F490943
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1156 | 511 | 2312 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0314590|Ga0395900_0314590_1035_1415 |
| Length | 126 |
| Sequence | MATKSRTGKKIDSATSRAKAPSMKVKKGDTVQVLSGKDRGAKGRVIAAYPQTQKVLVEGVGRIKKHTRISTTQRGAQQGGIVTQEAPIHVSNVMVVDSDNKPTRVGYRKDEDGRSIRVSRRTGKDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Metatranscriptome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 24 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 120 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 124 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 125 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 126 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 127 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 146 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 214 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 256 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 260 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 264 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 265 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 266 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 267 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 268 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 269 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 270 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 273 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 274 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 275 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 276 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 277 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 278 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 279 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 280 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 281 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 282 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 286 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 287 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 288 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 289 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 290 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 291 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 292 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 293 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 294 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 295 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 352 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 399 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 400 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 401 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 402 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 403 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 404 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 407 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 408 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 412 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 413 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 426 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 428 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 429 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 431 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 432 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 433 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 434 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 435 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 436 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 437 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 438 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 440 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 441 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 442 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 443 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 444 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 445 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 446 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 495 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 496 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 497 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 498 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 499 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 500 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 501 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 502 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 503 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 504 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 505 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 506 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 507 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 508 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 509 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 510 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 511 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.13 |
| Metatranscriptomes | 24.48 |
| Isolates | 1.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.42 |
| Nodule | 0.09 |
| Rhizoplane | 3.63 |
| Rhizosphere | 90.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0314590 | 3300037418 | Bacteria | 1548 |
| 2 | bgg_mtDRAFT_1028703 | 3300000305 | Bacteria | 952 |
| 3 | JGI24752J21851_1001457 | 3300001976 | Bacteria | 3185 |
| 4 | JGI24737J22298_10125765 | 3300001990 | Bacteria | 757 |
| 5 | JGI24743J22301_10011093 | 3300001991 | Bacteria | 1617 |
| 6 | JGI24735J21928_10104889 | 3300002067 | Bacteria | 812 |
| 7 | JGI24745J21846_1007554 | 3300002073 | Bacteria | 1218 |
| 8 | JGI24033J26618_1002668 | 3300002155 | Bacteria | 1838 |
| 9 | JGI24751J29686_10002090 | 3300002459 | Bacteria | 4053 |
| 10 | Ga0006759J45824_1021421 | 3300003163 | Bacteria | 826 |
| 11 | Ga0006759J45824_1044275 | 3300003163 | Bacteria | 697 |
| 12 | JGI25406J46586_10026916 | 3300003203 | Bacteria | 2211 |
| 13 | JGI25406J46586_10071578 | 3300003203 | Bacteria | 1087 |
| 14 | JGI25406J46586_10115402 | 3300003203 | Bacteria | 793 |
| 15 | Ga0007427J51700_112200 | 3300003559 | Bacteria | 664 |
| 16 | Ga0006781J51513_1011028 | 3300003568 | Bacteria | 1223 |
| 17 | Ga0007410J51695_1032800 | 3300003574 | Bacteria | 665 |
| 18 | Ga0007409J51694_1019784 | 3300003575 | Bacteria | 964 |
| 19 | Ga0007416J51690_1032530 | 3300003577 | Bacteria | 814 |
| 20 | Ga0007429J51699_1019317 | 3300003579 | Bacteria | 687 |
| 21 | Ga0007429J51699_1024229 | 3300003579 | Bacteria | 826 |
| 22 | Ga0007429J51699_1027973 | 3300003579 | Bacteria | 743 |
| 23 | JGI25404J52841_10003021 | 3300003659 | Bacteria | 3276 |
| 24 | Ga0032354_1016850 | 3300003693 | Bacteria | 602 |
| 25 | Ga0006780_1007700 | 3300003735 | Bacteria | 778 |
| 26 | Ga0058863_10025403 | 3300004799 | Bacteria | 1837 |
| 27 | Ga0058863_10092824 | 3300004799 | Bacteria | 1243 |
| 28 | Ga0058863_11918314 | 3300004799 | Bacteria | 960 |
| 29 | Ga0058861_10005407 | 3300004800 | Bacteria | 2249 |
| 30 | Ga0058861_10056599 | 3300004800 | Bacteria | 1345 |
| 31 | Ga0058861_10061286 | 3300004800 | Bacteria | 600 |
| 32 | Ga0058861_12074364 | 3300004800 | Bacteria | 1181 |
| 33 | Ga0058860_12144835 | 3300004801 | Bacteria | 669 |
| 34 | Ga0058862_12840177 | 3300004803 | Bacteria | 1934 |
| 35 | Ga0070658_10013033 | 3300005327 | Bacteria | 6672 |
| 36 | Ga0070658_10066569 | 3300005327 | Bacteria | 2943 |
| 37 | Ga0070658_10251817 | 3300005327 | Bacteria | 1498 |
| 38 | Ga0070658_10821661 | 3300005327 | Bacteria | 807 |
| 39 | Ga0070658_11375985 | 3300005327 | Bacteria | 612 |
| 40 | Ga0070676_10033824 | 3300005328 | Bacteria | 2933 |
| 41 | Ga0070676_10576225 | 3300005328 | Bacteria | 809 |
| 42 | Ga0070676_11003862 | 3300005328 | Bacteria | 626 |
| 43 | Ga0070683_100012328 | 3300005329 | Bacteria | 7426 |
| 44 | Ga0070683_100139274 | 3300005329 | Bacteria | 2298 |
| 45 | Ga0070683_100501523 | 3300005329 | Bacteria | 1159 |
| 46 | Ga0070683_100610950 | 3300005329 | Bacteria | 1044 |
| 47 | Ga0070683_100714779 | 3300005329 | Bacteria | 960 |
| 48 | Ga0070683_101829162 | 3300005329 | Bacteria | 584 |
| 49 | Ga0070690_100679803 | 3300005330 | Bacteria | 789 |
| 50 | Ga0070670_100035439 | 3300005331 | Bacteria | 4295 |
| 51 | Ga0070677_10765478 | 3300005333 | Bacteria | 549 |
| 52 | Ga0068869_100267928 | 3300005334 | Bacteria | 1369 |
| 53 | Ga0070666_10803093 | 3300005335 | Bacteria | 693 |
| 54 | Ga0070680_100013480 | 3300005336 | Bacteria | 6366 |
| 55 | Ga0070680_100066109 | 3300005336 | Bacteria | 2964 |
| 56 | Ga0070680_100779747 | 3300005336 | Bacteria | 823 |
| 57 | Ga0070682_100095043 | 3300005337 | Bacteria | 1956 |
| 58 | Ga0070682_100323753 | 3300005337 | Bacteria | 1140 |
| 59 | Ga0070682_100827531 | 3300005337 | Bacteria | 754 |
| 60 | Ga0068868_100052866 | 3300005338 | Bacteria | 3198 |
| 61 | Ga0068868_100479911 | 3300005338 | Bacteria | 1086 |
| 62 | Ga0068868_101009345 | 3300005338 | Bacteria | 762 |
| 63 | Ga0070660_100131054 | 3300005339 | Bacteria | 2006 |
| 64 | Ga0070660_100592342 | 3300005339 | Bacteria | 927 |
| 65 | Ga0070689_100100064 | 3300005340 | Bacteria | 2294 |
| 66 | Ga0070689_101539684 | 3300005340 | Bacteria | 603 |
| 67 | Ga0070691_10004434 | 3300005341 | Bacteria | 6380 |
| 68 | Ga0070687_100085942 | 3300005343 | Bacteria | 1728 |
| 69 | Ga0070692_10006088 | 3300005345 | Bacteria | 5209 |
| 70 | Ga0070692_10159601 | 3300005345 | Bacteria | 1291 |
| 71 | Ga0070668_100345821 | 3300005347 | Bacteria | 1257 |
| 72 | Ga0070669_100825923 | 3300005353 | Bacteria | 789 |
| 73 | Ga0070669_101880896 | 3300005353 | Bacteria | 523 |
| 74 | Ga0070675_100061737 | 3300005354 | Bacteria | 3095 |
| 75 | Ga0070675_100385802 | 3300005354 | Bacteria | 1248 |
| 76 | Ga0070675_101001669 | 3300005354 | Bacteria | 767 |
| 77 | Ga0070671_100012167 | 3300005355 | Bacteria | 6925 |
| 78 | Ga0070671_100365181 | 3300005355 | Bacteria | 1232 |
| 79 | Ga0070671_101088773 | 3300005355 | Bacteria | 701 |
| 80 | Ga0070673_100078654 | 3300005364 | Bacteria | 2668 |
| 81 | Ga0070688_100267788 | 3300005365 | Bacteria | 1223 |
| 82 | Ga0070659_100167676 | 3300005366 | Bacteria | 1797 |
| 83 | Ga0070659_100404644 | 3300005366 | Bacteria | 1153 |
| 84 | Ga0070659_101656958 | 3300005366 | Bacteria | 572 |
| 85 | Ga0070667_100280114 | 3300005367 | Bacteria | 1497 |
| 86 | Ga0070709_10007508 | 3300005434 | Bacteria | 5982 |
| 87 | Ga0070714_100046956 | 3300005435 | Bacteria | 3666 |
| 88 | Ga0070714_100157812 | 3300005435 | Bacteria | 2050 |
| 89 | Ga0070714_100189300 | 3300005435 | Bacteria | 1877 |
| 90 | Ga0070714_100468881 | 3300005435 | Bacteria | 1198 |
| 91 | Ga0070713_100005007 | 3300005436 | Bacteria | 8998 |
| 92 | Ga0070713_100489194 | 3300005436 | Bacteria | 1160 |
| 93 | Ga0070713_100511904 | 3300005436 | Bacteria | 1133 |
| 94 | Ga0070713_101174224 | 3300005436 | Bacteria | 743 |
| 95 | Ga0070713_102071782 | 3300005436 | Bacteria | 552 |
| 96 | Ga0070710_10483697 | 3300005437 | Bacteria | 845 |
| 97 | Ga0070710_10760959 | 3300005437 | Bacteria | 689 |
| 98 | Ga0070701_10338638 | 3300005438 | Bacteria | 936 |
| 99 | Ga0070701_10748916 | 3300005438 | Bacteria | 662 |
| 100 | Ga0070711_100013620 | 3300005439 | Bacteria | 5109 |
| 101 | Ga0070711_101201976 | 3300005439 | Bacteria | 656 |
| 102 | Ga0070705_100134274 | 3300005440 | Bacteria | 1619 |
| 103 | Ga0070705_100633146 | 3300005440 | Bacteria | 832 |
| 104 | Ga0070700_100403361 | 3300005441 | Bacteria | 1028 |
| 105 | Ga0070694_100531927 | 3300005444 | Bacteria | 939 |
| 106 | Ga0070694_100596698 | 3300005444 | Bacteria | 889 |
| 107 | Ga0070663_100133106 | 3300005455 | Bacteria | 1890 |
| 108 | Ga0070663_100133371 | 3300005455 | Bacteria | 1888 |
| 109 | Ga0070663_101529568 | 3300005455 | Bacteria | 594 |
| 110 | Ga0070678_100046927 | 3300005456 | Bacteria | 3101 |
| 111 | Ga0070678_100134588 | 3300005456 | Bacteria | 1969 |
| 112 | Ga0070678_100142868 | 3300005456 | Bacteria | 1917 |
| 113 | Ga0070662_100065234 | 3300005457 | Bacteria | 2669 |
| 114 | Ga0070681_10104714 | 3300005458 | Bacteria | 2771 |
| 115 | Ga0070681_10354040 | 3300005458 | Bacteria | 1378 |
| 116 | Ga0070681_10976429 | 3300005458 | Bacteria | 767 |
| 117 | Ga0070681_11130163 | 3300005458 | Bacteria | 704 |
| 118 | Ga0070681_11474233 | 3300005458 | Bacteria | 605 |
| 119 | Ga0070681_11530958 | 3300005458 | Bacteria | 592 |
| 120 | Ga0068867_100358505 | 3300005459 | Bacteria | 1219 |
| 121 | Ga0070679_100031334 | 3300005530 | Bacteria | 5252 |
| 122 | Ga0070679_100239703 | 3300005530 | Bacteria | 1771 |
| 123 | Ga0070679_100772996 | 3300005530 | Bacteria | 903 |
| 124 | Ga0070679_101020353 | 3300005530 | Bacteria | 771 |
| 125 | Ga0070679_101304760 | 3300005530 | Bacteria | 671 |
| 126 | Ga0070684_100060826 | 3300005535 | Bacteria | 3304 |
| 127 | Ga0070684_100850629 | 3300005535 | Bacteria | 854 |
| 128 | Ga0068853_100024387 | 3300005539 | Bacteria | 5070 |
| 129 | Ga0068853_102445376 | 3300005539 | Bacteria | 506 |
| 130 | Ga0070672_100064670 | 3300005543 | Bacteria | 2891 |
| 131 | Ga0070686_100081289 | 3300005544 | Bacteria | 2146 |
| 132 | Ga0070686_100886874 | 3300005544 | Bacteria | 725 |
| 133 | Ga0070695_100913122 | 3300005545 | Bacteria | 710 |
| 134 | Ga0070696_100696223 | 3300005546 | Bacteria | 828 |
| 135 | Ga0070696_100820698 | 3300005546 | Bacteria | 767 |
| 136 | Ga0070696_100843936 | 3300005546 | Bacteria | 757 |
| 137 | Ga0070693_100003210 | 3300005547 | Bacteria | 7588 |
| 138 | Ga0070693_100401384 | 3300005547 | Bacteria | 950 |
| 139 | Ga0070665_100042246 | 3300005548 | Bacteria | 4582 |
| 140 | Ga0070665_100612675 | 3300005548 | Bacteria | 1102 |
| 141 | Ga0070665_100668844 | 3300005548 | Bacteria | 1051 |
| 142 | Ga0070704_100980021 | 3300005549 | Bacteria | 764 |
| 143 | Ga0070704_102199975 | 3300005549 | Bacteria | 513 |
| 144 | Ga0068855_100229904 | 3300005563 | Bacteria | 2077 |
| 145 | Ga0068855_100305134 | 3300005563 | Bacteria | 1762 |
| 146 | Ga0070664_100308084 | 3300005564 | Bacteria | 1432 |
| 147 | Ga0070664_102198292 | 3300005564 | Bacteria | 524 |
