Bacteria 1483
1060 Ga0495595_0274711 3300053084 Bacteria 845
1061 Ga0495619_0000023 3300053085 Bacteria 182266
1062 Ga0495619_0003219 3300053085 Bacteria 10571
1063 Ga0495619_0013374 3300053085 Bacteria 5170
1064 Ga0495619_0024881 3300053085 Bacteria 3841
1065 Ga0495619_0058559 3300053085 Bacteria 2557
1066 Ga0495619_0230447 3300053085 Bacteria 1283
1067 Ga0495619_0643639 3300053085 Bacteria 723
1068 Ga0500644_0072537 3300053088 Bacteria 1244
1069 Ga0500646_0081659 3300053090 Bacteria 987
1070 Ga0500583_0162939 3300053092 Bacteria 1111
1071 Ga0500651_0039858 3300053093 Bacteria 2958
1072 Ga0500651_0121043 3300053093 Bacteria 1589
1073 Ga0500651_0139892 3300053093 Unclassified 1460
1074 Ga0500651_0144194 3300053093 Bacteria 1433
1075 Ga0500566_0000499 3300053094 Bacteria 21864
1076 Ga0500641_0018535 3300053096 Bacteria 2619
1077 Ga0500650_0002506 3300053098 Bacteria 6075
1078 Ga0500555_003654 3300053103 Bacteria 4379
1079 Ga0500556_0000004 3300053104 Bacteria 666287
1080 Ga0500562_067349 3300053108 Bacteria 965
1081 Ga0500569_033050 3300053109 Bacteria 1467
1082 Ga0500593_069737 3300053117 Bacteria 1527
1083 Ga0500594_0123260 3300053118 Bacteria 815
1084 Ga0500595_000731 3300053119 Bacteria 19548
1085 Ga0500595_022769 3300053119 Bacteria 2211
1086 Ga0500614_022675 3300053123 Bacteria 1468
1087 Ga0500618_001267 3300053125 Bacteria 11733
1088 Ga0500642_0000010 3300053130 Bacteria 272552
1089 Ga0500642_0000887 3300053130 Bacteria 8708
1090 Ga0500642_0009847 3300053130 Bacteria 3341
1091 Ga0500642_0124487 3300053130 Bacteria 1207
1092 Ga0500652_000063 3300053131 Bacteria 46678
1093 Ga0500658_0073848 3300053134 Bacteria 1445
1094 Ga0500568_0000388 3300053139 Bacteria 33489
1095 Ga0500568_0013508 3300053139 Bacteria 3720
1096 Ga0500577_0031982 3300053142 Bacteria 1846
1097 Ga0500577_0036118 3300053142 Bacteria 1767
1098 Ga0500577_0079257 3300053142 Bacteria 1306
1099 Ga0500588_0000561 3300053146 Bacteria 6037
1100 Ga0500588_0012298 3300053146 Bacteria 2119
1101 Ga0500588_0016324 3300053146 Bacteria 1919
1102 Ga0500588_0037346 3300053146 Bacteria 1442
1103 Ga0500604_0002284 3300053151 Bacteria 5248
1104 Ga0500604_0012185 3300053151 Bacteria 2318
1105 Ga0500604_0049761 3300053151 Bacteria 1289
1106 Ga0500616_0000014 3300053153 Bacteria 637918
1107 Ga0500616_0000888 3300053153 Bacteria 32969
1108 Ga0500616_0011431 3300053153 Bacteria 5242
1109 Ga0500619_020780 3300053154 Bacteria 1882
1110 Ga0500622_0000266 3300053156 Bacteria 53524
1111 Ga0500627_0033807 3300053158 Bacteria 2163
1112 Ga0500633_0038306 3300053160 Bacteria 1596
1113 Ga0500634_0249411 3300053161 Bacteria 739
1114 Ga0500636_0001741 3300053177 Bacteria 11927
1115 Ga0500570_069807 3300053724 Bacteria 1646
1116 Ga0500645_021692 3300053730 Bacteria 1981
1117 Ga0500609_002904 3300053731 Bacteria 2439
1118 Ga0500601_000022 3300053737 Bacteria 34845
1119 Ga0501084_0034090 3300054114 Bacteria 4257
1120 Ga0501084_0083270 3300054114 Bacteria 2685
1121 Ga0501084_0083298 3300054114 Bacteria 2684
1122 Ga0501084_0336590 3300054114 Bacteria 1275
1123 Ga0501084_0337175 3300054114 Bacteria 1274
1124 Ga0501084_0384489 3300054114 Bacteria 1186
1125 Ga0500661_021571 3300055283 Bacteria 1143
1126 Ga0501082_0001543 3300060353 Bacteria 20276
1127 Ga0501082_0007592 3300060353 Bacteria 9353
1128 Ga0501082_0021973 3300060353 Bacteria 5501
1129 Ga0501082_0051744 3300060353 Bacteria 3540
1130 Ga0501082_0299310 3300060353 Bacteria 1401
1131 Ga0501082_0323962 3300060353 Bacteria 1343
1132 Ga0501082_0694267 3300060353 Bacteria 891
1133 Ga0466962_0155906 3300061719 Bacteria 1109
1134 Ga0530510_0117097 3300061734 Bacteria 1954
1135 Ga0530510_0172919 3300061734 Unclassified 1600
1136 Ga0530510_0222121 3300061734 Bacteria 1404
1137 Ga0530510_0540371 3300061734 Bacteria 885
1138 Ga0530510_0570628 3300061734 Bacteria 860
1139 2603859168 2602042107 Bacteria 6226103
1140 2643892612 2643221576 Bacteria 5214352
1141 2643962061 2643221590 Bacteria 5214697
1142 2644034770 2643221604 Bacteria 5014917
1143 2644098735 2643221617 Bacteria 5139111
1144 2644116096 2643221620 Bacteria 5134593
1145 2738872000 2738541305 Bacteria 4910150
1146 2793068239 2791355197 Bacteria 8420563
1147 2812329952 2811994874 Bacteria 5367947
