F490934

General Info

Members Datasets Scaffolds Average Seq Length
1156 445 2312 153

Family's Representative Sequence

Representative Sequence 3300003760|Ga0055527_1005009|Ga0055527_10050092
Length 186
Sequence MTIVEKYWDDAREGDTCTSPTYLVTKXRILAXADLTGDHTPVHVDEEYANASHFGCLVAHGLFGLSIADGLKTQSDYRFLPGMSLGWTWDFLLPIKVGDVLHVTFRVGSMRASKSRPDWGIVVLPSXLINQDGQVVQRGEHRLMVPRRPEALXCRHVPSKAFASSTTAISSPARMSXAVSRRSAPK

Samples

Sample ID Description Type Environment
1 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
143 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
158 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
228 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
251 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
252 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
253 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
254 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
255 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
258 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
259 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
260 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
261 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
262 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
263 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
264 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
265 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
266 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
267 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
268 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
269 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
270 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
271 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
272 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
275 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
276 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
277 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
283 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
284 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
285 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
288 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
299 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
302 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
311 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
312 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
313 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
314 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
315 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
316 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
317 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
324 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
325 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
326 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
327 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
328 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
329 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
339 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
340 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
346 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
352 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
356 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
359 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
382 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
383 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
386 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
387 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
388 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
389 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
390 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
392 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
393 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
394 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
395 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
399 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
400 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
401 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
402 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
403 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
413 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
414 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
415 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
416 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
417 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
418 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
419 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
420 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
421 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
422 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
423 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
424 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
425 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
426 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
427 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
430 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
442 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
443 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
444 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
445 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 1.9
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.28
Nodule 0.09
Rhizoplane 3.29
Rhizosphere 68.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055527_1005009 3300003760 Bacteria 1763
2 JGI24741J21665_1000084 3300001915 Bacteria 23727
3 JGI24740J21852_10000038 3300001979 Bacteria 44180
4 JGI24740J21852_10000091 3300001979 Bacteria 31370
5 JGI24740J21852_10019260 3300001979 Bacteria 2407
6 JGI24740J21852_10065968 3300001979 Bacteria 983
7 JGI24739J22299_10078299 3300001989 Bacteria 1018
8 JGI24739J22299_10163337 3300001989 Bacteria 657
9 JGI24737J22298_10010200 3300001990 Bacteria 3106
10 JGI24735J21928_10000589 3300002067 Bacteria 12773
11 JGI25156J39149_1000006 3300002705 Bacteria 261778
12 JGI25156J39149_1000135 3300002705 Bacteria 53930
13 JGI25156J39149_1006100 3300002705 Bacteria 3344
14 JGI25156J39149_1006124 3300002705 Bacteria 3334
15 JGI25156J39149_1006256 3300002705 Bacteria 3278
16 JGI25156J39149_1016753 3300002705 Bacteria 1414
17 JGI25156J39149_1026051 3300002705 Bacteria 931
18 JGI25154J39366_1000389 3300002738 Bacteria 23912
19 JGI25158J39367_1009898 3300002739 Bacteria 1297
20 JGI25157J39369_1000016 3300002741 Bacteria 192349
21 JGI25150J39212_1002582 3300002774 Bacteria 4455
22 JGI25151J46595_10014151 3300003187 Bacteria 3567
23 JGI25151J46595_10068449 3300003187 Bacteria 1089
24 JGI25151J46595_10086425 3300003187 Bacteria 888
25 JGI25165J46597_1000661 3300003214 Bacteria 28133
26 JGI25153J46596_10033361 3300003215 Bacteria 1700
27 rootH1_10027942 3300003316 Bacteria 1821
28 rootH1_10048720 3300003316 Bacteria 2940
29 rootH1_10054218 3300003316 Bacteria 6135
30 rootH1_10101357 3300003316 Bacteria 1067
31 rootH2_10050565 3300003320 Bacteria 1325
32 rootL2_10009476 3300003322 Bacteria 12918
33 rootL2_10012388 3300003322 Bacteria 5838
34 rootL2_10137787 3300003322 Bacteria 12087
35 rootH1_10120212 3300003323 Bacteria 3646
36 rootH1_10201936 3300003323 Bacteria 1646
37 JGI25160J50197_1000098 3300003354 Bacteria 87307
38 JGI25161J50226_1000037 3300003374 Bacteria 133331
39 Ga0055539_1000075 3300003752 Bacteria 130079
40 Ga0055533_1000140 3300003756 Bacteria 76502
41 Ga0055533_1000933 3300003756 Bacteria 8687
42 Ga0055532_1000003 3300003758 Bacteria 494004
43 Ga0055532_1000056 3300003758 Bacteria 158878
44 Ga0055532_1000265 3300003758 Bacteria 34085
45 Ga0055532_1005641 3300003758 Bacteria 1739
46 Ga0055525_1000492 3300003759 Bacteria 20296
47 Ga0055525_1011031 3300003759 Bacteria 762
48 Ga0055527_1000006 3300003760 Bacteria 494004
49 Ga0055527_1000323 3300003760 Bacteria 25846
50 Ga0055527_1002493 3300003760 Bacteria 3100
51 Ga0055527_1006523 3300003760 Bacteria 1458
52 Ga0055535_1000003 3300003761 Bacteria 494004
53 Ga0055535_1000013 3300003761 Bacteria 299614
54 Ga0055535_1000115 3300003761 Bacteria 86313
55 Ga0055535_1000134 3300003761 Bacteria 78815
56 Ga0055535_1000701 3300003761 Bacteria 25846
57 Ga0055542_1000007 3300003762 Bacteria 494004
58 Ga0055542_1000028 3300003762 Bacteria 251458
59 Ga0055542_1000178 3300003762 Bacteria 78815
60 Ga0055542_1000861 3300003762 Bacteria 21268
61 Ga0055542_1002118 3300003762 Bacteria 7288
62 Ga0055529_1000003 3300003763 Bacteria 494004
63 Ga0055529_1000074 3300003763 Bacteria 158872
64 Ga0055529_1000203 3300003763 Bacteria 78815
65 Ga0055526_1000184 3300003771 Bacteria 54504
66 Ga0055537_1000006 3300003773 Bacteria 147020
67 Ga0055537_1007555 3300003773 Bacteria 2609
68 Ga0055524_1000032 3300003775 Bacteria 182182
69 Ga0055536_1005877 3300003781 Bacteria 5884
70 Ga0055536_1007682 3300003781 Bacteria 4777
71 Ga0055534_1004608 3300003784 Bacteria 3931
72 Ga0055534_1007435 3300003784 Bacteria 2609
73 Ga0055528_1002844 3300003790 Bacteria 9038
74 Ga0055528_1003256 3300003790 Bacteria 8273
75 Ga0055528_1016487 3300003790 Bacteria 2609
76 Ga0055530_10000380 3300003791 Bacteria 40324
77 Ga0055530_10000731 3300003791 Bacteria 27463
78 Ga0055530_10000890 3300003791 Bacteria 24579
79 Ga0055530_10003806 3300003791 Bacteria 8300
80 Ga0055540_1000046 3300003792 Bacteria 148762
81 Ga0055540_1001790 3300003792 Bacteria 12221
82 Ga0055540_1002356 3300003792 Bacteria 10109
83 Ga0055540_1019493 3300003792 Bacteria 1824
84 Ga0055531_10000084 3300003794 Bacteria 102550
85 Ga0055531_10003007 3300003794 Bacteria 10942
86 Ga0055541_1000425 3300003841 Bacteria 12425
87 Ga0055541_1002842 3300003841 Bacteria 3353
88 Ga0058692_1008655 3300003856 Bacteria 2617
89 Ga0055543_1000645 3300004625 Bacteria 18613
90 Ga0065165_1000821 3300005262 Bacteria 41157
91 Ga0065165_1022462 3300005262 Bacteria 2161
92 Ga0065165_1022630 3300005262 Bacteria 2149
93 Ga0065714_10077745 3300005288 Bacteria 2662
94 Ga0065704_10147436 3300005289 Bacteria 1459
95 Ga0070658_10027600 3300005327 Bacteria 4554
96 Ga0070658_10092842 3300005327 Bacteria 2489
97 Ga0070658_10247226 3300005327 Bacteria 1513
98 Ga0070658_10483300 3300005327 Bacteria 1069
99 Ga0070676_10018812 3300005328 Bacteria 3834
100 Ga0070676_10139974 3300005328 Bacteria 1539
101 Ga0070676_10149055 3300005328 Bacteria 1496
102 Ga0070670_100000540 3300005331 Bacteria 30079
103 Ga0070670_100022297 3300005331 Bacteria 5451
104 Ga0070670_100068177 3300005331 Bacteria 3054
105 Ga0068869_100002271 3300005334 Bacteria 11571
106 Ga0068869_101121546 3300005334 Bacteria 689
107 Ga0070666_10074877 3300005335 Bacteria 2308
108 Ga0068868_100032080 3300005338 Bacteria 4039
109 Ga0070660_100000029 3300005339 Bacteria 88220
110 Ga0070660_100015930 3300005339 Bacteria 5444
111 Ga0070660_100108727 3300005339 Bacteria 2204
112 Ga0070661_100001417 3300005344 Bacteria 16689
113 Ga0070661_100052691 3300005344 Bacteria 2978
114 Ga0070661_100400221 3300005344 Bacteria 1085