| 148 | Ga0068857_100239211 | 3300005577 | Bacteria | 1662 |
| 149 | Ga0068857_100259122 | 3300005577 | Bacteria | 1596 |
| 150 | Ga0068854_100132819 | 3300005578 | Bacteria | 1902 |
| 151 | Ga0068854_100395199 | 3300005578 | Bacteria | 1143 |
| 152 | Ga0068856_100266290 | 3300005614 | Bacteria | 1729 |
| 153 | Ga0068856_100917903 | 3300005614 | Bacteria | 894 |
| 154 | Ga0068856_102156339 | 3300005614 | Bacteria | 566 |
| 155 | Ga0070702_100000953 | 3300005615 | Bacteria | 11358 |
| 156 | Ga0070702_100242670 | 3300005615 | Bacteria | 1217 |
| 157 | Ga0068852_100613103 | 3300005616 | Bacteria | 1093 |
| 158 | Ga0068852_100943830 | 3300005616 | Bacteria | 881 |
| 159 | Ga0068852_100985163 | 3300005616 | Bacteria | 861 |
| 160 | Ga0068859_100081856 | 3300005617 | Bacteria | 3271 |
| 161 | Ga0068859_100128534 | 3300005617 | Bacteria | 2604 |
| 162 | Ga0068864_100063717 | 3300005618 | Bacteria | 3195 |
| 163 | Ga0068864_100100693 | 3300005618 | Bacteria | 2561 |
| 164 | Ga0068866_10512531 | 3300005718 | Bacteria | 796 |
| 165 | Ga0068851_10003041 | 3300005834 | Bacteria | 7416 |
| 166 | Ga0068870_10001758 | 3300005840 | Bacteria | 8886 |
| 167 | Ga0068863_100292689 | 3300005841 | Bacteria | 1578 |
| 168 | Ga0068858_100095043 | 3300005842 | Bacteria | 2777 |
| 169 | Ga0068858_100738686 | 3300005842 | Bacteria | 959 |
| 170 | Ga0068860_100028365 | 3300005843 | Bacteria | 5388 |
| 171 | Ga0068862_100771674 | 3300005844 | Bacteria | 937 |
| 172 | Ga0068862_100869526 | 3300005844 | Bacteria | 884 |
| 173 | Ga0068862_102770054 | 3300005844 | Bacteria | 502 |
| 174 | Ga0081455_10150567 | 3300005937 | Bacteria | 1794 |
| 175 | Ga0081455_10280882 | 3300005937 | Bacteria | 1203 |
| 176 | Ga0081540_1017209 | 3300005983 | Bacteria | 4483 |
| 177 | Ga0081540_1022585 | 3300005983 | Bacteria | 3713 |
| 178 | Ga0081540_1060450 | 3300005983 | Bacteria | 1812 |
| 179 | Ga0081540_1314996 | 3300005983 | Bacteria | 537 |
| 180 | Ga0081539_10008334 | 3300005985 | Bacteria | 9059 |
| 181 | Ga0081539_10011295 | 3300005985 | Bacteria | 7090 |
| 182 | Ga0081539_10053681 | 3300005985 | Bacteria | 2255 |
| 183 | Ga0081539_10132442 | 3300005985 | Bacteria | 1223 |
| 184 | Ga0081539_10389903 | 3300005985 | Bacteria | 580 |
| 185 | Ga0070717_10074289 | 3300006028 | Bacteria | 2841 |
| 186 | Ga0070717_10123383 | 3300006028 | Bacteria | 2221 |
| 187 | Ga0075432_10054172 | 3300006058 | Bacteria | 1420 |
| 188 | Ga0070715_10299533 | 3300006163 | Bacteria | 860 |
| 189 | Ga0070716_100164942 | 3300006173 | Bacteria | 1440 |
| 190 | Ga0070716_100503517 | 3300006173 | Bacteria | 894 |
| 191 | Ga0070712_100085634 | 3300006175 | Bacteria | 2294 |
| 192 | Ga0097621_100795528 | 3300006237 | Bacteria | 876 |
| 193 | Ga0068871_100043334 | 3300006358 | Bacteria | 3614 |
| 194 | Ga0075428_100023645 | 3300006844 | Bacteria | 6802 |
| 195 | Ga0075428_100089494 | 3300006844 | Bacteria | 3357 |
| 196 | Ga0075428_100238187 | 3300006844 | Bacteria | 1964 |
| 197 | Ga0075428_100815623 | 3300006844 | Bacteria | 991 |
| 198 | Ga0075428_101640037 | 3300006844 | Bacteria | 672 |
| 199 | Ga0075430_100003583 | 3300006846 | Bacteria | 13009 |
| 200 | Ga0075430_100292385 | 3300006846 | Bacteria | 1348 |
| 201 | Ga0075430_101305486 | 3300006846 | Bacteria | 597 |
| 202 | Ga0075431_100089013 | 3300006847 | Bacteria | 3187 |
| 203 | Ga0075431_100105026 | 3300006847 | Bacteria | 2915 |
| 204 | Ga0075431_100119295 | 3300006847 | Bacteria | 2722 |
| 205 | Ga0075431_100177640 | 3300006847 | Bacteria | 2186 |
| 206 | Ga0075431_101034013 | 3300006847 | Bacteria | 787 |
| 207 | Ga0075433_10047966 | 3300006852 | Bacteria | 3714 |
| 208 | Ga0075433_10979032 | 3300006852 | Bacteria | 737 |
| 209 | Ga0075433_11665201 | 3300006852 | Bacteria | 550 |
| 210 | Ga0075434_100049646 | 3300006871 | Bacteria | 4167 |
| 211 | Ga0075434_101975484 | 3300006871 | Bacteria | 589 |
| 212 | Ga0075429_100149559 | 3300006880 | Bacteria | 2044 |
| 213 | Ga0075429_100171779 | 3300006880 | Bacteria | 1899 |
| 214 | Ga0075429_100278238 | 3300006880 | Bacteria | 1465 |
| 215 | Ga0075436_100003595 | 3300006914 | Bacteria | 10621 |
| 216 | Ga0097620_100081856 | 3300006931 | Bacteria | 3271 |
| 217 | Ga0097620_100128547 | 3300006931 | Bacteria | 2604 |
| 218 | Ga0105251_10037521 | 3300009011 | Bacteria | 2378 |
| 219 | Ga0105240_10081735 | 3300009093 | Bacteria | 3969 |
| 220 | Ga0105240_11168661 | 3300009093 | Bacteria | 816 |
| 221 | Ga0111539_10091653 | 3300009094 | Bacteria | 3571 |
| 222 | Ga0111539_10327737 | 3300009094 | Bacteria | 1782 |
| 223 | Ga0111539_12271715 | 3300009094 | Bacteria | 629 |
| 224 | Ga0111539_12798881 | 3300009094 | Bacteria | 565 |
| 225 | Ga0105245_10395692 | 3300009098 | Bacteria | 1379 |
| 226 | Ga0105245_12754434 | 3300009098 | Bacteria | 544 |
| 227 | Ga0105245_12795465 | 3300009098 | Bacteria | 541 |
| 228 | Ga0105247_10013340 | 3300009101 | Bacteria | 4932 |
| 229 | Ga0114129_10015903 | 3300009147 | Bacteria | 10703 |
| 230 | Ga0114129_10044905 | 3300009147 | Bacteria | 6214 |
| 231 | Ga0114129_10142435 | 3300009147 | Bacteria | 3285 |
| 232 | Ga0114129_10230488 | 3300009147 | Bacteria | 2494 |
| 233 | Ga0114129_10527242 | 3300009147 | Bacteria | 1539 |
| 234 | Ga0114129_10835379 | 3300009147 | Bacteria | 1172 |
| 235 | Ga0114129_10872219 | 3300009147 | Bacteria | 1142 |
| 236 | Ga0114129_12282675 | 3300009147 | Bacteria | 650 |
| 237 | Ga0105241_10080948 | 3300009174 | Bacteria | 2543 |
| 238 | Ga0105242_11898839 | 3300009176 | Bacteria | 636 |
| 239 | Ga0105242_13121408 | 3300009176 | Bacteria | 514 |
| 240 | Ga0105248_11490908 | 3300009177 | Bacteria | 766 |
| 241 | Ga0105237_10013649 | 3300009545 | Bacteria | 8508 |
| 242 | Ga0105238_10061533 | 3300009551 | Bacteria | 3757 |
| 243 | Ga0105238_10649963 | 3300009551 | Bacteria | 1064 |
| 244 | Ga0105238_10905233 | 3300009551 | Bacteria | 901 |
| 245 | Ga0105238_11355228 | 3300009551 | Bacteria | 738 |
| 246 | Ga0105249_11051021 | 3300009553 | Bacteria | 884 |
| 247 | Ga0105249_11493303 | 3300009553 | Bacteria | 748 |
| 248 | Ga0105249_12843378 | 3300009553 | Bacteria | 555 |
| 249 | Ga0130084_1087343 | 3300009835 | Bacteria | 574 |
| 250 | Ga0130085_1104886 | 3300009850 | Bacteria | 574 |
| 251 | Ga0105239_10330290 | 3300010375 | Bacteria | 1720 |
| 252 | Ga0105239_11325585 | 3300010375 | Bacteria | 830 |
| 253 | Ga0105246_10003630 | 3300011119 | Bacteria | 9339 |
| 254 | Ga0105246_10833396 | 3300011119 | Bacteria | 821 |
| 255 | Ga0105246_10854410 | 3300011119 | Bacteria | 812 |
| 256 | Ga0105246_11289311 | 3300011119 | Bacteria | 676 |
| 257 | Ga0157320_1010361 | 3300012481 | Bacteria | 718 |
| 258 | Ga0157318_1018656 | 3300012482 | Bacteria | 597 |
| 259 | Ga0157342_1028164 | 3300012507 | Bacteria | 693 |
| 260 | Ga0157326_1009506 | 3300012513 | Bacteria | 1072 |
| 261 | Ga0154010_141469 | 3300013062 | Bacteria | 815 |
| 262 | Ga0157373_10093996 | 3300013100 | Bacteria | 2111 |
| 263 | Ga0157371_10040913 | 3300013102 | Bacteria | 3309 |
| 264 | Ga0157371_10251184 | 3300013102 | Bacteria | 1273 |
| 265 | Ga0157370_10020407 | 3300013104 | Bacteria | 6618 |
| 266 | Ga0157370_10480970 | 3300013104 | Bacteria | 1141 |
| 267 | Ga0157370_10789993 | 3300013104 | Bacteria | 864 |
| 268 | Ga0157370_11166939 | 3300013104 | Bacteria | 695 |
| 269 | Ga0157369_10340722 | 3300013105 | Bacteria | 1557 |
| 270 | Ga0157369_10484200 | 3300013105 | Bacteria | 1280 |
| 271 | Ga0157369_10950529 | 3300013105 | Bacteria | 881 |
| 272 | Ga0157369_11699054 | 3300013105 | Bacteria | 641 |
| 273 | Ga0157374_10101023 | 3300013296 | Bacteria | 2765 |
| 274 | Ga0157374_10959465 | 3300013296 | Bacteria | 874 |
| 275 | Ga0157378_10870191 | 3300013297 | Bacteria | 930 |
| 276 | Ga0157372_11118046 | 3300013307 | Bacteria | 911 |
| 277 | Ga0157372_11753016 | 3300013307 | Bacteria | 714 |
| 278 | Ga0157372_12673868 | 3300013307 | Bacteria | 573 |
| 279 | Ga0157375_10342053 | 3300013308 | Bacteria | 1661 |
| 280 | Ga0157375_10860112 | 3300013308 | Bacteria | 1053 |
| 281 | Ga0157375_12321951 | 3300013308 | Bacteria | 640 |
| 282 | Ga0157375_12651894 | 3300013308 | Bacteria | 599 |
| 283 | Ga0163163_10376126 | 3300014325 | Bacteria | 1478 |
| 284 | Ga0163163_11007748 | 3300014325 | Bacteria | 896 |
| 285 | Ga0163163_11063056 | 3300014325 | Bacteria | 872 |
| 286 | Ga0163163_12711349 | 3300014325 | Bacteria | 552 |
| 287 | Ga0157380_11593304 | 3300014326 | Bacteria | 708 |
| 288 | Ga0157380_13285738 | 3300014326 | Bacteria | 517 |
| 289 | Ga0182008_10190489 | 3300014497 | Bacteria | 1040 |
| 290 | Ga0157377_10002911 | 3300014745 | Bacteria | 7654 |
| 291 | Ga0157377_10689081 | 3300014745 | Bacteria | 740 |
| 292 | Ga0157379_10140306 | 3300014968 | Bacteria | 2179 |
| 293 | Ga0157379_10226154 | 3300014968 | Bacteria | 1696 |
| 294 | Ga0157376_10309994 | 3300014969 | Bacteria | 1497 |
| 295 | Ga0157376_11216712 | 3300014969 | Bacteria | 782 |
| 296 | Ga0157376_11865405 | 3300014969 | Bacteria | 638 |
| 297 | Ga0197907_10356475 | 3300020069 | Bacteria | 937 |
| 298 | Ga0197907_10391573 | 3300020069 | Bacteria | 821 |
| 299 | Ga0197907_10511654 | 3300020069 | Bacteria | 818 |
| 300 | Ga0197907_10633838 | 3300020069 | Bacteria | 1055 |
| 301 | Ga0197907_10731388 | 3300020069 | Bacteria | 7706 |
| 302 | Ga0197907_10949401 | 3300020069 | Bacteria | 1784 |
| 303 | Ga0197907_11188081 | 3300020069 | Bacteria | 717 |
| 304 | Ga0197907_11471494 | 3300020069 | Bacteria | 1478 |
| 305 | Ga0206356_10887482 | 3300020070 | Bacteria | 4557 |
| 306 | Ga0206356_11031005 | 3300020070 | Bacteria | 688 |
| 307 | Ga0206356_11040059 | 3300020070 | Bacteria | 763 |
| 308 | Ga0206356_11094015 | 3300020070 | Bacteria | 1176 |
| 309 | Ga0206356_11833246 | 3300020070 | Bacteria | 639 |
| 310 | Ga0206356_11858767 | 3300020070 | Bacteria | 1527 |
| 311 | Ga0206349_1016341 | 3300020075 | Bacteria | 1659 |
| 312 | Ga0206349_1049485 | 3300020075 | Bacteria | 646 |
| 313 | Ga0206349_1548026 | 3300020075 | Bacteria | 2220 |
| 314 | Ga0206355_1084914 | 3300020076 | Bacteria | 779 |
| 315 | Ga0206355_1118041 | 3300020076 | Bacteria | 765 |
| 316 | Ga0206355_1126517 | 3300020076 | Bacteria | 589 |
| 317 | Ga0206355_1417974 | 3300020076 | Bacteria | 907 |
| 318 | Ga0206355_1460842 | 3300020076 | Bacteria | 864 |
| 319 | Ga0206355_1655392 | 3300020076 | Bacteria | 2695 |
| 320 | Ga0206351_10483280 | 3300020077 | Bacteria | 2678 |
| 321 | Ga0206351_10502929 | 3300020077 | Bacteria | 929 |
| 322 | Ga0206351_10513026 | 3300020077 | Bacteria | 862 |
| 323 | Ga0206351_10610955 | 3300020077 | Bacteria | 571 |
| 324 | Ga0206351_10889650 | 3300020077 | Bacteria | 910 |
| 325 | Ga0206352_10667226 | 3300020078 | Bacteria | 512 |
| 326 | Ga0206352_10726005 | 3300020078 | Bacteria | 950 |
| 327 | Ga0206352_10986910 | 3300020078 | Bacteria | 1118 |
| 328 | Ga0206352_11141801 | 3300020078 | Bacteria | 524 |
| 329 | Ga0206350_10170609 | 3300020080 | Bacteria | 3867 |
| 330 | Ga0206350_10257355 | 3300020080 | Bacteria | 739 |
| 331 | Ga0206350_10804271 | 3300020080 | Bacteria | 2416 |
| 332 | Ga0206350_10851205 | 3300020080 | Bacteria | 1893 |
| 333 | Ga0206350_11401277 | 3300020080 | Bacteria | 932 |
| 334 | Ga0206354_10000715 | 3300020081 | Bacteria | 621 |
| 335 | Ga0206354_10035765 | 3300020081 | Bacteria | 923 |
| 336 | Ga0206354_10452546 | 3300020081 | Bacteria | 3648 |
| 337 | Ga0206354_10472065 | 3300020081 | Bacteria | 545 |
| 338 | Ga0206354_10516190 | 3300020081 | Bacteria | 2807 |
| 339 | Ga0206354_10596477 | 3300020081 | Bacteria | 2771 |
| 340 | Ga0206354_11181496 | 3300020081 | Bacteria | 677 |
| 341 | Ga0206353_10117959 | 3300020082 | Bacteria | 4534 |
| 342 | Ga0206353_10239640 | 3300020082 | Bacteria | 725 |
| 343 | Ga0206353_10453711 | 3300020082 | Bacteria | 726 |
| 344 | Ga0206353_10868437 | 3300020082 | Bacteria | 670 |
| 345 | Ga0206353_11113762 | 3300020082 | Bacteria | 3043 |
| 346 | Ga0206353_11610083 | 3300020082 | Bacteria | 945 |
| 347 | Ga0206353_11979475 | 3300020082 | Bacteria | 843 |
| 348 | Ga0154015_1321943 | 3300020610 | Bacteria | 2054 |
| 349 | Ga0154015_1469900 | 3300020610 | Bacteria | 553 |
| 350 | Ga0154015_1675764 | 3300020610 | Bacteria | 782 |
| 351 | Ga0224712_10005659 | 3300022467 | Bacteria | 3505 |
| 352 | Ga0224712_10010082 | 3300022467 | Bacteria | 2874 |
| 353 | Ga0224712_10010159 | 3300022467 | Bacteria | 2867 |
| 354 | Ga0224712_10023728 | 3300022467 | Bacteria | 2133 |
| 355 | Ga0224712_10064587 | 3300022467 | Bacteria | 1468 |
| 356 | Ga0224712_10380125 | 3300022467 | Bacteria | 671 |
| 357 | Ga0224712_10506907 | 3300022467 | Bacteria | 584 |
| 358 | Ga0224712_10513384 | 3300022467 | Bacteria | 580 |
| 359 | Ga0207713_1041726 | 3300025735 | Bacteria | 1911 |
| 360 | Ga0207692_10070446 | 3300025898 | Bacteria | 1841 |
| 361 | Ga0207692_10262544 | 3300025898 | Bacteria | 1039 |
| 362 | Ga0207642_10204093 | 3300025899 | Bacteria | 1094 |
| 363 | Ga0207710_10014134 | 3300025900 | Bacteria | 3362 |
| 364 | Ga0207647_10082211 | 3300025904 | Bacteria | 1929 |
| 365 | Ga0207647_10417567 | 3300025904 | Bacteria | 754 |
| 366 | Ga0207645_10017688 | 3300025907 | Bacteria | 4700 |
| 367 | Ga0207643_10002089 | 3300025908 | Bacteria | 11006 |
| 368 | Ga0207643_10297476 | 3300025908 | Bacteria | 1004 |
| 369 | Ga0207705_10007931 | 3300025909 | Bacteria | 7794 |
| 370 | Ga0207705_10015200 | 3300025909 | Bacteria | 5530 |
| 371 | Ga0207654_10013204 | 3300025911 | Bacteria | 4245 |
| 372 | Ga0207654_11256021 | 3300025911 | Bacteria | 540 |
| 373 | Ga0207707_10028012 | 3300025912 | Bacteria | 4925 |
| 374 | Ga0207707_10084168 | 3300025912 | Bacteria | 2777 |
| 375 | Ga0207707_10388364 | 3300025912 | Bacteria | 1199 |
| 376 | Ga0207707_10461843 | 3300025912 | Bacteria | 1086 |
| 377 | Ga0207695_10086383 | 3300025913 | Bacteria | 3164 |
| 378 | Ga0207671_10095680 | 3300025914 | Bacteria | 2243 |
| 379 | Ga0207671_11132095 | 3300025914 | Bacteria | 614 |
| 380 | Ga0207693_10028753 | 3300025915 | Bacteria | 4393 |
| 381 | Ga0207693_10064337 | 3300025915 | Bacteria | 2873 |
| 382 | Ga0207693_10287117 | 3300025915 | Bacteria | 1289 |
| 383 | Ga0207663_10122605 | 3300025916 | Bacteria | 1782 |
| 384 | Ga0207663_10523937 | 3300025916 | Bacteria | 923 |
| 385 | Ga0207663_10870615 | 3300025916 | Bacteria | 720 |
| 386 | Ga0207660_10055414 | 3300025917 | Bacteria | 2833 |
| 387 | Ga0207660_10609576 | 3300025917 | Bacteria | 889 |