1148 2824656246 2824653114 Bacteria 8493680
1149 2824665657 2824661429 Bacteria 9877870
1150 2844318741 2844315083 Bacteria 8138177
1151 2857527779 2857524615 Bacteria 6615449
1152 2893066499 2893066018 Bacteria 6158120
1153 2906604430 2906602504 Bacteria 8295279
1154 2919079445 2919073203 Bacteria 6531949
1155 8056973131 8056967851 Bacteria 9038162
1156 Ga0496126_0424088
1157 JGI24752J21851_1007459
1158 JGI24737J22298_10012530
1159 JGI24743J22301_10000134
1160 JGI24750J21931_1000851
1161 JGI24745J21846_1001252
1162 JGI24748J21848_1001597
1163 JGI24749J21850_1000509
1164 JGI24744J21845_10002294
1165 JGI24034J26672_10002367
1166 JGI24751J29686_10001980
1167 JGI25153J46596_10006534
1168 rootH1_10021619
1169 rootH2_10032559
1170 rootL2_10291390
1171 JGI25160J50197_1001950
1172 Ga0065165_1028635
1173 Ga0070683_100269295
1174 Ga0070690_100028892
1175 Ga0070670_100013394
1176 Ga0070670_100020400
1177 Ga0068869_100028205
1178 Ga0070680_100002406
1179 Ga0070680_100022351
1180 Ga0070680_100343800
1181 Ga0070680_100698473
1182 Ga0070682_100008050
1183 Ga0068868_100007445
1184 Ga0070660_100222309
1185 Ga0070689_100075714
1186 Ga0070691_10120209
1187 Ga0070687_100001322
1188 Ga0070687_100079089
1189 Ga0070661_100077062
1190 Ga0070668_100012197
1191 Ga0070669_100065344
1192 Ga0070669_100086295
1193 Ga0070669_100324818
1194 Ga0070669_100331888
1195 Ga0070675_100035184
1196 Ga0070671_100013663
1197 Ga0070671_100162171
1198 Ga0070671_100178959
1199 Ga0070671_100390424
1200 Ga0070671_100497137
1201 Ga0070674_100002023
1202 Ga0070674_100116254
1203 Ga0070674_100413441
1204 Ga0070673_100012244
1205 Ga0070673_100078176
1206 Ga0070673_100081066
1207 Ga0070688_100006730
1208 Ga0070688_100020200
1209 Ga0070688_100044398
1210 Ga0070659_100043352
1211 Ga0070659_100311580
1212 Ga0070667_100006086
1213 Ga0070667_100084771
1214 Ga0070714_100000556
1215 Ga0070713_101169477
1216 Ga0070710_10002571
1217 Ga0070710_10018625
1218 Ga0070701_10000544
1219 Ga0070711_100017293
1220 Ga0070711_100179886
1221 Ga0070711_100477130
1222 Ga0070700_100014905
1223 Ga0070663_100099777
1224 Ga0070663_100522804
1225 Ga0070678_100033394
1226 Ga0070678_100042057
1227 Ga0070678_100065144
1228 Ga0070681_10030828
1229 Ga0070681_10036642
1230 Ga0068867_100006600
1231 Ga0068867_100112569
1232 Ga0070685_10001171
1233 Ga0070698_100407018
1234 Ga0070679_100010449
1235 Ga0070679_100016290
1236 Ga0070684_100111632
1237 Ga0070697_100039437
1238 Ga0068853_100011139
1239 Ga0068853_100028508
1240 Ga0068853_100037050
1241 Ga0070672_100007959
1242 Ga0070686_100242105
1243 Ga0070686_100615599
1244 Ga0070695_100008588
1245 Ga0070696_100007312
1246 Ga0070693_100012903
1247 Ga0070665_100031361
1248 Ga0070704_100002394
1249 Ga0070704_100081333
1250 Ga0070704_100103455
1251 Ga0070704_100334507
1252 Ga0068855_100074040
1253 Ga0068855_100136130
1254 Ga0068855_100144161
1255 Ga0070664_100051607
1256 Ga0068857_100156103
1257 Ga0068854_100103200
1258 Ga0068856_100110413
1259 Ga0068856_100246984
1260 Ga0070702_100036072
1261 Ga0070702_100218091
1262 Ga0070702_100259079
1263 Ga0070702_100346934
1264 Ga0068859_100149112
1265 Ga0068859_100193521
1266 Ga0068864_100397581
1267 Ga0068864_100418600
1268 Ga0068870_10005222
1269 Ga0068863_100007012
1270 Ga0068863_100155966
1271 Ga0068863_100500957
1272 Ga0068858_100016071
1273 Ga0068858_100383926
1274 Ga0068860_100040442
1275 Ga0068860_100216486
1276 Ga0068862_100011484
1277 Ga0068862_100029912
1278 Ga0068862_100840405
1279 Ga0068862_101167701
1280 Ga0081455_10010899
1281 Ga0081455_10033604
1282 Ga0081455_10469817
1283 Ga0081538_10029065
1284 Ga0081538_10034984
1285 Ga0081538_10078950
1286 Ga0081540_1017139
1287 Ga0081539_10015587
1288 Ga0070717_10022811
1289 Ga0070717_10057188
1290 Ga0070717_10059609
1291 Ga0070717_10167415
1292 Ga0070717_10310901
1293 Ga0075365_10001017
1294 Ga0075365_10007361
1295 Ga0075365_10026251
1296 Ga0075365_10041020
1297 Ga0075365_10047027
1298 Ga0075365_10078435
1299 Ga0075365_10141855
1300 Ga0075365_10333070
1301 Ga0075365_10386415
1302 Ga0075368_10065813
1303 Ga0075368_10194856
1304 Ga0075363_100076097
1305 Ga0075363_100137181
1306 Ga0075363_100151318
1307 Ga0075363_100288731
1308 Ga0075364_10033452