115 Ga0070668_100110348 3300005347 Bacteria 2189
116 Ga0070669_100020431 3300005353 Bacteria 4730
117 Ga0070671_100020456 3300005355 Bacteria 5398
118 Ga0070671_100048591 3300005355 Bacteria 3529
119 Ga0070674_101228322 3300005356 Bacteria 666
120 Ga0070673_100266969 3300005364 Bacteria 1497
121 Ga0070659_100000006 3300005366 Bacteria 229954
122 Ga0070659_100000307 3300005366 Bacteria 38077
123 Ga0070659_100025930 3300005366 Bacteria 4509
124 Ga0070659_100057651 3300005366 Bacteria 3063
125 Ga0070667_100005867 3300005367 Bacteria 10238
126 Ga0070667_100216118 3300005367 Bacteria 1705
127 Ga0070667_100909936 3300005367 Bacteria 819
128 Ga0070705_100168650 3300005440 Bacteria 1471
129 Ga0070700_100352045 3300005441 Bacteria 1092
130 Ga0070708_100027484 3300005445 Bacteria 4883
131 Ga0070663_100000002 3300005455 Bacteria 298075
132 Ga0070663_100018810 3300005455 Bacteria 4539
133 Ga0070663_100288472 3300005455 Bacteria 1310
134 Ga0070663_100293494 3300005455 Bacteria 1299
135 Ga0070663_100365164 3300005455 Bacteria 1172
136 Ga0070663_100380086 3300005455 Bacteria 1150
137 Ga0070663_100398795 3300005455 Bacteria 1124
138 Ga0070663_100588954 3300005455 Bacteria 934
139 Ga0070663_100800769 3300005455 Bacteria 808
140 Ga0070678_100359437 3300005456 Bacteria 1254
141 Ga0070678_100675304 3300005456 Bacteria 929
142 Ga0070662_100179746 3300005457 Bacteria 1667
143 Ga0070662_100205147 3300005457 Bacteria 1566
144 Ga0070662_100521362 3300005457 Bacteria 993
145 Ga0070662_100867174 3300005457 Bacteria 769
146 Ga0068867_100058308 3300005459 Bacteria 2861
147 Ga0068867_100546421 3300005459 Bacteria 1003
148 Ga0070706_100008574 3300005467 Bacteria 9529
149 Ga0070706_100765192 3300005467 Bacteria 895
150 Ga0070707_101217524 3300005468 Bacteria 719
151 Ga0070684_100203830 3300005535 Bacteria 1802
152 Ga0068853_100024762 3300005539 Bacteria 5035
153 Ga0068853_100115482 3300005539 Bacteria 2389
154 Ga0068853_100170844 3300005539 Bacteria 1967
155 Ga0068853_100603924 3300005539 Bacteria 1042
156 Ga0068853_101622124 3300005539 Bacteria 627
157 Ga0070672_100013787 3300005543 Bacteria 5715
158 Ga0070672_101234742 3300005543 Bacteria 666
159 Ga0070695_100150446 3300005545 Bacteria 1624
160 Ga0070696_100527259 3300005546 Bacteria 943
161 Ga0070693_100101426 3300005547 Bacteria 1754
162 Ga0068855_100445628 3300005563 Bacteria 1413
163 Ga0068855_100540458 3300005563 Bacteria 1262
164 Ga0068855_100830538 3300005563 Bacteria 980
165 Ga0070664_100000004 3300005564 Bacteria 298075
166 Ga0070664_100005230 3300005564 Bacteria 10411
167 Ga0070664_100076910 3300005564 Bacteria 2869
168 Ga0068857_100057826 3300005577 Bacteria 3442
169 Ga0068857_100317346 3300005577 Bacteria 1439
170 Ga0068857_100334396 3300005577 Bacteria 1400
171 Ga0068857_100389899 3300005577 Bacteria 1295
172 Ga0068857_101590763 3300005577 Bacteria 638
173 Ga0068854_100000007 3300005578 Bacteria 182830
174 Ga0068854_100376402 3300005578 Bacteria 1169
175 Ga0068854_101469546 3300005578 Bacteria 618
176 Ga0068856_100000105 3300005614 Bacteria 81780
177 Ga0068856_100305768 3300005614 Bacteria 1608
178 Ga0068856_100414966 3300005614 Bacteria 1366
179 Ga0068856_100712190 3300005614 Bacteria 1024
180 Ga0068856_101023881 3300005614 Bacteria 844
181 Ga0068852_100013481 3300005616 Bacteria 6258
182 Ga0068852_100017829 3300005616 Bacteria 5580
183 Ga0068852_100018858 3300005616 Bacteria 5445
184 Ga0068852_100068820 3300005616 Bacteria 3100
185 Ga0068852_100142243 3300005616 Bacteria 2222
186 Ga0068852_100168530 3300005616 Bacteria 2051
187 Ga0068852_101425210 3300005616 Bacteria 715
188 Ga0068859_100057856 3300005617 Bacteria 3905
189 Ga0068859_100116942 3300005617 Bacteria 2731
190 Ga0068859_100491199 3300005617 Bacteria 1323
191 Ga0068859_100632211 3300005617 Bacteria 1163
192 Ga0068864_100003727 3300005618 Bacteria 12581
193 Ga0068864_100025373 3300005618 Bacteria 4990
194 Ga0068861_100006842 3300005719 Bacteria 7785
195 Ga0068861_101879197 3300005719 Bacteria 595
196 Ga0068851_10080322 3300005834 Bacteria 1702
197 Ga0068851_10121300 3300005834 Bacteria 1405
198 Ga0068870_10001893 3300005840 Bacteria 8628
199 Ga0068863_100048750 3300005841 Bacteria 4016
200 Ga0068863_100085322 3300005841 Bacteria 2992
201 Ga0068863_100086430 3300005841 Bacteria 2971
202 Ga0068858_100011316 3300005842 Bacteria 8430
203 Ga0068858_101576166 3300005842 Bacteria 648
204 Ga0068860_100013006 3300005843 Bacteria 8172
205 Ga0068860_100520270 3300005843 Bacteria 1190
206 Ga0068862_100028341 3300005844 Bacteria 4715
207 Ga0068862_100135585 3300005844 Bacteria 2181
208 Ga0081539_10266234 3300005985 Bacteria 753
209 Ga0075365_10001937 3300006038 Bacteria 9772
210 Ga0075365_10149154 3300006038 Bacteria 1626
211 Ga0075368_10001130 3300006042 Bacteria 8413
212 Ga0075368_10204252 3300006042 Bacteria 836
213 Ga0075368_10206456 3300006042 Bacteria 832
214 Ga0075363_100020439 3300006048 Bacteria 3320
215 Ga0075363_100185993 3300006048 Bacteria 1183
216 Ga0075363_100209451 3300006048 Bacteria 1115
217 Ga0075363_100615349 3300006048 Bacteria 651
218 Ga0075364_10005448 3300006051 Bacteria 7393
219 Ga0075364_10012743 3300006051 Bacteria 5156
220 Ga0075432_10004475 3300006058 Bacteria 4765
221 Ga0075362_10001157 3300006177 Bacteria 8246
222 Ga0075362_10029335 3300006177 Bacteria 2370
223 Ga0075367_10000488 3300006178 Bacteria 14852
224 Ga0075367_10094701 3300006178 Bacteria 1820
225 Ga0075367_10418751 3300006178 Bacteria 848
226 Ga0075367_10572047 3300006178 Bacteria 718
227 Ga0075369_10001709 3300006186 Bacteria 7598
228 Ga0075366_10024831 3300006195 Bacteria 3496
229 Ga0075366_10073998 3300006195 Bacteria 2031
230 Ga0075366_10088640 3300006195 Bacteria 1853
231 Ga0075366_10104313 3300006195 Bacteria 1703
232 Ga0075366_10221684 3300006195 Bacteria 1152
233 Ga0075366_10308888 3300006195 Bacteria 968
234 Ga0097621_100363184 3300006237 Bacteria 1290
235 Ga0075370_10000375 3300006353 Bacteria 16453
236 Ga0075370_10000575 3300006353 Bacteria 14121
237 Ga0075370_10023715 3300006353 Bacteria 3382
238 Ga0075370_10039542 3300006353 Bacteria 2658
239 Ga0075370_10060742 3300006353 Bacteria 2153
240 Ga0068871_101061949 3300006358 Bacteria 756
241 Ga0075428_100027331 3300006844 Bacteria 6314
242 Ga0075431_101080908 3300006847 Bacteria 767
243 Ga0075434_100283591 3300006871 Bacteria 1676
244 Ga0097620_100057853 3300006931 Bacteria 3905
245 Ga0097620_100116928 3300006931 Bacteria 2731
246 Ga0097620_100491111 3300006931 Bacteria 1323
247 Ga0097620_100632069 3300006931 Bacteria 1163
248 Ga0079104_1038669 3300006946 Bacteria 1129
249 Ga0075435_100833826 3300007076 Bacteria 803
250 Ga0105251_10000005 3300009011 Bacteria 259226
251 Ga0105251_10000427 3300009011 Bacteria 40852
252 Ga0105251_10003188 3300009011 Bacteria 12129
253 Ga0105244_10012387 3300009036 Bacteria 5040
254 Ga0105244_10023604 3300009036 Bacteria 3369
255 Ga0105244_10060514 3300009036 Bacteria 1907
256 Ga0105244_10282175 3300009036 Bacteria 770
257 Ga0105250_10030058 3300009092 Bacteria 2185
258 Ga0105250_10192633 3300009092 Bacteria 858
259 Ga0105240_10004916 3300009093 Bacteria 20092
260 Ga0105240_10006257 3300009093 Bacteria 17511
261 Ga0105240_10060318 3300009093 Bacteria 4729
262 Ga0105240_10088421 3300009093 Bacteria 3790
263 Ga0105240_10101797 3300009093 Bacteria 3492
264 Ga0105240_10203394 3300009093 Bacteria 2319
265 Ga0105240_10284603 3300009093 Bacteria 1898
266 Ga0105240_11165314 3300009093 Bacteria 817
267 Ga0105240_11214318 3300009093 Bacteria 798
268 Ga0105240_11650691 3300009093 Bacteria 670
269 Ga0105245_10014386 3300009098 Bacteria 6892
270 Ga0105245_10374711 3300009098 Bacteria 1416
271 Ga0105245_11123170 3300009098 Bacteria 833
272 Ga0105247_10034404 3300009101 Bacteria 3085
273 Ga0105243_10004528 3300009148 Bacteria 10982
274 Ga0105243_10032819 3300009148 Bacteria 4013
275 Ga0105243_10165120 3300009148 Bacteria 1913
276 Ga0105241_10169198 3300009174 Bacteria 1803
277 Ga0105242_10340120 3300009176 Bacteria 1383
278 Ga0105242_10567469 3300009176 Bacteria 1091
279 Ga0105248_10005602 3300009177 Bacteria 13799
280 Ga0105248_10006219 3300009177 Bacteria 13091
281 Ga0105248_10011634 3300009177 Bacteria 9694
282 Ga0105248_10236846 3300009177 Bacteria 2055
283 Ga0105248_10639287 3300009177 Bacteria 1200
284 Ga0105248_11017885 3300009177 Bacteria 936
285 Ga0105237_10015527 3300009545 Bacteria 7923
286 Ga0105237_10017774 3300009545 Bacteria 7372
287 Ga0105237_10141187 3300009545 Bacteria 2403
288 Ga0105237_10159765 3300009545 Bacteria 2252
289 Ga0105237_10377768 3300009545 Bacteria 1422
290 Ga0105238_10014547 3300009551 Bacteria 7958
291 Ga0105238_10051201 3300009551 Bacteria 4154
292 Ga0105238_10056077 3300009551 Bacteria 3953
293 Ga0105238_10671102 3300009551 Bacteria 1047
294 Ga0105238_11101693 3300009551 Bacteria 817
295 Ga0105238_11375308 3300009551 Bacteria 733
296 Ga0105238_12195069 3300009551 Bacteria 587
297 Ga0105249_10276877 3300009553 Bacteria 1674
298 Ga0105239_10014021 3300010375 Bacteria 8898
299 Ga0105239_10103451 3300010375 Bacteria 3152
300 Ga0105239_10158456 3300010375 Bacteria 2528
301 Ga0157347_1011112 3300012502 Bacteria 953
302 Ga0157373_10004956 3300013100 Bacteria 10008
303 Ga0157373_10015931 3300013100 Bacteria 5489
304 Ga0157373_10025435 3300013100 Bacteria 4282
305 Ga0157373_10261531 3300013100 Bacteria 1225
306 Ga0157373_10711698 3300013100 Bacteria 736
307 Ga0157371_10000086 3300013102 Bacteria 146397
308 Ga0157371_10000223 3300013102 Bacteria 82671
309 Ga0157371_10000986 3300013102 Bacteria 31519
310 Ga0157371_10025877 3300013102 Bacteria 4270
311 Ga0157371_10082692 3300013102 Bacteria 2273
312 Ga0157371_10123211 3300013102 Bacteria 1843
313 Ga0157371_10893380 3300013102 Bacteria 673
314 Ga0157370_10000074 3300013104 Bacteria 108622
315 Ga0157370_10042603 3300013104 Bacteria 4373
316 Ga0157370_10059009 3300013104 Bacteria 3647
317 Ga0157370_10113281 3300013104 Bacteria 2535
318 Ga0157370_11509944 3300013104 Bacteria 604
319 Ga0157369_10000383 3300013105 Bacteria 58625
320 Ga0157369_10001241 3300013105 Bacteria 31779
321 Ga0157369_10001440 3300013105 Bacteria 29208
322 Ga0157369_10001863 3300013105 Bacteria 25417
323 Ga0157369_10039961 3300013105 Bacteria 5124
324 Ga0157369_10138605 3300013105 Bacteria 2574
325 Ga0157369_10147744 3300013105 Bacteria 2485
326 Ga0157369_10165598 3300013105 Bacteria 2332
327 Ga0157369_10546899 3300013105 Bacteria 1197
328 Ga0157374_10000116 3300013296 Bacteria 73468
329 Ga0157374_10009373 3300013296 Bacteria 8399
330 Ga0157374_10043751 3300013296 Bacteria 4138
331 Ga0157374_10223274 3300013296 Bacteria 1849
332 Ga0157378_10010746 3300013297 Bacteria 8001
333 Ga0157378_10465018 3300013297 Bacteria 1258
334 Ga0163162_10005148 3300013306 Bacteria 12599
335 Ga0163162_10043604 3300013306 Bacteria 4492
336 Ga0163162_10160493 3300013306 Bacteria 2370
337 Ga0163162_10476825 3300013306 Bacteria 1379
338 Ga0163162_11008243 3300013306 Bacteria 942
339 Ga0157372_10000085 3300013307 Bacteria 96915
340 Ga0157372_10012524 3300013307 Bacteria 9032
341 Ga0157372_10166010 3300013307 Bacteria 2553
342 Ga0157372_10312934 3300013307 Bacteria 1828
343 Ga0157372_10516180 3300013307 Bacteria 1393
344 Ga0157375_10007536 3300013308 Bacteria 9515
345 Ga0157375_10194238 3300013308 Bacteria 2185
346 Ga0163163_10128554 3300014325 Bacteria 2572
347 Ga0163163_10574087 3300014325 Bacteria 1191
348 Ga0157380_12314693 3300014326 Bacteria 602
349 Ga0182008_10002465 3300014497 Bacteria 11584
350 Ga0182008_10002632 3300014497 Bacteria 11135
351 Ga0182008_10021729 3300014497 Bacteria 3295
352 Ga0182008_10294901 3300014497 Bacteria 847
353 Ga0157379_10021652 3300014968 Bacteria 5693
354 Ga0157379_10074906 3300014968 Bacteria 3030
355 Ga0182006_1000317 3300015261 Bacteria 42256
356 Ga0182006_1002482 3300015261 Bacteria 10055
357 Ga0182006_1004530 3300015261 Bacteria 6840
358 Ga0182006_1006004 3300015261 Bacteria 5691
359 Ga0182006_1007384 3300015261 Bacteria 5034
360 Ga0182006_1018543 3300015261 Bacteria 2939
361 Ga0182006_1020371 3300015261 Bacteria 2780
362 Ga0182006_1091634 3300015261 Bacteria 1093
363 Ga0182006_1204321 3300015261 Bacteria 654
364 Ga0182007_10001059 3300015262 Bacteria 14995
365 Ga0182007_10012055 3300015262 Bacteria 3338
366 Ga0182007_10038048 3300015262 Bacteria 1614
367 Ga0182005_1103388 3300015265 Bacteria 800
368 Ga0182005_1118525 3300015265 Bacteria 752
369 Ga0183362_10002 3300015683 Bacteria 1432711
370 Ga0163161_10000657 3300017792 Bacteria 27646
371 Ga0163161_11784556 3300017792 Bacteria 547
372 Ga0154015_1180002 3300020610 Bacteria 31491
373 Ga0213872_10003058 3300021361 Bacteria 9432
374 Ga0209435_100010 3300025206 Bacteria 475373
375 Ga0209435_101521 3300025206 Bacteria 2899
376 Ga0209436_104404 3300025208 Bacteria 3489
377 Ga0209784_100008 3300025224 Bacteria 740293
378 Ga0209784_100829 3300025224 Bacteria 6984
379 Ga0209784_101133 3300025224 Bacteria 4310
380 Ga0209566_100006 3300025225 Bacteria 789272
381 Ga0209566_100354 3300025225 Bacteria 39082
382 Ga0209566_100567 3300025225 Bacteria 24190
383 Ga0209566_104658 3300025225 Bacteria 1838
384 Ga0209674_100025 3300025226 Bacteria 515942
385 Ga0209674_100070 3300025226 Bacteria 242214
386 Ga0209674_100093 3300025226 Bacteria 170423
387 Ga0209674_100120 3300025226 Bacteria 134811
388 Ga0209674_101148 3300025226 Bacteria 7661
389 Ga0209672_100002 3300025228 Bacteria 1733325
390 Ga0209672_100044 3300025228 Bacteria 270292
391 Ga0209672_100075 3300025228 Bacteria 159275
392 Ga0209672_100413 3300025228 Bacteria 25187
393 Ga0209672_100982 3300025228 Bacteria 12586
394 Ga0209672_101155 3300025228 Bacteria 10845
395 Ga0209147_100003 3300025229 Bacteria 1733325
396 Ga0209147_100005 3300025229 Bacteria 1036530
397 Ga0209147_100039 3300025229 Bacteria 311101
398 Ga0209147_100119 3300025229 Bacteria 142860
399 Ga0209147_100176 3300025229 Bacteria 80329
400 Ga0209147_101077 3300025229 Bacteria 11501
401 Ga0209563_100016 3300025230 Bacteria 802091
402 Ga0209563_101301 3300025230 Bacteria 6813
403 Ga0209563_102708 3300025230 Bacteria 3895
404 Ga0207427_100777 3300025231 Bacteria 14536
405 Ga0209258_100005 3300025242 Bacteria 1087938
406 Ga0209258_100007 3300025242 Bacteria 1036530
407 Ga0209258_100062 3300025242 Bacteria 311101
408 Ga0209258_100067 3300025242 Bacteria 287603
409 Ga0209258_100153 3300025242 Bacteria 159275
410 Ga0207425_1000434 3300025245 Bacteria 27651
411 Ga0207425_1000908 3300025245 Bacteria 14229
412 Ga0207425_1001023 3300025245 Bacteria 13062
413 Ga0207425_1010792 3300025245 Bacteria 2208
414 Ga0209646_1000001 3300025246 Bacteria 3092932
415 Ga0209646_1000016 3300025246 Bacteria 501688
416 Ga0209646_1002708 3300025246 Bacteria 3782
417 Ga0209026_1000001 3300025250 Bacteria 1228671
418 Ga0209026_1001651 3300025250 Bacteria 9453
419 Ga0209677_100008 3300025253 Bacteria 802091
420 Ga0209148_1000006 3300025254 Bacteria 1733325
421 Ga0209148_1000051 3300025254 Bacteria 401000
422 Ga0209148_1000067 3300025254 Bacteria 338678
423 Ga0209148_1000075 3300025254 Bacteria 311101
424 Ga0209148_1000728 3300025254 Bacteria 25777
425 Ga0209148_1003409 3300025254 Bacteria 4417
426 Ga0209759_1000001 3300025256 Bacteria 2799452
427 Ga0209759_1000002 3300025256 Bacteria 1027596
428 Ga0209759_1000014 3300025256 Bacteria 396291
429 Ga0209759_1000039 3300025256 Bacteria 256444
430 Ga0209759_1001110 3300025256 Bacteria 17366
431 Ga0209759_1002345 3300025256 Bacteria 8458
432 Ga0209759_1006058 3300025256 Bacteria 4121
433 Ga0209759_1019604 3300025256 Bacteria 1598
434 Ga0209129_1000030 3300025258 Bacteria 391958
435 Ga0209129_1019612 3300025258 Bacteria 1274
436 Ga0209129_1031627 3300025258 Bacteria 880
437 Ga0209233_1000018 3300025261 Bacteria 886857
438 Ga0209233_1051508 3300025261 Bacteria 834
439 Ga0209565_1000016 3300025263 Bacteria 477707
440 Ga0209565_1000019 3300025263 Bacteria 438920
441 Ga0209565_1001223 3300025263 Bacteria 12115
442 Ga0209455_1000003 3300025272 Bacteria 1471893
443 Ga0209455_1000011 3300025272 Bacteria 947242
444 Ga0209455_1000067 3300025272 Bacteria 311101
445 Ga0209455_1000221 3300025272 Bacteria 78847
446 Ga0209673_1000066 3300025273 Bacteria 250037
447 Ga0209673_1000073 3300025273 Bacteria 233645
448 Ga0209673_1000095 3300025273 Bacteria 197466
449 Ga0209673_1001044 3300025273 Bacteria 32181
450 Ga0209130_1000011 3300025284 Bacteria 431723
451 Ga0209130_1000141 3300025284 Bacteria 115378
452 Ga0209130_1000210 3300025284 Bacteria 77155
453 Ga0209130_1004492 3300025284 Bacteria 5270
454 Ga0209130_1012453 3300025284 Bacteria 2224
455 Ga0209675_1000031 3300025291 Bacteria 273599
456 Ga0209675_1000356 3300025291 Bacteria 39400
457 Ga0209675_1004844 3300025291 Bacteria 5831
458 Ga0209676_1000005 3300025292 Bacteria 1076001
459 Ga0209676_1000123 3300025292 Bacteria 195351
460 Ga0209676_1000165 3300025292 Bacteria 156709
461 Ga0209676_1002917 3300025292 Bacteria 11181
462 Ga0209676_1020438 3300025292 Bacteria 2249
463 Ga0209025_1000078 3300025294 Bacteria 271683
464 Ga0209025_1000319 3300025294 Bacteria 107011
465 Ga0209025_1001554 3300025294 Bacteria 29174
466 Ga0209025_1009510 3300025294 Bacteria 6754
467 Ga0209564_1000056 3300025295 Bacteria 340873
468 Ga0209564_1000099 3300025295 Bacteria 225256
469 Ga0209564_1000165 3300025295 Bacteria 160244
470 Ga0209564_1005057 3300025295 Bacteria 7704
471 Ga0209564_1010599 3300025295 Bacteria 4223
472 Ga0209758_1000037 3300025297 Bacteria 439101
473 Ga0209050_1000007 3300025298 Bacteria 1187891
474 Ga0209050_1000084 3300025298 Bacteria 263245
475 Ga0209050_1000188 3300025298 Bacteria 138865
476 Ga0209050_1014814 3300025298 Bacteria 3327
477 Ga0209256_1000022 3300025299 Bacteria 481843
478 Ga0209256_1000043 3300025299 Bacteria 340873
479 Ga0209256_1000110 3300025299 Bacteria 182312
480 Ga0207426_1000029 3300025302 Bacteria 473835
481 Ga0207426_1000103 3300025302 Bacteria 250320
482 Ga0207426_1000145 3300025302 Bacteria 191065
483 Ga0207426_1000260 3300025302 Bacteria 114246
484 Ga0207426_1002451 3300025302 Bacteria 11822
485 Ga0207426_1003898 3300025302 Bacteria 7678
486 Ga0209051_1000036 3300025303 Bacteria 339863
487 Ga0209051_1000058 3300025303 Bacteria 263137
488 Ga0209051_1000091 3300025303 Bacteria 173683
489 Ga0209051_1000494 3300025303 Bacteria 50941
490 Ga0209257_1000011 3300025304 Bacteria 1112630
491 Ga0209257_1000057 3300025304 Bacteria 396985
492 Ga0209257_1000092 3300025304 Bacteria 263137
493 Ga0207697_10041147 3300025315 Bacteria 1898
494 Ga0207656_10008463 3300025321 Bacteria 3790
495 Ga0207656_10046457 3300025321 Bacteria 1863
496 Ga0207696_1054182 3300025711 Bacteria 1140
497 Ga0207655_1001871 3300025728 Bacteria 18120
498 Ga0207655_1023574 3300025728 Bacteria 3047
499 Ga0207655_1030654 3300025728 Bacteria 2497
500 Ga0207713_1000036 3300025735 Bacteria 259717
501 Ga0207713_1002789 3300025735 Bacteria 12345
502 Ga0207713_1007353 3300025735 Bacteria 6515
503 Ga0207713_1052813 3300025735 Bacteria 1606
504 Ga0207680_10060019 3300025903 Bacteria 2313
505 Ga0207680_10061690 3300025903 Bacteria 2287
506 Ga0207680_10164462 3300025903 Bacteria 1490
507 Ga0207647_10009559 3300025904 Bacteria 6883
508 Ga0207647_10011061 3300025904 Bacteria 6345
509 Ga0207647_10014440 3300025904 Bacteria 5444
510 Ga0207647_10042812 3300025904 Bacteria 2837
511 Ga0207647_10200988 3300025904 Bacteria 1153
512 Ga0207647_10501517 3300025904 Bacteria 677
513 Ga0207645_10031101 3300025907 Bacteria 3436
514 Ga0207645_10143331 3300025907 Bacteria 1557
515 Ga0207643_10195687 3300025908 Bacteria 1229
516 Ga0207705_10084916 3300025909 Bacteria 2312
517 Ga0207705_10107081 3300025909 Bacteria 2062
518 Ga0207705_10202607 3300025909 Bacteria 1504
519 Ga0207684_10609822 3300025910 Bacteria 932
520 Ga0207654_10454470 3300025911 Bacteria 898
521 Ga0207695_10003008 3300025913 Bacteria 24230
522 Ga0207695_10003114 3300025913 Bacteria 23727
523 Ga0207695_10014899 3300025913 Bacteria 9177
524 Ga0207695_10032225 3300025913 Bacteria 5738
525 Ga0207695_10159983 3300025913 Bacteria 2184
526 Ga0207695_10333238 3300025913 Bacteria 1406
527 Ga0207695_10400404 3300025913 Bacteria 1257
528 Ga0207695_10595466 3300025913 Bacteria 987
529 Ga0207695_10614241 3300025913 Bacteria 968
530 Ga0207695_10892025 3300025913 Bacteria 769
531 Ga0207671_10043088 3300025914 Bacteria 3337
532 Ga0207671_10065133 3300025914 Bacteria 2710
533 Ga0207671_10068770 3300025914 Bacteria 2639
534 Ga0207671_10343119 3300025914 Bacteria 1183
535 Ga0207657_10000072 3300025919 Bacteria 93655
536 Ga0207657_10000389 3300025919 Bacteria 46345
537 Ga0207657_10319697 3300025919 Bacteria 1227
538 Ga0207657_10985322 3300025919 Bacteria 647
539 Ga0207649_10001426 3300025920 Bacteria 14134
540 Ga0207646_10715054 3300025922 Bacteria 895
541 Ga0207646_11175496 3300025922 Bacteria 673
542 Ga0207681_10033213 3300025923 Bacteria 3381
543 Ga0207681_10139559 3300025923 Bacteria 1803
544 Ga0207694_10047952 3300025924 Bacteria 3304
545 Ga0207694_10152653 3300025924 Bacteria 1861
546 Ga0207694_10677670 3300025924 Bacteria 869
547 Ga0207694_10795689 3300025924 Bacteria 799
548 Ga0207694_10797322 3300025924 Bacteria 798
549 Ga0207694_10951144 3300025924 Bacteria 727
550 Ga0207650_10005387 3300025925 Bacteria 8727
551 Ga0207650_10007014 3300025925 Bacteria 7686
552 Ga0207650_10088595 3300025925 Bacteria 2360
553 Ga0207650_10201358 3300025925 Bacteria 1595
554 Ga0207687_10012072 3300025927 Bacteria 5649
555 Ga0207644_10007558 3300025931 Bacteria 7085
556 Ga0207644_10351277 3300025931 Bacteria 1197
557 Ga0207644_11125769 3300025931 Bacteria 660
558 Ga0207690_10000019 3300025932 Bacteria 235380
559 Ga0207690_10000722 3300025932 Bacteria 21290
560 Ga0207690_10064824 3300025932 Bacteria 2496
561 Ga0207690_10095002 3300025932 Bacteria 2117
562 Ga0207706_10311127 3300025933 Bacteria 1371
563 Ga0207706_10506764 3300025933 Bacteria 1041
564 Ga0207706_10534820 3300025933 Bacteria 1010
565 Ga0207686_10277216 3300025934 Bacteria 1236
566 Ga0207709_10001089 3300025935 Bacteria 19893
567 Ga0207709_10012585 3300025935 Bacteria 4662
568 Ga0207669_10312672 3300025937 Bacteria 1199
569 Ga0207704_11108880 3300025938 Bacteria 673
570 Ga0207691_10071487 3300025940 Bacteria 3131
571 Ga0207691_10423659 3300025940 Bacteria 1134
572 Ga0207711_10012168 3300025941 Bacteria 7152
573 Ga0207711_10015519 3300025941 Bacteria 6322
574 Ga0207711_10397875 3300025941 Bacteria 1280
575 Ga0207689_10000556 3300025942 Bacteria 35605
576 Ga0207689_10091608 3300025942 Bacteria 2497
577 Ga0207689_10271241 3300025942 Bacteria 1405
578 Ga0207679_10000002 3300025945 Bacteria 634491
579 Ga0207679_10026449 3300025945 Bacteria 4001
580 Ga0207679_10073814 3300025945 Bacteria 2583
581 Ga0207667_10038803 3300025949 Bacteria 5080
582 Ga0207667_10066718 3300025949 Bacteria 3750
583 Ga0207667_10866813 3300025949 Bacteria 896
584 Ga0207668_10016062 3300025972 Bacteria 4664
585 Ga0207668_10017548 3300025972 Bacteria 4486
586 Ga0207640_10000101 3300025981 Bacteria 66091
587 Ga0207640_10573321 3300025981 Bacteria 952
588 Ga0207658_10006734 3300025986 Bacteria 7821
589 Ga0207658_10112736 3300025986 Bacteria 2153
590 Ga0207658_10661784 3300025986 Bacteria 942
591 Ga0207677_10010768 3300026023 Bacteria 5185
592 Ga0207677_11861798 3300026023 Bacteria 559
593 Ga0207703_10005102 3300026035 Bacteria 10621
594 Ga0207703_10876535 3300026035 Bacteria 859
595 Ga0207639_10022579 3300026041 Bacteria 4533
596 Ga0207639_10427501 3300026041 Bacteria 1199
597 Ga0207678_10000003 3300026067 Bacteria 282716
598 Ga0207678_10030675 3300026067 Bacteria 4694
599 Ga0207678_10095757 3300026067 Bacteria 2537
600 Ga0207678_10358986 3300026067 Bacteria 1257
601 Ga0207678_10370686 3300026067 Bacteria 1237
602 Ga0207678_10420443 3300026067 Bacteria 1159
603 Ga0207702_10000010 3300026078 Bacteria 292789
604 Ga0207702_10458938 3300026078 Bacteria 1237
605 Ga0207702_10581841 3300026078 Bacteria 1097
606 Ga0207702_10957693 3300026078 Bacteria 849
607 Ga0207641_10050978 3300026088 Bacteria 3504
608 Ga0207641_10067199 3300026088 Bacteria 3070
609 Ga0207641_10420959 3300026088 Bacteria 1286
610 Ga0207648_10100100 3300026089 Bacteria 2539
611 Ga0207648_10194167 3300026089 Bacteria 1800
612 Ga0207648_10232950 3300026089 Bacteria 1638
613 Ga0207648_10673350 3300026089 Bacteria 957
614 Ga0207676_10004509 3300026095 Bacteria 9848
615 Ga0207676_10237638 3300026095 Bacteria 1632
616 Ga0207676_10495173 3300026095 Bacteria 1160
617 Ga0207674_10029272 3300026116 Bacteria 5799
618 Ga0207674_10245152 3300026116 Bacteria 1739
619 Ga0207674_10409664 3300026116 Bacteria 1310
620 Ga0207674_10616490 3300026116 Bacteria 1048
621 Ga0207675_100000530 3300026118 Bacteria 37109
622 Ga0207675_100282899 3300026118 Bacteria 1612
623 Ga0207698_10048515 3300026142 Bacteria 3225
624 Ga0207698_10057456 3300026142 Bacteria 3011
625 Ga0207698_10144329 3300026142 Bacteria 2056
626 Ga0207698_10185212 3300026142 Bacteria 1848
627 Ga0207698_10313260 3300026142 Bacteria 1466
628 Ga0207698_10323557 3300026142 Bacteria 1445
629 Ga0209371_1000095 3300027312 Bacteria 166175
630 Ga0209371_1000211 3300027312 Bacteria 81758
631 Ga0209371_1011309 3300027312 Bacteria 2660
632 Ga0209813_10003543 3300027866 Bacteria 3661
633 Ga0209813_10089423 3300027866 Bacteria 1031
634 Ga0209813_10147751 3300027866 Bacteria 839
635 Ga0207428_10093489 3300027907 Bacteria 2332
636 Ga0268266_11486230 3300028379 Bacteria 653
637 Ga0268265_10003468 3300028380 Bacteria 11334
638 Ga0268265_10024384 3300028380 Bacteria 4278
639 Ga0268265_11730424 3300028380 Bacteria 631
640 Ga0268264_10001980 3300028381 Bacteria 18431
641 Ga0307515_10610861 3300028794 Bacteria 701
642 Ga0268256_1000116 3300030500 Bacteria 115451
643 Ga0268256_1000319 3300030500 Bacteria 47885
644 Ga0268256_1012649 3300030500 Bacteria 2597
645 Ga0307408_100000926 3300031548 Bacteria 22869
646 Ga0307408_100010117 3300031548 Bacteria 6218
647 Ga0307408_100010914 3300031548 Bacteria 5996
648 Ga0307408_100017628 3300031548 Bacteria 4781
649 Ga0307408_100072377 3300031548 Bacteria 2551
650 Ga0307408_100884878 3300031548 Bacteria 816
651 Ga0307514_10017303 3300031649 Bacteria 5933
652 Ga0307516_10923911 3300031730 Bacteria 540
653 Ga0307405_10001796 3300031731 Bacteria 9182
654 Ga0307405_10180755 3300031731 Bacteria 1514
655 Ga0307413_10193441 3300031824 Bacteria 1462
656 Ga0307413_10867135 3300031824 Bacteria 764
657 Ga0307410_10033029 3300031852 Bacteria 3337
658 Ga0307406_10000530 3300031901 Bacteria 21943
659 Ga0307406_10001271 3300031901 Bacteria 14130
660 Ga0307406_10004428 3300031901 Bacteria 7643
661 Ga0307407_10050490 3300031903 Bacteria 2380
662 Ga0307407_10090915 3300031903 Bacteria 1870
663 Ga0307412_10019028 3300031911 Bacteria 4147
664 Ga0307412_10047156 3300031911 Bacteria 2828
665 Ga0307412_10135786 3300031911 Bacteria 1794
666 Ga0307412_10460129 3300031911 Bacteria 1050
667 Ga0307409_100016120 3300031995 Bacteria 4933
668 Ga0307416_100010204 3300032002 Bacteria 6193
669 Ga0307416_100010649 3300032002 Bacteria 6089
670 Ga0307416_100351229 3300032002 Bacteria 1492
671 Ga0307414_10043576 3300032004 Bacteria 3058
672 Ga0307414_10102929 3300032004 Bacteria 2153
673 Ga0307414_10293112 3300032004 Bacteria 1372
674 Ga0307411_10001196 3300032005 Bacteria 10269
675 Ga0307415_100008780 3300032126 Bacteria 5624
676 Ga0373948_0053336 3300034817 Bacteria 873
677 Ga0395899_0000035 3300037312 Bacteria 295584
678 Ga0395899_0097458 3300037312 Bacteria 2126
679 Ga0395899_0309102 3300037312 Bacteria 1068
680 Ga0395900_0000113 3300037418 Bacteria 139979
681 Ga0395900_0003027 3300037418 Bacteria 18294
682 Ga0395900_0017077 3300037418 Bacteria 7408
683 Ga0395900_0039514 3300037418 Bacteria 4862
684 Ga0395900_0078296 3300037418 Bacteria 3397
685 Ga0395900_0087484 3300037418 Bacteria 3202
686 Ga0395900_0402185 3300037418 Bacteria 1333
687 Ga0395898_0000254 3300037466 Bacteria 131247
688 Ga0395898_0000444 3300037466 Bacteria 85520
689 Ga0395898_0002993 3300037466 Bacteria 19184
690 Ga0395898_0188758 3300037466 Bacteria 1969
691 Ga0395898_0377900 3300037466 Bacteria 1351
692 Ga0395905_0197938 3300037471 Bacteria 1884
693 Ga0395905_0198135 3300037471 Bacteria 1883
694 Ga0395905_1115185 3300037471 Bacteria 692
695 Ga0395901_0000009 3300038443 Bacteria 479396
696 Ga0395901_0000302 3300038443 Bacteria 61152
697 Ga0395901_0026100 3300038443 Bacteria 5998
698 Ga0395901_0032650 3300038443 Bacteria 5369
699 Ga0395901_0144831 3300038443 Bacteria 2498
700 Ga0395901_0308651 3300038443 Bacteria 1639
701 Ga0436361_0834992 3300039447 Bacteria 23798
702 Ga0439436_0002289 3300041404 Bacteria 5737
703 Ga0439438_043902 3300041405 Bacteria 1153
704 Ga0439439_0008993 3300041406 Bacteria 2368
705 Ga0439439_0049299 3300041406 Bacteria 1102
706 Ga0439466_0081898 3300041411 Bacteria 1017
707 Ga0439466_0107144 3300041411 Bacteria 868
708 Ga0439431_0016108 3300041997 Bacteria 1746
709 Ga0439448_0170772 3300042005 Bacteria 758
710 Ga0439432_020286 3300042006 Bacteria 2211
711 Ga0439449_0000091 3300042007 Bacteria 29348
712 Ga0439449_0001822 3300042007 Bacteria 8383
713 Ga0439452_043402 3300042010 Bacteria 1052
714 Ga0439462_0001751 3300042015 Bacteria 4909
715 Ga0439462_0002942 3300042015 Bacteria 4035
716 Ga0439462_0063207 3300042015 Bacteria 1002
717 Ga0439462_0136483 3300042015 Bacteria 686
718 Ga0450911_000225 3300042115 Bacteria 21810
719 Ga0450911_014977 3300042115 Bacteria 1028
720 Ga0450920_006489 3300042122 Bacteria 2106
721 Ga0450923_007891 3300042125 Bacteria 1816
722 Ga0450923_026559 3300042125 Bacteria 1160
723 Ga0450897_019183 3300042128 Bacteria 722
724 Ga0450891_009863 3300042129 Bacteria 880
725 Ga0450894_006910 3300042131 Bacteria 1462
726 Ga0450898_049360 3300042134 Bacteria 811
727 Ga0450902_051631 3300042137 Bacteria 706
728 Ga0450903_011050 3300042138 Bacteria 1457
729 Ga0450906_035608 3300042145 Bacteria 878
730 Ga0439446_0004975 3300042156 Bacteria 3398
731 Ga0439446_0020533 3300042156 Bacteria 1862
732 Ga0439446_0074031 3300042156 Bacteria 1046
733 Ga0439458_0089039 3300042157 Bacteria 793
734 Ga0439458_0172519 3300042157 Bacteria 585
735 Ga0450909_005967 3300042185 Bacteria 1759
736 Ga0439434_0015977 3300042435 Bacteria 2241
737 Ga0439434_0074192 3300042435 Bacteria 1074
738 Ga0439435_0033244 3300042436 Bacteria 1411
739 Ga0439435_0121905 3300042436 Bacteria 817
740 Ga0439459_0021413 3300042438 Bacteria 1241
741 Ga0439459_0174293 3300042438 Bacteria 575
742 Ga0439464_0007334 3300042439 Bacteria 2882
743 Ga0439464_0161633 3300042439 Bacteria 704
744 Ga0439464_0251902 3300042439 Bacteria 570
745 Ga0450893_0032267 3300042532 Bacteria 937
746 Ga0451577_0984295 3300042876 Bacteria 758
747 Ga0466986_0231794 3300044650 Bacteria 1192
748 Ga0466969_0001266 3300044656 Bacteria 13617
749 Ga0466969_0058166 3300044656 Bacteria 1882
750 Ga0466969_0257838 3300044656 Bacteria 790
751 Ga0466972_0001179 3300044658 Bacteria 12540
752 Ga0466982_0564883 3300044672 Bacteria 572
753 Ga0466965_0047726 3300044683 Bacteria 2120
754 Ga0466966_0000043 3300044684 Bacteria 93998
755 Ga0466966_0000309 3300044684 Bacteria 31554
756 Ga0466966_0029640 3300044684 Bacteria 3558
757 Ga0466966_0069877 3300044684 Bacteria 2202
758 Ga0466966_0209084 3300044684 Bacteria 1179
759 Ga0466961_0000026 3300044693 Bacteria 92667
760 Ga0466961_0000383 3300044693 Bacteria 28540
761 Ga0466961_0001377 3300044693 Bacteria 15025
762 Ga0466961_0014187 3300044693 Bacteria 5113
763 Ga0466961_0126232 3300044693 Bacteria 1605
764 Ga0466963_0000484 3300044694 Bacteria 18542
765 Ga0466963_0031544 3300044694 Bacteria 3427
766 Ga0466964_0233160 3300044706 Bacteria 899
767 Ga0466971_0005125 3300044719 Bacteria 5675
768 Ga0466971_0008279 3300044719 Bacteria 4536
769 Ga0466971_0020938 3300044719 Bacteria 2907
770 Ga0466971_0023300 3300044719 Bacteria 2759
771 Ga0466970_0000060 3300044765 Bacteria 42753
772 Ga0466970_0006300 3300044765 Bacteria 5926
773 Ga0466970_0156797 3300044765 Bacteria 1258
774 Ga0466957_0003198 3300044842 Bacteria 8950
775 Ga0466957_0006531 3300044842 Bacteria 6586
776 Ga0466957_0044637 3300044842 Bacteria 2686
777 Ga0466957_0458910 3300044842 Bacteria 879
778 Ga0466959_0000129 3300045049 Bacteria 48753
779 Ga0466959_0013198 3300045049 Bacteria 5985
780 Ga0466959_0013429 3300045049 Bacteria 5935
781 Ga0466959_0114717 3300045049 Bacteria 1919
782 Ga0466959_0551113 3300045049 Bacteria 778
783 Ga0451576_0086095 3300045051 Bacteria 3268
784 Ga0466958_0003437 3300045836 Bacteria 8217
785 Ga0466958_0030082 3300045836 Bacteria 3222
786 Ga0466958_0228778 3300045836 Bacteria 1187
787 Ga0466967_0002547 3300045976 Bacteria 11424
788 Ga0466967_0103605 3300045976 Bacteria 2604
789 Ga0466967_0730741 3300045976 Bacteria 981
790 Ga0495592_0087784 3300046454 Bacteria 2236
791 Ga0495603_0006343 3300046455 Bacteria 7074
792 Ga0495603_0041414 3300046455 Bacteria 2754
793 Ga0495603_0313690 3300046455 Bacteria 900
794 Ga0495590_0001136 3300046457 Bacteria 11652
795 Ga0495590_0001242 3300046457 Bacteria 11107
796 Ga0495591_121300 3300046458 Bacteria 638
797 Ga0495629_0000517 3300046459 Bacteria 32307
798 Ga0495629_0000586 3300046459 Bacteria 29559
799 Ga0495629_0001679 3300046459 Bacteria 17381
800 Ga0495629_0060857 3300046459 Bacteria 2638
801 Ga0495629_0429509 3300046459 Bacteria 896
802 Ga0495629_0552036 3300046459 Bacteria 773
803 Ga0495638_0006568 3300046460 Bacteria 8458
804 Ga0495641_0012345 3300046461 Bacteria 4787
805 Ga0495651_0013214 3300046462 Bacteria 6383
806 Ga0495653_0032148 3300046463 Bacteria 4169
807 Ga0495653_0064837 3300046463 Bacteria 2751
808 Ga0495653_0110614 3300046463 Bacteria 1974
809 Ga0495653_0145368 3300046463 Bacteria 1662
810 Ga0495653_0154177 3300046463 Bacteria 1602
811 Ga0495650_0011835 3300046471 Bacteria 4739
812 Ga0495650_0060376 3300046471 Bacteria 1523
813 Ga0495580_0000142 3300046472 Bacteria 51382
814 Ga0495580_0000495 3300046472 Bacteria 32967
815 Ga0495580_0007425 3300046472 Bacteria 8811
816 Ga0495580_0034264 3300046472 Bacteria 3656
817 Ga0495580_0099569 3300046472 Bacteria 2022
818 Ga0495580_0141534 3300046472 Bacteria 1667
819 Ga0495580_0201356 3300046472 Bacteria 1371
820 Ga0495580_0245885 3300046472 Bacteria 1225
821 Ga0495580_0290474 3300046472 Bacteria 1114
822 Ga0495582_0015769 3300046473 Bacteria 4144
823 Ga0495582_0019877 3300046473 Bacteria 3673
824 Ga0495582_0114894 3300046473 Bacteria 1513
825 Ga0495605_0085722 3300046474 Bacteria 1466
826 Ga0495662_0048379 3300046476 Bacteria 2053
827 Ga0495664_0000149 3300046477 Bacteria 35104
828 Ga0495664_0006570 3300046477 Bacteria 6426
829 Ga0495664_0013453 3300046477 Bacteria 4640
830 Ga0495664_0624366 3300046477 Bacteria 639
831 Ga0495596_0030259 3300046500 Bacteria 2168
832 Ga0495596_0180299 3300046500 Bacteria 821
833 Ga0495607_0325571 3300046501 Bacteria 716
834 Ga0495583_0002966 3300046506 Bacteria 13618
835 Ga0495583_0040051 3300046506 Bacteria 2203
836 Ga0495606_0008201 3300046507 Bacteria 9138
837 Ga0495606_0055462 3300046507 Bacteria 2563
838 Ga0495606_0062041 3300046507 Bacteria 2388
839 Ga0495610_0014119 3300046512 Bacteria 4711
840 Ga0495616_0002706 3300046513 Bacteria 11619
841 Ga0495616_0083202 3300046513 Bacteria 1527
842 Ga0495618_0012638 3300046514 Bacteria 5128
843 Ga0495618_0075319 3300046514 Bacteria 2149
844 Ga0495620_0007723 3300046515 Bacteria 5812
845 Ga0495628_0019740 3300046516 Bacteria 5568
846 Ga0495628_0032491 3300046516 Bacteria 4213
847 Ga0495628_0047551 3300046516 Bacteria 3403
848 Ga0495628_0122346 3300046516 Bacteria 1995
849 Ga0495628_0162264 3300046516 Bacteria 1698
850 Ga0495628_0288253 3300046516 Bacteria 1217
851 Ga0495628_0535227 3300046516 Bacteria 842
852 Ga0495630_0020639 3300046517 Bacteria 4858
853 Ga0495630_0028929 3300046517 Bacteria 4118
854 Ga0495630_0083495 3300046517 Bacteria 2411
855 Ga0495630_0733761 3300046517 Bacteria 755
856 Ga0495631_0000007 3300046518 Bacteria 130158
857 Ga0495637_0155607 3300046520 Bacteria 860
858 Ga0495643_0000261 3300046522 Bacteria 77011
859 Ga0495648_0003737 3300046524 Bacteria 13267
860 Ga0495648_0007144 3300046524 Bacteria 8978
861 Ga0495648_0007593 3300046524 Bacteria 8660
862 Ga0495648_0024057 3300046524 Bacteria 4157
863 Ga0495648_0094444 3300046524 Bacteria 1665
864 Ga0495648_0389674 3300046524 Bacteria 626
865 Ga0495666_0001598 3300046526 Bacteria 11153
866 Ga0495666_0075413 3300046526 Bacteria 1599
867 Ga0495642_0007805 3300046528 Bacteria 4101
868 Ga0495652_0008580 3300046529 Bacteria 9319
869 Ga0495652_0010563 3300046529 Bacteria 8366
870 Ga0495652_0039526 3300046529 Bacteria 4079
871 Ga0495652_0072702 3300046529 Bacteria 2865
872 Ga0495652_0513060 3300046529 Bacteria 829
873 Ga0495665_0006558 3300046531 Bacteria 6285
874 Ga0495665_0096230 3300046531 Bacteria 1555
875 Ga0495665_0225943 3300046531 Bacteria 967
876 Ga0495665_0440500 3300046531 Bacteria 659
877 Ga0495665_0524614 3300046531 Bacteria 595
878 Ga0495640_0009773 3300046533 Bacteria 7453
879 Ga0495640_0031297 3300046533 Bacteria 3799
880 Ga0495586_0034012 3300046535 Bacteria 2736
881 Ga0495586_0196004 3300046535 Bacteria 1144
882 Ga0495587_0001137 3300046536 Bacteria 17418
883 Ga0495597_0100199 3300046542 Bacteria 1222
884 Ga0495645_0005083 3300046543 Bacteria 9014
885 Ga0495645_0023662 3300046543 Bacteria 4450
886 Ga0495645_0307709 3300046543 Bacteria 1033
887 Ga0495645_0510483 3300046543 Bacteria 750
888 Ga0495668_0032056 3300046616 Bacteria 2959
889 Ga0495634_0002825 3300046642 Bacteria 14255
890 Ga0495634_0076659 3300046642 Bacteria 2194
891 Ga0495625_0000056 3300046660 Bacteria 186024
892 Ga0495625_0156761 3300046660 Bacteria 1527
893 Ga0495635_0000635 3300046663 Bacteria 22541
894 Ga0495635_0814476 3300046663 Bacteria 601
895 Ga0495635_0992851 3300046663 Bacteria 534
896 Ga0495588_0015467 3300046674 Bacteria 3673
897 Ga0495588_0218424 3300046674 Bacteria 1006
898 Ga0495599_0010543 3300046678 Bacteria 5655
899 Ga0495599_0092709 3300046678 Bacteria 1884
900 Ga0495623_0043618 3300046679 Bacteria 2853
901 Ga0495623_0095104 3300046679 Bacteria 1821
902 Ga0495623_0132150 3300046679 Bacteria 1493
903 Ga0495623_0599511 3300046679 Bacteria 572
904 Ga0495646_0002054 3300046680 Bacteria 12208
905 Ga0495646_0087347 3300046680 Bacteria 1807
906 Ga0495646_0167769 3300046680 Bacteria 1211
907 Ga0495646_0223546 3300046680 Bacteria 1017
908 Ga0495646_0563475 3300046680 Bacteria 581
909 Ga0495613_0006353 3300046689 Bacteria 8838
910 Ga0495624_0000416 3300046690 Bacteria 33753
911 Ga0495624_0011083 3300046690 Bacteria 6204
912 Ga0495624_0031482 3300046690 Bacteria 3447
913 Ga0495624_0216162 3300046690 Bacteria 1162
914 Ga0495624_0485495 3300046690 Bacteria 739
915 Ga0495670_0084782 3300046691 Bacteria 1617
916 Ga0495671_0011589 3300046692 Bacteria 4845
917 Ga0495649_0006208 3300046694 Bacteria 7459
918 Ga0495649_0008319 3300046694 Bacteria 6246
919 Ga0495649_0038208 3300046694 Bacteria 2635
920 Ga0495649_0178661 3300046694 Bacteria 1108
921 Ga0495649_0264115 3300046694 Bacteria 882
922 Ga0495589_0519939 3300046794 Bacteria 543
923 Ga0495600_0227112 3300046809 Bacteria 1193
924 Ga0495660_0090964 3300046810 Bacteria 1586
925 Ga0495660_0135472 3300046810 Bacteria 1231
926 Ga0495581_0002468 3300047315 Bacteria 10463
927 Ga0495581_0024077 3300047315 Bacteria 3527
928 Ga0495604_0003914 3300047317 Bacteria 11856
929 Ga0495604_0011020 3300047317 Bacteria 7175
930 Ga0495604_0014111 3300047317 Bacteria 6370
931 Ga0495604_0056243 3300047317 Bacteria 3029
932 Ga0495604_0332872 3300047317 Bacteria 1012
933 Ga0495674_0007725 3300047319 Bacteria 10271
934 Ga0495674_0010470 3300047319 Bacteria 8779
935 Ga0495674_0014141 3300047319 Bacteria 7476
936 Ga0495674_0017052 3300047319 Bacteria 6766
937 Ga0495674_0116308 3300047319 Bacteria 2262
938 Ga0495674_0126356 3300047319 Bacteria 2157
939 Ga0495674_0818369 3300047319 Bacteria 723
940 Ga0495672_0006413 3300047320 Bacteria 9126
941 Ga0495672_0016206 3300047320 Bacteria 5034
942 Ga0495672_0025309 3300047320 Bacteria 3802
943 Ga0495672_0167347 3300047320 Bacteria 1124
944 Ga0495676_0009149 3300047321 Bacteria 9030
945 Ga0495676_0059065 3300047321 Bacteria 3014
946 Ga0495676_0212051 3300047321 Bacteria 1339
947 Ga0495676_0257393 3300047321 Bacteria 1188
948 Ga0495680_0009118 3300047322 Bacteria 8955
949 Ga0495680_0098131 3300047322 Bacteria 2186
950 Ga0495680_0146979 3300047322 Bacteria 1721
951 Ga0495680_0317619 3300047322 Bacteria 1090
952 Ga0495680_0400765 3300047322 Bacteria 947
953 Ga0495683_0000483 3300047323 Bacteria 30928
954 Ga0495683_0003326 3300047323 Bacteria 9400
955 Ga0495683_0018608 3300047323 Bacteria 3588
956 Ga0495683_0040476 3300047323 Bacteria 2354
957 Ga0495683_0152303 3300047323 Bacteria 1075
958 Ga0495687_000207 3300047443 Bacteria 84210
959 Ga0495687_010068 3300047443 Bacteria 5217
960 Ga0495687_085518 3300047443 Bacteria 1222
961 Ga0495687_163490 3300047443 Bacteria 745
962 Ga0495675_0007904 3300047444 Bacteria 6571
963 Ga0495675_0089483 3300047444 Bacteria 1932
964 Ga0495675_0240245 3300047444 Bacteria 1090
965 Ga0495677_0147119 3300047445 Bacteria 906
966 Ga0495679_000103 3300047446 Bacteria 76165
967 Ga0495679_003183 3300047446 Bacteria 8002
968 Ga0495679_024465 3300047446 Bacteria 2034
969 Ga0495673_0089393 3300047469 Bacteria 1261
970 Ga0495673_0175641 3300047469 Bacteria 814
971 Ga0495681_0019317 3300047470 Bacteria 3726
972 Ga0495593_0007253 3300047673 Bacteria 6495
973 Ga0495593_0012829 3300047673 Bacteria 4786
974 Ga0495593_0016859 3300047673 Bacteria 4112
975 Ga0495593_0031481 3300047673 Bacteria 2897
976 Ga0495593_0040623 3300047673 Bacteria 2504
977 Ga0495602_0011434 3300048088 Bacteria 9180
978 Ga0495602_0017599 3300048088 Bacteria 7160
979 Ga0495602_0038320 3300048088 Bacteria 4434
980 Ga0495602_0245692 3300048088 Bacteria 1336
981 Ga0495602_0436685 3300048088 Bacteria 926
982 Ga0495602_0473077 3300048088 Bacteria 880
983 Ga0495614_0015565 3300048089 Bacteria 3315
984 Ga0495626_0005595 3300048091 Bacteria 7287
985 Ga0495626_0009926 3300048091 Bacteria 5117
986 Ga0496100_0002550 3300048903 Bacteria 9281
987 Ga0496100_0101416 3300048903 Bacteria 1984
988 Ga0496101_0002228 3300048904 Bacteria 11847
989 Ga0496101_0019182 3300048904 Bacteria 4664
990 Ga0496101_0269745 3300048904 Bacteria 1328
991 Ga0496102_0000247 3300048905 Bacteria 70783
992 Ga0496102_0011536 3300048905 Bacteria 7623
993 Ga0496102_0357330 3300048905 Bacteria 1375
994 Ga0496102_0765825 3300048905 Bacteria 888
995 Ga0496103_0000278 3300048906 Bacteria 48336
996 Ga0496103_0004113 3300048906 Bacteria 8833
997 Ga0496103_0674933 3300048906 Bacteria 656
998 Ga0496104_0012686 3300048907 Bacteria 7589
999 Ga0496104_0442682 3300048907 Bacteria 1211
1000 Ga0496104_0841253 3300048907 Bacteria 823
1001 Ga0496105_0193414 3300048908 Bacteria 1663
1002 Ga0496105_0333670 3300048908 Bacteria 1213
1003 Ga0496106_0034656 3300048909 Bacteria 3771
1004 Ga0496106_0339206 3300048909 Bacteria 1207
1005 Ga0496107_0007427 3300048910 Bacteria 7557
1006 Ga0496107_0129345 3300048910 Bacteria 1864
1007 Ga0496108_0220724 3300048911 Bacteria 1647
1008 Ga0496108_0726060 3300048911 Bacteria 860
1009 Ga0496108_0767753 3300048911 Bacteria 833
1010 Ga0496109_0156865 3300048912 Bacteria 2132
1011 Ga0496109_0253568 3300048912 Bacteria 1657
1012 Ga0496109_1580520 3300048912 Bacteria 590
1013 Ga0496110_0033465 3300048913 Bacteria 4446
1014 Ga0496110_0855295 3300048913 Bacteria 815
1015 Ga0496111_0097044 3300048914 Bacteria 2163
1016 Ga0496112_0049701 3300048915 Bacteria 4110
1017 Ga0496112_0969349 3300048915 Bacteria 771
1018 Ga0496112_1626283 3300048915 Bacteria 559
1019 Ga0496113_0004854 3300048916 Bacteria 8324
1020 Ga0496113_0247667 3300048916 Bacteria 1422
1021 Ga0496113_0877810 3300048916 Bacteria 710
1022 Ga0496114_0049041 3300048917 Bacteria 3513
1023 Ga0496114_0921698 3300048917 Bacteria 755
1024 Ga0496116_0067882 3300048919 Bacteria 2275
1025 Ga0496116_0077471 3300048919 Bacteria 2077
1026 Ga0496116_0210565 3300048919 Bacteria 1008
1027 Ga0496116_0261687 3300048919 Bacteria 852
1028 Ga0496117_0000445 3300048920 Bacteria 68610
1029 Ga0496117_0018250 3300048920 Bacteria 5822
1030 Ga0496117_0028196 3300048920 Bacteria 4352
1031 Ga0496117_0077015 3300048920 Bacteria 2208
1032 Ga0496117_0142136 3300048920 Bacteria 1435
1033 Ga0496118_0000138 3300048921 Bacteria 128826
1034 Ga0496118_0038446 3300048921 Bacteria 3835
1035 Ga0496118_0064386 3300048921 Bacteria 2690
1036 Ga0496118_0088277 3300048921 Bacteria 2145
1037 Ga0496118_0201297 3300048921 Bacteria 1179
1038 Ga0496118_0283728 3300048921 Bacteria 920
1039 Ga0496118_0319804 3300048921 Bacteria 842
1040 Ga0496121_0001530 3300048924 Bacteria 38696
1041 Ga0496121_0007122 3300048924 Bacteria 13575
1042 Ga0496121_0009428 3300048924 Bacteria 11220
1043 Ga0496121_0019431 3300048924 Bacteria 6793
1044 Ga0496121_0200367 3300048924 Bacteria 1423
1045 Ga0496122_0037608 3300048925 Bacteria 3893
1046 Ga0496122_0096052 3300048925 Bacteria 2000
1047 Ga0496122_0097709 3300048925 Bacteria 1975
1048 Ga0496122_0107920 3300048925 Bacteria 1838
1049 Ga0496122_0125380 3300048925 Bacteria 1645
1050 Ga0496123_0061360 3300048926 Bacteria 2416
1051 Ga0496123_0085045 3300048926 Bacteria 1905
1052 Ga0496123_0167325 3300048926 Bacteria 1164
1053 Ga0496123_0489792 3300048926 Bacteria 539
1054 Ga0496124_0019236 3300048927 Bacteria 6365
1055 Ga0496124_0109845 3300048927 Bacteria 2221
1056 Ga0496124_0135768 3300048927 Bacteria 1948
1057 Ga0496124_0199425 3300048927 Bacteria 1523
1058 Ga0496124_0397733 3300048927 Bacteria 957
1059 Ga0496125_0010667 3300048928 Bacteria 9276
1060 Ga0496125_0018669 3300048928 Bacteria 6578
1061 Ga0496125_0152093 3300048928 Bacteria 1587
1062 Ga0496126_0001647 3300048929 Bacteria 33697
1063 Ga0496126_0116341 3300048929 Bacteria 2324
1064 Ga0496126_0198850 3300048929 Bacteria 1694
1065 Ga0501309_017261 3300049129 Bacteria 990
1066 Ga0495678_043424 3300049459 Bacteria 1785
1067 Ga0495682_0000254 3300049460 Bacteria 42240
1068 Ga0495682_0003881 3300049460 Bacteria 6538
1069 Ga0495682_0030071 3300049460 Bacteria 2010
1070 Ga0495682_0049284 3300049460 Bacteria 1534
1071 Ga0501292_060251 3300049515 Bacteria 687
1072 Ga0501294_024554 3300049517 Bacteria 672
1073 Ga0501034_0000003 3300049571 Bacteria 471748
1074 Ga0501046_1138357 3300049580 Bacteria 538
1075 Ga0501048_0582599 3300049582 Bacteria 803
1076 Ga0501072_0224223 3300049588 Bacteria 1498
1077 Ga0501206_000487 3300049653 Bacteria 4790
1078 Ga0501207_075224 3300049654 Bacteria 641
1079 Ga0501262_010025 3300049759 Bacteria 1180
1080 Ga0501265_003053 3300049762 Bacteria 1903
1081 nmdc:mga03683_26699_c1 3300050489 Bacteria 2280
1082 nmdc:mga03683_545_c1 3300050489 Bacteria 10807
1083 nmdc:mga03683_6134_c1 3300050489 Bacteria 4101
1084 nmdc:mga03n38_29907_c1 3300050490 Bacteria 2285
1085 nmdc:mga03n38_4827_c1 3300050490 Bacteria 4516
1086 nmdc:mga03n38_9667_c1 3300050490 Bacteria 3516
1087 nmdc:mga00v17_14264_c1 3300050491 Bacteria 4431
1088 nmdc:mga00v17_1957_c1 3300050491 Bacteria 10639
1089 nmdc:mga00v17_620390_c1 3300050491 Bacteria 696
1090 nmdc:mga0yw44_5595_c1 3300050492 Bacteria 5969
1091 nmdc:mga0yw44_822_c1 3300050492 Bacteria 11590
1092 nmdc:mga0k408_11610_c1 3300050493 Bacteria 4801
1093 nmdc:mga0k408_1313_c1 3300050493 Bacteria 13430
1094 nmdc:mga0k408_18508_c1 3300050493 Bacteria 3888
1095 nmdc:mga0k408_36108_c1 3300050493 Bacteria 2836
1096 nmdc:mga0k408_40895_c1 3300050493 Bacteria 2669
1097 nmdc:mga0k408_637108_c1 3300050493 Bacteria 627
1098 nmdc:mga06z11_1020_c1 3300050494 Bacteria 10220
1099 nmdc:mga06z11_267741_c1 3300050494 Bacteria 1010
1100 nmdc:mga06z11_80647_c1 3300050494 Bacteria 1745
1101 nmdc:mga04h51_135699_c1 3300050495 Bacteria 929
1102 nmdc:mga04h51_173348_c1 3300050495 Bacteria 836
1103 nmdc:mga04h51_1956_c1 3300050495 Bacteria 4802
1104 nmdc:mga07m45_1263_c1 3300050496 Bacteria 11509
1105 nmdc:mga07m45_26187_c1 3300050496 Bacteria 3204
1106 nmdc:mga07m45_570823_c1 3300050496 Bacteria 654
1107 nmdc:mga07m45_82856_c1 3300050496 Bacteria 1832
1108 nmdc:mga07m45_9583_c1 3300050496 Bacteria 5031
1109 nmdc:mga07m45_98435_c1 3300050496 Bacteria 1679
1110 nmdc:mga06r32_1022248_c1 3300050510 Bacteria 778
1111 nmdc:mga0n895_445597_c1 3300050512 Bacteria 1307
1112 nmdc:mga0sz30_7217_c1 3300050516 Bacteria 4162
1113 Ga0500643_013144 3300053087 Bacteria 2936
1114 Ga0500651_0000957 3300053093 Bacteria 14201
1115 Ga0500566_0142346 3300053094 Bacteria 1271
1116 Ga0500660_054333 3300053100 Bacteria 1964
1117 Ga0500571_000024 3300053110 Bacteria 52195
1118 Ga0500592_008481 3300053116 Bacteria 1630
1119 Ga0500608_001647 3300053122 Bacteria 8021
1120 Ga0500618_031463 3300053125 Bacteria 1244
1121 Ga0500559_0027986 3300053136 Bacteria 2406
1122 Ga0500559_0096536 3300053136 Bacteria 1358
1123 Ga0500564_068558 3300053138 Bacteria 1602
1124 Ga0500568_0003259 3300053139 Bacteria 9165
1125 Ga0500574_007237 3300053141 Bacteria 2288
1126 Ga0500619_193608 3300053154 Bacteria 684
1127 Ga0500638_004803 3300053162 Bacteria 5284
1128 Ga0500636_0153160 3300053177 Bacteria 1264
1129 Ga0500565_022799 3300053734 Bacteria 768
1130 Ga0587084_001920 3300059477 Bacteria 2067
1131 Ga0587084_003128 3300059477 Bacteria 1792
1132 Ga0587084_040228 3300059477 Bacteria 791
1133 Ga0587083_0016341 3300059505 Bacteria 1312
1134 Ga0587090_001520 3300059510 Bacteria 2371
1135 Ga0587090_002110 3300059510 Bacteria 2138
1136 Ga0587090_007688 3300059510 Bacteria 1423
1137 Ga0587090_017945 3300059510 Bacteria 1076
1138 Ga0587094_019363 3300059513 Bacteria 976
1139 Ga0587101_018139 3300059623 Bacteria 983
1140 Ga0587067_008178 3300059640 Bacteria 1520
1141 Ga0587068_008866 3300059641 Bacteria 1469
1142 Ga0587068_024858 3300059641 Bacteria 1006
1143 Ga0587072_011558 3300059643 Bacteria 1446
1144 Ga0587076_012201 3300059645 Bacteria 1279
1145 Ga0587076_023408 3300059645 Bacteria 1040
1146 Ga0587105_001077 3300059651 Bacteria 1337
1147 Ga0587111_0012970 3300060346 Bacteria 1482
1148 Ga0587111_0020665 3300060346 Bacteria 1262
1149 Ga0587111_0024244 3300060346 Bacteria 1193
1150 Ga0466962_0001661 3300061719 Bacteria 10431
1151 Ga0466962_0004649 3300061719 Bacteria 6594
1152 Ga0466962_0011849 3300061719 Bacteria 4196
1153 2863422838 2863421361 Bacteria 7300805
1154 2904486920 2904483920 Bacteria 7545285
1155 2919528234 2919527303 Bacteria 7718827
1156 2928116997 2928115317 Bacteria 6477646
1157 Ga0055527_1005009
1158 JGI24741J21665_1000084
1159 JGI24740J21852_10000038
1160 JGI24740J21852_10000091
1161 JGI24740J21852_10019260
1162 JGI24740J21852_10065968
1163 JGI24739J22299_10078299
1164 JGI24739J22299_10163337
1165 JGI24737J22298_10010200
1166 JGI24735J21928_10000589
1167 JGI25156J39149_1000006
1168 JGI25156J39149_1000135
1169 JGI25156J39149_1006100
1170 JGI25156J39149_1006124
1171 JGI25156J39149_1006256
1172 JGI25156J39149_1016753
1173 JGI25156J39149_1026051
1174 JGI25154J39366_1000389
1175 JGI25158J39367_1009898
1176 JGI25157J39369_1000016
1177 JGI25150J39212_1002582
1178 JGI25151J46595_10014151
1179 JGI25151J46595_10068449
1180 JGI25151J46595_10086425
1181 JGI25165J46597_1000661
1182 JGI25153J46596_10033361
1183 rootH1_10027942
1184 rootH1_10048720
1185 rootH1_10054218
1186 rootH1_10101357
1187 rootH2_10050565
1188 rootL2_10009476
1189 rootL2_10012388
1190 rootL2_10137787
1191 rootH1_10120212
1192 rootH1_10201936
1193 JGI25160J50197_1000098
1194 JGI25161J50226_1000037
1195 Ga0055539_1000075
1196 Ga0055533_1000140
1197 Ga0055533_1000933
1198 Ga0055532_1000003
1199 Ga0055532_1000056
1200 Ga0055532_1000265
1201 Ga0055532_1005641
1202 Ga0055525_1000492
1203 Ga0055525_1011031
1204 Ga0055527_1000006
1205 Ga0055527_1000323
1206 Ga0055527_1002493
1207 Ga0055527_1006523
1208 Ga0055535_1000003
1209 Ga0055535_1000013
1210 Ga0055535_1000115
1211 Ga0055535_1000134
1212 Ga0055535_1000701
1213 Ga0055542_1000007
1214 Ga0055542_1000028
1215 Ga0055542_1000178
1216 Ga0055542_1000861
1217 Ga0055542_1002118
1218 Ga0055529_1000003
1219 Ga0055529_1000074
1220 Ga0055529_1000203
1221 Ga0055526_1000184
1222 Ga0055537_1000006
1223 Ga0055537_1007555
1224 Ga0055524_1000032
1225 Ga0055536_1005877
1226 Ga0055536_1007682
1227 Ga0055534_1004608
1228 Ga0055534_1007435
1229 Ga0055528_1002844
1230 Ga0055528_1003256
1231 Ga0055528_1016487
1232 Ga0055530_10000380
1233 Ga0055530_10000731
1234 Ga0055530_10000890
1235 Ga0055530_10003806
1236 Ga0055540_1000046
1237 Ga0055540_1001790
1238 Ga0055540_1002356
1239 Ga0055540_1019493
1240 Ga0055531_10000084
1241 Ga0055531_10003007
1242 Ga0055541_1000425
1243 Ga0055541_1002842
1244 Ga0058692_1008655
1245 Ga0055543_1000645
1246 Ga0065165_1000821
1247 Ga0065165_1022462
1248 Ga0065165_1022630
1249 Ga0065714_10077745
1250 Ga0065704_10147436
1251 Ga0070658_10027600
1252 Ga0070658_10092842
1253 Ga0070658_10247226
1254 Ga0070658_10483300
1255 Ga0070676_10018812
1256 Ga0070676_10139974
1257 Ga0070676_10149055
1258 Ga0070670_100000540
1259 Ga0070670_100022297
1260 Ga0070670_100068177
1261 Ga0068869_100002271
1262 Ga0068869_101121546
1263 Ga0070666_10074877
1264 Ga0068868_100032080
1265 Ga0070660_100000029
1266 Ga0070660_100015930
1267 Ga0070660_100108727
1268 Ga0070661_100001417
1269 Ga0070661_100052691
1270 Ga0070661_100400221
1271 Ga0070668_100110348
1272 Ga0070669_100020431
1273 Ga0070671_100020456
1274 Ga0070671_100048591
1275 Ga0070674_101228322
1276 Ga0070673_100266969
1277 Ga0070659_100000006
1278 Ga0070659_100000307
1279 Ga0070659_100025930
1280 Ga0070659_100057651
1281 Ga0070667_100005867
1282 Ga0070667_100216118
1283 Ga0070667_100909936
1284 Ga0070705_100168650
1285 Ga0070700_100352045
1286 Ga0070708_100027484
1287 Ga0070663_100000002
1288 Ga0070663_100018810
1289 Ga0070663_100288472
1290 Ga0070663_100293494
1291 Ga0070663_100365164
1292 Ga0070663_100380086
1293 Ga0070663_100398795
1294 Ga0070663_100588954
1295 Ga0070663_100800769
1296 Ga0070678_100359437
1297 Ga0070678_100675304
1298 Ga0070662_100179746
1299 Ga0070662_100205147
1300 Ga0070662_100521362
1301 Ga0070662_100867174
1302 Ga0068867_100058308
1303 Ga0068867_100546421
1304 Ga0070706_100008574
1305 Ga0070706_100765192
1306 Ga0070707_101217524
1307 Ga0070684_100203830
1308 Ga0068853_100024762
1309 Ga0068853_100115482
1310 Ga0068853_100170844
1311 Ga0068853_100603924
1312 Ga0068853_101622124
1313 Ga0070672_100013787
1314 Ga0070672_101234742
1315 Ga0070695_100150446
1316 Ga0070696_100527259
1317 Ga0070693_100101426
1318 Ga0068855_100445628
1319 Ga0068855_100540458
1320 Ga0068855_100830538
1321 Ga0070664_100000004
1322 Ga0070664_100005230
1323 Ga0070664_100076910
1324 Ga0068857_100057826
1325 Ga0068857_100317346
1326 Ga0068857_100334396
1327 Ga0068857_100389899
1328 Ga0068857_101590763
1329 Ga0068854_100000007
1330 Ga0068854_100376402
1331 Ga0068854_101469546
1332 Ga0068856_100000105
1333 Ga0068856_100305768
1334 Ga0068856_100414966
1335 Ga0068856_100712190
1336 Ga0068856_101023881
1337 Ga0068852_100013481
1338 Ga0068852_100017829
1339 Ga0068852_100018858
1340 Ga0068852_100068820
1341 Ga0068852_100142243
1342 Ga0068852_100168530
1343 Ga0068852_101425210
1344 Ga0068859_100057856
1345 Ga0068859_100116942
1346 Ga0068859_100491199
1347 Ga0068859_100632211
1348 Ga0068864_100003727
1349 Ga0068864_100025373
1350 Ga0068861_100006842
1351 Ga0068861_101879197
1352 Ga0068851_10080322
1353 Ga0068851_10121300
1354 Ga0068870_10001893
1355 Ga0068863_100048750
1356 Ga0068863_100085322
1357 Ga0068863_100086430
1358 Ga0068858_100011316
1359 Ga0068858_101576166
1360 Ga0068860_100013006
1361 Ga0068860_100520270
1362 Ga0068862_100028341
1363 Ga0068862_100135585
1364 Ga0081539_10266234
1365 Ga0075365_10001937
1366 Ga0075365_10149154
1367 Ga0075368_10001130
1368 Ga0075368_10204252
1369 Ga0075368_10206456
1370 Ga0075363_100020439
1371 Ga0075363_100185993
1372 Ga0075363_100209451
1373 Ga0075363_100615349
1374 Ga0075364_10005448
1375 Ga0075364_10012743
1376 Ga0075432_10004475
1377 Ga0075362_10001157
1378 Ga0075362_10029335
1379 Ga0075367_10000488
1380 Ga0075367_10094701
1381 Ga0075367_10418751
1382 Ga0075367_10572047
1383 Ga0075369_10001709
1384 Ga0075366_10024831
1385 Ga0075366_10073998
1386 Ga0075366_10088640
1387 Ga0075366_10104313
1388 Ga0075366_10221684
1389 Ga0075366_10308888
1390 Ga0097621_100363184
1391 Ga0075370_10000375
1392 Ga0075370_10000575
1393 Ga0075370_10023715
1394 Ga0075370_10039542
1395 Ga0075370_10060742
1396 Ga0068871_101061949
1397 Ga0075428_100027331
1398 Ga0075431_101080908
1399 Ga0075434_100283591
1400 Ga0097620_100057853
1401 Ga0097620_100116928
1402 Ga0097620_100491111
1403 Ga0097620_100632069
1404 Ga0079104_1038669
1405 Ga0075435_100833826
1406 Ga0105251_10000005
1407 Ga0105251_10000427
1408 Ga0105251_10003188
1409 Ga0105244_10012387
1410 Ga0105244_10023604
1411 Ga0105244_10060514
1412 Ga0105244_10282175
1413 Ga0105250_10030058
1414 Ga0105250_10192633
1415 Ga0105240_10004916
1416 Ga0105240_10006257
1417 Ga0105240_10060318
1418 Ga0105240_10088421
1419 Ga0105240_10101797
1420 Ga0105240_10203394
1421 Ga0105240_10284603
1422 Ga0105240_11165314
1423 Ga0105240_11214318
1424 Ga0105240_11650691
1425 Ga0105245_10014386
1426 Ga0105245_10374711
1427 Ga0105245_11123170
1428 Ga0105247_10034404
1429 Ga0105243_10004528
1430 Ga0105243_10032819
1431 Ga0105243_10165120
1432 Ga0105241_10169198
1433 Ga0105242_10340120
1434 Ga0105242_10567469
1435 Ga0105248_10005602
1436 Ga0105248_10006219
1437 Ga0105248_10011634
1438 Ga0105248_10236846
1439 Ga0105248_10639287
1440 Ga0105248_11017885
1441 Ga0105237_10015527
1442 Ga0105237_10017774
1443 Ga0105237_10141187
1444 Ga0105237_10159765
1445 Ga0105237_10377768
1446 Ga0105238_10014547
1447 Ga0105238_10051201
1448 Ga0105238_10056077
1449 Ga0105238_10671102
1450 Ga0105238_11101693
1451 Ga0105238_11375308
1452 Ga0105238_12195069
1453 Ga0105249_10276877
1454 Ga0105239_10014021
1455 Ga0105239_10103451
1456 Ga0105239_10158456
1457 Ga0157347_1011112
1458 Ga0157373_10004956
1459 Ga0157373_10015931
1460 Ga0157373_10025435
1461 Ga0157373_10261531
1462 Ga0157373_10711698
1463 Ga0157371_10000086
1464 Ga0157371_10000223
1465 Ga0157371_10000986
1466 Ga0157371_10025877
1467 Ga0157371_10082692
1468 Ga0157371_10123211
1469 Ga0157371_10893380
1470 Ga0157370_10000074
1471 Ga0157370_10042603
1472 Ga0157370_10059009
1473 Ga0157370_10113281
1474 Ga0157370_11509944
1475 Ga0157369_10000383
1476 Ga0157369_10001241
1477 Ga0157369_10001440
1478 Ga0157369_10001863
1479 Ga0157369_10039961
1480 Ga0157369_10138605
1481 Ga0157369_10147744
1482 Ga0157369_10165598
1483 Ga0157369_10546899
1484 Ga0157374_10000116
1485 Ga0157374_10009373
1486 Ga0157374_10043751
1487 Ga0157374_10223274
1488 Ga0157378_10010746
1489 Ga0157378_10465018
1490 Ga0163162_10005148
1491 Ga0163162_10043604
1492 Ga0163162_10160493
1493 Ga0163162_10476825
1494 Ga0163162_11008243
1495 Ga0157372_10000085
1496 Ga0157372_10012524
1497 Ga0157372_10166010
1498 Ga0157372_10312934
1499 Ga0157372_10516180
1500 Ga0157375_10007536
1501 Ga0157375_10194238
1502 Ga0163163_10128554
1503 Ga0163163_10574087
1504 Ga0157380_12314693
1505 Ga0182008_10002465
1506 Ga0182008_10002632
1507 Ga0182008_10021729
1508 Ga0182008_10294901
1509 Ga0157379_10021652
1510 Ga0157379_10074906
1511 Ga0182006_1000317
1512 Ga0182006_1002482
1513 Ga0182006_1004530
1514 Ga0182006_1006004
1515 Ga0182006_1007384
1516 Ga0182006_1018543
1517 Ga0182006_1020371
1518 Ga0182006_1091634
1519 Ga0182006_1204321
1520 Ga0182007_10001059
1521 Ga0182007_10012055
1522 Ga0182007_10038048
1523 Ga0182005_1103388
1524 Ga0182005_1118525
1525 Ga0183362_10002
1526 Ga0163161_10000657
1527 Ga0163161_11784556
1528 Ga0154015_1180002
1529 Ga0213872_10003058
1530 Ga0209435_100010
1531 Ga0209435_101521
1532 Ga0209436_104404
1533 Ga0209784_100008
1534 Ga0209784_100829
1535 Ga0209784_101133
1536 Ga0209566_100006
1537 Ga0209566_100354
1538 Ga0209566_100567
1539 Ga0209566_104658
1540 Ga0209674_100025
1541 Ga0209674_100070
1542 Ga0209674_100093
1543 Ga0209674_100120
1544 Ga0209674_101148
1545 Ga0209672_100002
1546 Ga0209672_100044
1547 Ga0209672_100075
1548 Ga0209672_100413
1549 Ga0209672_100982
1550 Ga0209672_101155
1551 Ga0209147_100003
1552 Ga0209147_100005
1553 Ga0209147_100039
1554 Ga0209147_100119
1555 Ga0209147_100176
1556 Ga0209147_101077
1557 Ga0209563_100016
1558 Ga0209563_101301
1559 Ga0209563_102708
1560 Ga0207427_100777
1561 Ga0209258_100005
1562 Ga0209258_100007
1563 Ga0209258_100062
1564 Ga0209258_100067
1565 Ga0209258_100153
1566 Ga0207425_1000434
1567 Ga0207425_1000908
1568 Ga0207425_1001023
1569 Ga0207425_1010792
1570 Ga0209646_1000001
1571 Ga0209646_1000016
1572 Ga0209646_1002708
1573 Ga0209026_1000001
1574 Ga0209026_1001651
1575 Ga0209677_100008
1576 Ga0209148_1000006
1577 Ga0209148_1000051
1578 Ga0209148_1000067
1579 Ga0209148_1000075
1580 Ga0209148_1000728
1581 Ga0209148_1003409
1582 Ga0209759_1000001
1583 Ga0209759_1000002
1584 Ga0209759_1000014
1585 Ga0209759_1000039
1586 Ga0209759_1001110
1587 Ga0209759_1002345
1588 Ga0209759_1006058
1589 Ga0209759_1019604
1590 Ga0209129_1000030
1591 Ga0209129_1019612
1592 Ga0209129_1031627
1593 Ga0209233_1000018
1594 Ga0209233_1051508
1595 Ga0209565_1000016
1596 Ga0209565_1000019
1597 Ga0209565_1001223
1598 Ga0209455_1000003
1599 Ga0209455_1000011
1600 Ga0209455_1000067
1601 Ga0209455_1000221
1602 Ga0209673_1000066
1603 Ga0209673_1000073
1604 Ga0209673_1000095
1605 Ga0209673_1001044
1606 Ga0209130_1000011
1607 Ga0209130_1000141
1608 Ga0209130_1000210
1609 Ga0209130_1004492
1610 Ga0209130_1012453
1611 Ga0209675_1000031
1612 Ga0209675_1000356
1613 Ga0209675_1004844
1614 Ga0209676_1000005
1615 Ga0209676_1000123
1616 Ga0209676_1000165
1617 Ga0209676_1002917
1618 Ga0209676_1020438
1619 Ga0209025_1000078
1620 Ga0209025_1000319
1621 Ga0209025_1001554
1622 Ga0209025_1009510
1623 Ga0209564_1000056
1624 Ga0209564_1000099
1625 Ga0209564_1000165
1626 Ga0209564_1005057
1627 Ga0209564_1010599
1628 Ga0209758_1000037
1629 Ga0209050_1000007
1630 Ga0209050_1000084
1631 Ga0209050_1000188
1632 Ga0209050_1014814
1633 Ga0209256_1000022
1634 Ga0209256_1000043
1635 Ga0209256_1000110
1636 Ga0207426_1000029
1637 Ga0207426_1000103
1638 Ga0207426_1000145
1639 Ga0207426_1000260
1640 Ga0207426_1002451
1641 Ga0207426_1003898
1642 Ga0209051_1000036
1643 Ga0209051_1000058
1644 Ga0209051_1000091
1645 Ga0209051_1000494
1646 Ga0209257_1000011
1647 Ga0209257_1000057
1648 Ga0209257_1000092
1649 Ga0207697_10041147
1650 Ga0207656_10008463
1651 Ga0207656_10046457
1652 Ga0207696_1054182
1653 Ga0207655_1001871
1654 Ga0207655_1023574
1655 Ga0207655_1030654
1656 Ga0207713_1000036
1657 Ga0207713_1002789
1658 Ga0207713_1007353
1659 Ga0207713_1052813
1660 Ga0207680_10060019
1661 Ga0207680_10061690
1662 Ga0207680_10164462
1663 Ga0207647_10009559
1664 Ga0207647_10011061
1665 Ga0207647_10014440
1666 Ga0207647_10042812
1667 Ga0207647_10200988
1668 Ga0207647_10501517
1669 Ga0207645_10031101
1670 Ga0207645_10143331
1671 Ga0207643_10195687
1672 Ga0207705_10084916
1673 Ga0207705_10107081
1674 Ga0207705_10202607
1675 Ga0207684_10609822
1676 Ga0207654_10454470
1677 Ga0207695_10003008
1678 Ga0207695_10003114
1679 Ga0207695_10014899
1680 Ga0207695_10032225
1681 Ga0207695_10159983
1682 Ga0207695_10333238
1683 Ga0207695_10400404
1684 Ga0207695_10595466
1685 Ga0207695_10614241
1686 Ga0207695_10892025
1687 Ga0207671_10043088
1688 Ga0207671_10065133
1689 Ga0207671_10068770
1690 Ga0207671_10343119
1691 Ga0207657_10000072
1692 Ga0207657_10000389
1693 Ga0207657_10319697
1694 Ga0207657_10985322
1695 Ga0207649_10001426
1696 Ga0207646_10715054
1697 Ga0207646_11175496
1698 Ga0207681_10033213
1699 Ga0207681_10139559
1700 Ga0207694_10047952
1701 Ga0207694_10152653
1702 Ga0207694_10677670
1703 Ga0207694_10795689
1704 Ga0207694_10797322
1705 Ga0207694_10951144
1706 Ga0207650_10005387
1707 Ga0207650_10007014
1708 Ga0207650_10088595
1709 Ga0207650_10201358
1710 Ga0207687_10012072
1711 Ga0207644_10007558
1712 Ga0207644_10351277
1713 Ga0207644_11125769
1714 Ga0207690_10000019
1715 Ga0207690_10000722
1716 Ga0207690_10064824
1717 Ga0207690_10095002
1718 Ga0207706_10311127
1719 Ga0207706_10506764
1720 Ga0207706_10534820
1721 Ga0207686_10277216
1722 Ga0207709_10001089
1723 Ga0207709_10012585
1724 Ga0207669_10312672
1725 Ga0207704_11108880
1726 Ga0207691_10071487
1727 Ga0207691_10423659
1728 Ga0207711_10012168
1729 Ga0207711_10015519
1730 Ga0207711_10397875
1731 Ga0207689_10000556
1732 Ga0207689_10091608
1733 Ga0207689_10271241
1734 Ga0207679_10000002
1735 Ga0207679_10026449
1736 Ga0207679_10073814
1737 Ga0207667_10038803
1738 Ga0207667_10066718
1739 Ga0207667_10866813
1740 Ga0207668_10016062
1741 Ga0207668_10017548
1742 Ga0207640_10000101
1743 Ga0207640_10573321
1744 Ga0207658_10006734
1745 Ga0207658_10112736
1746 Ga0207658_10661784
1747 Ga0207677_10010768
1748 Ga0207677_11861798
1749 Ga0207703_10005102
1750 Ga0207703_10876535
1751 Ga0207639_10022579
1752 Ga0207639_10427501
1753 Ga0207678_10000003
1754 Ga0207678_10030675
1755 Ga0207678_10095757
1756 Ga0207678_10358986
1757 Ga0207678_10370686
1758 Ga0207678_10420443
1759 Ga0207702_10000010
1760 Ga0207702_10458938
1761 Ga0207702_10581841
1762 Ga0207702_10957693
1763 Ga0207641_10050978
1764 Ga0207641_10067199
1765 Ga0207641_10420959
1766 Ga0207648_10100100
1767 Ga0207648_10194167
1768 Ga0207648_10232950
1769 Ga0207648_10673350
1770 Ga0207676_10004509
1771 Ga0207676_10237638
1772 Ga0207676_10495173
1773 Ga0207674_10029272
1774 Ga0207674_10245152
1775 Ga0207674_10409664
1776 Ga0207674_10616490
1777 Ga0207675_100000530
1778 Ga0207675_100282899
1779 Ga0207698_10048515
1780 Ga0207698_10057456
1781 Ga0207698_10144329
1782 Ga0207698_10185212
1783 Ga0207698_10313260
1784 Ga0207698_10323557
1785 Ga0209371_1000095
1786 Ga0209371_1000211
1787 Ga0209371_1011309
1788 Ga0209813_10003543
1789 Ga0209813_10089423
1790 Ga0209813_10147751
1791 Ga0207428_10093489
1792 Ga0268266_11486230
1793 Ga0268265_10003468
1794 Ga0268265_10024384
1795 Ga0268265_11730424
1796 Ga0268264_10001980
1797 Ga0307515_10610861
1798 Ga0268256_1000116
1799 Ga0268256_1000319
1800 Ga0268256_1012649
1801 Ga0307408_100000926
1802 Ga0307408_100010117
1803 Ga0307408_100010914
1804 Ga0307408_100017628
1805 Ga0307408_100072377
1806 Ga0307408_100884878
1807 Ga0307514_10017303
1808 Ga0307516_10923911
1809 Ga0307405_10001796
1810 Ga0307405_10180755
1811 Ga0307413_10193441
1812 Ga0307413_10867135
1813 Ga0307410_10033029
1814 Ga0307406_10000530
1815 Ga0307406_10001271
1816 Ga0307406_10004428
1817 Ga0307407_10050490
1818 Ga0307407_10090915
1819 Ga0307412_10019028
1820 Ga0307412_10047156
1821 Ga0307412_10135786
1822 Ga0307412_10460129
1823 Ga0307409_100016120
1824 Ga0307416_100010204
1825 Ga0307416_100010649
1826 Ga0307416_100351229
1827 Ga0307414_10043576
1828 Ga0307414_10102929
1829 Ga0307414_10293112
1830 Ga0307411_10001196
1831 Ga0307415_100008780
1832 Ga0373948_0053336
1833 Ga0395899_0000035
1834 Ga0395899_0097458
1835 Ga0395899_0309102
1836 Ga0395900_0000113
1837 Ga0395900_0003027
1838 Ga0395900_0017077
1839 Ga0395900_0039514
1840 Ga0395900_0078296
1841 Ga0395900_0087484
1842 Ga0395900_0402185
1843 Ga0395898_0000254
1844 Ga0395898_0000444
1845 Ga0395898_0002993
1846 Ga0395898_0188758
1847 Ga0395898_0377900
1848 Ga0395905_0197938
1849 Ga0395905_0198135
1850 Ga0395905_1115185
1851 Ga0395901_0000009
1852 Ga0395901_0000302
1853 Ga0395901_0026100
1854 Ga0395901_0032650
1855 Ga0395901_0144831
1856 Ga0395901_0308651
1857 Ga0436361_0834992
1858 Ga0439436_0002289
1859 Ga0439438_043902
1860 Ga0439439_0008993
1861 Ga0439439_0049299
1862 Ga0439466_0081898
1863 Ga0439466_0107144
1864 Ga0439431_0016108
1865 Ga0439448_0170772
1866 Ga0439432_020286
1867 Ga0439449_0000091
1868 Ga0439449_0001822
1869 Ga0439452_043402
1870 Ga0439462_0001751
1871 Ga0439462_0002942
1872 Ga0439462_0063207
1873 Ga0439462_0136483
1874 Ga0450911_000225
1875 Ga0450911_014977
1876 Ga0450920_006489
1877 Ga0450923_007891
1878 Ga0450923_026559
1879 Ga0450897_019183
1880 Ga0450891_009863
1881 Ga0450894_006910
1882 Ga0450898_049360
1883 Ga0450902_051631
1884 Ga0450903_011050
1885 Ga0450906_035608
1886 Ga0439446_0004975
1887 Ga0439446_0020533
1888 Ga0439446_0074031
1889 Ga0439458_0089039
1890 Ga0439458_0172519
1891 Ga0450909_005967
1892 Ga0439434_0015977
1893 Ga0439434_0074192
1894 Ga0439435_0033244
1895 Ga0439435_0121905
1896 Ga0439459_0021413
1897 Ga0439459_0174293
1898 Ga0439464_0007334
1899 Ga0439464_0161633
1900 Ga0439464_0251902
1901 Ga0450893_0032267
1902 Ga0451577_0984295
1903 Ga0466986_0231794
1904 Ga0466969_0001266
1905 Ga0466969_0058166
1906 Ga0466969_0257838
1907 Ga0466972_0001179
1908 Ga0466982_0564883
1909 Ga0466965_0047726
1910 Ga0466966_0000043
1911 Ga0466966_0000309
1912 Ga0466966_0029640
1913 Ga0466966_0069877
1914 Ga0466966_0209084
1915 Ga0466961_0000026
1916 Ga0466961_0000383
1917 Ga0466961_0001377
1918 Ga0466961_0014187
1919 Ga0466961_0126232
1920 Ga0466963_0000484
1921 Ga0466963_0031544
1922 Ga0466964_0233160
1923 Ga0466971_0005125
1924 Ga0466971_0008279
1925 Ga0466971_0020938
1926 Ga0466971_0023300
1927 Ga0466970_0000060
1928 Ga0466970_0006300
1929 Ga0466970_0156797
1930 Ga0466957_0003198
1931 Ga0466957_0006531
1932 Ga0466957_0044637
1933 Ga0466957_0458910
1934 Ga0466959_0000129
1935 Ga0466959_0013198
1936 Ga0466959_0013429
1937 Ga0466959_0114717
1938 Ga0466959_0551113
1939 Ga0451576_0086095
1940 Ga0466958_0003437
1941 Ga0466958_0030082
1942 Ga0466958_0228778
1943 Ga0466967_0002547
1944 Ga0466967_0103605
1945 Ga0466967_0730741
1946 Ga0495592_0087784
1947 Ga0495603_0006343
1948 Ga0495603_0041414
1949 Ga0495603_0313690
1950 Ga0495590_0001136
1951 Ga0495590_0001242
1952 Ga0495591_121300
1953 Ga0495629_0000517
1954 Ga0495629_0000586
1955 Ga0495629_0001679
1956 Ga0495629_0060857
1957 Ga0495629_0429509
1958 Ga0495629_0552036
1959 Ga0495638_0006568
1960 Ga0495641_0012345
1961 Ga0495651_0013214
1962 Ga0495653_0032148
1963 Ga0495653_0064837
1964 Ga0495653_0110614
1965 Ga0495653_0145368
1966 Ga0495653_0154177
1967 Ga0495650_0011835
1968 Ga0495650_0060376
1969 Ga0495580_0000142
1970 Ga0495580_0000495
1971 Ga0495580_0007425
1972 Ga0495580_0034264
1973 Ga0495580_0099569
1974 Ga0495580_0141534
1975 Ga0495580_0201356
1976 Ga0495580_0245885
1977 Ga0495580_0290474
1978 Ga0495582_0015769
1979 Ga0495582_0019877
1980 Ga0495582_0114894
1981 Ga0495605_0085722
1982 Ga0495662_0048379
1983 Ga0495664_0000149
1984 Ga0495664_0006570
1985 Ga0495664_0013453
1986 Ga0495664_0624366
1987 Ga0495596_0030259
1988 Ga0495596_0180299
1989 Ga0495607_0325571
1990 Ga0495583_0002966
1991 Ga0495583_0040051
1992 Ga0495606_0008201
1993 Ga0495606_0055462
1994 Ga0495606_0062041
1995 Ga0495610_0014119
1996 Ga0495616_0002706
1997 Ga0495616_0083202
1998 Ga0495618_0012638
1999 Ga0495618_0075319
2000 Ga0495620_0007723
2001 Ga0495628_0019740
2002 Ga0495628_0032491
2003 Ga0495628_0047551
2004 Ga0495628_0122346
2005 Ga0495628_0162264
2006 Ga0495628_0288253
2007 Ga0495628_0535227
2008 Ga0495630_0020639
2009 Ga0495630_0028929
2010 Ga0495630_0083495
2011 Ga0495630_0733761
2012 Ga0495631_0000007
2013 Ga0495637_0155607
2014 Ga0495643_0000261
2015 Ga0495648_0003737
2016 Ga0495648_0007144
2017 Ga0495648_0007593
2018 Ga0495648_0024057
2019 Ga0495648_0094444
2020 Ga0495648_0389674
2021 Ga0495666_0001598
2022 Ga0495666_0075413
2023 Ga0495642_0007805
2024 Ga0495652_0008580
2025 Ga0495652_0010563
2026 Ga0495652_0039526
2027 Ga0495652_0072702
2028 Ga0495652_0513060
2029 Ga0495665_0006558
2030 Ga0495665_0096230
2031 Ga0495665_0225943
2032 Ga0495665_0440500
2033 Ga0495665_0524614
2034 Ga0495640_0009773
2035 Ga0495640_0031297
2036 Ga0495586_0034012
2037 Ga0495586_0196004
2038 Ga0495587_0001137
2039 Ga0495597_0100199
2040 Ga0495645_0005083
2041 Ga0495645_0023662
2042 Ga0495645_0307709
2043 Ga0495645_0510483
2044 Ga0495668_0032056
2045 Ga0495634_0002825
2046 Ga0495634_0076659
2047 Ga0495625_0000056
2048 Ga0495625_0156761
2049 Ga0495635_0000635
2050 Ga0495635_0814476
2051 Ga0495635_0992851
2052 Ga0495588_0015467
2053 Ga0495588_0218424
2054 Ga0495599_0010543
2055 Ga0495599_0092709
2056 Ga0495623_0043618
2057 Ga0495623_0095104
2058 Ga0495623_0132150
2059 Ga0495623_0599511
2060 Ga0495646_0002054
2061 Ga0495646_0087347
2062 Ga0495646_0167769
2063 Ga0495646_0223546
2064 Ga0495646_0563475
2065 Ga0495613_0006353
2066 Ga0495624_0000416
2067 Ga0495624_0011083
2068 Ga0495624_0031482
2069 Ga0495624_0216162
2070 Ga0495624_0485495
2071 Ga0495670_0084782
2072 Ga0495671_0011589
2073 Ga0495649_0006208
2074 Ga0495649_0008319
2075 Ga0495649_0038208
2076 Ga0495649_0178661
2077 Ga0495649_0264115
2078 Ga0495589_0519939
2079 Ga0495600_0227112
2080 Ga0495660_0090964
2081 Ga0495660_0135472
2082 Ga0495581_0002468
2083 Ga0495581_0024077
2084 Ga0495604_0003914
2085 Ga0495604_0011020
2086 Ga0495604_0014111
2087 Ga0495604_0056243
2088 Ga0495604_0332872
2089 Ga0495674_0007725
2090 Ga0495674_0010470
2091 Ga0495674_0014141
2092 Ga0495674_0017052
2093 Ga0495674_0116308
2094 Ga0495674_0126356
2095 Ga0495674_0818369
2096 Ga0495672_0006413
2097 Ga0495672_0016206
2098 Ga0495672_0025309
2099 Ga0495672_0167347
2100 Ga0495676_0009149
2101 Ga0495676_0059065
2102 Ga0495676_0212051
2103 Ga0495676_0257393
2104 Ga0495680_0009118
2105 Ga0495680_0098131
2106 Ga0495680_0146979
2107 Ga0495680_0317619
2108 Ga0495680_0400765
2109 Ga0495683_0000483
2110 Ga0495683_0003326
2111 Ga0495683_0018608
2112 Ga0495683_0040476
2113 Ga0495683_0152303
2114 Ga0495687_000207
2115 Ga0495687_010068
2116 Ga0495687_085518
2117 Ga0495687_163490
2118 Ga0495675_0007904
2119 Ga0495675_0089483
2120 Ga0495675_0240245
2121 Ga0495677_0147119
2122 Ga0495679_000103
2123 Ga0495679_003183
2124 Ga0495679_024465
2125 Ga0495673_0089393
2126 Ga0495673_0175641
2127 Ga0495681_0019317
2128 Ga0495593_0007253
2129 Ga0495593_0012829
2130 Ga0495593_0016859
2131 Ga0495593_0031481
2132 Ga0495593_0040623
2133 Ga0495602_0011434
2134 Ga0495602_0017599
2135 Ga0495602_0038320
2136 Ga0495602_0245692
2137 Ga0495602_0436685
2138 Ga0495602_0473077
2139 Ga0495614_0015565
2140 Ga0495626_0005595
2141 Ga0495626_0009926
2142 Ga0496100_0002550
2143 Ga0496100_0101416
2144 Ga0496101_0002228
2145 Ga0496101_0019182
2146 Ga0496101_0269745
2147 Ga0496102_0000247
2148 Ga0496102_0011536
2149 Ga0496102_0357330
2150 Ga0496102_0765825
2151 Ga0496103_0000278
2152 Ga0496103_0004113
2153 Ga0496103_0674933
2154 Ga0496104_0012686
2155 Ga0496104_0442682
2156 Ga0496104_0841253
2157 Ga0496105_0193414
2158 Ga0496105_0333670
2159 Ga0496106_0034656
2160 Ga0496106_0339206
2161 Ga0496107_0007427
2162 Ga0496107_0129345
2163 Ga0496108_0220724
2164 Ga0496108_0726060
2165 Ga0496108_0767753
2166 Ga0496109_0156865
2167 Ga0496109_0253568
2168 Ga0496109_1580520
2169 Ga0496110_0033465
2170 Ga0496110_0855295
2171 Ga0496111_0097044
2172 Ga0496112_0049701
2173 Ga0496112_0969349
2174 Ga0496112_1626283
2175 Ga0496113_0004854
2176 Ga0496113_0247667
2177 Ga0496113_0877810
2178 Ga0496114_0049041
2179 Ga0496114_0921698
2180 Ga0496116_0067882
2181 Ga0496116_0077471
2182 Ga0496116_0210565
2183 Ga0496116_0261687
2184 Ga0496117_0000445
2185 Ga0496117_0018250
2186 Ga0496117_0028196
2187 Ga0496117_0077015
2188 Ga0496117_0142136
2189 Ga0496118_0000138
2190 Ga0496118_0038446
2191 Ga0496118_0064386
2192 Ga0496118_0088277
2193 Ga0496118_0201297
2194 Ga0496118_0283728
2195 Ga0496118_0319804
2196 Ga0496121_0001530
2197 Ga0496121_0007122
2198 Ga0496121_0009428
2199 Ga0496121_0019431
2200 Ga0496121_0200367
2201 Ga0496122_0037608
2202 Ga0496122_0096052
2203 Ga0496122_0097709
2204 Ga0496122_0107920
2205 Ga0496122_0125380
2206 Ga0496123_0061360
2207 Ga0496123_0085045
2208 Ga0496123_0167325
2209 Ga0496123_0489792
2210 Ga0496124_0019236
2211 Ga0496124_0109845
2212 Ga0496124_0135768
2213 Ga0496124_0199425
2214 Ga0496124_0397733
2215 Ga0496125_0010667
2216 Ga0496125_0018669
2217 Ga0496125_0152093
2218 Ga0496126_0001647
2219 Ga0496126_0116341
2220 Ga0496126_0198850
2221 Ga0501309_017261
2222 Ga0495678_043424
2223 Ga0495682_0000254
2224 Ga0495682_0003881
2225 Ga0495682_0030071
2226 Ga0495682_0049284
2227 Ga0501292_060251
2228 Ga0501294_024554
2229 Ga0501034_0000003
2230 Ga0501046_1138357
2231 Ga0501048_0582599
2232 Ga0501072_0224223
2233 Ga0501206_000487
2234 Ga0501207_075224
2235 Ga0501262_010025
2236 Ga0501265_003053
2237 nmdc:mga03683_26699_c1
2238 nmdc:mga03683_545_c1
2239 nmdc:mga03683_6134_c1
2240 nmdc:mga03n38_29907_c1
2241 nmdc:mga03n38_4827_c1
2242 nmdc:mga03n38_9667_c1
2243 nmdc:mga00v17_14264_c1
2244 nmdc:mga00v17_1957_c1
2245 nmdc:mga00v17_620390_c1
2246 nmdc:mga0yw44_5595_c1
2247 nmdc:mga0yw44_822_c1
2248 nmdc:mga0k408_11610_c1
2249 nmdc:mga0k408_1313_c1
2250 nmdc:mga0k408_18508_c1
2251 nmdc:mga0k408_36108_c1
2252 nmdc:mga0k408_40895_c1
2253 nmdc:mga0k408_637108_c1
2254 nmdc:mga06z11_1020_c1
2255 nmdc:mga06z11_267741_c1
2256 nmdc:mga06z11_80647_c1
2257 nmdc:mga04h51_135699_c1
2258 nmdc:mga04h51_173348_c1
2259 nmdc:mga04h51_1956_c1
2260 nmdc:mga07m45_1263_c1
2261 nmdc:mga07m45_26187_c1
2262 nmdc:mga07m45_570823_c1
2263 nmdc:mga07m45_82856_c1
2264 nmdc:mga07m45_9583_c1
2265 nmdc:mga07m45_98435_c1
2266 nmdc:mga06r32_1022248_c1
2267 nmdc:mga0n895_445597_c1
2268 nmdc:mga0sz30_7217_c1
2269 Ga0500643_013144
2270 Ga0500651_0000957
2271 Ga0500566_0142346
2272 Ga0500660_054333
2273 Ga0500571_000024
2274 Ga0500592_008481
2275 Ga0500608_001647
2276 Ga0500618_031463
2277 Ga0500559_0027986
2278 Ga0500559_0096536
2279 Ga0500564_068558
2280 Ga0500568_0003259
2281 Ga0500574_007237
2282 Ga0500619_193608
2283 Ga0500638_004803
2284 Ga0500636_0153160
2285 Ga0500565_022799
2286 Ga0587084_001920
2287 Ga0587084_003128
2288 Ga0587084_040228
2289 Ga0587083_0016341
2290 Ga0587090_001520
2291 Ga0587090_002110
2292 Ga0587090_007688
2293 Ga0587090_017945
2294 Ga0587094_019363
2295 Ga0587101_018139
2296 Ga0587067_008178
2297 Ga0587068_008866
2298 Ga0587068_024858
2299 Ga0587072_011558
2300 Ga0587076_012201
2301 Ga0587076_023408
2302 Ga0587105_001077
2303 Ga0587111_0012970
2304 Ga0587111_0020665
2305 Ga0587111_0024244
2306 Ga0466962_0001661
2307 Ga0466962_0004649
2308 Ga0466962_0011849
2309 2863422838
2310 2904486920
2311 2919528234
2312 2928116997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

10

122

0.92

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

11

138

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8935 7 148
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8851 4 147
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.879 4 147
4ffu-assembly1.cif.gz_D crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8785 4 149
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.8764 6 149
ID Description Score Start End Superfamily
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9081 81 144 3.10.129.10
4ffuI00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9031 4 149 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8935 7 148 3.10.129.10
af_Q9W440_48_153_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8899 81 145 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8856 1 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A2WH49-F1-model_v4 deleted 0.9683 1 152
AF-A2WH49-F1-model_v4 deleted 0.9622 1 152
AF-A0A0N0ZBV9-F1-model_v4 deleted 0.9584 1 152
AF-A0A7W9TR50-F1-model_v4 Acyl dehydratase 0.9493 2 152
AF-A0A840Y4M6-F1-model_v4 Acyl dehydratase 0.9476 4 147

Map