| 388 | Ga0207662_10034135 | 3300025918 | Bacteria | 2969 |
| 389 | Ga0207662_10475906 | 3300025918 | Bacteria | 857 |
| 390 | Ga0207657_10185805 | 3300025919 | Bacteria | 1678 |
| 391 | Ga0207657_10420469 | 3300025919 | Bacteria | 1050 |
| 392 | Ga0207649_10004433 | 3300025920 | Bacteria | 7620 |
| 393 | Ga0207649_10070500 | 3300025920 | Bacteria | 2229 |
| 394 | Ga0207649_10282445 | 3300025920 | Bacteria | 1207 |
| 395 | Ga0207652_10004203 | 3300025921 | Bacteria | 11751 |
| 396 | Ga0207652_10061664 | 3300025921 | Bacteria | 3239 |
| 397 | Ga0207652_10083068 | 3300025921 | Bacteria | 2804 |
| 398 | Ga0207652_10090147 | 3300025921 | Bacteria | 2694 |
| 399 | Ga0207652_10609864 | 3300025921 | Bacteria | 978 |
| 400 | Ga0207694_10169497 | 3300025924 | Bacteria | 1767 |
| 401 | Ga0207694_10197643 | 3300025924 | Bacteria | 1635 |
| 402 | Ga0207650_10011563 | 3300025925 | Bacteria | 6077 |
| 403 | Ga0207659_10042850 | 3300025926 | Bacteria | 3175 |
| 404 | Ga0207659_10695293 | 3300025926 | Bacteria | 871 |
| 405 | Ga0207659_11353852 | 3300025926 | Bacteria | 611 |
| 406 | Ga0207687_10202761 | 3300025927 | Bacteria | 1552 |
| 407 | Ga0207700_10003264 | 3300025928 | Bacteria | 9377 |
| 408 | Ga0207700_10034290 | 3300025928 | Bacteria | 3643 |
| 409 | Ga0207700_10808439 | 3300025928 | Bacteria | 839 |
| 410 | Ga0207700_10866059 | 3300025928 | Bacteria | 808 |
| 411 | Ga0207700_11017347 | 3300025928 | Bacteria | 741 |
| 412 | Ga0207664_10010419 | 3300025929 | Bacteria | 6563 |
| 413 | Ga0207664_11670779 | 3300025929 | Bacteria | 559 |
| 414 | Ga0207664_11742984 | 3300025929 | Bacteria | 545 |
| 415 | Ga0207644_10018730 | 3300025931 | Bacteria | 4687 |
| 416 | Ga0207690_10015527 | 3300025932 | Bacteria | 4616 |
| 417 | Ga0207690_11026227 | 3300025932 | Bacteria | 686 |
| 418 | Ga0207690_11200792 | 3300025932 | Bacteria | 633 |
| 419 | Ga0207690_11406743 | 3300025932 | Bacteria | 583 |
| 420 | Ga0207706_10030233 | 3300025933 | Bacteria | 4833 |
| 421 | Ga0207706_11467437 | 3300025933 | Bacteria | 557 |
| 422 | Ga0207686_11487021 | 3300025934 | Bacteria | 558 |
| 423 | Ga0207670_10053403 | 3300025936 | Bacteria | 2722 |
| 424 | Ga0207670_10192108 | 3300025936 | Bacteria | 1545 |
| 425 | Ga0207670_10628470 | 3300025936 | Bacteria | 884 |
| 426 | Ga0207665_10238338 | 3300025939 | Bacteria | 1339 |
| 427 | Ga0207665_10254816 | 3300025939 | Bacteria | 1298 |
| 428 | Ga0207691_10021575 | 3300025940 | Bacteria | 6080 |
| 429 | Ga0207711_11032478 | 3300025941 | Bacteria | 762 |
| 430 | Ga0207711_11452298 | 3300025941 | Bacteria | 629 |
| 431 | Ga0207661_10039485 | 3300025944 | Bacteria | 3704 |
| 432 | Ga0207661_10141404 | 3300025944 | Bacteria | 2071 |
| 433 | Ga0207661_10621201 | 3300025944 | Bacteria | 992 |
| 434 | Ga0207661_11740550 | 3300025944 | Bacteria | 569 |
| 435 | Ga0207679_10003731 | 3300025945 | Bacteria | 9444 |
| 436 | Ga0207679_10289028 | 3300025945 | Bacteria | 1409 |
| 437 | Ga0207679_10917863 | 3300025945 | Bacteria | 801 |
| 438 | Ga0207679_11831436 | 3300025945 | Bacteria | 554 |
| 439 | Ga0207667_10435483 | 3300025949 | Bacteria | 1333 |
| 440 | Ga0207667_10523275 | 3300025949 | Bacteria | 1201 |
| 441 | Ga0207651_11077952 | 3300025960 | Bacteria | 719 |
| 442 | Ga0207712_11009142 | 3300025961 | Bacteria | 739 |
| 443 | Ga0207712_11073256 | 3300025961 | Bacteria | 716 |
| 444 | Ga0207668_10031521 | 3300025972 | Bacteria | 3492 |
| 445 | Ga0207668_11931043 | 3300025972 | Bacteria | 532 |
| 446 | Ga0207640_11360506 | 3300025981 | Bacteria | 635 |
| 447 | Ga0207658_12121673 | 3300025986 | Bacteria | 511 |
| 448 | Ga0207677_10167050 | 3300026023 | Bacteria | 1716 |
| 449 | Ga0207677_10255235 | 3300026023 | Bacteria | 1426 |
| 450 | Ga0207703_10317468 | 3300026035 | Bacteria | 1426 |
| 451 | Ga0207639_10072464 | 3300026041 | Bacteria | 2697 |
| 452 | Ga0207639_11366650 | 3300026041 | Bacteria | 665 |
| 453 | Ga0207639_11820156 | 3300026041 | Bacteria | 570 |
| 454 | Ga0207678_10858285 | 3300026067 | Bacteria | 802 |
| 455 | Ga0207678_10959994 | 3300026067 | Bacteria | 756 |
| 456 | Ga0207678_11215445 | 3300026067 | Bacteria | 667 |
| 457 | Ga0207708_10119093 | 3300026075 | Bacteria | 2056 |
| 458 | Ga0207708_10638490 | 3300026075 | Bacteria | 905 |
| 459 | Ga0207702_10017073 | 3300026078 | Bacteria | 6003 |
| 460 | Ga0207702_10072516 | 3300026078 | Bacteria | 2968 |
| 461 | Ga0207641_10007209 | 3300026088 | Bacteria | 9268 |
| 462 | Ga0207641_10110520 | 3300026088 | Bacteria | 2436 |
| 463 | Ga0207648_10406847 | 3300026089 | Bacteria | 1234 |
| 464 | Ga0207676_10002451 | 3300026095 | Bacteria | 13225 |
| 465 | Ga0207676_10286665 | 3300026095 | Bacteria | 1497 |
| 466 | Ga0207674_10043063 | 3300026116 | Bacteria | 4657 |
| 467 | Ga0207674_10104826 | 3300026116 | Bacteria | 2806 |
| 468 | Ga0207675_100028646 | 3300026118 | Bacteria | 5187 |
| 469 | Ga0207675_100332863 | 3300026118 | Bacteria | 1485 |
| 470 | Ga0207683_10031983 | 3300026121 | Bacteria | 4569 |
| 471 | Ga0207683_10218976 | 3300026121 | Bacteria | 1734 |
| 472 | Ga0207683_10306387 | 3300026121 | Bacteria | 1453 |
| 473 | Ga0207683_11506685 | 3300026121 | Bacteria | 621 |
| 474 | Ga0207698_10023796 | 3300026142 | Bacteria | 4286 |
| 475 | Ga0207698_10638913 | 3300026142 | Bacteria | 1053 |
| 476 | Ga0207428_10002902 | 3300027907 | Bacteria | 16993 |
| 477 | Ga0268266_10036855 | 3300028379 | Bacteria | 4166 |
| 478 | Ga0268266_10106164 | 3300028379 | Bacteria | 2482 |
| 479 | Ga0268265_11272482 | 3300028380 | Bacteria | 735 |
| 480 | Ga0268264_10281820 | 3300028381 | Bacteria | 1557 |
| 481 | Ga0307517_10118346 | 3300028786 | Bacteria | 1972 |
| 482 | Ga0307515_10001812 | 3300028794 | Bacteria | 47673 |
| 483 | Ga0307515_10051195 | 3300028794 | Bacteria | 6166 |
| 484 | Ga0307515_10104593 | 3300028794 | Bacteria | 3380 |
| 485 | Ga0307511_10116992 | 3300030521 | Bacteria | 1668 |
| 486 | Ga0307512_10007298 | 3300030522 | Bacteria | 10983 |
| 487 | Ga0307513_10017932 | 3300031456 | Bacteria | 8475 |
| 488 | Ga0307513_10103919 | 3300031456 | Bacteria | 2856 |
| 489 | Ga0307513_10112852 | 3300031456 | Bacteria | 2707 |
| 490 | Ga0307513_10266258 | 3300031456 | Bacteria | 1500 |
| 491 | Ga0307408_100261093 | 3300031548 | Bacteria | 1433 |
| 492 | Ga0307408_100264370 | 3300031548 | Bacteria | 1425 |
| 493 | Ga0307408_100337570 | 3300031548 | Bacteria | 1274 |
| 494 | Ga0307408_101138352 | 3300031548 | Bacteria | 725 |
| 495 | Ga0307408_101445278 | 3300031548 | Bacteria | 649 |
| 496 | Ga0307408_101931294 | 3300031548 | Bacteria | 566 |
| 497 | Ga0307508_10003351 | 3300031616 | Bacteria | 16261 |
| 498 | Ga0307508_10012047 | 3300031616 | Bacteria | 7911 |
| 499 | Ga0307508_10179119 | 3300031616 | Bacteria | 1722 |
| 500 | Ga0307508_10463955 | 3300031616 | Bacteria | 860 |
| 501 | Ga0307514_10413159 | 3300031649 | Bacteria | 682 |
| 502 | Ga0307516_10023078 | 3300031730 | Bacteria | 6384 |
| 503 | Ga0307516_10049250 | 3300031730 | Bacteria | 4142 |
| 504 | Ga0307516_10080069 | 3300031730 | Bacteria | 3110 |
| 505 | Ga0307405_10076719 | 3300031731 | Bacteria | 2169 |
| 506 | Ga0307405_10161360 | 3300031731 | Bacteria | 1588 |
| 507 | Ga0307405_10218801 | 3300031731 | Bacteria | 1396 |
| 508 | Ga0307405_10236329 | 3300031731 | Bacteria | 1350 |
| 509 | Ga0307405_10273516 | 3300031731 | Bacteria | 1268 |
| 510 | Ga0307405_10589329 | 3300031731 | Bacteria | 905 |
| 511 | Ga0307405_10972683 | 3300031731 | Bacteria | 722 |
| 512 | Ga0307413_10340662 | 3300031824 | Bacteria | 1153 |
| 513 | Ga0307413_10356678 | 3300031824 | Bacteria | 1130 |
| 514 | Ga0307413_10394382 | 3300031824 | Bacteria | 1082 |
| 515 | Ga0307413_10504691 | 3300031824 | Bacteria | 972 |
| 516 | Ga0307413_10534963 | 3300031824 | Bacteria | 947 |
| 517 | Ga0307413_10746142 | 3300031824 | Bacteria | 818 |
| 518 | Ga0307413_10881248 | 3300031824 | Bacteria | 759 |
| 519 | Ga0307413_11377922 | 3300031824 | Bacteria | 619 |
| 520 | Ga0307413_11479240 | 3300031824 | Bacteria | 600 |
| 521 | Ga0307518_10284046 | 3300031838 | Bacteria | 1021 |
| 522 | Ga0307410_10109410 | 3300031852 | Bacteria | 1997 |
| 523 | Ga0307410_10191571 | 3300031852 | Bacteria | 1555 |
| 524 | Ga0307410_10236459 | 3300031852 | Bacteria | 1413 |
| 525 | Ga0307410_10391672 | 3300031852 | Bacteria | 1120 |
| 526 | Ga0307410_10693864 | 3300031852 | Bacteria | 857 |
| 527 | Ga0307410_10929522 | 3300031852 | Bacteria | 746 |
| 528 | Ga0307410_11315877 | 3300031852 | Bacteria | 632 |
| 529 | Ga0307410_11636273 | 3300031852 | Bacteria | 569 |
| 530 | Ga0307410_12049908 | 3300031852 | Bacteria | 511 |
| 531 | Ga0326468_10001157 | 3300031889 | Bacteria | 2419 |
| 532 | Ga0307406_10024435 | 3300031901 | Bacteria | 3609 |
| 533 | Ga0307406_10028359 | 3300031901 | Bacteria | 3382 |
| 534 | Ga0307406_10177088 | 3300031901 | Bacteria | 1549 |
| 535 | Ga0307406_10188837 | 3300031901 | Bacteria | 1506 |
| 536 | Ga0307406_10518339 | 3300031901 | Bacteria | 970 |
| 537 | Ga0307406_10876782 | 3300031901 | Bacteria | 762 |
| 538 | Ga0307406_11152717 | 3300031901 | Bacteria | 671 |
| 539 | Ga0307406_11232334 | 3300031901 | Bacteria | 651 |
| 540 | Ga0307407_10035608 | 3300031903 | Bacteria | 2736 |
| 541 | Ga0307407_10039561 | 3300031903 | Bacteria | 2623 |
| 542 | Ga0307407_10253678 | 3300031903 | Bacteria | 1206 |
| 543 | Ga0307407_10279627 | 3300031903 | Bacteria | 1155 |
| 544 | Ga0307407_10339391 | 3300031903 | Bacteria | 1060 |
| 545 | Ga0307407_10366312 | 3300031903 | Bacteria | 1025 |
| 546 | Ga0307407_11022059 | 3300031903 | Bacteria | 639 |
| 547 | Ga0307412_10065395 | 3300031911 | Bacteria | 2461 |
| 548 | Ga0307412_10095271 | 3300031911 | Bacteria | 2092 |
| 549 | Ga0307412_10325618 | 3300031911 | Bacteria | 1224 |
| 550 | Ga0307412_10910006 | 3300031911 | Bacteria | 771 |
| 551 | Ga0307412_11251693 | 3300031911 | Bacteria | 666 |
| 552 | Ga0307409_100017545 | 3300031995 | Bacteria | 4776 |
| 553 | Ga0307409_100052854 | 3300031995 | Bacteria | 3117 |
| 554 | Ga0307409_100094193 | 3300031995 | Bacteria | 2463 |
| 555 | Ga0307409_100341855 | 3300031995 | Bacteria | 1408 |
| 556 | Ga0307409_100476313 | 3300031995 | Bacteria | 1210 |
| 557 | Ga0307409_100635273 | 3300031995 | Bacteria | 1059 |
| 558 | Ga0307409_100886394 | 3300031995 | Bacteria | 905 |
| 559 | Ga0307409_100930118 | 3300031995 | Bacteria | 884 |
| 560 | Ga0307409_101047794 | 3300031995 | Bacteria | 835 |
| 561 | Ga0307409_101632127 | 3300031995 | Bacteria | 673 |
| 562 | Ga0307409_102331514 | 3300031995 | Bacteria | 564 |
| 563 | Ga0307409_102407541 | 3300031995 | Bacteria | 555 |
| 564 | Ga0307416_100014883 | 3300032002 | Bacteria | 5350 |
| 565 | Ga0307416_100036084 | 3300032002 | Bacteria | 3786 |
| 566 | Ga0307416_100064521 | 3300032002 | Bacteria | 3005 |
| 567 | Ga0307416_100154192 | 3300032002 | Bacteria | 2112 |
| 568 | Ga0307416_100189090 | 3300032002 | Bacteria | 1939 |
| 569 | Ga0307416_100330505 | 3300032002 | Bacteria | 1531 |
| 570 | Ga0307416_100644594 | 3300032002 | Bacteria | 1143 |
| 571 | Ga0307416_100727581 | 3300032002 | Bacteria | 1083 |
| 572 | Ga0307416_101050605 | 3300032002 | Bacteria | 918 |
| 573 | Ga0307416_101336454 | 3300032002 | Bacteria | 822 |
| 574 | Ga0307416_101505571 | 3300032002 | Bacteria | 778 |
| 575 | Ga0307416_103395600 | 3300032002 | Bacteria | 533 |
| 576 | Ga0307416_103497754 | 3300032002 | Bacteria | 525 |
| 577 | Ga0307414_10225085 | 3300032004 | Bacteria | 1542 |
| 578 | Ga0307414_10461493 | 3300032004 | Bacteria | 1116 |
| 579 | Ga0307414_10702795 | 3300032004 | Bacteria | 915 |
| 580 | Ga0307414_11126115 | 3300032004 | Bacteria | 725 |
| 581 | Ga0307414_11486590 | 3300032004 | Bacteria | 630 |
| 582 | Ga0307414_11495097 | 3300032004 | Bacteria | 628 |
| 583 | Ga0307411_10056847 | 3300032005 | Bacteria | 2581 |
| 584 | Ga0307411_10101205 | 3300032005 | Bacteria | 2038 |
| 585 | Ga0307411_10200982 | 3300032005 | Bacteria | 1530 |
| 586 | Ga0307411_11262069 | 3300032005 | Bacteria | 672 |
| 587 | Ga0307411_11412900 | 3300032005 | Bacteria | 637 |
| 588 | Ga0307411_11665949 | 3300032005 | Bacteria | 590 |
| 589 | Ga0307415_100008029 | 3300032126 | Bacteria | 5823 |
| 590 | Ga0307415_100033892 | 3300032126 | Bacteria | 3318 |
| 591 | Ga0307415_100131993 | 3300032126 | Bacteria | 1892 |
| 592 | Ga0307415_100236273 | 3300032126 | Bacteria | 1475 |
| 593 | Ga0307415_100308833 | 3300032126 | Bacteria | 1313 |
| 594 | Ga0307415_100369152 | 3300032126 | Bacteria | 1214 |
| 595 | Ga0307415_100513396 | 3300032126 | Bacteria | 1050 |
| 596 | Ga0307415_100608634 | 3300032126 | Bacteria | 973 |
| 597 | Ga0307415_101022041 | 3300032126 | Bacteria | 769 |
| 598 | Ga0307415_101117753 | 3300032126 | Bacteria | 738 |
| 599 | Ga0307415_102286906 | 3300032126 | Bacteria | 530 |
| 600 | Ga0373950_0014056 | 3300034818 | Bacteria | 1343 |
| 601 | Ga0373929_0133123 | 3300035085 | Bacteria | 654 |
| 602 | Ga0373929_0242963 | 3300035085 | Bacteria | 520 |
| 603 | Ga0373940_0007085 | 3300035088 | Bacteria | 2516 |
| 604 | Ga0373940_0164876 | 3300035088 | Bacteria | 713 |
| 605 | Ga0373951_0000463 | 3300035091 | Bacteria | 11707 |
| 606 | Ga0373952_0048318 | 3300035092 | Bacteria | 1006 |
| 607 | Ga0373932_0186273 | 3300035112 | Bacteria | 731 |
| 608 | Ga0373936_0222380 | 3300035113 | Bacteria | 838 |
| 609 | Ga0373945_0193415 | 3300035116 | Bacteria | 842 |
| 610 | Ga0373960_0174214 | 3300035121 | Bacteria | 748 |
| 611 | Ga0373943_0359790 | 3300035170 | Bacteria | 835 |
| 612 | Ga0373946_0276810 | 3300035171 | Bacteria | 825 |
| 613 | Ga0373942_0000479 | 3300035207 | Bacteria | 11391 |
| 614 | Ga0373942_0045512 | 3300035207 | Bacteria | 1212 |
| 615 | Ga0373962_0004423 | 3300035242 | Bacteria | 3395 |
| 616 | Ga0373931_0046447 | 3300035691 | Bacteria | 2296 |
| 617 | Ga0373931_0125226 | 3300035691 | Bacteria | 1473 |
| 618 | Ga0373931_0621784 | 3300035691 | Bacteria | 708 |
| 619 | Ga0373935_0017873 | 3300035692 | Bacteria | 4308 |
| 620 | Ga0373935_0643016 | 3300035692 | Bacteria | 778 |
| 621 | Ga0373935_0862703 | 3300035692 | Bacteria | 670 |
| 622 | Ga0373925_0456924 | 3300037068 | Bacteria | 1046 |
| 623 | Ga0373925_1125641 | 3300037068 | Bacteria | 646 |
| 624 | Ga0395899_0254458 | 3300037312 | Bacteria | 1204 |
| 625 | Ga0395899_0404327 | 3300037312 | Bacteria | 903 |
| 626 | Ga0395899_0590332 | 3300037312 | Bacteria | 709 |