1309 Ga0075364_10083572
1310 Ga0070715_10127066
1311 Ga0070715_10174973
1312 Ga0070716_100022930
1313 Ga0070712_100004847
1314 Ga0070712_100033476
1315 Ga0070712_100088621
1316 Ga0075362_10013531
1317 Ga0075362_10051552
1318 Ga0075367_10047397
1319 Ga0075367_10140312
1320 Ga0075367_10172944
1321 Ga0075367_10218491
1322 Ga0075367_10305587
1323 Ga0075369_10005025
1324 Ga0075369_10047996
1325 Ga0075369_10189107
1326 Ga0075366_10008616
1327 Ga0075366_10013786
1328 Ga0075366_10036925
1329 Ga0075366_10193129
1330 Ga0075366_10404603
1331 Ga0075370_10027696
1332 Ga0075370_10099290
1333 Ga0068871_100067335
1334 Ga0068871_100113778
1335 Ga0075428_100001218
1336 Ga0075428_100022676
1337 Ga0075428_100573027
1338 Ga0075428_100624086
1339 Ga0075430_100000152
1340 Ga0075430_100025527
1341 Ga0075430_100045037
1342 Ga0075430_100198426
1343 Ga0075431_100000613
1344 Ga0075431_100010947
1345 Ga0075431_100062491
1346 Ga0075431_100064062
1347 Ga0075431_100582744
1348 Ga0075431_101208336
1349 Ga0075433_10059850
1350 Ga0075433_10298209
1351 Ga0075434_100017361
1352 Ga0075434_100056047
1353 Ga0075434_100269646
1354 Ga0075429_100004424
1355 Ga0075429_100274586
1356 Ga0075429_100429975
1357 Ga0068865_100098503
1358 Ga0068865_100403720
1359 Ga0075436_100000477
1360 Ga0075436_100028761
1361 Ga0075436_100520032
1362 Ga0097620_100149123
1363 Ga0097620_100193536
1364 Ga0075435_100076627
1365 Ga0075435_100079110
1366 Ga0099794_10089867
1367 Ga0099795_10001007
1368 Ga0099795_10025722
1369 Ga0105251_10054542
1370 Ga0105240_10026738
1371 Ga0111539_10000840
1372 Ga0111539_10044534
1373 Ga0111539_10083183
1374 Ga0111539_10089489
1375 Ga0111539_10106273
1376 Ga0111539_10168821
1377 Ga0111539_10241880
1378 Ga0105245_10028096
1379 Ga0105245_10201889
1380 Ga0105247_10110832
1381 Ga0105247_10228451
1382 Ga0114129_10000320
1383 Ga0114129_10002097
1384 Ga0114129_10051669
1385 Ga0114129_10061592
1386 Ga0114129_11430534
1387 Ga0105243_10023744
1388 Ga0105243_10221733
1389 Ga0105241_10024393
1390 Ga0105241_10075452
1391 Ga0105241_10116553
1392 Ga0105241_10639123
1393 Ga0105242_10102353
1394 Ga0105242_10390973
1395 Ga0105248_10039516
1396 Ga0105248_10629824
1397 Ga0105237_10047128
1398 Ga0105237_10092024
1399 Ga0105237_10640661
1400 Ga0105238_10080512
1401 Ga0105238_10277946
1402 Ga0105238_10855019
1403 Ga0099796_10006006
1404 Ga0099796_10043499
1405 Ga0099796_10048748
1406 Ga0105239_10007779
1407 Ga0105239_10307471
1408 Ga0105246_10076930
1409 Ga0105246_10103701
1410 Ga0105246_10241714
1411 Ga0105246_10557154
1412 Ga0157373_10015435
1413 Ga0157373_10242012
1414 Ga0157374_10144995
1415 Ga0157378_10142728
1416 Ga0157378_10430782
1417 Ga0157378_11203288
1418 Ga0163162_10090461
1419 Ga0163162_10736081
1420 Ga0157372_10016504
1421 Ga0157372_11029520
1422 Ga0157375_10369079
1423 Ga0163163_10039625
1424 Ga0163163_10623628
1425 Ga0157380_10084701
1426 Ga0157380_10137661
1427 Ga0157377_10005862
1428 Ga0157379_10056034
1429 Ga0157379_10144281
1430 Ga0157376_10111300
1431 Ga0157376_10571090
1432 Ga0163161_10009501
1433 Ga0224572_1001576
1434 Ga0209148_1000274
1435 Ga0209148_1001585
1436 Ga0209758_1000059
1437 Ga0209758_1001730
1438 Ga0209758_1001908
1439 Ga0209758_1036239
1440 Ga0209758_1046740
1441 Ga0209050_1002314
1442 Ga0209256_1068092
1443 Ga0207426_1000143
1444 Ga0209257_1000114
1445 Ga0209257_1019160
1446 Ga0209257_1030530
1447 Ga0207692_10009902
1448 Ga0207692_10029373
1449 Ga0207642_10000663
1450 Ga0207642_10138146
1451 Ga0207710_10023256
1452 Ga0207688_10000130
1453 Ga0207688_10068808
1454 Ga0207688_10273334
1455 Ga0207647_10002385
1456 Ga0207685_10061678
1457 Ga0207699_10001003
1458 Ga0207645_10049854
1459 Ga0207643_10001981
1460 Ga0207705_10315453
1461 Ga0207654_10063597
1462 Ga0207707_10045123
1463 Ga0207707_10121547
1464 Ga0207695_10050992
1465 Ga0207671_10087282
1466 Ga0207693_10004368
1467 Ga0207693_10045948
1468 Ga0207693_10062706
1469 Ga0207693_10080870
1470 Ga0207693_10253175
1471 Ga0207663_10012503
1472 Ga0207663_10046371
1473 Ga0207660_10174649
1474 Ga0207660_10294967
1475 Ga0207662_10147737
1476 Ga0207657_10032651
1477 Ga0207652_10043743
1478 Ga0207652_10102515
1479 Ga0207652_10413202
1480 Ga0207681_10054305
1481 Ga0207681_10364887
1482 Ga0207694_10127645