| 627 | Ga0395899_0673174 | 3300037312 | Bacteria | 652 |
| 628 | Ga0395900_0014327 | 3300037418 | Bacteria | 8095 |
| 629 | Ga0395900_0123671 | 3300037418 | Bacteria | 2653 |
| 630 | Ga0395900_0431590 | 3300037418 | Bacteria | 1277 |
| 631 | Ga0395900_1879661 | 3300037418 | Bacteria | 509 |
| 632 | Ga0395898_0021962 | 3300037466 | Bacteria | 6464 |
| 633 | Ga0395898_0052865 | 3300037466 | Bacteria | 3968 |
| 634 | Ga0395898_0072810 | 3300037466 | Bacteria | 3319 |
| 635 | Ga0395898_0185594 | 3300037466 | Bacteria | 1987 |
| 636 | Ga0395905_0932659 | 3300037471 | Bacteria | 771 |
| 637 | Ga0436364_0331973 | 3300037853 | Bacteria | 748 |
| 638 | Ga0436364_0851430 | 3300037853 | Bacteria | 1232 |
| 639 | Ga0395901_0008088 | 3300038443 | Bacteria | 10623 |
| 640 | Ga0395901_0013538 | 3300038443 | Bacteria | 8294 |
| 641 | Ga0395901_0042762 | 3300038443 | Bacteria | 4699 |
| 642 | Ga0395901_0183293 | 3300038443 | Bacteria | 2196 |
| 643 | Ga0436363_1651514 | 3300039450 | Bacteria | 1289 |
| 644 | Ga0439447_053842 | 3300041407 | Bacteria | 956 |
| 645 | Ga0451789_0657542 | 3300041443 | Bacteria | 541 |
| 646 | Ga0451791_1217965 | 3300041451 | Bacteria | 712 |
| 647 | Ga0451793_0887120 | 3300041452 | Bacteria | 519 |
| 648 | Ga0451801_15528 | 3300041455 | Bacteria | 828 |
| 649 | Ga0451802_1574513 | 3300041460 | Bacteria | 534 |
| 650 | Ga0451804_0214233 | 3300041463 | Bacteria | 575 |
| 651 | Ga0451804_0678624 | 3300041463 | Bacteria | 568 |
| 652 | Ga0451807_0691119 | 3300041486 | Bacteria | 1219 |
| 653 | Ga0451835_0487623 | 3300041492 | Bacteria | 1052 |
| 654 | Ga0451837_0823205 | 3300041494 | Bacteria | 1003 |
| 655 | Ga0451839_0748863 | 3300041496 | Bacteria | 1220 |
| 656 | Ga0451841_0159007 | 3300041498 | Bacteria | 752 |
| 657 | Ga0451847_0907213 | 3300041503 | Bacteria | 614 |
| 658 | Ga0451843_0355274 | 3300041509 | Bacteria | 529 |
| 659 | Ga0451853_0669882 | 3300041512 | Bacteria | 673 |
| 660 | Ga0451853_2012304 | 3300041512 | Bacteria | 2258 |
| 661 | Ga0439433_0084542 | 3300041999 | Bacteria | 775 |
| 662 | Ga0439448_0026261 | 3300042005 | Bacteria | 1830 |
| 663 | Ga0439463_025905 | 3300042016 | Bacteria | 1472 |
| 664 | Ga0439463_212223 | 3300042016 | Bacteria | 503 |
| 665 | Ga0450923_111259 | 3300042125 | Bacteria | 639 |
| 666 | Ga0450900_010409 | 3300042136 | Bacteria | 1191 |
| 667 | Ga0450902_029835 | 3300042137 | Bacteria | 916 |
| 668 | Ga0450905_009200 | 3300042142 | Bacteria | 1357 |
| 669 | Ga0439459_0008060 | 3300042438 | Bacteria | 1792 |
| 670 | Ga0439459_0113624 | 3300042438 | Bacteria | 676 |
| 671 | Ga0439459_0152160 | 3300042438 | Bacteria | 605 |
| 672 | Ga0439464_0027423 | 3300042439 | Bacteria | 1584 |
| 673 | Ga0439464_0055266 | 3300042439 | Bacteria | 1155 |
| 674 | Ga0450901_040448 | 3300042533 | Bacteria | 525 |
| 675 | Ga0466969_0112933 | 3300044656 | Bacteria | 1270 |
| 676 | Ga0466969_0521973 | 3300044656 | Bacteria | 543 |
| 677 | Ga0466972_0151683 | 3300044658 | Bacteria | 1089 |
| 678 | Ga0466965_0087939 | 3300044683 | Bacteria | 1577 |
| 679 | Ga0466965_0668230 | 3300044683 | Bacteria | 594 |
| 680 | Ga0466966_0215282 | 3300044684 | Bacteria | 1160 |
| 681 | Ga0466966_0544677 | 3300044684 | Bacteria | 698 |
| 682 | Ga0466966_0829636 | 3300044684 | Bacteria | 557 |
| 683 | Ga0466961_0104065 | 3300044693 | Bacteria | 1787 |
| 684 | Ga0466961_0331429 | 3300044693 | Bacteria | 927 |
| 685 | Ga0466961_0534953 | 3300044693 | Bacteria | 706 |
| 686 | Ga0466963_0012748 | 3300044694 | Bacteria | 5149 |
| 687 | Ga0466963_0387822 | 3300044694 | Bacteria | 985 |
| 688 | Ga0466963_0462324 | 3300044694 | Bacteria | 895 |
| 689 | Ga0466963_0490286 | 3300044694 | Bacteria | 867 |
| 690 | Ga0466963_0746615 | 3300044694 | Bacteria | 690 |
| 691 | Ga0466964_0252763 | 3300044706 | Bacteria | 870 |
| 692 | Ga0466964_0397261 | 3300044706 | Bacteria | 719 |
| 693 | Ga0466964_0704063 | 3300044706 | Bacteria | 563 |
| 694 | Ga0466964_0922303 | 3300044706 | Bacteria | 501 |
| 695 | Ga0466971_0045049 | 3300044719 | Bacteria | 1981 |
| 696 | Ga0466971_0209828 | 3300044719 | Bacteria | 921 |
| 697 | Ga0466971_0402477 | 3300044719 | Bacteria | 667 |
| 698 | Ga0466968_0270107 | 3300044735 | Bacteria | 811 |
| 699 | Ga0466970_0101046 | 3300044765 | Bacteria | 1570 |
| 700 | Ga0466970_0186881 | 3300044765 | Bacteria | 1150 |
| 701 | Ga0466970_0227635 | 3300044765 | Bacteria | 1041 |
| 702 | Ga0466970_0333703 | 3300044765 | Bacteria | 859 |
| 703 | Ga0466970_0371307 | 3300044765 | Bacteria | 813 |
| 704 | Ga0466970_0511510 | 3300044765 | Bacteria | 692 |
| 705 | Ga0466957_0006102 | 3300044842 | Bacteria | 6802 |
| 706 | Ga0466957_0290325 | 3300044842 | Bacteria | 1096 |
| 707 | Ga0466957_0932066 | 3300044842 | Bacteria | 622 |
| 708 | Ga0466957_1119544 | 3300044842 | Bacteria | 568 |
| 709 | Ga0466960_0126172 | 3300044901 | Bacteria | 1345 |
| 710 | Ga0466960_0178241 | 3300044901 | Bacteria | 1150 |
| 711 | Ga0466960_0321500 | 3300044901 | Bacteria | 876 |
| 712 | Ga0466960_0388962 | 3300044901 | Bacteria | 801 |
| 713 | Ga0466960_0605751 | 3300044901 | Bacteria | 650 |
| 714 | Ga0466959_0103930 | 3300045049 | Bacteria | 2032 |
| 715 | Ga0466959_0245006 | 3300045049 | Bacteria | 1237 |
| 716 | Ga0466959_0395638 | 3300045049 | Bacteria | 939 |
| 717 | Ga0466959_0502413 | 3300045049 | Bacteria | 819 |
| 718 | Ga0466959_0637839 | 3300045049 | Bacteria | 715 |
| 719 | Ga0466959_0686772 | 3300045049 | Bacteria | 686 |
| 720 | Ga0466959_0714098 | 3300045049 | Bacteria | 671 |
| 721 | Ga0466958_0006910 | 3300045836 | Bacteria | 6207 |
| 722 | Ga0466958_0069284 | 3300045836 | Bacteria | 2156 |
| 723 | Ga0466958_0292197 | 3300045836 | Bacteria | 1045 |
| 724 | Ga0466958_0574976 | 3300045836 | Bacteria | 732 |
| 725 | Ga0466958_1032283 | 3300045836 | Bacteria | 536 |
| 726 | Ga0466967_0214532 | 3300045976 | Bacteria | 1826 |
| 727 | Ga0466967_0346000 | 3300045976 | Bacteria | 1438 |
| 728 | Ga0466967_0502429 | 3300045976 | Bacteria | 1190 |
| 729 | Ga0466967_1487806 | 3300045976 | Bacteria | 674 |
| 730 | Ga0466967_2261283 | 3300045976 | Bacteria | 539 |
| 731 | Ga0495603_0505647 | 3300046455 | Bacteria | 692 |
| 732 | Ga0495629_0029225 | 3300046459 | Bacteria | 3911 |
| 733 | Ga0495638_0239364 | 3300046460 | Bacteria | 1006 |
| 734 | Ga0495641_0558516 | 3300046461 | Bacteria | 523 |
| 735 | Ga0495582_0581073 | 3300046473 | Bacteria | 648 |
| 736 | Ga0495585_0184036 | 3300046492 | Bacteria | 1073 |
| 737 | Ga0495616_0340944 | 3300046513 | Bacteria | 626 |
| 738 | Ga0495631_0099125 | 3300046518 | Bacteria | 1254 |
| 739 | Ga0495632_0021539 | 3300046519 | Bacteria | 3472 |
| 740 | Ga0495632_0052375 | 3300046519 | Bacteria | 2007 |
| 741 | Ga0495644_0216348 | 3300046523 | Bacteria | 740 |
| 742 | Ga0495654_0186332 | 3300046530 | Bacteria | 896 |
| 743 | Ga0495640_0579224 | 3300046533 | Bacteria | 679 |
| 744 | Ga0495609_0215830 | 3300046538 | Bacteria | 798 |
| 745 | Ga0495621_0118080 | 3300046539 | Bacteria | 1023 |
| 746 | Ga0495656_0119943 | 3300046615 | Bacteria | 1240 |
| 747 | Ga0495656_0307750 | 3300046615 | Bacteria | 813 |
| 748 | Ga0495668_0250283 | 3300046616 | Bacteria | 970 |
| 749 | Ga0495661_0406478 | 3300046665 | Bacteria | 661 |
| 750 | Ga0495588_0307163 | 3300046674 | Bacteria | 835 |
| 751 | Ga0495657_0454280 | 3300046675 | Bacteria | 750 |
| 752 | Ga0495658_0456178 | 3300046683 | Bacteria | 817 |
| 753 | Ga0495669_0019422 | 3300046684 | Bacteria | 2933 |
| 754 | Ga0495613_1004268 | 3300046689 | Bacteria | 536 |
| 755 | Ga0495624_0297375 | 3300046690 | Bacteria | 974 |
| 756 | Ga0495670_0130068 | 3300046691 | Bacteria | 1312 |
| 757 | Ga0495581_0099232 | 3300047315 | Bacteria | 1692 |
| 758 | Ga0495581_0106714 | 3300047315 | Bacteria | 1628 |
| 759 | Ga0495676_0568775 | 3300047321 | Bacteria | 740 |
| 760 | Ga0495680_0846079 | 3300047322 | Bacteria | 595 |
| 761 | Ga0495675_0402568 | 3300047444 | Bacteria | 798 |
| 762 | Ga0495677_0028270 | 3300047445 | Bacteria | 2036 |
| 763 | Ga0495685_254956 | 3300047447 | Bacteria | 556 |
| 764 | Ga0495593_0271436 | 3300047673 | Bacteria | 849 |
| 765 | Ga0495614_0552418 | 3300048089 | Bacteria | 551 |
| 766 | Ga0495615_0064206 | 3300048090 | Bacteria | 976 |
| 767 | Ga0496100_0577715 | 3300048903 | Bacteria | 871 |
| 768 | Ga0496102_0071684 | 3300048905 | Bacteria | 3181 |
| 769 | Ga0496102_0989376 | 3300048905 | Bacteria | 762 |
| 770 | Ga0496104_0006275 | 3300048907 | Bacteria | 10451 |
| 771 | Ga0496104_0544843 | 3300048907 | Bacteria | 1071 |
| 772 | Ga0496105_0051832 | 3300048908 | Bacteria | 3388 |
| 773 | Ga0496105_0679476 | 3300048908 | Bacteria | 792 |
| 774 | Ga0496105_0859331 | 3300048908 | Bacteria | 686 |
| 775 | Ga0496106_0014813 | 3300048909 | Bacteria | 5766 |
| 776 | Ga0496106_0210540 | 3300048909 | Bacteria | 1549 |
| 777 | Ga0496106_1054841 | 3300048909 | Bacteria | 638 |
| 778 | Ga0496107_0036486 | 3300048910 | Bacteria | 3526 |
| 779 | Ga0496107_0474447 | 3300048910 | Bacteria | 929 |
| 780 | Ga0496108_0000043 | 3300048911 | Bacteria | 146005 |
| 781 | Ga0496108_0023561 | 3300048911 | Bacteria | 5067 |
| 782 | Ga0496108_0207592 | 3300048911 | Bacteria | 1700 |
| 783 | Ga0496108_1409722 | 3300048911 | Bacteria | 582 |
| 784 | Ga0496109_0679033 | 3300048912 | Bacteria | 967 |
| 785 | Ga0496109_0948459 | 3300048912 | Bacteria | 798 |
| 786 | Ga0496110_0006221 | 3300048913 | Bacteria | 9417 |
| 787 | Ga0496110_0850028 | 3300048913 | Bacteria | 818 |
| 788 | Ga0496111_0145743 | 3300048914 | Bacteria | 1755 |
| 789 | Ga0496111_0830552 | 3300048914 | Bacteria | 668 |
| 790 | Ga0496112_0084231 | 3300048915 | Bacteria | 3144 |
| 791 | Ga0496112_0210360 | 3300048915 | Bacteria | 1902 |
| 792 | Ga0496112_0809318 | 3300048915 | Bacteria | 861 |
| 793 | Ga0496113_0098655 | 3300048916 | Bacteria | 2261 |
| 794 | Ga0496113_0183972 | 3300048916 | Bacteria | 1657 |
| 795 | Ga0496113_0548820 | 3300048916 | Bacteria | 927 |
| 796 | Ga0496114_0955653 | 3300048917 | Bacteria | 739 |
| 797 | Ga0496114_1766659 | 3300048917 | Bacteria | 507 |
| 798 | Ga0496115_0036607 | 3300048918 | Bacteria | 3887 |
| 799 | Ga0496115_0215335 | 3300048918 | Bacteria | 1586 |
| 800 | Ga0496115_0519805 | 3300048918 | Bacteria | 955 |
| 801 | Ga0496126_0039353 | 3300048929 | Bacteria | 4388 |
| 802 | Ga0496126_1104051 | 3300048929 | Bacteria | 589 |
| 803 | Ga0501306_015842 | 3300049127 | Bacteria | 1007 |
| 804 | Ga0501306_041094 | 3300049127 | Bacteria | 717 |
| 805 | Ga0501306_042794 | 3300049127 | Bacteria | 707 |
| 806 | Ga0501306_060023 | 3300049127 | Bacteria | 625 |
| 807 | Ga0501306_107771 | 3300049127 | Bacteria | 504 |
| 808 | Ga0501308_013417 | 3300049128 | Bacteria | 947 |
| 809 | Ga0501308_037168 | 3300049128 | Bacteria | 674 |
| 810 | Ga0501308_038362 | 3300049128 | Bacteria | 667 |
| 811 | Ga0501309_019895 | 3300049129 | Bacteria | 936 |
| 812 | Ga0501309_047685 | 3300049129 | Bacteria | 667 |
| 813 | Ga0501309_057543 | 3300049129 | Bacteria | 621 |
| 814 | Ga0501309_077048 | 3300049129 | Bacteria | 555 |
| 815 | Ga0501310_015665 | 3300049130 | Bacteria | 902 |
| 816 | Ga0501310_022772 | 3300049130 | Bacteria | 793 |
| 817 | Ga0501310_045021 | 3300049130 | Bacteria | 625 |
| 818 | Ga0501310_052217 | 3300049130 | Bacteria | 593 |
| 819 | Ga0501341_07343 | 3300049131 | Bacteria | 689 |
| 820 | Ga0501341_11037 | 3300049131 | Bacteria | 600 |
| 821 | Ga0501341_15040 | 3300049131 | Bacteria | 541 |
| 822 | Ga0501304_010765 | 3300049160 | Bacteria | 804 |
| 823 | Ga0501305_059256 | 3300049161 | Bacteria | 656 |
| 824 | Ga0501305_066644 | 3300049161 | Bacteria | 628 |
| 825 | Ga0501307_020498 | 3300049162 | Bacteria | 855 |
| 826 | Ga0501307_043099 | 3300049162 | Bacteria | 660 |
| 827 | Ga0501307_049787 | 3300049162 | Bacteria | 627 |
| 828 | Ga0501294_011007 | 3300049517 | Bacteria | 898 |
| 829 | Ga0501311_024050 | 3300049527 | Bacteria | 847 |
| 830 | Ga0501312_004720 | 3300049528 | Bacteria | 1621 |
| 831 | Ga0501312_020483 | 3300049528 | Bacteria | 979 |
| 832 | Ga0501313_016430 | 3300049529 | Bacteria | 889 |
| 833 | Ga0501313_050527 | 3300049529 | Bacteria | 574 |
| 834 | Ga0501314_004579 | 3300049530 | Bacteria | 1151 |
| 835 | Ga0501314_008510 | 3300049530 | Bacteria | 928 |
| 836 | Ga0501314_033788 | 3300049530 | Bacteria | 577 |
| 837 | Ga0501315_021741 | 3300049531 | Bacteria | 870 |
| 838 | Ga0501315_032613 | 3300049531 | Bacteria | 757 |
| 839 | Ga0501316_032470 | 3300049532 | Bacteria | 703 |
| 840 | Ga0501316_038761 | 3300049532 | Bacteria | 659 |
| 841 | Ga0501317_009803 | 3300049533 | Bacteria | 1132 |
| 842 | Ga0501317_022426 | 3300049533 | Bacteria | 865 |
| 843 | Ga0501317_024948 | 3300049533 | Bacteria | 835 |
| 844 | Ga0501318_002847 | 3300049534 | Bacteria | 1537 |
| 845 | Ga0501318_014714 | 3300049534 | Bacteria | 926 |
| 846 | Ga0501318_027680 | 3300049534 | Bacteria | 755 |
| 847 | Ga0501318_034788 | 3300049534 | Bacteria | 700 |
| 848 | Ga0501318_035505 | 3300049534 | Bacteria | 695 |
| 849 | Ga0501318_035750 | 3300049534 | Bacteria | 693 |
| 850 | Ga0501318_043480 | 3300049534 | Bacteria | 649 |
| 851 | Ga0501319_001908 | 3300049535 | Bacteria | 1268 |
| 852 | Ga0501319_002279 | 3300049535 | Bacteria | 1203 |
| 853 | Ga0501320_025583 | 3300049536 | Bacteria | 708 |
| 854 | Ga0501320_027277 | 3300049536 | Bacteria | 694 |
| 855 | Ga0501320_028453 | 3300049536 | Bacteria | 684 |
| 856 | Ga0501320_046231 | 3300049536 | Bacteria | 583 |
| 857 | Ga0501321_021705 | 3300049537 | Bacteria | 803 |
| 858 | Ga0501321_025001 | 3300049537 | Bacteria | 767 |
| 859 | Ga0501321_039197 | 3300049537 | Bacteria | 661 |
| 860 | Ga0501321_043159 | 3300049537 | Bacteria | 640 |
| 861 | Ga0501322_000554 | 3300049538 | Bacteria | 1805 |
| 862 | Ga0501322_011003 | 3300049538 | Bacteria | 703 |
| 863 | Ga0501323_038903 | 3300049539 | Bacteria | 691 |
| 864 | Ga0501323_039272 | 3300049539 | Bacteria | 689 |
| 865 | Ga0501323_092161 | 3300049539 | Bacteria | 506 |
| 866 | Ga0501324_003187 | 3300049540 | Bacteria | 1244 |
| 867 | Ga0501324_003960 | 3300049540 | Bacteria | 1159 |
| 868 | Ga0501324_008952 | 3300049540 | Bacteria | 890 |
| 869 | Ga0501324_018450 | 3300049540 | Bacteria | 698 |
| 870 | Ga0501324_019575 | 3300049540 | Bacteria | 684 |
| 871 | Ga0501324_026983 | 3300049540 | Bacteria | 612 |
| 872 | Ga0501325_008439 | 3300049541 | Bacteria | 894 |
| 873 | Ga0501325_011558 | 3300049541 | Bacteria | 818 |
| 874 | Ga0501325_020811 | 3300049541 | Bacteria | 690 |
| 875 | Ga0501325_053628 | 3300049541 | Bacteria | 518 |
| 876 | Ga0501325_056154 | 3300049541 | Bacteria | 511 |
| 877 | Ga0501326_06330 | 3300049542 | Bacteria | 659 |
| 878 | Ga0501330_008147 | 3300049546 | Bacteria | 715 |
| 879 | Ga0501330_009879 | 3300049546 | Bacteria | 671 |
| 880 | Ga0501332_09188 | 3300049548 | Bacteria | 649 |
| 881 | Ga0501333_004109 | 3300049549 | Bacteria | 908 |
| 882 | Ga0501336_010878 | 3300049552 | Bacteria | 734 |
| 883 | Ga0501337_004918 | 3300049553 | Bacteria | 884 |
| 884 | Ga0501340_001733 | 3300049556 | Bacteria | 1208 |
| 885 | Ga0501340_012472 | 3300049556 | Bacteria | 645 |
| 886 | Ga0501031_0032070 | 3300049568 | Bacteria | 3426 |
| 887 | Ga0501031_0251952 | 3300049568 | Bacteria | 1147 |
| 888 | Ga0501031_0255011 | 3300049568 | Bacteria | 1140 |
| 889 | Ga0501032_0025353 | 3300049569 | Bacteria | 4088 |
| 890 | Ga0501032_0027327 | 3300049569 | Bacteria | 3921 |
| 891 | Ga0501032_0099412 | 3300049569 | Bacteria | 1927 |
| 892 | Ga0501032_0129448 | 3300049569 | Bacteria | 1666 |
| 893 | Ga0501033_0500218 | 3300049570 | Bacteria | 841 |
| 894 | Ga0501034_0043245 | 3300049571 | Bacteria | 4560 |
| 895 | Ga0501034_0288249 | 3300049571 | Bacteria | 1580 |
| 896 | Ga0501034_0716403 | 3300049571 | Bacteria | 898 |
| 897 | Ga0501036_0271293 | 3300049572 | Bacteria | 1420 |
| 898 | Ga0501036_0683565 | 3300049572 | Bacteria | 848 |
| 899 | Ga0501037_0015377 | 3300049573 | Bacteria | 5631 |
| 900 | Ga0501037_0023357 | 3300049573 | Bacteria | 4573 |
| 901 | Ga0501038_0003477 | 3300049574 | Bacteria | 14673 |
| 902 | Ga0501038_0419031 | 3300049574 | Bacteria | 1033 |
| 903 | Ga0501038_0805865 | 3300049574 | Bacteria | 698 |
| 904 | Ga0501039_0020664 | 3300049575 | Bacteria | 5045 |
| 905 | Ga0501039_0436639 | 3300049575 | Bacteria | 1028 |
| 906 | Ga0501039_0700846 | 3300049575 | Bacteria | 792 |
| 907 | Ga0501040_1020907 | 3300049576 | Bacteria | 600 |
| 908 | Ga0501042_0348768 | 3300049578 | Bacteria | 1071 |
| 909 | Ga0501042_0433902 | 3300049578 | Bacteria | 952 |
| 910 | Ga0501043_0009715 | 3300049579 | Bacteria | 7540 |
| 911 | Ga0501043_0065711 | 3300049579 | Bacteria | 2848 |
| 912 | Ga0501043_0912995 | 3300049579 | Bacteria | 629 |
| 913 | Ga0501043_1032153 | 3300049579 | Bacteria | 584 |
| 914 | Ga0501046_0525250 | 3300049580 | Bacteria | 846 |
| 915 | Ga0501046_0604004 | 3300049580 | Bacteria | 778 |
| 916 | Ga0501047_0000278 | 3300049581 | Bacteria | 59271 |
| 917 | Ga0501047_0000811 | 3300049581 | Bacteria | 32563 |
| 918 | Ga0501047_0053457 | 3300049581 | Bacteria | 3905 |
| 919 | Ga0501047_0109201 | 3300049581 | Bacteria | 2649 |
| 920 | Ga0501047_1395960 | 3300049581 | Bacteria | 515 |
| 921 | Ga0501048_0000853 | 3300049582 | Bacteria | 22450 |
| 922 | Ga0501048_0511053 | 3300049582 | Bacteria | 861 |
| 923 | Ga0501048_0733973 | 3300049582 | Bacteria | 709 |
| 924 | Ga0501068_0226302 | 3300049584 | Bacteria | 1189 |
| 925 | Ga0501068_0454140 | 3300049584 | Bacteria | 829 |
| 926 | Ga0501069_0324486 | 3300049585 | Bacteria | 905 |
| 927 | Ga0501070_0018107 | 3300049586 | Bacteria | 5909 |
| 928 | Ga0501070_0084253 | 3300049586 | Bacteria | 2632 |
| 929 | Ga0501070_0553621 | 3300049586 | Bacteria | 920 |
| 930 | Ga0501071_0288416 | 3300049587 | Bacteria | 1243 |
| 931 | Ga0501071_0463056 | 3300049587 | Bacteria | 971 |
| 932 | Ga0501072_0852645 | 3300049588 | Bacteria | 712 |
| 933 | Ga0501072_1485199 | 3300049588 | Bacteria | 523 |
| 934 | Ga0501073_0188088 | 3300049589 | Bacteria | 1429 |
| 935 | Ga0501073_1127616 | 3300049589 | Bacteria | 539 |
| 936 | Ga0501073_1128844 | 3300049589 | Bacteria | 539 |
| 937 | Ga0501074_0018515 | 3300049590 | Bacteria | 5060 |
| 938 | Ga0501075_0243915 | 3300049591 | Bacteria | 1370 |
| 939 | Ga0501075_0578735 | 3300049591 | Bacteria | 857 |
| 940 | Ga0501076_1129738 | 3300049592 | Bacteria | 645 |
| 941 | Ga0501077_0505915 | 3300049593 | Bacteria | 775 |
| 942 | Ga0501202_138270 | 3300049652 | Bacteria | 627 |
| 943 | Ga0501206_073400 | 3300049653 | Bacteria | 583 |
| 944 | Ga0501206_095777 | 3300049653 | Bacteria | 533 |
| 945 | Ga0501243_038166 | 3300049675 | Bacteria | 837 |
| 946 | Ga0501250_004678 | 3300049680 | Bacteria | 1374 |
| 947 | Ga0501253_076304 | 3300049683 | Bacteria | 749 |
| 948 | Ga0501221_187885 | 3300049704 | Bacteria | 568 |
| 949 | Ga0501080_0004134 | 3300049742 | Bacteria | 12866 |
| 950 | Ga0501080_0025709 | 3300049742 | Bacteria | 5468 |
| 951 | Ga0501080_0862801 | 3300049742 | Bacteria | 791 |
| 952 | Ga0501081_0091990 | 3300049743 | Bacteria | 2134 |
| 953 | Ga0501081_0501284 | 3300049743 | Bacteria | 905 |
| 954 | Ga0501271_063174 | 3300049768 | Bacteria | 523 |
| 955 | Ga0501281_16014 | 3300049777 | Bacteria | 557 |
| 956 | Ga0501035_0038436 | 3300049822 | Bacteria | 4333 |
| 957 | Ga0501035_0202932 | 3300049822 | Bacteria | 1699 |
| 958 | Ga0501044_0074873 | 3300049823 | Bacteria | 3438 |
| 959 | Ga0501044_0095420 | 3300049823 | Bacteria | 2997 |
| 960 | Ga0501044_0105745 | 3300049823 | Bacteria | 2827 |
| 961 | Ga0501044_0551129 | 3300049823 | Bacteria | 1050 |
| 962 | Ga0501045_0065355 | 3300049824 | Bacteria | 2671 |
| 963 | Ga0501045_0759188 | 3300049824 | Bacteria | 715 |
| 964 | Ga0501212_016793 | 3300049851 | Bacteria | 1102 |
| 965 | nmdc:mga03n38_186314_c1 | 3300050490 | Bacteria | 1066 |
| 966 | nmdc:mga06z11_516640_c1 | 3300050494 | Bacteria | 724 |
| 967 | nmdc:mga05p37_123655_c1 | 3300050507 | Bacteria | 2241 |
| 968 | nmdc:mga05p37_162208_c1 | 3300050507 | Bacteria | 2729 |
| 969 | nmdc:mga05p37_177510_c1 | 3300050507 | Bacteria | 2594 |
| 970 | nmdc:mga05p37_1822883_c1 | 3300050507 | Bacteria | 586 |
| 971 | nmdc:mga05p37_363629_c1 | 3300050507 | Bacteria | 1700 |
| 972 | nmdc:mga05p37_716771_c1 | 3300050507 | Bacteria | 1109 |
| 973 | nmdc:mga05p37_7235_c1 | 3300050507 | Bacteria | 13094 |
| 974 | nmdc:mga05p37_834097_c1 | 3300050507 | Bacteria | 1003 |
| 975 | nmdc:mga09592_24046_c1 | 3300050508 | Bacteria | 5036 |
| 976 | nmdc:mga09592_271995_c1 | 3300050508 | Bacteria | 1469 |
| 977 | nmdc:mga09592_3032_c1 | 3300050508 | Bacteria | 13623 |
| 978 | nmdc:mga09592_425863_c1 | 3300050508 | Bacteria | 1146 |
| 979 | nmdc:mga09592_96028_c1 | 3300050508 | Bacteria | 2535 |
| 980 | nmdc:mga0qj67_35737_c1 | 3300050509 | Bacteria | 3886 |
| 981 | nmdc:mga06r32_235136_c1 | 3300050510 | Bacteria | 1820 |
| 982 | nmdc:mga06r32_33048_c1 | 3300050510 | Bacteria | 4872 |
| 983 | nmdc:mga06r32_545733_c1 | 3300050510 | Bacteria | 1133 |
| 984 | nmdc:mga06r32_880541_c1 | 3300050510 | Bacteria | 853 |
| 985 | nmdc:mga06r32_895258_c1 | 3300050510 | Bacteria | 844 |
| 986 | nmdc:mga08y16_1607870_c1 | 3300050511 | Bacteria | 607 |
| 987 | nmdc:mga08y16_36056_c1 | 3300050511 | Bacteria | 5194 |
| 988 | nmdc:mga0n895_486326_c1 | 3300050512 | Bacteria | 1244 |
| 989 | nmdc:mga0n895_56468_c1 | 3300050512 | Bacteria | 3868 |
| 990 | nmdc:mga0n895_776852_c1 | 3300050512 | Bacteria | 949 |
| 991 | nmdc:mga0rr50_43762_c1 | 3300050513 | Bacteria | 3280 |
| 992 | nmdc:mga08x19_3249_c1 | 3300050514 | Bacteria | 9738 |
| 993 | nmdc:mga0a205_1925_c1 | 3300050515 | Bacteria | 18037 |
| 994 | nmdc:mga0a205_493254_c1 | 3300050515 | Bacteria | 1082 |
| 995 | Ga0495655_0336295 | 3300053083 | Bacteria | 526 |
| 996 | Ga0500578_0187199 | 3300053086 | Bacteria | 1273 |
| 997 | Ga0500643_001399 | 3300053087 | Bacteria | 13942 |
| 998 | Ga0500644_0006960 | 3300053088 | Bacteria | 2923 |
| 999 | Ga0500644_0050399 | 3300053088 | Bacteria | 1425 |
| 1000 | Ga0500644_0177867 | 3300053088 | Bacteria | 869 |
| 1001 | Ga0500646_0005473 | 3300053090 | Bacteria | 3211 |
| 1002 | Ga0500651_0042524 | 3300053093 | Bacteria | 2863 |
| 1003 | Ga0500641_0008601 | 3300053096 | Bacteria | 3649 |
| 1004 | Ga0500641_0013366 | 3300053096 | Bacteria | 3015 |
| 1005 | Ga0500650_0055724 | 3300053098 | Bacteria | 1841 |
| 1006 | Ga0500660_115897 | 3300053100 | Bacteria | 1129 |
| 1007 | Ga0500556_0054639 | 3300053104 | Bacteria | 1455 |
| 1008 | Ga0500562_032531 | 3300053108 | Bacteria | 1377 |
| 1009 | Ga0500569_001934 | 3300053109 | Bacteria | 4008 |
| 1010 | Ga0500594_0057890 | 3300053118 | Bacteria | 1109 |
| 1011 | Ga0500621_130042 | 3300053126 | Bacteria | 966 |
| 1012 | Ga0500652_002002 | 3300053131 | Bacteria | 6138 |
| 1013 | Ga0500658_0217687 | 3300053134 | Bacteria | 875 |
| 1014 | Ga0500579_078834 | 3300053143 | Bacteria | 1855 |
| 1015 | Ga0500588_0002195 | 3300053146 | Bacteria | 3914 |
| 1016 | Ga0500588_0084668 | 3300053146 | Bacteria | 1067 |
| 1017 | Ga0500589_157930 | 3300053147 | Bacteria | 915 |
| 1018 | Ga0500622_0138576 | 3300053156 | Bacteria | 1163 |
| 1019 | Ga0500630_285297 | 3300053159 | Bacteria | 548 |
| 1020 | Ga0500633_0251722 | 3300053160 | Bacteria | 656 |
| 1021 | Ga0500634_0377664 | 3300053161 | Bacteria | 531 |
| 1022 | Ga0587084_011899 | 3300059477 | Bacteria | 1168 |
| 1023 | Ga0587084_032338 | 3300059477 | Bacteria | 849 |
| 1024 | Ga0587084_034181 | 3300059477 | Bacteria | 834 |
| 1025 | Ga0587084_083035 | 3300059477 | Bacteria | 623 |
| 1026 | Ga0587084_102646 | 3300059477 | Bacteria | 582 |
| 1027 | Ga0587093_006992 | 3300059478 | Bacteria | 1247 |
| 1028 | Ga0587093_022718 | 3300059478 | Bacteria | 852 |
| 1029 | Ga0587066_055425 | 3300059490 | Bacteria | 794 |
| 1030 | Ga0587066_117250 | 3300059490 | Bacteria | 624 |
| 1031 | Ga0587070_051962 | 3300059491 | Bacteria | 821 |
| 1032 | Ga0587070_117878 | 3300059491 | Bacteria | 631 |
| 1033 | Ga0587070_185580 | 3300059491 | Bacteria | 544 |
| 1034 | Ga0587073_0080963 | 3300059492 | Bacteria | 806 |
| 1035 | Ga0587073_0266780 | 3300059492 | Bacteria | 544 |
| 1036 | Ga0587073_0273658 | 3300059492 | Bacteria | 539 |
| 1037 | Ga0587077_086063 | 3300059493 | Bacteria | 730 |
| 1038 | Ga0587077_176178 | 3300059493 | Bacteria | 576 |
| 1039 | Ga0587080_011481 | 3300059503 | Bacteria | 1324 |
| 1040 | Ga0587080_012877 | 3300059503 | Bacteria | 1272 |
| 1041 | Ga0587080_160302 | 3300059503 | Bacteria | 527 |
| 1042 | Ga0587082_178140 | 3300059504 | Bacteria | 519 |
| 1043 | Ga0587083_0031125 | 3300059505 | Bacteria | 1063 |
| 1044 | Ga0587083_0032986 | 3300059505 | Bacteria | 1042 |
| 1045 | Ga0587083_0036588 | 3300059505 | Bacteria | 1006 |
| 1046 | Ga0587083_0096390 | 3300059505 | Bacteria | 730 |
| 1047 | Ga0587083_0118035 | 3300059505 | Bacteria | 682 |
| 1048 | Ga0587083_0129878 | 3300059505 | Bacteria | 660 |
| 1049 | Ga0587083_0163716 | 3300059505 | Bacteria | 610 |
| 1050 | Ga0587083_0201997 | 3300059505 | Bacteria | 568 |
| 1051 | Ga0587085_011491 | 3300059506 | Bacteria | 1196 |
| 1052 | Ga0587085_019890 | 3300059506 | Bacteria | 1010 |
| 1053 | Ga0587085_101757 | 3300059506 | Bacteria | 608 |
| 1054 | Ga0587086_018073 | 3300059507 | Bacteria | 936 |
| 1055 | Ga0587086_023672 | 3300059507 | Bacteria | 858 |
| 1056 | Ga0587088_050557 | 3300059508 | Bacteria | 813 |
| 1057 | Ga0587088_056450 | 3300059508 | Bacteria | 784 |
| 1058 | Ga0587089_016154 | 3300059509 | Bacteria | 992 |
| 1059 | Ga0587090_015681 | 3300059510 | Bacteria | 1124 |
| 1060 | Ga0587090_044881 | 3300059510 | Bacteria | 791 |
| 1061 | Ga0587090_121466 | 3300059510 | Bacteria | 567 |
| 1062 | Ga0587091_012183 | 3300059511 | Bacteria | 1356 |
| 1063 | Ga0587091_023594 | 3300059511 | Bacteria | 1097 |
| 1064 | Ga0587091_025987 | 3300059511 | Bacteria | 1063 |
| 1065 | Ga0587091_102323 | 3300059511 | Bacteria | 673 |
| 1066 | Ga0587092_004442 | 3300059512 | Bacteria | 1672 |
| 1067 | Ga0587092_030061 | 3300059512 | Bacteria | 893 |
| 1068 | Ga0587092_049007 | 3300059512 | Bacteria | 759 |
| 1069 | Ga0587092_052695 | 3300059512 | Bacteria | 741 |
| 1070 | Ga0587092_088680 | 3300059512 | Bacteria | 621 |
| 1071 | Ga0587094_040989 | 3300059513 | Bacteria | 754 |
| 1072 | Ga0587094_051581 | 3300059513 | Bacteria | 698 |
| 1073 | Ga0587098_005401 | 3300059604 | Bacteria | 1252 |
| 1074 | Ga0587098_039472 | 3300059604 | Bacteria | 682 |
| 1075 | Ga0587098_065869 | 3300059604 | Bacteria | 578 |
| 1076 | Ga0587106_004030 | 3300059605 | Bacteria | 1588 |
| 1077 | Ga0587106_028574 | 3300059605 | Bacteria | 881 |
| 1078 | Ga0587106_074765 | 3300059605 | Bacteria | 649 |
| 1079 | Ga0587106_122465 | 3300059605 | Bacteria | 553 |
| 1080 | Ga0587125_002113 | 3300059607 | Bacteria | 1553 |
| 1081 | Ga0587129_008560 | 3300059608 | Bacteria | 760 |
| 1082 | Ga0587099_006116 | 3300059622 | Bacteria | 1104 |
| 1083 | Ga0587101_016593 | 3300059623 | Bacteria | 1011 |
| 1084 | Ga0587109_049071 | 3300059624 | Bacteria | 860 |
| 1085 | Ga0587109_076477 | 3300059624 | Bacteria | 733 |
| 1086 | Ga0587109_093501 | 3300059624 | Bacteria | 682 |
| 1087 | Ga0587109_101306 | 3300059624 | Bacteria | 662 |
| 1088 | Ga0587115_033939 | 3300059626 | Bacteria | 770 |
| 1089 | Ga0587115_081177 | 3300059626 | Bacteria | 575 |
| 1090 | Ga0587117_024422 | 3300059627 | Bacteria | 869 |
| 1091 | Ga0587117_064563 | 3300059627 | Bacteria | 636 |
| 1092 | Ga0587122_036941 | 3300059628 | Bacteria | 595 |
| 1093 | Ga0587127_006350 | 3300059629 | Bacteria | 834 |
| 1094 | Ga0587128_017047 | 3300059630 | Bacteria | 1071 |
| 1095 | Ga0587128_053654 | 3300059630 | Bacteria | 743 |
| 1096 | Ga0587128_125004 | 3300059630 | Bacteria | 564 |
| 1097 | Ga0587062_003426 | 3300059639 | Bacteria | 1602 |
| 1098 | Ga0587067_049243 | 3300059640 | Bacteria | 847 |
| 1099 | Ga0587068_019156 | 3300059641 | Bacteria | 1107 |
| 1100 | Ga0587068_053142 | 3300059641 | Bacteria | 763 |
| 1101 | Ga0587069_154504 | 3300059642 | Bacteria | 512 |
| 1102 | Ga0587072_029663 | 3300059643 | Bacteria | 1016 |
| 1103 | Ga0587072_078861 | 3300059643 | Bacteria | 708 |
| 1104 | Ga0587072_196961 | 3300059643 | Bacteria | 510 |
| 1105 | Ga0587075_053087 | 3300059644 | Bacteria | 712 |
| 1106 | Ga0587076_006901 | 3300059645 | Bacteria | 1531 |
| 1107 | Ga0587076_111178 | 3300059645 | Bacteria | 624 |
| 1108 | Ga0587076_147397 | 3300059645 | Bacteria | 568 |
| 1109 | Ga0587076_155865 | 3300059645 | Bacteria | 558 |
| 1110 | Ga0587078_063842 | 3300059646 | Bacteria | 563 |
| 1111 | Ga0587079_112206 | 3300059647 | Bacteria | 664 |
| 1112 | Ga0587079_190887 | 3300059647 | Bacteria | 554 |
| 1113 | Ga0587079_191740 | 3300059647 | Bacteria | 553 |
| 1114 | Ga0587107_020410 | 3300059652 | Bacteria | 918 |
| 1115 | Ga0587107_034467 | 3300059652 | Bacteria | 788 |