1483 Ga0207694_10175041
1484 Ga0207650_10004418
1485 Ga0207650_10014049
1486 Ga0207650_10025768
1487 Ga0207659_10012143
1488 Ga0207659_10066708
1489 Ga0207659_10099922
1490 Ga0207687_10005289
1491 Ga0207687_10061597
1492 Ga0207700_10058615
1493 Ga0207700_10084407
1494 Ga0207700_10452787
1495 Ga0207700_10977642
1496 Ga0207664_10030708
1497 Ga0207664_10156957
1498 Ga0207664_10182416
1499 Ga0207644_10006827
1500 Ga0207644_10025164
1501 Ga0207644_10102456
1502 Ga0207706_10002801
1503 Ga0207686_10054100
1504 Ga0207709_10015455
1505 Ga0207709_10177333
1506 Ga0207670_10021754
1507 Ga0207670_10052934
1508 Ga0207670_10076670
1509 Ga0207670_10305155
1510 Ga0207669_10007567
1511 Ga0207704_10196064
1512 Ga0207665_10029125
1513 Ga0207665_10281471
1514 Ga0207691_10011407
1515 Ga0207691_10540575
1516 Ga0207711_10016266
1517 Ga0207711_10090712
1518 Ga0207689_10000756
1519 Ga0207679_10024806
1520 Ga0207667_10354994
1521 Ga0207667_10358477
1522 Ga0207651_10003263
1523 Ga0207651_10007290
1524 Ga0207651_10072681
1525 Ga0207651_10799889
1526 Ga0207712_10017551
1527 Ga0207668_10028885
1528 Ga0207668_10485434
1529 Ga0207668_10767144
1530 Ga0207640_10015569
1531 Ga0207677_10006114
1532 Ga0207703_10011569
1533 Ga0207703_10783315
1534 Ga0207639_10012134
1535 Ga0207639_10143515
1536 Ga0207678_10038702
1537 Ga0207678_10042400
1538 Ga0207678_10121665
1539 Ga0207708_10004345
1540 Ga0207702_10543101
1541 Ga0207641_10058535
1542 Ga0207641_10162421
1543 Ga0207641_10991663
1544 Ga0207648_10009209
1545 Ga0207648_10060490
1546 Ga0207676_10007771
1547 Ga0207676_10132024
1548 Ga0207676_10308045
1549 Ga0207674_10184805
1550 Ga0207675_100004438
1551 Ga0207683_10015749
1552 Ga0207683_10049872
1553 Ga0207683_10090523
1554 Ga0207683_10572721
1555 Ga0207698_10115378
1556 Ga0209813_10005872
1557 Ga0209813_10039324
1558 Ga0209813_10074582
1559 Ga0207428_10017604
1560 Ga0207428_10066313
1561 Ga0207428_10123330
1562 Ga0268266_10209882
1563 Ga0268266_10319538
1564 Ga0268265_10015994
1565 Ga0268264_10244109
1566 Ga0268264_10733889
1567 Ga0307515_10091636
1568 Ga0265324_10060633
1569 Ga0307512_10186941
1570 Ga0265762_1004526
1571 Ga0265763_1001918
1572 Ga0265328_10012454
1573 Ga0265325_10014052
1574 Ga0265340_10034405
1575 Ga0265331_10000333
1576 Ga0265327_10000775
1577 Ga0265327_10091170
1578 Ga0265316_10374520
1579 Ga0307513_10451469
1580 Ga0307408_100242164
1581 Ga0265313_10073434
1582 Ga0307508_10047520
1583 Ga0316215_1000920
1584 Ga0373926_0006659
1585 Ga0373926_0162366
1586 Ga0373929_0010236
1587 Ga0373940_0007997
1588 Ga0373944_0001173
1589 Ga0373923_0002035
1590 Ga0373936_0001796
1591 Ga0373936_0047960
1592 Ga0373936_0165075
1593 Ga0373939_0001290
1594 Ga0373945_0005121
1595 Ga0373945_0007492
1596 Ga0373945_0007797
1597 Ga0373945_0017489
1598 Ga0373953_0032305
1599 Ga0373956_0012955
1600 Ga0373956_0037590
1601 Ga0373943_0000381
1602 Ga0373943_0002159
1603 Ga0373943_0015098
1604 Ga0373943_0031493
1605 Ga0373943_0077253
1606 Ga0373943_0224374
1607 Ga0373946_0002070
1608 Ga0373946_0036439
1609 Ga0373946_0052451
1610 Ga0373955_0002179
1611 Ga0373955_0007537
1612 Ga0373962_0041982
1613 Ga0373924_0015268
1614 Ga0373924_0031708
1615 Ga0373924_0102603
1616 Ga0373931_0086002
1617 Ga0373935_0000006
1618 Ga0373935_0034107
1619 Ga0373935_0049660
1620 Ga0373935_0053179
1621 Ga0373935_0105630
1622 Ga0373935_0170453
1623 Ga0373927_0003706
1624 Ga0373927_0013209
1625 Ga0373927_0015339
1626 Ga0373927_0015712
1627 Ga0373927_0018500
1628 Ga0373927_0029730
1629 Ga0373927_0171463
1630 Ga0373927_0238671
1631 Ga0373927_0547269
1632 Ga0373933_0000007
1633 Ga0373933_0004171
1634 Ga0373933_0056949
1635 Ga0373947_0000419
1636 Ga0373947_0001498
1637 Ga0373947_0003146
1638 Ga0373947_0006728
1639 Ga0373947_0016255
1640 Ga0373947_0019872
1641 Ga0373947_0033265
1642 Ga0373947_0105033
1643 Ga0373947_0139717
1644 Ga0373937_0000124
1645 Ga0373937_0018439
1646 Ga0373937_0025281
1647 Ga0373937_0047656
1648 Ga0372808_000937
1649 Ga0373925_0000210
1650 Ga0373925_0004278
1651 Ga0373925_0006000
1652 Ga0373925_0006086
1653 Ga0373925_0026431
1654 Ga0373925_0032271
1655 Ga0373925_0083949
1656 Ga0373925_0284217
1657 Ga0373925_0594639
1658 Ga0395900_0534211
1659 Ga0395898_0179458
1660 Ga0395901_0266328