| 1116 | Ga0587107_109028 | 3300059652 | Bacteria | 557 |
| 1117 | Ga0587108_003256 | 3300059653 | Bacteria | 1139 |
| 1118 | Ga0587108_018973 | 3300059653 | Bacteria | 642 |
| 1119 | Ga0587110_036107 | 3300059654 | Bacteria | 620 |
| 1120 | Ga0587114_009789 | 3300059655 | Bacteria | 1157 |
| 1121 | Ga0587114_011482 | 3300059655 | Bacteria | 1105 |
| 1122 | Ga0587114_100857 | 3300059655 | Bacteria | 562 |
| 1123 | Ga0587118_22038 | 3300059657 | Bacteria | 534 |
| 1124 | Ga0587119_004905 | 3300059658 | Bacteria | 1350 |
| 1125 | Ga0587119_020492 | 3300059658 | Bacteria | 840 |
| 1126 | Ga0587120_013445 | 3300059659 | Bacteria | 723 |
| 1127 | Ga0587071_013067 | 3300060344 | Bacteria | 1425 |
| 1128 | Ga0587071_065132 | 3300060344 | Bacteria | 782 |
| 1129 | Ga0587071_072454 | 3300060344 | Bacteria | 753 |
| 1130 | Ga0587071_108677 | 3300060344 | Bacteria | 650 |
| 1131 | Ga0587071_142931 | 3300060344 | Bacteria | 589 |
| 1132 | Ga0587071_159053 | 3300060344 | Bacteria | 567 |
| 1133 | Ga0587111_0052099 | 3300060346 | Bacteria | 907 |
| 1134 | Ga0587111_0182057 | 3300060346 | Bacteria | 585 |
| 1135 | Ga0501082_0538361 | 3300060353 | Bacteria | 1021 |
| 1136 | Ga0466962_0029867 | 3300061719 | Bacteria | 2609 |
| 1137 | Ga0466962_0186980 | 3300061719 | Bacteria | 1010 |
| 1138 | Ga0466962_0192437 | 3300061719 | Bacteria | 995 |
| 1139 | Ga0466962_0728950 | 3300061719 | Bacteria | 509 |
| 1140 | Ga0530510_0444541 | 3300061734 | Bacteria | 980 |
| 1141 | 2501945902 | 2501939600 | Bacteria | 6907073 |
| 1142 | 2515496689 | 2515154088 | Bacteria | 5526283 |
| 1143 | 2515718310 | 2515154129 | Bacteria | 5584369 |
| 1144 | 2515756928 | 2515154137 | Bacteria | 5711575 |
| 1145 | 2516083530 | 2515154202 | Bacteria | 5471270 |
| 1146 | 2516089466 | 2515154203 | Bacteria | 5458536 |
| 1147 | 2623497648 | 2622736605 | Bacteria | 4992138 |
| 1148 | 2623585036 | 2622736626 | Bacteria | 7181580 |
| 1149 | 2772644892 | 2772190715 | Bacteria | 6959372 |
| 1150 | 2867510880 | 2867507094 | Bacteria | 6506033 |
| 1151 | 2996223711 | 2996221748 | Bacteria | 6799777 |
| 1152 | 649810773 | 649633069 | Bacteria | 6962533 |
| 1153 | 8003835116 | 8003830390 | Bacteria | 6541657 |
| 1154 | 8003862015 | 8003856774 | Bacteria | 7675274 |
| 1155 | 8003872925 | 8003870546 | Bacteria | 7396674 |
| 1156 | 8055412841 | 8055412473 | Bacteria | 6257500 |
| 1157 | Ga0395900_0314590 | |||
| 1158 | bgg_mtDRAFT_1028703 | |||
| 1159 | JGI24752J21851_1001457 | |||
| 1160 | JGI24737J22298_10125765 | |||
| 1161 | JGI24743J22301_10011093 | |||
| 1162 | JGI24735J21928_10104889 | |||
| 1163 | JGI24745J21846_1007554 | |||
| 1164 | JGI24033J26618_1002668 | |||
| 1165 | JGI24751J29686_10002090 | |||
| 1166 | Ga0006759J45824_1021421 | |||
| 1167 | Ga0006759J45824_1044275 | |||
| 1168 | JGI25406J46586_10026916 | |||
| 1169 | JGI25406J46586_10071578 | |||
| 1170 | JGI25406J46586_10115402 | |||
| 1171 | Ga0007427J51700_112200 | |||
| 1172 | Ga0006781J51513_1011028 | |||
| 1173 | Ga0007410J51695_1032800 | |||
| 1174 | Ga0007409J51694_1019784 | |||
| 1175 | Ga0007416J51690_1032530 | |||
| 1176 | Ga0007429J51699_1019317 | |||
| 1177 | Ga0007429J51699_1024229 | |||
| 1178 | Ga0007429J51699_1027973 | |||
| 1179 | JGI25404J52841_10003021 | |||
| 1180 | Ga0032354_1016850 | |||
| 1181 | Ga0006780_1007700 | |||
| 1182 | Ga0058863_10025403 | |||
| 1183 | Ga0058863_10092824 | |||
| 1184 | Ga0058863_11918314 | |||
| 1185 | Ga0058861_10005407 | |||
| 1186 | Ga0058861_10056599 | |||
| 1187 | Ga0058861_10061286 | |||
| 1188 | Ga0058861_12074364 | |||
| 1189 | Ga0058860_12144835 | |||
| 1190 | Ga0058862_12840177 | |||
| 1191 | Ga0070658_10013033 | |||
| 1192 | Ga0070658_10066569 | |||
| 1193 | Ga0070658_10251817 | |||
| 1194 | Ga0070658_10821661 | |||
| 1195 | Ga0070658_11375985 | |||
| 1196 | Ga0070676_10033824 | |||
| 1197 | Ga0070676_10576225 | |||
| 1198 | Ga0070676_11003862 | |||
| 1199 | Ga0070683_100012328 | |||
| 1200 | Ga0070683_100139274 | |||
| 1201 | Ga0070683_100501523 | |||
| 1202 | Ga0070683_100610950 | |||
| 1203 | Ga0070683_100714779 | |||
| 1204 | Ga0070683_101829162 | |||
| 1205 | Ga0070690_100679803 | |||
| 1206 | Ga0070670_100035439 | |||
| 1207 | Ga0070677_10765478 | |||
| 1208 | Ga0068869_100267928 | |||
| 1209 | Ga0070666_10803093 | |||
| 1210 | Ga0070680_100013480 | |||
| 1211 | Ga0070680_100066109 | |||
| 1212 | Ga0070680_100779747 | |||
| 1213 | Ga0070682_100095043 | |||
| 1214 | Ga0070682_100323753 | |||
| 1215 | Ga0070682_100827531 | |||
| 1216 | Ga0068868_100052866 | |||
| 1217 | Ga0068868_100479911 | |||
| 1218 | Ga0068868_101009345 | |||
| 1219 | Ga0070660_100131054 | |||
| 1220 | Ga0070660_100592342 | |||
| 1221 | Ga0070689_100100064 | |||
| 1222 | Ga0070689_101539684 | |||
| 1223 | Ga0070691_10004434 | |||
| 1224 | Ga0070687_100085942 | |||
| 1225 | Ga0070692_10006088 | |||
| 1226 | Ga0070692_10159601 | |||
| 1227 | Ga0070668_100345821 | |||
| 1228 | Ga0070669_100825923 | |||
| 1229 | Ga0070669_101880896 | |||
| 1230 | Ga0070675_100061737 | |||
| 1231 | Ga0070675_100385802 | |||
| 1232 | Ga0070675_101001669 | |||
| 1233 | Ga0070671_100012167 | |||
| 1234 | Ga0070671_100365181 | |||
| 1235 | Ga0070671_101088773 | |||
| 1236 | Ga0070673_100078654 | |||
| 1237 | Ga0070688_100267788 | |||
| 1238 | Ga0070659_100167676 | |||
| 1239 | Ga0070659_100404644 | |||
| 1240 | Ga0070659_101656958 | |||
| 1241 | Ga0070667_100280114 | |||
| 1242 | Ga0070709_10007508 | |||
| 1243 | Ga0070714_100046956 | |||
| 1244 | Ga0070714_100157812 | |||
| 1245 | Ga0070714_100189300 | |||
| 1246 | Ga0070714_100468881 | |||
| 1247 | Ga0070713_100005007 | |||
| 1248 | Ga0070713_100489194 | |||
| 1249 | Ga0070713_100511904 | |||
| 1250 | Ga0070713_101174224 | |||
| 1251 | Ga0070713_102071782 | |||
| 1252 | Ga0070710_10483697 | |||
| 1253 | Ga0070710_10760959 | |||
| 1254 | Ga0070701_10338638 | |||
| 1255 | Ga0070701_10748916 | |||
| 1256 | Ga0070711_100013620 | |||
| 1257 | Ga0070711_101201976 | |||
| 1258 | Ga0070705_100134274 | |||
| 1259 | Ga0070705_100633146 | |||
| 1260 | Ga0070700_100403361 | |||
| 1261 | Ga0070694_100531927 | |||
| 1262 | Ga0070694_100596698 | |||
| 1263 | Ga0070663_100133106 | |||
| 1264 | Ga0070663_100133371 | |||
| 1265 | Ga0070663_101529568 | |||
| 1266 | Ga0070678_100046927 | |||
| 1267 | Ga0070678_100134588 | |||
| 1268 | Ga0070678_100142868 | |||
| 1269 | Ga0070662_100065234 | |||
| 1270 | Ga0070681_10104714 | |||
| 1271 | Ga0070681_10354040 | |||
| 1272 | Ga0070681_10976429 | |||
| 1273 | Ga0070681_11130163 | |||
| 1274 | Ga0070681_11474233 | |||
| 1275 | Ga0070681_11530958 | |||
| 1276 | Ga0068867_100358505 | |||
| 1277 | Ga0070679_100031334 | |||
| 1278 | Ga0070679_100239703 | |||
| 1279 | Ga0070679_100772996 | |||
| 1280 | Ga0070679_101020353 | |||
| 1281 | Ga0070679_101304760 | |||
| 1282 | Ga0070684_100060826 | |||
| 1283 | Ga0070684_100850629 | |||
| 1284 | Ga0068853_100024387 | |||
| 1285 | Ga0068853_102445376 | |||
| 1286 | Ga0070672_100064670 | |||
| 1287 | Ga0070686_100081289 | |||
| 1288 | Ga0070686_100886874 | |||
| 1289 | Ga0070695_100913122 | |||
| 1290 | Ga0070696_100696223 | |||
| 1291 | Ga0070696_100820698 | |||
| 1292 | Ga0070696_100843936 | |||
| 1293 | Ga0070693_100003210 | |||
| 1294 | Ga0070693_100401384 | |||
| 1295 | Ga0070665_100042246 | |||
| 1296 | Ga0070665_100612675 | |||
| 1297 | Ga0070665_100668844 | |||
| 1298 | Ga0070704_100980021 | |||
| 1299 | Ga0070704_102199975 | |||
| 1300 | Ga0068855_100229904 | |||
| 1301 | Ga0068855_100305134 | |||
| 1302 | Ga0070664_100308084 | |||
| 1303 | Ga0070664_102198292 | |||
| 1304 | Ga0068857_100239211 | |||
| 1305 | Ga0068857_100259122 | |||
| 1306 | Ga0068854_100132819 | |||
| 1307 | Ga0068854_100395199 | |||
| 1308 | Ga0068856_100266290 | |||
| 1309 | Ga0068856_100917903 | |||
| 1310 | Ga0068856_102156339 | |||
| 1311 | Ga0070702_100000953 | |||
| 1312 | Ga0070702_100242670 | |||
| 1313 | Ga0068852_100613103 | |||
| 1314 | Ga0068852_100943830 | |||
| 1315 | Ga0068852_100985163 | |||
| 1316 | Ga0068859_100081856 | |||
| 1317 | Ga0068859_100128534 | |||
| 1318 | Ga0068864_100063717 | |||
| 1319 | Ga0068864_100100693 | |||
| 1320 | Ga0068866_10512531 | |||
| 1321 | Ga0068851_10003041 | |||
| 1322 | Ga0068870_10001758 | |||
| 1323 | Ga0068863_100292689 | |||
| 1324 | Ga0068858_100095043 | |||
| 1325 | Ga0068858_100738686 | |||
| 1326 | Ga0068860_100028365 | |||
| 1327 | Ga0068862_100771674 | |||
| 1328 | Ga0068862_100869526 | |||
| 1329 | Ga0068862_102770054 | |||
| 1330 | Ga0081455_10150567 | |||
| 1331 | Ga0081455_10280882 | |||
| 1332 | Ga0081540_1017209 | |||
| 1333 | Ga0081540_1022585 | |||
| 1334 | Ga0081540_1060450 | |||
| 1335 | Ga0081540_1314996 | |||
| 1336 | Ga0081539_10008334 | |||
| 1337 | Ga0081539_10011295 | |||
| 1338 | Ga0081539_10053681 | |||
| 1339 | Ga0081539_10132442 | |||
| 1340 | Ga0081539_10389903 | |||
| 1341 | Ga0070717_10074289 | |||
| 1342 | Ga0070717_10123383 | |||
| 1343 | Ga0075432_10054172 | |||
| 1344 | Ga0070715_10299533 | |||
| 1345 | Ga0070716_100164942 | |||
| 1346 | Ga0070716_100503517 | |||
| 1347 | Ga0070712_100085634 | |||
| 1348 | Ga0097621_100795528 | |||
| 1349 | Ga0068871_100043334 | |||
| 1350 | Ga0075428_100023645 | |||
| 1351 | Ga0075428_100089494 | |||
| 1352 | Ga0075428_100238187 | |||
| 1353 | Ga0075428_100815623 | |||
| 1354 | Ga0075428_101640037 | |||
| 1355 | Ga0075430_100003583 | |||
| 1356 | Ga0075430_100292385 | |||
| 1357 | Ga0075430_101305486 | |||
| 1358 | Ga0075431_100089013 | |||
| 1359 | Ga0075431_100105026 | |||
| 1360 | Ga0075431_100119295 | |||
| 1361 | Ga0075431_100177640 | |||
| 1362 | Ga0075431_101034013 | |||
| 1363 | Ga0075433_10047966 | |||
| 1364 | Ga0075433_10979032 | |||
| 1365 | Ga0075433_11665201 | |||
| 1366 | Ga0075434_100049646 | |||
| 1367 | Ga0075434_101975484 | |||
| 1368 | Ga0075429_100149559 | |||
| 1369 | Ga0075429_100171779 | |||
| 1370 | Ga0075429_100278238 | |||
| 1371 | Ga0075436_100003595 | |||
| 1372 | Ga0097620_100081856 | |||
| 1373 | Ga0097620_100128547 | |||
| 1374 | Ga0105251_10037521 | |||
| 1375 | Ga0105240_10081735 | |||
| 1376 | Ga0105240_11168661 | |||
| 1377 | Ga0111539_10091653 | |||
| 1378 | Ga0111539_10327737 | |||
| 1379 | Ga0111539_12271715 | |||
| 1380 | Ga0111539_12798881 | |||
| 1381 | Ga0105245_10395692 | |||
| 1382 | Ga0105245_12754434 | |||
| 1383 | Ga0105245_12795465 | |||
| 1384 | Ga0105247_10013340 | |||
| 1385 | Ga0114129_10015903 | |||
| 1386 | Ga0114129_10044905 | |||
| 1387 | Ga0114129_10142435 | |||
| 1388 | Ga0114129_10230488 | |||
| 1389 | Ga0114129_10527242 | |||
| 1390 | Ga0114129_10835379 | |||
| 1391 | Ga0114129_10872219 | |||
| 1392 | Ga0114129_12282675 | |||
| 1393 | Ga0105241_10080948 | |||
| 1394 | Ga0105242_11898839 | |||
| 1395 | Ga0105242_13121408 | |||
| 1396 | Ga0105248_11490908 | |||
| 1397 | Ga0105237_10013649 | |||
| 1398 | Ga0105238_10061533 | |||
| 1399 | Ga0105238_10649963 | |||
| 1400 | Ga0105238_10905233 | |||
| 1401 | Ga0105238_11355228 | |||
| 1402 | Ga0105249_11051021 | |||
| 1403 | Ga0105249_11493303 | |||
| 1404 | Ga0105249_12843378 | |||
| 1405 | Ga0130084_1087343 | |||
| 1406 | Ga0130085_1104886 | |||
| 1407 | Ga0105239_10330290 | |||
| 1408 | Ga0105239_11325585 | |||
| 1409 | Ga0105246_10003630 | |||
| 1410 | Ga0105246_10833396 | |||
| 1411 | Ga0105246_10854410 | |||
| 1412 | Ga0105246_11289311 | |||
| 1413 | Ga0157320_1010361 | |||
| 1414 | Ga0157318_1018656 | |||
| 1415 | Ga0157342_1028164 | |||
| 1416 | Ga0157326_1009506 | |||
| 1417 | Ga0154010_141469 | |||
| 1418 | Ga0157373_10093996 | |||
| 1419 | Ga0157371_10040913 | |||
| 1420 | Ga0157371_10251184 | |||
| 1421 | Ga0157370_10020407 | |||
| 1422 | Ga0157370_10480970 | |||
| 1423 | Ga0157370_10789993 | |||
| 1424 | Ga0157370_11166939 | |||
| 1425 | Ga0157369_10340722 | |||
| 1426 | Ga0157369_10484200 | |||
| 1427 | Ga0157369_10950529 | |||
| 1428 | Ga0157369_11699054 | |||
| 1429 | Ga0157374_10101023 | |||
| 1430 | Ga0157374_10959465 | |||
| 1431 | Ga0157378_10870191 | |||
| 1432 | Ga0157372_11118046 | |||
| 1433 | Ga0157372_11753016 | |||
| 1434 | Ga0157372_12673868 | |||
| 1435 | Ga0157375_10342053 | |||
| 1436 | Ga0157375_10860112 | |||
| 1437 | Ga0157375_12321951 | |||
| 1438 | Ga0157375_12651894 | |||
| 1439 | Ga0163163_10376126 | |||
| 1440 | Ga0163163_11007748 | |||
| 1441 | Ga0163163_11063056 | |||
| 1442 | Ga0163163_12711349 | |||
| 1443 | Ga0157380_11593304 | |||
| 1444 | Ga0157380_13285738 | |||
| 1445 | Ga0182008_10190489 | |||
| 1446 | Ga0157377_10002911 | |||
| 1447 | Ga0157377_10689081 | |||
| 1448 | Ga0157379_10140306 | |||
| 1449 | Ga0157379_10226154 | |||
| 1450 | Ga0157376_10309994 | |||
| 1451 | Ga0157376_11216712 | |||
| 1452 | Ga0157376_11865405 | |||
| 1453 | Ga0197907_10356475 | |||
| 1454 | Ga0197907_10391573 | |||
| 1455 | Ga0197907_10511654 | |||
| 1456 | Ga0197907_10633838 | |||
| 1457 | Ga0197907_10731388 | |||
| 1458 | Ga0197907_10949401 | |||
| 1459 | Ga0197907_11188081 | |||
| 1460 | Ga0197907_11471494 | |||
| 1461 | Ga0206356_10887482 | |||
| 1462 | Ga0206356_11031005 | |||
| 1463 | Ga0206356_11040059 | |||
| 1464 | Ga0206356_11094015 | |||
| 1465 | Ga0206356_11833246 | |||
| 1466 | Ga0206356_11858767 | |||
| 1467 | Ga0206349_1016341 | |||
| 1468 | Ga0206349_1049485 | |||
| 1469 | Ga0206349_1548026 | |||
| 1470 | Ga0206355_1084914 | |||
| 1471 | Ga0206355_1118041 | |||
| 1472 | Ga0206355_1126517 | |||
| 1473 | Ga0206355_1417974 | |||
| 1474 | Ga0206355_1460842 | |||
| 1475 | Ga0206355_1655392 | |||
| 1476 | Ga0206351_10483280 | |||
| 1477 | Ga0206351_10502929 | |||
| 1478 | Ga0206351_10513026 | |||
| 1479 | Ga0206351_10610955 | |||
| 1480 | Ga0206351_10889650 | |||
| 1481 | Ga0206352_10667226 | |||
| 1482 | Ga0206352_10726005 | |||
| 1483 | Ga0206352_10986910 | |||
| 1484 | Ga0206352_11141801 | |||
| 1485 | Ga0206350_10170609 | |||
| 1486 | Ga0206350_10257355 | |||
| 1487 | Ga0206350_10804271 | |||
| 1488 | Ga0206350_10851205 | |||
| 1489 | Ga0206350_11401277 | |||
| 1490 | Ga0206354_10000715 | |||
| 1491 | Ga0206354_10035765 | |||
| 1492 | Ga0206354_10452546 | |||
| 1493 | Ga0206354_10472065 | |||
| 1494 | Ga0206354_10516190 | |||
| 1495 | Ga0206354_10596477 | |||
| 1496 | Ga0206354_11181496 | |||
| 1497 | Ga0206353_10117959 | |||
| 1498 | Ga0206353_10239640 | |||
| 1499 | Ga0206353_10453711 | |||
| 1500 | Ga0206353_10868437 | |||