1661 Ga0436365_0368397
1662 Ga0436365_1370429
1663 Ga0436360_0320708
1664 Ga0436361_0622258
1665 Ga0451800_0784539
1666 Ga0451807_2166610
1667 Ga0451849_0087101
1668 Ga0439448_0084842
1669 Ga0439456_078854
1670 Ga0453683_0473469
1671 Ga0466965_0102315
1672 Ga0466963_0017811
1673 Ga0466964_0163810
1674 Ga0453684_0000006
1675 Ga0453684_0000031
1676 Ga0453684_0008102
1677 Ga0453684_0112756
1678 Ga0453684_0313101
1679 Ga0453684_1220544
1680 Ga0466970_0243946
1681 Ga0466967_0024864
1682 Ga0466967_0069388
1683 Ga0495617_078930
1684 Ga0495592_0000020
1685 Ga0495592_0026318
1686 Ga0495592_0034109
1687 Ga0495592_0095454
1688 Ga0495603_0001017
1689 Ga0495629_0001626
1690 Ga0495629_0006124
1691 Ga0495629_0008249
1692 Ga0495629_0044612
1693 Ga0495629_0258401
1694 Ga0495629_0444729
1695 Ga0495638_0011195
1696 Ga0495641_0114372
1697 Ga0495651_0000282
1698 Ga0495651_0001410
1699 Ga0495653_0000046
1700 Ga0495653_0001155
1701 Ga0495653_0092433
1702 Ga0495580_0000806
1703 Ga0495580_0147371
1704 Ga0495582_0001348
1705 Ga0495582_0059585
1706 Ga0495582_0096554
1707 Ga0495639_0001292
1708 Ga0495639_0133006
1709 Ga0495639_0146341
1710 Ga0495639_0307503
1711 Ga0495662_0001018
1712 Ga0495662_0130074
1713 Ga0495662_0139554
1714 Ga0495664_0000017
1715 Ga0495664_0000670
1716 Ga0495664_0064886
1717 Ga0495584_0008719
1718 Ga0495584_0032467
1719 Ga0495584_0187068
1720 Ga0495594_0000401
1721 Ga0495607_0103777
1722 Ga0495607_0104439
1723 Ga0495607_0233215
1724 Ga0495606_0110584
1725 Ga0495608_0000250
1726 Ga0495608_0010843
1727 Ga0495608_0081432
1728 Ga0495610_0021653
1729 Ga0495616_0071391
1730 Ga0495616_0191170
1731 Ga0495618_0000059
1732 Ga0495618_0002157
1733 Ga0495618_0002703
1734 Ga0495618_0237435
1735 Ga0495620_0064800
1736 Ga0495628_0000022
1737 Ga0495628_0015475
1738 Ga0495628_0056961
1739 Ga0495628_0245684
1740 Ga0495630_0000758
1741 Ga0495630_0011807
1742 Ga0495630_0104242
1743 Ga0495630_0310229
1744 Ga0495630_0347433
1745 Ga0495631_0020740
1746 Ga0495637_0135961
1747 Ga0495643_0215295
1748 Ga0495644_0095070
1749 Ga0495648_0082144
1750 Ga0495663_0063692
1751 Ga0495666_0114782
1752 Ga0495666_0204169
1753 Ga0495652_0000008
1754 Ga0495652_0001912
1755 Ga0495652_0026195
1756 Ga0495652_0153943
1757 Ga0495652_0365284
1758 Ga0495665_0123950
1759 Ga0495665_0137291
1760 Ga0495665_0269460
1761 Ga0495640_0000029
1762 Ga0495640_0008277
1763 Ga0495640_0012288
1764 Ga0495640_0033432
1765 Ga0495640_0092337
1766 Ga0495586_0010651
1767 Ga0495587_0000019
1768 Ga0495587_0006011
1769 Ga0495598_0010537
1770 Ga0495645_0000006
1771 Ga0495645_0008317
1772 Ga0495645_0175214
1773 Ga0495645_0204885
1774 Ga0495622_0046788
1775 Ga0495622_0118276
1776 Ga0495633_0061264
1777 Ga0495667_0000061
1778 Ga0495667_0000879
1779 Ga0495656_0001123
1780 Ga0495656_0034826
1781 Ga0495668_0053325
1782 Ga0495634_0001212
1783 Ga0495634_0001468
1784 Ga0495634_0007204
1785 Ga0495634_0007643
1786 Ga0495634_0189376
1787 Ga0495634_0297489
1788 Ga0495611_0251504
1789 Ga0495625_0034767
1790 Ga0495625_0325743
1791 Ga0495625_0346003
1792 Ga0495635_0000023
1793 Ga0495635_0009308
1794 Ga0495635_0050714
1795 Ga0495635_0135616
1796 Ga0495635_0169013
1797 Ga0495661_0016354
1798 Ga0495661_0018986
1799 Ga0495588_0005816
1800 Ga0495657_0000099
1801 Ga0495657_0031948
1802 Ga0495599_0000039
1803 Ga0495599_0068733
1804 Ga0495599_0183154
1805 Ga0495623_0000253
1806 Ga0495623_0002814
1807 Ga0495623_0163132
1808 Ga0495646_0000017
1809 Ga0495646_0010331
1810 Ga0495646_0115426
1811 Ga0495646_0156346
1812 Ga0495647_0006744
1813 Ga0495647_0068679
1814 Ga0495658_0003498
1815 Ga0495658_0036061
1816 Ga0495658_0046803
1817 Ga0495658_0069182
1818 Ga0495658_0082845
1819 Ga0495658_0165063
1820 Ga0495669_0090032
1821 Ga0495613_0000508
1822 Ga0495613_0026976
1823 Ga0495613_0049670
1824 Ga0495613_0597593
1825 Ga0495624_0032723
1826 Ga0495624_0036798
1827 Ga0495624_0047972
1828 Ga0495624_0107846
1829 Ga0495624_0208057
1830 Ga0495670_0005031
1831 Ga0495671_0088284
1832 Ga0495649_0073715
1833 Ga0495649_0100214
1834 Ga0495589_0282080
1835 Ga0495600_0000030
1836 Ga0495581_0015077
1837 Ga0495581_0071686
1838 Ga0495581_0078613
1839 Ga0495581_0163574
1840 Ga0495604_0000030
1841 Ga0495604_0000662
1842 Ga0495604_0515409
1843 Ga0495674_0000009
1844 Ga0495674_0002163
1845 Ga0495674_0013531
1846 Ga0495674_0479164
1847 Ga0495676_0104282
1848 Ga0495676_0116718
1849 Ga0495676_0120623
1850 Ga0495676_0192362
1851 Ga0495676_0200553
1852 Ga0495676_0241159
1853 Ga0495680_0000359
1854 Ga0495680_0001209
1855 Ga0495680_0040382
1856 Ga0495680_0238091
1857 Ga0495680_0339882
1858 Ga0495675_0000056
1859 Ga0495675_0008977
1860 Ga0495684_0000056
1861 Ga0495684_0001278
1862 Ga0495684_0074981
1863 Ga0495686_0214595
1864 Ga0495686_0262390
1865 Ga0495593_0003363
1866 Ga0495593_0003599
1867 Ga0495593_0127986
1868 Ga0495602_0000006
1869 Ga0495602_0000539
1870 Ga0495602_0244967
1871 Ga0495602_0549334
1872 Ga0495614_0137271
1873 Ga0495614_0299412
1874 Ga0496100_0000926
1875 Ga0496100_0007931
1876 Ga0496100_0010730
1877 Ga0496100_0116252
1878 Ga0496100_0209142
1879 Ga0496101_0004497
1880 Ga0496101_0020299
1881 Ga0496101_0032008
1882 Ga0496102_0002933
1883 Ga0496102_0005716
1884 Ga0496104_0008179
1885 Ga0496104_0010922
1886 Ga0496104_0039756
1887 Ga0496104_0077661
1888 Ga0496104_0222826
1889 Ga0496105_0005555
1890 Ga0496105_0020686
1891 Ga0496105_0029456
1892 Ga0496105_0031349
1893 Ga0496105_0267976
1894 Ga0496105_0322327
1895 Ga0496106_0004750
1896 Ga0496106_0015351
1897 Ga0496106_0016428
1898 Ga0496106_0117374
1899 Ga0496106_0174483
1900 Ga0496107_0007435
1901 Ga0496107_0010058
1902 Ga0496107_0091732
1903 Ga0496108_0001187
1904 Ga0496108_0022989
1905 Ga0496108_0037474
1906 Ga0496108_0057975
1907 Ga0496108_0481587
1908 Ga0496109_0003628
1909 Ga0496109_0005207
1910 Ga0496109_0005449
1911 Ga0496109_0014804
1912 Ga0496109_0233656
1913 Ga0496109_0644463
1914 Ga0496110_0001389
1915 Ga0496110_0002156
1916 Ga0496110_0008745
1917 Ga0496110_0012668
1918 Ga0496110_0184014
1919 Ga0496110_0238597
1920 Ga0496111_0001694
1921 Ga0496111_0018942
1922 Ga0496111_0023129
1923 Ga0496111_0034140
1924 Ga0496112_0001346
1925 Ga0496112_0001940
1926 Ga0496112_0020476
1927 Ga0496112_0057488
1928 Ga0496112_0306561
1929 Ga0496113_0001229
1930 Ga0496113_0003069
1931 Ga0496113_0009756
1932 Ga0496113_0046514
1933 Ga0496113_0421480
1934 Ga0496113_0710337
1935 Ga0496114_0017584
1936 Ga0496114_0067775
1937 Ga0496114_0093566
1938 Ga0496114_0393844
1939 Ga0496115_0003119
1940 Ga0496115_0010171
1941 Ga0496115_0030851
1942 Ga0496115_0037797
1943 Ga0496115_0061881
1944 Ga0496116_0001851
1945 Ga0496117_0121378
1946 Ga0496120_0300990
1947 Ga0496121_0013940
1948 Ga0496122_0054736
1949 Ga0496123_0226992
1950 Ga0496125_0029721
1951 Ga0496125_0090833
1952 Ga0501031_0045287
1953 Ga0501031_0048768
1954 Ga0501031_0092149
1955 Ga0501032_0013003
1956 Ga0501032_0022105
1957 Ga0501032_0048876
1958 Ga0501032_0055122
1959 Ga0501032_0093051
1960 Ga0501033_0017990
1961 Ga0501033_0033329
1962 Ga0501033_0127122
1963 Ga0501034_0002201
1964 Ga0501034_0023489
1965 Ga0501034_0031875
1966 Ga0501034_0050893
1967 Ga0501034_0056596
1968 Ga0501034_0081474
1969 Ga0501034_0093059
1970 Ga0501034_0127324
1971 Ga0501034_0158572
1972 Ga0501034_0269075
1973 Ga0501034_0283883
1974 Ga0501034_0345771
1975 Ga0501034_0708855
1976 Ga0501036_0007818
1977 Ga0501036_0016265
1978 Ga0501036_0058284
1979 Ga0501036_0062481
1980 Ga0501036_0069973
1981 Ga0501036_0124437
1982 Ga0501036_0136118
1983 Ga0501037_0005054
1984 Ga0501037_0009480
1985 Ga0501037_0126480
1986 Ga0501037_0417485
1987 Ga0501038_0018363
1988 Ga0501038_0037433
1989 Ga0501038_0047640
1990 Ga0501038_0137111
1991 Ga0501038_0173305
1992 Ga0501038_0224760
1993 Ga0501038_0310331
1994 Ga0501038_0342794
1995 Ga0501039_0088736
1996 Ga0501039_0126551
1997 Ga0501039_0180494
1998 Ga0501039_0195945
1999 Ga0501039_0356505
2000 Ga0501040_0066629
2001 Ga0501040_0093026
2002 Ga0501040_0451038
2003 Ga0501041_0054388
2004 Ga0501042_0039496
2005 Ga0501042_0199294
2006 Ga0501043_0001843
2007 Ga0501043_0028972
2008 Ga0501043_0049051
2009 Ga0501043_0052764
2010 Ga0501043_0145326
2011 Ga0501043_0149423
2012 Ga0501043_0230029
2013 Ga0501043_0346698
2014 Ga0501043_0539355
2015 Ga0501043_0832478
2016 Ga0501046_0029021
2017 Ga0501046_0042972
2018 Ga0501046_0046372
2019 Ga0501046_0213269
2020 Ga0501046_0267391
2021 Ga0501047_0000010
2022 Ga0501047_0001775
2023 Ga0501047_0014495
2024 Ga0501047_0095778
2025 Ga0501047_0127392
2026 Ga0501047_0289149
2027 Ga0501047_0327509
2028 Ga0501048_0004920
2029 Ga0501048_0016921
2030 Ga0501048_0111287
2031 Ga0501048_0578936
2032 Ga0501067_0089828
2033 Ga0501067_0165649
2034 Ga0501067_0325256
2035 Ga0501068_0005782
2036 Ga0501068_0103009
2037 Ga0501068_0111004
2038 Ga0501068_0154246
2039 Ga0501068_0191423
2040 Ga0501068_0325772
2041 Ga0501068_0327630
2042 Ga0501069_0035200
2043 Ga0501069_0051069
2044 Ga0501069_0102789
2045 Ga0501069_0108775
2046 Ga0501069_0124177
2047 Ga0501069_0246239
2048 Ga0501070_0044484
2049 Ga0501070_0056695
2050 Ga0501070_0102058
2051 Ga0501070_0123635
2052 Ga0501070_0132694
2053 Ga0501070_0154409
2054 Ga0501070_0191252
2055 Ga0501070_0202789
2056 Ga0501070_0242180
2057 Ga0501070_0245748
2058 Ga0501070_0256771
2059 Ga0501071_0083235
2060 Ga0501071_0155413
2061 Ga0501072_0033081
2062 Ga0501072_0062220
2063 Ga0501072_0086538
2064 Ga0501072_0258493
2065 Ga0501072_0327898
2066 Ga0501072_0461682
2067 Ga0501073_0004541
2068 Ga0501073_0016110
2069 Ga0501073_0033338
2070 Ga0501073_0072315
2071 Ga0501073_0124554
2072 Ga0501073_0183423
2073 Ga0501073_0334461
2074 Ga0501073_0377293
2075 Ga0501073_0382846
2076 Ga0501074_0009189
2077 Ga0501074_0010349
2078 Ga0501074_0046562
2079 Ga0501074_0180689
2080 Ga0501074_0192647
2081 Ga0501075_0010200
2082 Ga0501075_0040287
2083 Ga0501075_0600613
2084 Ga0501076_0009793
2085 Ga0501076_0078679
2086 Ga0501076_0247431
2087 Ga0501076_0337393
2088 Ga0501076_0400388
2089 Ga0501077_0118183
2090 Ga0501079_0020198
2091 Ga0501079_0042950
2092 Ga0501079_0066627
2093 Ga0501079_0291895
2094 Ga0501079_0312730
2095 Ga0501080_0000314
2096 Ga0501080_0006102
2097 Ga0501080_0008717
2098 Ga0501080_0009753
2099 Ga0501080_0011995
2100 Ga0501080_0022269
2101 Ga0501080_0023180
2102 Ga0501080_0035262
2103 Ga0501080_0045183
2104 Ga0501080_0081340
2105 Ga0501080_0177989
2106 Ga0501080_0236493
2107 Ga0501080_0254933
2108 Ga0501080_0504689
2109 Ga0501080_0540662
2110 Ga0501081_0018902
2111 Ga0501081_0027216
2112 Ga0501081_0148981
2113 Ga0501081_0533896
2114 Ga0501083_0005058
2115 Ga0501083_0030007
2116 Ga0501083_0144139
2117 Ga0501083_0181223
2118 Ga0501083_0418990
2119 Ga0501035_0004729
2120 Ga0501035_0011561
2121 Ga0501035_0030708
2122 Ga0501035_0036440
2123 Ga0501035_0330562
2124 Ga0501035_0620731
2125 Ga0501044_0000116
2126 Ga0501044_0002291
2127 Ga0501044_0003610
2128 Ga0501044_0078352
2129 Ga0501044_0093602
2130 Ga0501044_0125313
2131 Ga0501044_0262961
2132 Ga0501044_0404528
2133 Ga0501045_0038834
2134 Ga0501045_0361097
2135 Ga0501045_0520249
2136 nmdc:mga03683_1213_c2
2137 nmdc:mga03683_44154_c1
2138 nmdc:mga03n38_331637_c1
2139 nmdc:mga03n38_59258_c1
2140 nmdc:mga03n38_9563_c1
2141 nmdc:mga00v17_149620_c1
2142 nmdc:mga00v17_24709_c1
2143 nmdc:mga00v17_28997_c1
2144 nmdc:mga00v17_4955_c1
2145 nmdc:mga00v17_79322_c1
2146 nmdc:mga0yw44_11062_c1
2147 nmdc:mga0yw44_116513_c1
2148 nmdc:mga0yw44_4079_c1
2149 nmdc:mga0yw44_54507_c1
2150 nmdc:mga0yw44_580_c1
2151 nmdc:mga0yw44_63973_c1
2152 nmdc:mga0yw44_69664_c1
2153 nmdc:mga0yw44_98989_c1
2154 nmdc:mga0k408_142046_c1
2155 nmdc:mga0k408_47462_c1
2156 nmdc:mga06z11_15735_c2
2157 nmdc:mga06z11_169845_c1
2158 nmdc:mga06z11_33677_c1
2159 nmdc:mga06z11_44729_c1
2160 nmdc:mga04h51_121630_c1
2161 nmdc:mga04h51_148960_c1
2162 nmdc:mga04h51_19183_c1
2163 nmdc:mga04h51_6680_c1
2164 nmdc:mga07m45_12481_c1
2165 nmdc:mga07m45_46338_c1
2166 nmdc:mga05p37_11744_c1
2167 nmdc:mga05p37_374_c1
2168 nmdc:mga05p37_47092_c1
2169 nmdc:mga05p37_512131_c1
2170 nmdc:mga09592_20752_c1
2171 nmdc:mga09592_2601_c1
2172 nmdc:mga0qj67_134130_c1
2173 nmdc:mga0qj67_50765_c1
2174 nmdc:mga0qj67_551023_c1
2175 nmdc:mga0qj67_65941_c1
2176 nmdc:mga06r32_250622_c2
2177 nmdc:mga06r32_307479_c1
2178 nmdc:mga06r32_349126_c1
2179 nmdc:mga06r32_397_c1
2180 nmdc:mga08y16_122069_c1
2181 nmdc:mga08y16_124566_c1
2182 nmdc:mga08y16_155771_c1
2183 nmdc:mga08y16_184_c1
2184 nmdc:mga08y16_270713_c1
2185 nmdc:mga08y16_321525_c1
2186 nmdc:mga08y16_90408_c1
2187 nmdc:mga0n895_381227_c1
2188 nmdc:mga0n895_445606_c1
2189 nmdc:mga0n895_834709_c1
2190 nmdc:mga0n895_96376_c1
2191 nmdc:mga0rr50_282808_c1
2192 nmdc:mga0rr50_64490_c1
2193 nmdc:mga0rr50_70704_c1
2194 nmdc:mga08x19_103158_c1
2195 nmdc:mga08x19_138367_c1
2196 nmdc:mga08x19_14_c1
2197 nmdc:mga0a205_203406_c1
2198 nmdc:mga0sz30_19112_c1
2199 nmdc:mga0sz30_38510_c1
2200 nmdc:mga0sz30_56787_c1
2201 Ga0495601_0000007
2202 Ga0495601_0005541
2203 Ga0495601_0012397
2204 Ga0495601_0301767
2205 Ga0495612_0000053
2206 Ga0495612_0001301
2207 Ga0495612_0002727
2208 Ga0495612_0271565
2209 Ga0495655_0034961
2210 Ga0495595_0000031
2211 Ga0495595_0005529
2212 Ga0495595_0010781
2213 Ga0495595_0030894
2214 Ga0495595_0088479
2215 Ga0495595_0274711
2216 Ga0495619_0000023
2217 Ga0495619_0003219
2218 Ga0495619_0013374
2219 Ga0495619_0024881
2220 Ga0495619_0058559
2221 Ga0495619_0230447
2222 Ga0495619_0643639
2223 Ga0500644_0072537
2224 Ga0500646_0081659
2225 Ga0500583_0162939
2226 Ga0500651_0039858
2227 Ga0500651_0121043
2228 Ga0500651_0139892
2229 Ga0500651_0144194
2230 Ga0500566_0000499
2231 Ga0500641_0018535
2232 Ga0500650_0002506
2233 Ga0500555_003654
2234 Ga0500556_0000004
2235 Ga0500562_067349
2236 Ga0500569_033050
2237 Ga0500593_069737
2238 Ga0500594_0123260
2239 Ga0500595_000731
2240 Ga0500595_022769
2241 Ga0500614_022675
2242 Ga0500618_001267
2243 Ga0500642_0000010
2244 Ga0500642_0000887
2245 Ga0500642_0009847
2246 Ga0500642_0124487
2247 Ga0500652_000063
2248 Ga0500658_0073848
2249 Ga0500568_0000388
2250 Ga0500568_0013508
2251 Ga0500577_0031982
2252 Ga0500577_0036118
2253 Ga0500577_0079257
2254 Ga0500588_0000561
2255 Ga0500588_0012298
2256 Ga0500588_0016324
2257 Ga0500588_0037346
2258 Ga0500604_0002284
2259 Ga0500604_0012185
2260 Ga0500604_0049761
2261 Ga0500616_0000014
2262 Ga0500616_0000888
2263 Ga0500616_0011431
2264 Ga0500619_020780
2265 Ga0500622_0000266
2266 Ga0500627_0033807
2267 Ga0500633_0038306
2268 Ga0500634_0249411
2269 Ga0500636_0001741
2270 Ga0500570_069807
2271 Ga0500645_021692
2272 Ga0500609_002904
2273 Ga0500601_000022
2274 Ga0501084_0034090
2275 Ga0501084_0083270
2276 Ga0501084_0083298
2277 Ga0501084_0336590
2278 Ga0501084_0337175
2279 Ga0501084_0384489
2280 Ga0500661_021571
2281 Ga0501082_0001543
2282 Ga0501082_0007592
2283 Ga0501082_0021973
2284 Ga0501082_0051744
2285 Ga0501082_0299310
2286 Ga0501082_0323962
2287 Ga0501082_0694267
2288 Ga0466962_0155906
2289 Ga0530510_0117097
2290 Ga0530510_0172919
2291 Ga0530510_0222121
2292 Ga0530510_0540371
2293 Ga0530510_0570628
2294 2603859168
2295 2643892612
2296 2643962061
2297 2644034770
2298 2644098735
2299 2644116096
2300 2738872000
2301 2793068239
2302 2812329952
2303 2824656246
2304 2824665657
2305 2844318741
2306 2857527779
2307 2893066499
2308 2906604430
2309 2919079445
2310 8056973131

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

20

218

0.97

PF13521

AAA_28

AAA domain

17

189

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x98-assembly1.cif.gz_A y162f mutant of thermus thermophilus hb8 thymidylate kinase 0.9583 3 206
5xal-assembly1.cif.gz_B y99f mutant of thermus thermophilus hb8 thymidylate kinase 0.9581 3 206
5x8a-assembly1.cif.gz_B crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 0.9578 3 206
5x8d-assembly1.cif.gz_B d90l mutant of thermus thermophilus hb8 thymidylate kinase 0.9577 3 206
3hjn-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9559 5 202
ID Description Score Start End Superfamily
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9463 3 208 3.40.50.300
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 5 206 3.40.50.300
3uwoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9389 3 208 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9325 3 208 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9306 5 202 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537P924-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9974 1 186 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A537T9L3-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9969 1 210 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A2P8NJ21-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9918 1 209 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A3D2CX13-F1-model_v4 deleted 0.9906 1 173
AF-A0A0A8K505-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9896 2 209 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Map