| 1501 | Ga0206353_11113762 | |||
| 1502 | Ga0206353_11610083 | |||
| 1503 | Ga0206353_11979475 | |||
| 1504 | Ga0154015_1321943 | |||
| 1505 | Ga0154015_1469900 | |||
| 1506 | Ga0154015_1675764 | |||
| 1507 | Ga0224712_10005659 | |||
| 1508 | Ga0224712_10010082 | |||
| 1509 | Ga0224712_10010159 | |||
| 1510 | Ga0224712_10023728 | |||
| 1511 | Ga0224712_10064587 | |||
| 1512 | Ga0224712_10380125 | |||
| 1513 | Ga0224712_10506907 | |||
| 1514 | Ga0224712_10513384 | |||
| 1515 | Ga0207713_1041726 | |||
| 1516 | Ga0207692_10070446 | |||
| 1517 | Ga0207692_10262544 | |||
| 1518 | Ga0207642_10204093 | |||
| 1519 | Ga0207710_10014134 | |||
| 1520 | Ga0207647_10082211 | |||
| 1521 | Ga0207647_10417567 | |||
| 1522 | Ga0207645_10017688 | |||
| 1523 | Ga0207643_10002089 | |||
| 1524 | Ga0207643_10297476 | |||
| 1525 | Ga0207705_10007931 | |||
| 1526 | Ga0207705_10015200 | |||
| 1527 | Ga0207654_10013204 | |||
| 1528 | Ga0207654_11256021 | |||
| 1529 | Ga0207707_10028012 | |||
| 1530 | Ga0207707_10084168 | |||
| 1531 | Ga0207707_10388364 | |||
| 1532 | Ga0207707_10461843 | |||
| 1533 | Ga0207695_10086383 | |||
| 1534 | Ga0207671_10095680 | |||
| 1535 | Ga0207671_11132095 | |||
| 1536 | Ga0207693_10028753 | |||
| 1537 | Ga0207693_10064337 | |||
| 1538 | Ga0207693_10287117 | |||
| 1539 | Ga0207663_10122605 | |||
| 1540 | Ga0207663_10523937 | |||
| 1541 | Ga0207663_10870615 | |||
| 1542 | Ga0207660_10055414 | |||
| 1543 | Ga0207660_10609576 | |||
| 1544 | Ga0207662_10034135 | |||
| 1545 | Ga0207662_10475906 | |||
| 1546 | Ga0207657_10185805 | |||
| 1547 | Ga0207657_10420469 | |||
| 1548 | Ga0207649_10004433 | |||
| 1549 | Ga0207649_10070500 | |||
| 1550 | Ga0207649_10282445 | |||
| 1551 | Ga0207652_10004203 | |||
| 1552 | Ga0207652_10061664 | |||
| 1553 | Ga0207652_10083068 | |||
| 1554 | Ga0207652_10090147 | |||
| 1555 | Ga0207652_10609864 | |||
| 1556 | Ga0207694_10169497 | |||
| 1557 | Ga0207694_10197643 | |||
| 1558 | Ga0207650_10011563 | |||
| 1559 | Ga0207659_10042850 | |||
| 1560 | Ga0207659_10695293 | |||
| 1561 | Ga0207659_11353852 | |||
| 1562 | Ga0207687_10202761 | |||
| 1563 | Ga0207700_10003264 | |||
| 1564 | Ga0207700_10034290 | |||
| 1565 | Ga0207700_10808439 | |||
| 1566 | Ga0207700_10866059 | |||
| 1567 | Ga0207700_11017347 | |||
| 1568 | Ga0207664_10010419 | |||
| 1569 | Ga0207664_11670779 | |||
| 1570 | Ga0207664_11742984 | |||
| 1571 | Ga0207644_10018730 | |||
| 1572 | Ga0207690_10015527 | |||
| 1573 | Ga0207690_11026227 | |||
| 1574 | Ga0207690_11200792 | |||
| 1575 | Ga0207690_11406743 | |||
| 1576 | Ga0207706_10030233 | |||
| 1577 | Ga0207706_11467437 | |||
| 1578 | Ga0207686_11487021 | |||
| 1579 | Ga0207670_10053403 | |||
| 1580 | Ga0207670_10192108 | |||
| 1581 | Ga0207670_10628470 | |||
| 1582 | Ga0207665_10238338 | |||
| 1583 | Ga0207665_10254816 | |||
| 1584 | Ga0207691_10021575 | |||
| 1585 | Ga0207711_11032478 | |||
| 1586 | Ga0207711_11452298 | |||
| 1587 | Ga0207661_10039485 | |||
| 1588 | Ga0207661_10141404 | |||
| 1589 | Ga0207661_10621201 | |||
| 1590 | Ga0207661_11740550 | |||
| 1591 | Ga0207679_10003731 | |||
| 1592 | Ga0207679_10289028 | |||
| 1593 | Ga0207679_10917863 | |||
| 1594 | Ga0207679_11831436 | |||
| 1595 | Ga0207667_10435483 | |||
| 1596 | Ga0207667_10523275 | |||
| 1597 | Ga0207651_11077952 | |||
| 1598 | Ga0207712_11009142 | |||
| 1599 | Ga0207712_11073256 | |||
| 1600 | Ga0207668_10031521 | |||
| 1601 | Ga0207668_11931043 | |||
| 1602 | Ga0207640_11360506 | |||
| 1603 | Ga0207658_12121673 | |||
| 1604 | Ga0207677_10167050 | |||
| 1605 | Ga0207677_10255235 | |||
| 1606 | Ga0207703_10317468 | |||
| 1607 | Ga0207639_10072464 | |||
| 1608 | Ga0207639_11366650 | |||
| 1609 | Ga0207639_11820156 | |||
| 1610 | Ga0207678_10858285 | |||
| 1611 | Ga0207678_10959994 | |||
| 1612 | Ga0207678_11215445 | |||
| 1613 | Ga0207708_10119093 | |||
| 1614 | Ga0207708_10638490 | |||
| 1615 | Ga0207702_10017073 | |||
| 1616 | Ga0207702_10072516 | |||
| 1617 | Ga0207641_10007209 | |||
| 1618 | Ga0207641_10110520 | |||
| 1619 | Ga0207648_10406847 | |||
| 1620 | Ga0207676_10002451 | |||
| 1621 | Ga0207676_10286665 | |||
| 1622 | Ga0207674_10043063 | |||
| 1623 | Ga0207674_10104826 | |||
| 1624 | Ga0207675_100028646 | |||
| 1625 | Ga0207675_100332863 | |||
| 1626 | Ga0207683_10031983 | |||
| 1627 | Ga0207683_10218976 | |||
| 1628 | Ga0207683_10306387 | |||
| 1629 | Ga0207683_11506685 | |||
| 1630 | Ga0207698_10023796 | |||
| 1631 | Ga0207698_10638913 | |||
| 1632 | Ga0207428_10002902 | |||
| 1633 | Ga0268266_10036855 | |||
| 1634 | Ga0268266_10106164 | |||
| 1635 | Ga0268265_11272482 | |||
| 1636 | Ga0268264_10281820 | |||
| 1637 | Ga0307517_10118346 | |||
| 1638 | Ga0307515_10001812 | |||
| 1639 | Ga0307515_10051195 | |||
| 1640 | Ga0307515_10104593 | |||
| 1641 | Ga0307511_10116992 | |||
| 1642 | Ga0307512_10007298 | |||
| 1643 | Ga0307513_10017932 | |||
| 1644 | Ga0307513_10103919 | |||
| 1645 | Ga0307513_10112852 | |||
| 1646 | Ga0307513_10266258 | |||
| 1647 | Ga0307408_100261093 | |||
| 1648 | Ga0307408_100264370 | |||
| 1649 | Ga0307408_100337570 | |||
| 1650 | Ga0307408_101138352 | |||
| 1651 | Ga0307408_101445278 | |||
| 1652 | Ga0307408_101931294 | |||
| 1653 | Ga0307508_10003351 | |||
| 1654 | Ga0307508_10012047 | |||
| 1655 | Ga0307508_10179119 | |||
| 1656 | Ga0307508_10463955 | |||
| 1657 | Ga0307514_10413159 | |||
| 1658 | Ga0307516_10023078 | |||
| 1659 | Ga0307516_10049250 | |||
| 1660 | Ga0307516_10080069 | |||
| 1661 | Ga0307405_10076719 | |||
| 1662 | Ga0307405_10161360 | |||
| 1663 | Ga0307405_10218801 | |||
| 1664 | Ga0307405_10236329 | |||
| 1665 | Ga0307405_10273516 | |||
| 1666 | Ga0307405_10589329 | |||
| 1667 | Ga0307405_10972683 | |||
| 1668 | Ga0307413_10340662 | |||
| 1669 | Ga0307413_10356678 | |||
| 1670 | Ga0307413_10394382 | |||
| 1671 | Ga0307413_10504691 | |||
| 1672 | Ga0307413_10534963 | |||
| 1673 | Ga0307413_10746142 | |||
| 1674 | Ga0307413_10881248 | |||
| 1675 | Ga0307413_11377922 | |||
| 1676 | Ga0307413_11479240 | |||
| 1677 | Ga0307518_10284046 | |||
| 1678 | Ga0307410_10109410 | |||
| 1679 | Ga0307410_10191571 | |||
| 1680 | Ga0307410_10236459 | |||
| 1681 | Ga0307410_10391672 | |||
| 1682 | Ga0307410_10693864 | |||
| 1683 | Ga0307410_10929522 | |||
| 1684 | Ga0307410_11315877 | |||
| 1685 | Ga0307410_11636273 | |||
| 1686 | Ga0307410_12049908 | |||
| 1687 | Ga0326468_10001157 | |||
| 1688 | Ga0307406_10024435 | |||
| 1689 | Ga0307406_10028359 | |||
| 1690 | Ga0307406_10177088 | |||
| 1691 | Ga0307406_10188837 | |||
| 1692 | Ga0307406_10518339 | |||
| 1693 | Ga0307406_10876782 | |||
| 1694 | Ga0307406_11152717 | |||
| 1695 | Ga0307406_11232334 | |||
| 1696 | Ga0307407_10035608 | |||
| 1697 | Ga0307407_10039561 | |||
| 1698 | Ga0307407_10253678 | |||
| 1699 | Ga0307407_10279627 | |||
| 1700 | Ga0307407_10339391 | |||
| 1701 | Ga0307407_10366312 | |||
| 1702 | Ga0307407_11022059 | |||
| 1703 | Ga0307412_10065395 | |||
| 1704 | Ga0307412_10095271 | |||
| 1705 | Ga0307412_10325618 | |||
| 1706 | Ga0307412_10910006 | |||
| 1707 | Ga0307412_11251693 | |||
| 1708 | Ga0307409_100017545 | |||
| 1709 | Ga0307409_100052854 | |||
| 1710 | Ga0307409_100094193 | |||
| 1711 | Ga0307409_100341855 | |||
| 1712 | Ga0307409_100476313 | |||
| 1713 | Ga0307409_100635273 | |||
| 1714 | Ga0307409_100886394 | |||
| 1715 | Ga0307409_100930118 | |||
| 1716 | Ga0307409_101047794 | |||
| 1717 | Ga0307409_101632127 | |||
| 1718 | Ga0307409_102331514 | |||
| 1719 | Ga0307409_102407541 | |||
| 1720 | Ga0307416_100014883 | |||
| 1721 | Ga0307416_100036084 | |||
| 1722 | Ga0307416_100064521 | |||
| 1723 | Ga0307416_100154192 | |||
| 1724 | Ga0307416_100189090 | |||
| 1725 | Ga0307416_100330505 | |||
| 1726 | Ga0307416_100644594 | |||
| 1727 | Ga0307416_100727581 | |||
| 1728 | Ga0307416_101050605 | |||
| 1729 | Ga0307416_101336454 | |||
| 1730 | Ga0307416_101505571 | |||
| 1731 | Ga0307416_103395600 | |||
| 1732 | Ga0307416_103497754 | |||
| 1733 | Ga0307414_10225085 | |||
| 1734 | Ga0307414_10461493 | |||
| 1735 | Ga0307414_10702795 | |||
| 1736 | Ga0307414_11126115 | |||
| 1737 | Ga0307414_11486590 | |||
| 1738 | Ga0307414_11495097 | |||
| 1739 | Ga0307411_10056847 | |||
| 1740 | Ga0307411_10101205 | |||
| 1741 | Ga0307411_10200982 | |||
| 1742 | Ga0307411_11262069 | |||
| 1743 | Ga0307411_11412900 | |||
| 1744 | Ga0307411_11665949 | |||
| 1745 | Ga0307415_100008029 | |||
| 1746 | Ga0307415_100033892 | |||
| 1747 | Ga0307415_100131993 | |||
| 1748 | Ga0307415_100236273 | |||
| 1749 | Ga0307415_100308833 | |||
| 1750 | Ga0307415_100369152 | |||
| 1751 | Ga0307415_100513396 | |||
| 1752 | Ga0307415_100608634 | |||
| 1753 | Ga0307415_101022041 | |||
| 1754 | Ga0307415_101117753 | |||
| 1755 | Ga0307415_102286906 | |||
| 1756 | Ga0373950_0014056 | |||
| 1757 | Ga0373929_0133123 | |||
| 1758 | Ga0373929_0242963 | |||
| 1759 | Ga0373940_0007085 | |||
| 1760 | Ga0373940_0164876 | |||
| 1761 | Ga0373951_0000463 | |||
| 1762 | Ga0373952_0048318 | |||
| 1763 | Ga0373932_0186273 | |||
| 1764 | Ga0373936_0222380 | |||
| 1765 | Ga0373945_0193415 | |||
| 1766 | Ga0373960_0174214 | |||
| 1767 | Ga0373943_0359790 | |||
| 1768 | Ga0373946_0276810 | |||
| 1769 | Ga0373942_0000479 | |||
| 1770 | Ga0373942_0045512 | |||
| 1771 | Ga0373962_0004423 | |||
| 1772 | Ga0373931_0046447 | |||
| 1773 | Ga0373931_0125226 | |||
| 1774 | Ga0373931_0621784 | |||
| 1775 | Ga0373935_0017873 | |||
| 1776 | Ga0373935_0643016 | |||
| 1777 | Ga0373935_0862703 | |||
| 1778 | Ga0373925_0456924 | |||
| 1779 | Ga0373925_1125641 | |||
| 1780 | Ga0395899_0254458 | |||
| 1781 | Ga0395899_0404327 | |||
| 1782 | Ga0395899_0590332 | |||
| 1783 | Ga0395899_0673174 | |||
| 1784 | Ga0395900_0014327 | |||
| 1785 | Ga0395900_0123671 | |||
| 1786 | Ga0395900_0431590 | |||
| 1787 | Ga0395900_1879661 | |||
| 1788 | Ga0395898_0021962 | |||
| 1789 | Ga0395898_0052865 | |||
| 1790 | Ga0395898_0072810 | |||
| 1791 | Ga0395898_0185594 | |||
| 1792 | Ga0395905_0932659 | |||
| 1793 | Ga0436364_0331973 | |||
| 1794 | Ga0436364_0851430 | |||
| 1795 | Ga0395901_0008088 | |||
| 1796 | Ga0395901_0013538 | |||
| 1797 | Ga0395901_0042762 | |||
| 1798 | Ga0395901_0183293 | |||
| 1799 | Ga0436363_1651514 | |||
| 1800 | Ga0439447_053842 | |||
| 1801 | Ga0451789_0657542 | |||
| 1802 | Ga0451791_1217965 | |||
| 1803 | Ga0451793_0887120 | |||
| 1804 | Ga0451801_15528 | |||
| 1805 | Ga0451802_1574513 | |||
| 1806 | Ga0451804_0214233 | |||
| 1807 | Ga0451804_0678624 | |||
| 1808 | Ga0451807_0691119 | |||
| 1809 | Ga0451835_0487623 | |||
| 1810 | Ga0451837_0823205 | |||
| 1811 | Ga0451839_0748863 | |||
| 1812 | Ga0451841_0159007 | |||
| 1813 | Ga0451847_0907213 | |||
| 1814 | Ga0451843_0355274 | |||
| 1815 | Ga0451853_0669882 | |||
| 1816 | Ga0451853_2012304 | |||
| 1817 | Ga0439433_0084542 | |||
| 1818 | Ga0439448_0026261 | |||
| 1819 | Ga0439463_025905 | |||
| 1820 | Ga0439463_212223 | |||
| 1821 | Ga0450923_111259 | |||
| 1822 | Ga0450900_010409 | |||
| 1823 | Ga0450902_029835 | |||
| 1824 | Ga0450905_009200 | |||
| 1825 | Ga0439459_0008060 | |||
| 1826 | Ga0439459_0113624 | |||
| 1827 | Ga0439459_0152160 | |||
| 1828 | Ga0439464_0027423 | |||
| 1829 | Ga0439464_0055266 | |||
| 1830 | Ga0450901_040448 | |||
| 1831 | Ga0466969_0112933 | |||
| 1832 | Ga0466969_0521973 | |||
| 1833 | Ga0466972_0151683 | |||
| 1834 | Ga0466965_0087939 | |||
| 1835 | Ga0466965_0668230 | |||
| 1836 | Ga0466966_0215282 | |||
| 1837 | Ga0466966_0544677 | |||
| 1838 | Ga0466966_0829636 | |||
| 1839 | Ga0466961_0104065 | |||
| 1840 | Ga0466961_0331429 | |||
| 1841 | Ga0466961_0534953 | |||
| 1842 | Ga0466963_0012748 | |||
| 1843 | Ga0466963_0387822 | |||
| 1844 | Ga0466963_0462324 | |||
| 1845 | Ga0466963_0490286 | |||
| 1846 | Ga0466963_0746615 | |||
| 1847 | Ga0466964_0252763 | |||
| 1848 | Ga0466964_0397261 | |||
| 1849 | Ga0466964_0704063 | |||
| 1850 | Ga0466964_0922303 | |||
| 1851 | Ga0466971_0045049 | |||
| 1852 | Ga0466971_0209828 | |||
| 1853 | Ga0466971_0402477 | |||
| 1854 | Ga0466968_0270107 | |||
| 1855 | Ga0466970_0101046 | |||
| 1856 | Ga0466970_0186881 | |||
| 1857 | Ga0466970_0227635 | |||
| 1858 | Ga0466970_0333703 | |||
| 1859 | Ga0466970_0371307 | |||
| 1860 | Ga0466970_0511510 | |||
| 1861 | Ga0466957_0006102 | |||
| 1862 | Ga0466957_0290325 | |||
| 1863 | Ga0466957_0932066 | |||
| 1864 | Ga0466957_1119544 | |||
| 1865 | Ga0466960_0126172 | |||
| 1866 | Ga0466960_0178241 | |||
| 1867 | Ga0466960_0321500 | |||
| 1868 | Ga0466960_0388962 | |||
| 1869 | Ga0466960_0605751 | |||
| 1870 | Ga0466959_0103930 | |||
| 1871 | Ga0466959_0245006 | |||
| 1872 | Ga0466959_0395638 | |||
| 1873 | Ga0466959_0502413 | |||
| 1874 | Ga0466959_0637839 | |||
| 1875 | Ga0466959_0686772 | |||
| 1876 | Ga0466959_0714098 | |||
| 1877 | Ga0466958_0006910 | |||
| 1878 | Ga0466958_0069284 | |||
| 1879 | Ga0466958_0292197 | |||
| 1880 | Ga0466958_0574976 | |||
| 1881 | Ga0466958_1032283 | |||
| 1882 | Ga0466967_0214532 | |||
| 1883 | Ga0466967_0346000 | |||
| 1884 | Ga0466967_0502429 | |||
| 1885 | Ga0466967_1487806 | |||
| 1886 | Ga0466967_2261283 | |||
| 1887 | Ga0495603_0505647 | |||
| 1888 | Ga0495629_0029225 | |||
| 1889 | Ga0495638_0239364 | |||
| 1890 | Ga0495641_0558516 | |||
| 1891 | Ga0495582_0581073 | |||
| 1892 | Ga0495585_0184036 | |||
| 1893 | Ga0495616_0340944 | |||
| 1894 | Ga0495631_0099125 | |||
| 1895 | Ga0495632_0021539 | |||
| 1896 | Ga0495632_0052375 | |||
| 1897 | Ga0495644_0216348 | |||
| 1898 | Ga0495654_0186332 | |||
| 1899 | Ga0495640_0579224 | |||
| 1900 | Ga0495609_0215830 | |||
| 1901 | Ga0495621_0118080 | |||
| 1902 | Ga0495656_0119943 | |||
| 1903 | Ga0495656_0307750 | |||
| 1904 | Ga0495668_0250283 | |||
| 1905 | Ga0495661_0406478 | |||
| 1906 | Ga0495588_0307163 | |||
| 1907 | Ga0495657_0454280 | |||
| 1908 | Ga0495658_0456178 | |||
| 1909 | Ga0495669_0019422 | |||
| 1910 | Ga0495613_1004268 | |||
| 1911 | Ga0495624_0297375 | |||
| 1912 | Ga0495670_0130068 | |||
| 1913 | Ga0495581_0099232 | |||
| 1914 | Ga0495581_0106714 | |||
| 1915 | Ga0495676_0568775 | |||
| 1916 | Ga0495680_0846079 | |||
| 1917 | Ga0495675_0402568 | |||
| 1918 | Ga0495677_0028270 | |||
| 1919 | Ga0495685_254956 | |||
| 1920 | Ga0495593_0271436 | |||
| 1921 | Ga0495614_0552418 | |||
| 1922 | Ga0495615_0064206 | |||
| 1923 | Ga0496100_0577715 | |||
| 1924 | Ga0496102_0071684 | |||
| 1925 | Ga0496102_0989376 | |||
| 1926 | Ga0496104_0006275 | |||
| 1927 | Ga0496104_0544843 | |||
| 1928 | Ga0496105_0051832 | |||
| 1929 | Ga0496105_0679476 | |||
| 1930 | Ga0496105_0859331 | |||
| 1931 | Ga0496106_0014813 | |||
| 1932 | Ga0496106_0210540 | |||
| 1933 | Ga0496106_1054841 | |||
| 1934 | Ga0496107_0036486 | |||
| 1935 | Ga0496107_0474447 | |||
| 1936 | Ga0496108_0000043 | |||
| 1937 | Ga0496108_0023561 | |||
| 1938 | Ga0496108_0207592 | |||
| 1939 | Ga0496108_1409722 | |||
| 1940 | Ga0496109_0679033 | |||
| 1941 | Ga0496109_0948459 | |||
| 1942 | Ga0496110_0006221 | |||
| 1943 | Ga0496110_0850028 | |||
| 1944 | Ga0496111_0145743 | |||
| 1945 | Ga0496111_0830552 | |||
| 1946 | Ga0496112_0084231 | |||
| 1947 | Ga0496112_0210360 | |||
| 1948 | Ga0496112_0809318 | |||
| 1949 | Ga0496113_0098655 | |||
| 1950 | Ga0496113_0183972 | |||
| 1951 | Ga0496113_0548820 | |||
| 1952 | Ga0496114_0955653 | |||
| 1953 | Ga0496114_1766659 | |||
| 1954 | Ga0496115_0036607 | |||
| 1955 | Ga0496115_0215335 | |||
| 1956 | Ga0496115_0519805 | |||
| 1957 | Ga0496126_0039353 | |||
| 1958 | Ga0496126_1104051 | |||
| 1959 | Ga0501306_015842 | |||
| 1960 | Ga0501306_041094 | |||
| 1961 | Ga0501306_042794 | |||
| 1962 | Ga0501306_060023 | |||
| 1963 | Ga0501306_107771 | |||
| 1964 | Ga0501308_013417 | |||
| 1965 | Ga0501308_037168 | |||
| 1966 | Ga0501308_038362 | |||
| 1967 | Ga0501309_019895 | |||
| 1968 | Ga0501309_047685 | |||
| 1969 | Ga0501309_057543 | |||
| 1970 | Ga0501309_077048 | |||
| 1971 | Ga0501310_015665 | |||
| 1972 | Ga0501310_022772 | |||
| 1973 | Ga0501310_045021 | |||
| 1974 | Ga0501310_052217 | |||
| 1975 | Ga0501341_07343 | |||
| 1976 | Ga0501341_11037 | |||
| 1977 | Ga0501341_15040 | |||
| 1978 | Ga0501304_010765 | |||
| 1979 | Ga0501305_059256 | |||
| 1980 | Ga0501305_066644 | |||
| 1981 | Ga0501307_020498 | |||
| 1982 | Ga0501307_043099 | |||
| 1983 | Ga0501307_049787 | |||
| 1984 | Ga0501294_011007 | |||
| 1985 | Ga0501311_024050 | |||
| 1986 | Ga0501312_004720 | |||
| 1987 | Ga0501312_020483 | |||
| 1988 | Ga0501313_016430 | |||
| 1989 | Ga0501313_050527 | |||
| 1990 | Ga0501314_004579 | |||
| 1991 | Ga0501314_008510 | |||
| 1992 | Ga0501314_033788 | |||
| 1993 | Ga0501315_021741 | |||
| 1994 | Ga0501315_032613 | |||
| 1995 | Ga0501316_032470 | |||
| 1996 | Ga0501316_038761 | |||
| 1997 | Ga0501317_009803 | |||
| 1998 | Ga0501317_022426 | |||
| 1999 | Ga0501317_024948 | |||
| 2000 | Ga0501318_002847 | |||
| 2001 | Ga0501318_014714 | |||
| 2002 | Ga0501318_027680 | |||
| 2003 | Ga0501318_034788 | |||
| 2004 | Ga0501318_035505 | |||
| 2005 | Ga0501318_035750 | |||
| 2006 | Ga0501318_043480 | |||
| 2007 | Ga0501319_001908 | |||
| 2008 | Ga0501319_002279 | |||
| 2009 | Ga0501320_025583 | |||
| 2010 | Ga0501320_027277 | |||
| 2011 | Ga0501320_028453 | |||
| 2012 | Ga0501320_046231 | |||
| 2013 | Ga0501321_021705 | |||
| 2014 | Ga0501321_025001 | |||
| 2015 | Ga0501321_039197 | |||
| 2016 | Ga0501321_043159 | |||
| 2017 | Ga0501322_000554 | |||
| 2018 | Ga0501322_011003 | |||
| 2019 | Ga0501323_038903 | |||
| 2020 | Ga0501323_039272 | |||
| 2021 | Ga0501323_092161 | |||
| 2022 | Ga0501324_003187 | |||
| 2023 | Ga0501324_003960 | |||
| 2024 | Ga0501324_008952 | |||
| 2025 | Ga0501324_018450 | |||
| 2026 | Ga0501324_019575 | |||
| 2027 | Ga0501324_026983 | |||
| 2028 | Ga0501325_008439 | |||
| 2029 | Ga0501325_011558 | |||
| 2030 | Ga0501325_020811 | |||
| 2031 | Ga0501325_053628 | |||
| 2032 | Ga0501325_056154 | |||
| 2033 | Ga0501326_06330 | |||
| 2034 | Ga0501330_008147 | |||
| 2035 | Ga0501330_009879 | |||
| 2036 | Ga0501332_09188 | |||
| 2037 | Ga0501333_004109 | |||
| 2038 | Ga0501336_010878 | |||
| 2039 | Ga0501337_004918 | |||
| 2040 | Ga0501340_001733 | |||
| 2041 | Ga0501340_012472 | |||
| 2042 | Ga0501031_0032070 | |||
| 2043 | Ga0501031_0251952 | |||
| 2044 | Ga0501031_0255011 | |||
| 2045 | Ga0501032_0025353 | |||
| 2046 | Ga0501032_0027327 | |||
| 2047 | Ga0501032_0099412 | |||
| 2048 | Ga0501032_0129448 | |||
| 2049 | Ga0501033_0500218 | |||
| 2050 | Ga0501034_0043245 | |||
| 2051 | Ga0501034_0288249 | |||
| 2052 | Ga0501034_0716403 | |||
| 2053 | Ga0501036_0271293 | |||
| 2054 | Ga0501036_0683565 | |||
| 2055 | Ga0501037_0015377 | |||
| 2056 | Ga0501037_0023357 | |||
| 2057 | Ga0501038_0003477 | |||
| 2058 | Ga0501038_0419031 | |||
| 2059 | Ga0501038_0805865 | |||
| 2060 | Ga0501039_0020664 | |||
| 2061 | Ga0501039_0436639 | |||
| 2062 | Ga0501039_0700846 | |||
| 2063 | Ga0501040_1020907 | |||
| 2064 | Ga0501042_0348768 | |||
| 2065 | Ga0501042_0433902 | |||
| 2066 | Ga0501043_0009715 | |||
| 2067 | Ga0501043_0065711 | |||
| 2068 | Ga0501043_0912995 | |||
| 2069 | Ga0501043_1032153 | |||
| 2070 | Ga0501046_0525250 | |||
| 2071 | Ga0501046_0604004 | |||
| 2072 | Ga0501047_0000278 | |||
| 2073 | Ga0501047_0000811 | |||
| 2074 | Ga0501047_0053457 | |||
| 2075 | Ga0501047_0109201 | |||
| 2076 | Ga0501047_1395960 | |||
| 2077 | Ga0501048_0000853 | |||
| 2078 | Ga0501048_0511053 | |||
| 2079 | Ga0501048_0733973 | |||
| 2080 | Ga0501068_0226302 | |||
| 2081 | Ga0501068_0454140 | |||
| 2082 | Ga0501069_0324486 | |||
| 2083 | Ga0501070_0018107 | |||
| 2084 | Ga0501070_0084253 | |||
| 2085 | Ga0501070_0553621 | |||
| 2086 | Ga0501071_0288416 | |||
| 2087 | Ga0501071_0463056 | |||
| 2088 | Ga0501072_0852645 | |||
| 2089 | Ga0501072_1485199 | |||
| 2090 | Ga0501073_0188088 | |||
| 2091 | Ga0501073_1127616 | |||
| 2092 | Ga0501073_1128844 | |||
| 2093 | Ga0501074_0018515 | |||
| 2094 | Ga0501075_0243915 | |||
| 2095 | Ga0501075_0578735 | |||
| 2096 | Ga0501076_1129738 | |||
| 2097 | Ga0501077_0505915 | |||
| 2098 | Ga0501202_138270 | |||
| 2099 | Ga0501206_073400 | |||
| 2100 | Ga0501206_095777 | |||
| 2101 | Ga0501243_038166 | |||
| 2102 | Ga0501250_004678 | |||
| 2103 | Ga0501253_076304 | |||
| 2104 | Ga0501221_187885 | |||
| 2105 | Ga0501080_0004134 | |||
| 2106 | Ga0501080_0025709 | |||
| 2107 | Ga0501080_0862801 | |||
| 2108 | Ga0501081_0091990 | |||
| 2109 | Ga0501081_0501284 | |||
| 2110 | Ga0501271_063174 | |||
| 2111 | Ga0501281_16014 | |||
| 2112 | Ga0501035_0038436 | |||
| 2113 | Ga0501035_0202932 | |||
| 2114 | Ga0501044_0074873 | |||
| 2115 | Ga0501044_0095420 | |||
| 2116 | Ga0501044_0105745 | |||
| 2117 | Ga0501044_0551129 | |||
| 2118 | Ga0501045_0065355 | |||
| 2119 | Ga0501045_0759188 | |||
| 2120 | Ga0501212_016793 | |||
| 2121 | nmdc:mga03n38_186314_c1 | |||
| 2122 | nmdc:mga06z11_516640_c1 | |||
| 2123 | nmdc:mga05p37_123655_c1 | |||
| 2124 | nmdc:mga05p37_162208_c1 | |||
| 2125 | nmdc:mga05p37_177510_c1 | |||
| 2126 | nmdc:mga05p37_1822883_c1 | |||
| 2127 | nmdc:mga05p37_363629_c1 | |||
| 2128 | nmdc:mga05p37_716771_c1 | |||
| 2129 | nmdc:mga05p37_7235_c1 | |||
| 2130 | nmdc:mga05p37_834097_c1 | |||
| 2131 | nmdc:mga09592_24046_c1 | |||
| 2132 | nmdc:mga09592_271995_c1 | |||
| 2133 | nmdc:mga09592_3032_c1 | |||
| 2134 | nmdc:mga09592_425863_c1 | |||
| 2135 | nmdc:mga09592_96028_c1 | |||
| 2136 | nmdc:mga0qj67_35737_c1 | |||
| 2137 | nmdc:mga06r32_235136_c1 | |||
| 2138 | nmdc:mga06r32_33048_c1 | |||
| 2139 | nmdc:mga06r32_545733_c1 | |||
| 2140 | nmdc:mga06r32_880541_c1 | |||
| 2141 | nmdc:mga06r32_895258_c1 | |||
| 2142 | nmdc:mga08y16_1607870_c1 | |||
| 2143 | nmdc:mga08y16_36056_c1 | |||
| 2144 | nmdc:mga0n895_486326_c1 | |||
| 2145 | nmdc:mga0n895_56468_c1 | |||
| 2146 | nmdc:mga0n895_776852_c1 | |||
| 2147 | nmdc:mga0rr50_43762_c1 | |||
| 2148 | nmdc:mga08x19_3249_c1 | |||
| 2149 | nmdc:mga0a205_1925_c1 | |||
| 2150 | nmdc:mga0a205_493254_c1 | |||
| 2151 | Ga0495655_0336295 | |||
| 2152 | Ga0500578_0187199 | |||
| 2153 | Ga0500643_001399 | |||
| 2154 | Ga0500644_0006960 | |||
| 2155 | Ga0500644_0050399 | |||
| 2156 | Ga0500644_0177867 | |||
| 2157 | Ga0500646_0005473 | |||
| 2158 | Ga0500651_0042524 | |||
| 2159 | Ga0500641_0008601 | |||
| 2160 | Ga0500641_0013366 | |||
| 2161 | Ga0500650_0055724 | |||
| 2162 | Ga0500660_115897 | |||
| 2163 | Ga0500556_0054639 | |||
| 2164 | Ga0500562_032531 | |||
| 2165 | Ga0500569_001934 | |||
| 2166 | Ga0500594_0057890 | |||
| 2167 | Ga0500621_130042 | |||
| 2168 | Ga0500652_002002 | |||
| 2169 | Ga0500658_0217687 | |||
| 2170 | Ga0500579_078834 | |||
| 2171 | Ga0500588_0002195 | |||
| 2172 | Ga0500588_0084668 | |||
| 2173 | Ga0500589_157930 | |||
| 2174 | Ga0500622_0138576 | |||
| 2175 | Ga0500630_285297 | |||
| 2176 | Ga0500633_0251722 | |||
| 2177 | Ga0500634_0377664 | |||
| 2178 | Ga0587084_011899 | |||
| 2179 | Ga0587084_032338 | |||
| 2180 | Ga0587084_034181 | |||
| 2181 | Ga0587084_083035 | |||
| 2182 | Ga0587084_102646 | |||
| 2183 | Ga0587093_006992 | |||
| 2184 | Ga0587093_022718 | |||
| 2185 | Ga0587066_055425 | |||
| 2186 | Ga0587066_117250 | |||
| 2187 | Ga0587070_051962 | |||
| 2188 | Ga0587070_117878 | |||
| 2189 | Ga0587070_185580 | |||
| 2190 | Ga0587073_0080963 | |||
| 2191 | Ga0587073_0266780 | |||
| 2192 | Ga0587073_0273658 | |||
| 2193 | Ga0587077_086063 | |||
| 2194 | Ga0587077_176178 | |||
| 2195 | Ga0587080_011481 | |||
| 2196 | Ga0587080_012877 | |||
| 2197 | Ga0587080_160302 | |||
| 2198 | Ga0587082_178140 | |||
| 2199 | Ga0587083_0031125 | |||
| 2200 | Ga0587083_0032986 | |||
| 2201 | Ga0587083_0036588 | |||
| 2202 | Ga0587083_0096390 | |||
| 2203 | Ga0587083_0118035 | |||
| 2204 | Ga0587083_0129878 | |||
| 2205 | Ga0587083_0163716 | |||
| 2206 | Ga0587083_0201997 | |||
| 2207 | Ga0587085_011491 | |||
| 2208 | Ga0587085_019890 | |||
| 2209 | Ga0587085_101757 | |||
| 2210 | Ga0587086_018073 | |||
| 2211 | Ga0587086_023672 | |||
| 2212 | Ga0587088_050557 | |||
| 2213 | Ga0587088_056450 | |||
| 2214 | Ga0587089_016154 | |||
| 2215 | Ga0587090_015681 | |||
| 2216 | Ga0587090_044881 | |||
| 2217 | Ga0587090_121466 | |||
| 2218 | Ga0587091_012183 | |||
| 2219 | Ga0587091_023594 | |||
| 2220 | Ga0587091_025987 | |||
| 2221 | Ga0587091_102323 | |||
| 2222 | Ga0587092_004442 | |||
| 2223 | Ga0587092_030061 | |||
| 2224 | Ga0587092_049007 | |||
| 2225 | Ga0587092_052695 | |||
| 2226 | Ga0587092_088680 | |||
| 2227 | Ga0587094_040989 | |||
| 2228 | Ga0587094_051581 | |||
| 2229 | Ga0587098_005401 | |||
| 2230 | Ga0587098_039472 | |||
| 2231 | Ga0587098_065869 | |||
| 2232 | Ga0587106_004030 | |||
| 2233 | Ga0587106_028574 | |||
| 2234 | Ga0587106_074765 | |||
| 2235 | Ga0587106_122465 | |||
| 2236 | Ga0587125_002113 | |||
| 2237 | Ga0587129_008560 | |||
| 2238 | Ga0587099_006116 | |||
| 2239 | Ga0587101_016593 | |||
| 2240 | Ga0587109_049071 | |||
| 2241 | Ga0587109_076477 | |||
| 2242 | Ga0587109_093501 | |||
| 2243 | Ga0587109_101306 | |||
| 2244 | Ga0587115_033939 | |||
| 2245 | Ga0587115_081177 | |||
| 2246 | Ga0587117_024422 | |||
| 2247 | Ga0587117_064563 | |||
| 2248 | Ga0587122_036941 | |||
| 2249 | Ga0587127_006350 | |||
| 2250 | Ga0587128_017047 | |||
| 2251 | Ga0587128_053654 | |||
| 2252 | Ga0587128_125004 | |||
| 2253 | Ga0587062_003426 | |||
| 2254 | Ga0587067_049243 | |||
| 2255 | Ga0587068_019156 | |||
| 2256 | Ga0587068_053142 | |||
| 2257 | Ga0587069_154504 | |||
| 2258 | Ga0587072_029663 | |||
| 2259 | Ga0587072_078861 | |||
| 2260 | Ga0587072_196961 | |||
| 2261 | Ga0587075_053087 | |||
| 2262 | Ga0587076_006901 | |||
| 2263 | Ga0587076_111178 | |||
| 2264 | Ga0587076_147397 | |||
| 2265 | Ga0587076_155865 | |||
| 2266 | Ga0587078_063842 | |||
| 2267 | Ga0587079_112206 | |||
| 2268 | Ga0587079_190887 | |||
| 2269 | Ga0587079_191740 | |||
| 2270 | Ga0587107_020410 | |||
| 2271 | Ga0587107_034467 | |||
| 2272 | Ga0587107_109028 | |||
| 2273 | Ga0587108_003256 | |||
| 2274 | Ga0587108_018973 | |||
| 2275 | Ga0587110_036107 | |||
| 2276 | Ga0587114_009789 | |||
| 2277 | Ga0587114_011482 | |||
| 2278 | Ga0587114_100857 | |||
| 2279 | Ga0587118_22038 | |||
| 2280 | Ga0587119_004905 | |||
| 2281 | Ga0587119_020492 | |||
| 2282 | Ga0587120_013445 | |||
| 2283 | Ga0587071_013067 | |||
| 2284 | Ga0587071_065132 | |||
| 2285 | Ga0587071_072454 | |||
| 2286 | Ga0587071_108677 | |||
| 2287 | Ga0587071_142931 | |||
| 2288 | Ga0587071_159053 | |||
| 2289 | Ga0587111_0052099 | |||
| 2290 | Ga0587111_0182057 | |||
| 2291 | Ga0501082_0538361 | |||
| 2292 | Ga0466962_0029867 | |||
| 2293 | Ga0466962_0186980 | |||
| 2294 | Ga0466962_0192437 | |||
| 2295 | Ga0466962_0728950 | |||
| 2296 | Ga0530510_0444541 | |||
| 2297 | 2501945902 | |||
| 2298 | 2515496689 | |||
| 2299 | 2515718310 | |||
| 2300 | 2515756928 | |||
| 2301 | 2516083530 | |||
| 2302 | 2516089466 | |||
| 2303 | 2623497648 | |||
| 2304 | 2623585036 | |||
| 2305 | 2772644892 | |||
| 2306 | 2867510880 | |||
| 2307 | 2996223711 | |||
| 2308 | 649810773 | |||
| 2309 | 8003835116 | |||
| 2310 | 8003862015 | |||
| 2311 | 8003872925 | |||
| 2312 | 8055412841 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xym-assembly1.cif.gz_U | large subunit of mycobacterium smegmatis | 0.9671 | 18 | 121 |
| 5xym-assembly1.cif.gz_U | large subunit of mycobacterium smegmatis | 0.956 | 18 | 121 |
| 7mt3-assembly1.cif.gz_U | mtb 70s with p/e trna | 0.9462 | 18 | 120 |
| 5o61-assembly1.cif.gz_V | the complete structure of the mycobacterium smegmatis 70s ribosome | 0.9376 | 18 | 121 |
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9372 | 16 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHB7_1_104_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9531 | 18 | 120 | 2.30.30.30 |
| af_C6KSP8_36_136_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9441 | 17 | 119 | 2.30.30.30 |
| af_P9WHB7_1_104_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9356 | 18 | 120 | 2.30.30.30 |
| af_Q69T55_240_282_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8991 | 20 | 53 | 2.30.30.30 |
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8805 | 18 | 120 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V2Q2Y1-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9615 | 18 | 121 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A323VGA6-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9566 | 18 | 121 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1V2Q2Y1-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9527 | 18 | 121 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7K1C5Y8-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9518 | 18 | 121 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A6J7HUI7-F1-model_v4 | Unannotated protein | 0.9508 | 17 | 121 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |