F490943

General Info

Members Datasets Scaffolds Average Seq Length
1156 511 2312 110

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0314590|Ga0395900_0314590_1035_1415
Length 126
Sequence MATKSRTGKKIDSATSRAKAPSMKVKKGDTVQVLSGKDRGAKGRVIAAYPQTQKVLVEGVGRIKKHTRISTTQRGAQQGGIVTQEAPIHVSNVMVVDSDNKPTRVGYRKDEDGRSIRVSRRTGKDL

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
24 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
120 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
124 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
125 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
126 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
127 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
146 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
214 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
239 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
256 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
257 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
258 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
259 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
260 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
261 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
262 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
263 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
264 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
265 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
266 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
267 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
268 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
273 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
274 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
275 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
276 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
277 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
283 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
286 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
287 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
288 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
292 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
305 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
308 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
352 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
396 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
397 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
398 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
399 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
400 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
401 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
402 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
403 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
407 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
408 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
412 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
415 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
416 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
417 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
424 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
425 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
426 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
427 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
428 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
429 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
430 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
431 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
432 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
433 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
434 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
435 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
436 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
437 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
438 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
439 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
440 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
441 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
442 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
443 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
444 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
445 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
446 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
494 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
495 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
496 2501939600 Micromonospora sp. L5 Isolate Unclassified
497 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
498 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
499 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
500 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
501 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
502 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
503 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
504 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
505 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
506 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
507 649633069 Micromonospora sp. L5 Isolate Unclassified
508 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
509 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
510 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
511 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.13
Metatranscriptomes 24.48
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0.09
Rhizoplane 3.63
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0314590 3300037418 Bacteria 1548
2 bgg_mtDRAFT_1028703 3300000305 Bacteria 952
3 JGI24752J21851_1001457 3300001976 Bacteria 3185
4 JGI24737J22298_10125765 3300001990 Bacteria 757
5 JGI24743J22301_10011093 3300001991 Bacteria 1617
6 JGI24735J21928_10104889 3300002067 Bacteria 812
7 JGI24745J21846_1007554 3300002073 Bacteria 1218
8 JGI24033J26618_1002668 3300002155 Bacteria 1838
9 JGI24751J29686_10002090 3300002459 Bacteria 4053
10 Ga0006759J45824_1021421 3300003163 Bacteria 826
11 Ga0006759J45824_1044275 3300003163 Bacteria 697
12 JGI25406J46586_10026916 3300003203 Bacteria 2211
13 JGI25406J46586_10071578 3300003203 Bacteria 1087
14 JGI25406J46586_10115402 3300003203 Bacteria 793
15 Ga0007427J51700_112200 3300003559 Bacteria 664
16 Ga0006781J51513_1011028 3300003568 Bacteria 1223
17 Ga0007410J51695_1032800 3300003574 Bacteria 665
18 Ga0007409J51694_1019784 3300003575 Bacteria 964
19 Ga0007416J51690_1032530 3300003577 Bacteria 814
20 Ga0007429J51699_1019317 3300003579 Bacteria 687
21 Ga0007429J51699_1024229 3300003579 Bacteria 826
22 Ga0007429J51699_1027973 3300003579 Bacteria 743
23 JGI25404J52841_10003021 3300003659 Bacteria 3276
24 Ga0032354_1016850 3300003693 Bacteria 602
25 Ga0006780_1007700 3300003735 Bacteria 778
26 Ga0058863_10025403 3300004799 Bacteria 1837
27 Ga0058863_10092824 3300004799 Bacteria 1243
28 Ga0058863_11918314 3300004799 Bacteria 960
29 Ga0058861_10005407 3300004800 Bacteria 2249
30 Ga0058861_10056599 3300004800 Bacteria 1345
31 Ga0058861_10061286 3300004800 Bacteria 600
32 Ga0058861_12074364 3300004800 Bacteria 1181
33 Ga0058860_12144835 3300004801 Bacteria 669
34 Ga0058862_12840177 3300004803 Bacteria 1934
35 Ga0070658_10013033 3300005327 Bacteria 6672
36 Ga0070658_10066569 3300005327 Bacteria 2943
37 Ga0070658_10251817 3300005327 Bacteria 1498
38 Ga0070658_10821661 3300005327 Bacteria 807
39 Ga0070658_11375985 3300005327 Bacteria 612
40 Ga0070676_10033824 3300005328 Bacteria 2933
41 Ga0070676_10576225 3300005328 Bacteria 809
42 Ga0070676_11003862 3300005328 Bacteria 626
43 Ga0070683_100012328 3300005329 Bacteria 7426
44 Ga0070683_100139274 3300005329 Bacteria 2298
45 Ga0070683_100501523 3300005329 Bacteria 1159
46 Ga0070683_100610950 3300005329 Bacteria 1044
47 Ga0070683_100714779 3300005329 Bacteria 960
48 Ga0070683_101829162 3300005329 Bacteria 584
49 Ga0070690_100679803 3300005330 Bacteria 789
50 Ga0070670_100035439 3300005331 Bacteria 4295
51 Ga0070677_10765478 3300005333 Bacteria 549
52 Ga0068869_100267928 3300005334 Bacteria 1369
53 Ga0070666_10803093 3300005335 Bacteria 693
54 Ga0070680_100013480 3300005336 Bacteria 6366
55 Ga0070680_100066109 3300005336 Bacteria 2964
56 Ga0070680_100779747 3300005336 Bacteria 823
57 Ga0070682_100095043 3300005337 Bacteria 1956
58 Ga0070682_100323753 3300005337 Bacteria 1140
59 Ga0070682_100827531 3300005337 Bacteria 754
60 Ga0068868_100052866 3300005338 Bacteria 3198
61 Ga0068868_100479911 3300005338 Bacteria 1086
62 Ga0068868_101009345 3300005338 Bacteria 762
63 Ga0070660_100131054 3300005339 Bacteria 2006
64 Ga0070660_100592342 3300005339 Bacteria 927
65 Ga0070689_100100064 3300005340 Bacteria 2294
66 Ga0070689_101539684 3300005340 Bacteria 603
67 Ga0070691_10004434 3300005341 Bacteria 6380
68 Ga0070687_100085942 3300005343 Bacteria 1728
69 Ga0070692_10006088 3300005345 Bacteria 5209
70 Ga0070692_10159601 3300005345 Bacteria 1291
71 Ga0070668_100345821 3300005347 Bacteria 1257
72 Ga0070669_100825923 3300005353 Bacteria 789
73 Ga0070669_101880896 3300005353 Bacteria 523
74 Ga0070675_100061737 3300005354 Bacteria 3095
75 Ga0070675_100385802 3300005354 Bacteria 1248
76 Ga0070675_101001669 3300005354 Bacteria 767
77 Ga0070671_100012167 3300005355 Bacteria 6925
78 Ga0070671_100365181 3300005355 Bacteria 1232
79 Ga0070671_101088773 3300005355 Bacteria 701
80 Ga0070673_100078654 3300005364 Bacteria 2668
81 Ga0070688_100267788 3300005365 Bacteria 1223
82 Ga0070659_100167676 3300005366 Bacteria 1797
83 Ga0070659_100404644 3300005366 Bacteria 1153
84 Ga0070659_101656958 3300005366 Bacteria 572
85 Ga0070667_100280114 3300005367 Bacteria 1497
86 Ga0070709_10007508 3300005434 Bacteria 5982
87 Ga0070714_100046956 3300005435 Bacteria 3666
88 Ga0070714_100157812 3300005435 Bacteria 2050
89 Ga0070714_100189300 3300005435 Bacteria 1877
90 Ga0070714_100468881 3300005435 Bacteria 1198
91 Ga0070713_100005007 3300005436 Bacteria 8998
92 Ga0070713_100489194 3300005436 Bacteria 1160
93 Ga0070713_100511904 3300005436 Bacteria 1133
94 Ga0070713_101174224 3300005436 Bacteria 743
95 Ga0070713_102071782 3300005436 Bacteria 552
96 Ga0070710_10483697 3300005437 Bacteria 845
97 Ga0070710_10760959 3300005437 Bacteria 689
98 Ga0070701_10338638 3300005438 Bacteria 936
99 Ga0070701_10748916 3300005438 Bacteria 662
100 Ga0070711_100013620 3300005439 Bacteria 5109
101 Ga0070711_101201976 3300005439 Bacteria 656
102 Ga0070705_100134274 3300005440 Bacteria 1619
103 Ga0070705_100633146 3300005440 Bacteria 832
104 Ga0070700_100403361 3300005441 Bacteria 1028
105 Ga0070694_100531927 3300005444 Bacteria 939
106 Ga0070694_100596698 3300005444 Bacteria 889
107 Ga0070663_100133106 3300005455 Bacteria 1890
108 Ga0070663_100133371 3300005455 Bacteria 1888
109 Ga0070663_101529568 3300005455 Bacteria 594
110 Ga0070678_100046927 3300005456 Bacteria 3101
111 Ga0070678_100134588 3300005456 Bacteria 1969
112 Ga0070678_100142868 3300005456 Bacteria 1917
113 Ga0070662_100065234 3300005457 Bacteria 2669
114 Ga0070681_10104714 3300005458 Bacteria 2771
115 Ga0070681_10354040 3300005458 Bacteria 1378
116 Ga0070681_10976429 3300005458 Bacteria 767
117 Ga0070681_11130163 3300005458 Bacteria 704
118 Ga0070681_11474233 3300005458 Bacteria 605
119 Ga0070681_11530958 3300005458 Bacteria 592
120 Ga0068867_100358505 3300005459 Bacteria 1219
121 Ga0070679_100031334 3300005530 Bacteria 5252
122 Ga0070679_100239703 3300005530 Bacteria 1771
123 Ga0070679_100772996 3300005530 Bacteria 903
124 Ga0070679_101020353 3300005530 Bacteria 771
125 Ga0070679_101304760 3300005530 Bacteria 671
126 Ga0070684_100060826 3300005535 Bacteria 3304
127 Ga0070684_100850629 3300005535 Bacteria 854
128 Ga0068853_100024387 3300005539 Bacteria 5070
129 Ga0068853_102445376 3300005539 Bacteria 506
130 Ga0070672_100064670 3300005543 Bacteria 2891
131 Ga0070686_100081289 3300005544 Bacteria 2146
132 Ga0070686_100886874 3300005544 Bacteria 725
133 Ga0070695_100913122 3300005545 Bacteria 710
134 Ga0070696_100696223 3300005546 Bacteria 828
135 Ga0070696_100820698 3300005546 Bacteria 767
136 Ga0070696_100843936 3300005546 Bacteria 757
137 Ga0070693_100003210 3300005547 Bacteria 7588
138 Ga0070693_100401384 3300005547 Bacteria 950
139 Ga0070665_100042246 3300005548 Bacteria 4582
140 Ga0070665_100612675 3300005548 Bacteria 1102
141 Ga0070665_100668844 3300005548 Bacteria 1051
142 Ga0070704_100980021 3300005549 Bacteria 764
143 Ga0070704_102199975 3300005549 Bacteria 513
144 Ga0068855_100229904 3300005563 Bacteria 2077
145 Ga0068855_100305134 3300005563 Bacteria 1762
146 Ga0070664_100308084 3300005564 Bacteria 1432
147 Ga0070664_102198292 3300005564 Bacteria 524
148 Ga0068857_100239211 3300005577 Bacteria 1662
149 Ga0068857_100259122 3300005577 Bacteria 1596
150 Ga0068854_100132819 3300005578 Bacteria 1902
151 Ga0068854_100395199 3300005578 Bacteria 1143
152 Ga0068856_100266290 3300005614 Bacteria 1729
153 Ga0068856_100917903 3300005614 Bacteria 894
154 Ga0068856_102156339 3300005614 Bacteria 566
155 Ga0070702_100000953 3300005615 Bacteria 11358
156 Ga0070702_100242670 3300005615 Bacteria 1217
157 Ga0068852_100613103 3300005616 Bacteria 1093
158 Ga0068852_100943830 3300005616 Bacteria 881
159 Ga0068852_100985163 3300005616 Bacteria 861
160 Ga0068859_100081856 3300005617 Bacteria 3271
161 Ga0068859_100128534 3300005617 Bacteria 2604
162 Ga0068864_100063717 3300005618 Bacteria 3195
163 Ga0068864_100100693 3300005618 Bacteria 2561
164 Ga0068866_10512531 3300005718 Bacteria 796
165 Ga0068851_10003041 3300005834 Bacteria 7416
166 Ga0068870_10001758 3300005840 Bacteria 8886
167 Ga0068863_100292689 3300005841 Bacteria 1578
168 Ga0068858_100095043 3300005842 Bacteria 2777
169 Ga0068858_100738686 3300005842 Bacteria 959
170 Ga0068860_100028365 3300005843 Bacteria 5388
171 Ga0068862_100771674 3300005844 Bacteria 937
172 Ga0068862_100869526 3300005844 Bacteria 884
173 Ga0068862_102770054 3300005844 Bacteria 502
174 Ga0081455_10150567 3300005937 Bacteria 1794
175 Ga0081455_10280882 3300005937 Bacteria 1203
176 Ga0081540_1017209 3300005983 Bacteria 4483
177 Ga0081540_1022585 3300005983 Bacteria 3713
178 Ga0081540_1060450 3300005983 Bacteria 1812
179 Ga0081540_1314996 3300005983 Bacteria 537
180 Ga0081539_10008334 3300005985 Bacteria 9059
181 Ga0081539_10011295 3300005985 Bacteria 7090
182 Ga0081539_10053681 3300005985 Bacteria 2255
183 Ga0081539_10132442 3300005985 Bacteria 1223
184 Ga0081539_10389903 3300005985 Bacteria 580
185 Ga0070717_10074289 3300006028 Bacteria 2841
186 Ga0070717_10123383 3300006028 Bacteria 2221
187 Ga0075432_10054172 3300006058 Bacteria 1420
188 Ga0070715_10299533 3300006163 Bacteria 860
189 Ga0070716_100164942 3300006173 Bacteria 1440
190 Ga0070716_100503517 3300006173 Bacteria 894
191 Ga0070712_100085634 3300006175 Bacteria 2294
192 Ga0097621_100795528 3300006237 Bacteria 876
193 Ga0068871_100043334 3300006358 Bacteria 3614
194 Ga0075428_100023645 3300006844 Bacteria 6802
195 Ga0075428_100089494 3300006844 Bacteria 3357
196 Ga0075428_100238187 3300006844 Bacteria 1964
197 Ga0075428_100815623 3300006844 Bacteria 991
198 Ga0075428_101640037 3300006844 Bacteria 672
199 Ga0075430_100003583 3300006846 Bacteria 13009
200 Ga0075430_100292385 3300006846 Bacteria 1348
201 Ga0075430_101305486 3300006846 Bacteria 597
202 Ga0075431_100089013 3300006847 Bacteria 3187
203 Ga0075431_100105026 3300006847 Bacteria 2915
204 Ga0075431_100119295 3300006847 Bacteria 2722
205 Ga0075431_100177640 3300006847 Bacteria 2186
206 Ga0075431_101034013 3300006847 Bacteria 787
207 Ga0075433_10047966 3300006852 Bacteria 3714
208 Ga0075433_10979032 3300006852 Bacteria 737
209 Ga0075433_11665201 3300006852 Bacteria 550
210 Ga0075434_100049646 3300006871 Bacteria 4167
211 Ga0075434_101975484 3300006871 Bacteria 589
212 Ga0075429_100149559 3300006880 Bacteria 2044
213 Ga0075429_100171779 3300006880 Bacteria 1899
214 Ga0075429_100278238 3300006880 Bacteria 1465
215 Ga0075436_100003595 3300006914 Bacteria 10621
216 Ga0097620_100081856 3300006931 Bacteria 3271
217 Ga0097620_100128547 3300006931 Bacteria 2604
218 Ga0105251_10037521 3300009011 Bacteria 2378
219 Ga0105240_10081735 3300009093 Bacteria 3969
220 Ga0105240_11168661 3300009093 Bacteria 816
221 Ga0111539_10091653 3300009094 Bacteria 3571
222 Ga0111539_10327737 3300009094 Bacteria 1782
223 Ga0111539_12271715 3300009094 Bacteria 629
224 Ga0111539_12798881 3300009094 Bacteria 565
225 Ga0105245_10395692 3300009098 Bacteria 1379
226 Ga0105245_12754434 3300009098 Bacteria 544
227 Ga0105245_12795465 3300009098 Bacteria 541
228 Ga0105247_10013340 3300009101 Bacteria 4932
229 Ga0114129_10015903 3300009147 Bacteria 10703
230 Ga0114129_10044905 3300009147 Bacteria 6214
231 Ga0114129_10142435 3300009147 Bacteria 3285
232 Ga0114129_10230488 3300009147 Bacteria 2494
233 Ga0114129_10527242 3300009147 Bacteria 1539
234 Ga0114129_10835379 3300009147 Bacteria 1172
235 Ga0114129_10872219 3300009147 Bacteria 1142
236 Ga0114129_12282675 3300009147 Bacteria 650
237 Ga0105241_10080948 3300009174 Bacteria 2543
238 Ga0105242_11898839 3300009176 Bacteria 636
239 Ga0105242_13121408 3300009176 Bacteria 514
240 Ga0105248_11490908 3300009177 Bacteria 766
241 Ga0105237_10013649 3300009545 Bacteria 8508
242 Ga0105238_10061533 3300009551 Bacteria 3757
243 Ga0105238_10649963 3300009551 Bacteria 1064
244 Ga0105238_10905233 3300009551 Bacteria 901
245 Ga0105238_11355228 3300009551 Bacteria 738
246 Ga0105249_11051021 3300009553 Bacteria 884
247 Ga0105249_11493303 3300009553 Bacteria 748
248 Ga0105249_12843378 3300009553 Bacteria 555
249 Ga0130084_1087343 3300009835 Bacteria 574
250 Ga0130085_1104886 3300009850 Bacteria 574
251 Ga0105239_10330290 3300010375 Bacteria 1720
252 Ga0105239_11325585 3300010375 Bacteria 830
253 Ga0105246_10003630 3300011119 Bacteria 9339
254 Ga0105246_10833396 3300011119 Bacteria 821
255 Ga0105246_10854410 3300011119 Bacteria 812
256 Ga0105246_11289311 3300011119 Bacteria 676
257 Ga0157320_1010361 3300012481 Bacteria 718
258 Ga0157318_1018656 3300012482 Bacteria 597
259 Ga0157342_1028164 3300012507 Bacteria 693
260 Ga0157326_1009506 3300012513 Bacteria 1072
261 Ga0154010_141469 3300013062 Bacteria 815
262 Ga0157373_10093996 3300013100 Bacteria 2111
263 Ga0157371_10040913 3300013102 Bacteria 3309
264 Ga0157371_10251184 3300013102 Bacteria 1273
265 Ga0157370_10020407 3300013104 Bacteria 6618
266 Ga0157370_10480970 3300013104 Bacteria 1141
267 Ga0157370_10789993 3300013104 Bacteria 864
268 Ga0157370_11166939 3300013104 Bacteria 695
269 Ga0157369_10340722 3300013105 Bacteria 1557
270 Ga0157369_10484200 3300013105 Bacteria 1280
271 Ga0157369_10950529 3300013105 Bacteria 881
272 Ga0157369_11699054 3300013105 Bacteria 641
273 Ga0157374_10101023 3300013296 Bacteria 2765
274 Ga0157374_10959465 3300013296 Bacteria 874
275 Ga0157378_10870191 3300013297 Bacteria 930
276 Ga0157372_11118046 3300013307 Bacteria 911
277 Ga0157372_11753016 3300013307 Bacteria 714
278 Ga0157372_12673868 3300013307 Bacteria 573
279 Ga0157375_10342053 3300013308 Bacteria 1661
280 Ga0157375_10860112 3300013308 Bacteria 1053
281 Ga0157375_12321951 3300013308 Bacteria 640
282 Ga0157375_12651894 3300013308 Bacteria 599
283 Ga0163163_10376126 3300014325 Bacteria 1478
284 Ga0163163_11007748 3300014325 Bacteria 896
285 Ga0163163_11063056 3300014325 Bacteria 872
286 Ga0163163_12711349 3300014325 Bacteria 552
287 Ga0157380_11593304 3300014326 Bacteria 708
288 Ga0157380_13285738 3300014326 Bacteria 517
289 Ga0182008_10190489 3300014497 Bacteria 1040
290 Ga0157377_10002911 3300014745 Bacteria 7654
291 Ga0157377_10689081 3300014745 Bacteria 740
292 Ga0157379_10140306 3300014968 Bacteria 2179
293 Ga0157379_10226154 3300014968 Bacteria 1696
294 Ga0157376_10309994 3300014969 Bacteria 1497
295 Ga0157376_11216712 3300014969 Bacteria 782
296 Ga0157376_11865405 3300014969 Bacteria 638
297 Ga0197907_10356475 3300020069 Bacteria 937
298 Ga0197907_10391573 3300020069 Bacteria 821
299 Ga0197907_10511654 3300020069 Bacteria 818
300 Ga0197907_10633838 3300020069 Bacteria 1055
301 Ga0197907_10731388 3300020069 Bacteria 7706
302 Ga0197907_10949401 3300020069 Bacteria 1784
303 Ga0197907_11188081 3300020069 Bacteria 717
304 Ga0197907_11471494 3300020069 Bacteria 1478
305 Ga0206356_10887482 3300020070 Bacteria 4557
306 Ga0206356_11031005 3300020070 Bacteria 688
307 Ga0206356_11040059 3300020070 Bacteria 763
308 Ga0206356_11094015 3300020070 Bacteria 1176
309 Ga0206356_11833246 3300020070 Bacteria 639
310 Ga0206356_11858767 3300020070 Bacteria 1527
311 Ga0206349_1016341 3300020075 Bacteria 1659
312 Ga0206349_1049485 3300020075 Bacteria 646
313 Ga0206349_1548026 3300020075 Bacteria 2220
314 Ga0206355_1084914 3300020076 Bacteria 779
315 Ga0206355_1118041 3300020076 Bacteria 765
316 Ga0206355_1126517 3300020076 Bacteria 589
317 Ga0206355_1417974 3300020076 Bacteria 907
318 Ga0206355_1460842 3300020076 Bacteria 864
319 Ga0206355_1655392 3300020076 Bacteria 2695
320 Ga0206351_10483280 3300020077 Bacteria 2678
321 Ga0206351_10502929 3300020077 Bacteria 929
322 Ga0206351_10513026 3300020077 Bacteria 862
323 Ga0206351_10610955 3300020077 Bacteria 571
324 Ga0206351_10889650 3300020077 Bacteria 910
325 Ga0206352_10667226 3300020078 Bacteria 512
326 Ga0206352_10726005 3300020078 Bacteria 950
327 Ga0206352_10986910 3300020078 Bacteria 1118
328 Ga0206352_11141801 3300020078 Bacteria 524
329 Ga0206350_10170609 3300020080 Bacteria 3867
330 Ga0206350_10257355 3300020080 Bacteria 739
331 Ga0206350_10804271 3300020080 Bacteria 2416
332 Ga0206350_10851205 3300020080 Bacteria 1893
333 Ga0206350_11401277 3300020080 Bacteria 932
334 Ga0206354_10000715 3300020081 Bacteria 621
335 Ga0206354_10035765 3300020081 Bacteria 923
336 Ga0206354_10452546 3300020081 Bacteria 3648
337 Ga0206354_10472065 3300020081 Bacteria 545
338 Ga0206354_10516190 3300020081 Bacteria 2807
339 Ga0206354_10596477 3300020081 Bacteria 2771
340 Ga0206354_11181496 3300020081 Bacteria 677
341 Ga0206353_10117959 3300020082 Bacteria 4534
342 Ga0206353_10239640 3300020082 Bacteria 725
343 Ga0206353_10453711 3300020082 Bacteria 726
344 Ga0206353_10868437 3300020082 Bacteria 670
345 Ga0206353_11113762 3300020082 Bacteria 3043
346 Ga0206353_11610083 3300020082 Bacteria 945
347 Ga0206353_11979475 3300020082 Bacteria 843
348 Ga0154015_1321943 3300020610 Bacteria 2054
349 Ga0154015_1469900 3300020610 Bacteria 553
350 Ga0154015_1675764 3300020610 Bacteria 782
351 Ga0224712_10005659 3300022467 Bacteria 3505
352 Ga0224712_10010082 3300022467 Bacteria 2874
353 Ga0224712_10010159 3300022467 Bacteria 2867
354 Ga0224712_10023728 3300022467 Bacteria 2133
355 Ga0224712_10064587 3300022467 Bacteria 1468
356 Ga0224712_10380125 3300022467 Bacteria 671
357 Ga0224712_10506907 3300022467 Bacteria 584
358 Ga0224712_10513384 3300022467 Bacteria 580
359 Ga0207713_1041726 3300025735 Bacteria 1911
360 Ga0207692_10070446 3300025898 Bacteria 1841
361 Ga0207692_10262544 3300025898 Bacteria 1039
362 Ga0207642_10204093 3300025899 Bacteria 1094
363 Ga0207710_10014134 3300025900 Bacteria 3362
364 Ga0207647_10082211 3300025904 Bacteria 1929
365 Ga0207647_10417567 3300025904 Bacteria 754
366 Ga0207645_10017688 3300025907 Bacteria 4700
367 Ga0207643_10002089 3300025908 Bacteria 11006
368 Ga0207643_10297476 3300025908 Bacteria 1004
369 Ga0207705_10007931 3300025909 Bacteria 7794
370 Ga0207705_10015200 3300025909 Bacteria 5530
371 Ga0207654_10013204 3300025911 Bacteria 4245
372 Ga0207654_11256021 3300025911 Bacteria 540
373 Ga0207707_10028012 3300025912 Bacteria 4925
374 Ga0207707_10084168 3300025912 Bacteria 2777
375 Ga0207707_10388364 3300025912 Bacteria 1199
376 Ga0207707_10461843 3300025912 Bacteria 1086
377 Ga0207695_10086383 3300025913 Bacteria 3164
378 Ga0207671_10095680 3300025914 Bacteria 2243
379 Ga0207671_11132095 3300025914 Bacteria 614
380 Ga0207693_10028753 3300025915 Bacteria 4393
381 Ga0207693_10064337 3300025915 Bacteria 2873
382 Ga0207693_10287117 3300025915 Bacteria 1289
383 Ga0207663_10122605 3300025916 Bacteria 1782
384 Ga0207663_10523937 3300025916 Bacteria 923
385 Ga0207663_10870615 3300025916 Bacteria 720
386 Ga0207660_10055414 3300025917 Bacteria 2833
387 Ga0207660_10609576 3300025917 Bacteria 889
388 Ga0207662_10034135 3300025918 Bacteria 2969
389 Ga0207662_10475906 3300025918 Bacteria 857
390 Ga0207657_10185805 3300025919 Bacteria 1678
391 Ga0207657_10420469 3300025919 Bacteria 1050
392 Ga0207649_10004433 3300025920 Bacteria 7620
393 Ga0207649_10070500 3300025920 Bacteria 2229
394 Ga0207649_10282445 3300025920 Bacteria 1207
395 Ga0207652_10004203 3300025921 Bacteria 11751
396 Ga0207652_10061664 3300025921 Bacteria 3239
397 Ga0207652_10083068 3300025921 Bacteria 2804
398 Ga0207652_10090147 3300025921 Bacteria 2694
399 Ga0207652_10609864 3300025921 Bacteria 978
400 Ga0207694_10169497 3300025924 Bacteria 1767
401 Ga0207694_10197643 3300025924 Bacteria 1635
402 Ga0207650_10011563 3300025925 Bacteria 6077
403 Ga0207659_10042850 3300025926 Bacteria 3175
404 Ga0207659_10695293 3300025926 Bacteria 871
405 Ga0207659_11353852 3300025926 Bacteria 611
406 Ga0207687_10202761 3300025927 Bacteria 1552
407 Ga0207700_10003264 3300025928 Bacteria 9377
408 Ga0207700_10034290 3300025928 Bacteria 3643
409 Ga0207700_10808439 3300025928 Bacteria 839
410 Ga0207700_10866059 3300025928 Bacteria 808
411 Ga0207700_11017347 3300025928 Bacteria 741
412 Ga0207664_10010419 3300025929 Bacteria 6563
413 Ga0207664_11670779 3300025929 Bacteria 559
414 Ga0207664_11742984 3300025929 Bacteria 545
415 Ga0207644_10018730 3300025931 Bacteria 4687
416 Ga0207690_10015527 3300025932 Bacteria 4616
417 Ga0207690_11026227 3300025932 Bacteria 686
418 Ga0207690_11200792 3300025932 Bacteria 633
419 Ga0207690_11406743 3300025932 Bacteria 583
420 Ga0207706_10030233 3300025933 Bacteria 4833
421 Ga0207706_11467437 3300025933 Bacteria 557
422 Ga0207686_11487021 3300025934 Bacteria 558
423 Ga0207670_10053403 3300025936 Bacteria 2722
424 Ga0207670_10192108 3300025936 Bacteria 1545
425 Ga0207670_10628470 3300025936 Bacteria 884
426 Ga0207665_10238338 3300025939 Bacteria 1339
427 Ga0207665_10254816 3300025939 Bacteria 1298
428 Ga0207691_10021575 3300025940 Bacteria 6080
429 Ga0207711_11032478 3300025941 Bacteria 762
430 Ga0207711_11452298 3300025941 Bacteria 629
431 Ga0207661_10039485 3300025944 Bacteria 3704
432 Ga0207661_10141404 3300025944 Bacteria 2071
433 Ga0207661_10621201 3300025944 Bacteria 992
434 Ga0207661_11740550 3300025944 Bacteria 569
435 Ga0207679_10003731 3300025945 Bacteria 9444
436 Ga0207679_10289028 3300025945 Bacteria 1409
437 Ga0207679_10917863 3300025945 Bacteria 801
438 Ga0207679_11831436 3300025945 Bacteria 554
439 Ga0207667_10435483 3300025949 Bacteria 1333
440 Ga0207667_10523275 3300025949 Bacteria 1201
441 Ga0207651_11077952 3300025960 Bacteria 719
442 Ga0207712_11009142 3300025961 Bacteria 739
443 Ga0207712_11073256 3300025961 Bacteria 716
444 Ga0207668_10031521 3300025972 Bacteria 3492
445 Ga0207668_11931043 3300025972 Bacteria 532
446 Ga0207640_11360506 3300025981 Bacteria 635
447 Ga0207658_12121673 3300025986 Bacteria 511
448 Ga0207677_10167050 3300026023 Bacteria 1716
449 Ga0207677_10255235 3300026023 Bacteria 1426
450 Ga0207703_10317468 3300026035 Bacteria 1426
451 Ga0207639_10072464 3300026041 Bacteria 2697
452 Ga0207639_11366650 3300026041 Bacteria 665
453 Ga0207639_11820156 3300026041 Bacteria 570
454 Ga0207678_10858285 3300026067 Bacteria 802
455 Ga0207678_10959994 3300026067 Bacteria 756
456 Ga0207678_11215445 3300026067 Bacteria 667
457 Ga0207708_10119093 3300026075 Bacteria 2056
458 Ga0207708_10638490 3300026075 Bacteria 905
459 Ga0207702_10017073 3300026078 Bacteria 6003
460 Ga0207702_10072516 3300026078 Bacteria 2968
461 Ga0207641_10007209 3300026088 Bacteria 9268
462 Ga0207641_10110520 3300026088 Bacteria 2436
463 Ga0207648_10406847 3300026089 Bacteria 1234
464 Ga0207676_10002451 3300026095 Bacteria 13225
465 Ga0207676_10286665 3300026095 Bacteria 1497
466 Ga0207674_10043063 3300026116 Bacteria 4657
467 Ga0207674_10104826 3300026116 Bacteria 2806
468 Ga0207675_100028646 3300026118 Bacteria 5187
469 Ga0207675_100332863 3300026118 Bacteria 1485
470 Ga0207683_10031983 3300026121 Bacteria 4569
471 Ga0207683_10218976 3300026121 Bacteria 1734
472 Ga0207683_10306387 3300026121 Bacteria 1453
473 Ga0207683_11506685 3300026121 Bacteria 621
474 Ga0207698_10023796 3300026142 Bacteria 4286
475 Ga0207698_10638913 3300026142 Bacteria 1053
476 Ga0207428_10002902 3300027907 Bacteria 16993
477 Ga0268266_10036855 3300028379 Bacteria 4166
478 Ga0268266_10106164 3300028379 Bacteria 2482
479 Ga0268265_11272482 3300028380 Bacteria 735
480 Ga0268264_10281820 3300028381 Bacteria 1557
481 Ga0307517_10118346 3300028786 Bacteria 1972
482 Ga0307515_10001812 3300028794 Bacteria 47673
483 Ga0307515_10051195 3300028794 Bacteria 6166
484 Ga0307515_10104593 3300028794 Bacteria 3380
485 Ga0307511_10116992 3300030521 Bacteria 1668
486 Ga0307512_10007298 3300030522 Bacteria 10983
487 Ga0307513_10017932 3300031456 Bacteria 8475
488 Ga0307513_10103919 3300031456 Bacteria 2856
489 Ga0307513_10112852 3300031456 Bacteria 2707
490 Ga0307513_10266258 3300031456 Bacteria 1500
491 Ga0307408_100261093 3300031548 Bacteria 1433
492 Ga0307408_100264370 3300031548 Bacteria 1425
493 Ga0307408_100337570 3300031548 Bacteria 1274
494 Ga0307408_101138352 3300031548 Bacteria 725
495 Ga0307408_101445278 3300031548 Bacteria 649
496 Ga0307408_101931294 3300031548 Bacteria 566
497 Ga0307508_10003351 3300031616 Bacteria 16261
498 Ga0307508_10012047 3300031616 Bacteria 7911
499 Ga0307508_10179119 3300031616 Bacteria 1722
500 Ga0307508_10463955 3300031616 Bacteria 860
501 Ga0307514_10413159 3300031649 Bacteria 682
502 Ga0307516_10023078 3300031730 Bacteria 6384
503 Ga0307516_10049250 3300031730 Bacteria 4142
504 Ga0307516_10080069 3300031730 Bacteria 3110
505 Ga0307405_10076719 3300031731 Bacteria 2169
506 Ga0307405_10161360 3300031731 Bacteria 1588
507 Ga0307405_10218801 3300031731 Bacteria 1396
508 Ga0307405_10236329 3300031731 Bacteria 1350
509 Ga0307405_10273516 3300031731 Bacteria 1268
510 Ga0307405_10589329 3300031731 Bacteria 905
511 Ga0307405_10972683 3300031731 Bacteria 722
512 Ga0307413_10340662 3300031824 Bacteria 1153
513 Ga0307413_10356678 3300031824 Bacteria 1130
514 Ga0307413_10394382 3300031824 Bacteria 1082
515 Ga0307413_10504691 3300031824 Bacteria 972
516 Ga0307413_10534963 3300031824 Bacteria 947
517 Ga0307413_10746142 3300031824 Bacteria 818
518 Ga0307413_10881248 3300031824 Bacteria 759
519 Ga0307413_11377922 3300031824 Bacteria 619
520 Ga0307413_11479240 3300031824 Bacteria 600
521 Ga0307518_10284046 3300031838 Bacteria 1021
522 Ga0307410_10109410 3300031852 Bacteria 1997
523 Ga0307410_10191571 3300031852 Bacteria 1555
524 Ga0307410_10236459 3300031852 Bacteria 1413
525 Ga0307410_10391672 3300031852 Bacteria 1120
526 Ga0307410_10693864 3300031852 Bacteria 857
527 Ga0307410_10929522 3300031852 Bacteria 746
528 Ga0307410_11315877 3300031852 Bacteria 632
529 Ga0307410_11636273 3300031852 Bacteria 569
530 Ga0307410_12049908 3300031852 Bacteria 511
531 Ga0326468_10001157 3300031889 Bacteria 2419
532 Ga0307406_10024435 3300031901 Bacteria 3609
533 Ga0307406_10028359 3300031901 Bacteria 3382
534 Ga0307406_10177088 3300031901 Bacteria 1549
535 Ga0307406_10188837 3300031901 Bacteria 1506
536 Ga0307406_10518339 3300031901 Bacteria 970
537 Ga0307406_10876782 3300031901 Bacteria 762
538 Ga0307406_11152717 3300031901 Bacteria 671
539 Ga0307406_11232334 3300031901 Bacteria 651
540 Ga0307407_10035608 3300031903 Bacteria 2736
541 Ga0307407_10039561 3300031903 Bacteria 2623
542 Ga0307407_10253678 3300031903 Bacteria 1206
543 Ga0307407_10279627 3300031903 Bacteria 1155
544 Ga0307407_10339391 3300031903 Bacteria 1060
545 Ga0307407_10366312 3300031903 Bacteria 1025
546 Ga0307407_11022059 3300031903 Bacteria 639
547 Ga0307412_10065395 3300031911 Bacteria 2461
548 Ga0307412_10095271 3300031911 Bacteria 2092
549 Ga0307412_10325618 3300031911 Bacteria 1224
550 Ga0307412_10910006 3300031911 Bacteria 771
551 Ga0307412_11251693 3300031911 Bacteria 666
552 Ga0307409_100017545 3300031995 Bacteria 4776
553 Ga0307409_100052854 3300031995 Bacteria 3117
554 Ga0307409_100094193 3300031995 Bacteria 2463
555 Ga0307409_100341855 3300031995 Bacteria 1408
556 Ga0307409_100476313 3300031995 Bacteria 1210
557 Ga0307409_100635273 3300031995 Bacteria 1059
558 Ga0307409_100886394 3300031995 Bacteria 905
559 Ga0307409_100930118 3300031995 Bacteria 884
560 Ga0307409_101047794 3300031995 Bacteria 835
561 Ga0307409_101632127 3300031995 Bacteria 673
562 Ga0307409_102331514 3300031995 Bacteria 564
563 Ga0307409_102407541 3300031995 Bacteria 555
564 Ga0307416_100014883 3300032002 Bacteria 5350
565 Ga0307416_100036084 3300032002 Bacteria 3786
566 Ga0307416_100064521 3300032002 Bacteria 3005
567 Ga0307416_100154192 3300032002 Bacteria 2112
568 Ga0307416_100189090 3300032002 Bacteria 1939
569 Ga0307416_100330505 3300032002 Bacteria 1531
570 Ga0307416_100644594 3300032002 Bacteria 1143
571 Ga0307416_100727581 3300032002 Bacteria 1083
572 Ga0307416_101050605 3300032002 Bacteria 918
573 Ga0307416_101336454 3300032002 Bacteria 822
574 Ga0307416_101505571 3300032002 Bacteria 778
575 Ga0307416_103395600 3300032002 Bacteria 533
576 Ga0307416_103497754 3300032002 Bacteria 525
577 Ga0307414_10225085 3300032004 Bacteria 1542
578 Ga0307414_10461493 3300032004 Bacteria 1116
579 Ga0307414_10702795 3300032004 Bacteria 915
580 Ga0307414_11126115 3300032004 Bacteria 725
581 Ga0307414_11486590 3300032004 Bacteria 630
582 Ga0307414_11495097 3300032004 Bacteria 628
583 Ga0307411_10056847 3300032005 Bacteria 2581
584 Ga0307411_10101205 3300032005 Bacteria 2038
585 Ga0307411_10200982 3300032005 Bacteria 1530
586 Ga0307411_11262069 3300032005 Bacteria 672
587 Ga0307411_11412900 3300032005 Bacteria 637
588 Ga0307411_11665949 3300032005 Bacteria 590
589 Ga0307415_100008029 3300032126 Bacteria 5823
590 Ga0307415_100033892 3300032126 Bacteria 3318
591 Ga0307415_100131993 3300032126 Bacteria 1892
592 Ga0307415_100236273 3300032126 Bacteria 1475
593 Ga0307415_100308833 3300032126 Bacteria 1313
594 Ga0307415_100369152 3300032126 Bacteria 1214
595 Ga0307415_100513396 3300032126 Bacteria 1050
596 Ga0307415_100608634 3300032126 Bacteria 973
597 Ga0307415_101022041 3300032126 Bacteria 769
598 Ga0307415_101117753 3300032126 Bacteria 738
599 Ga0307415_102286906 3300032126 Bacteria 530
600 Ga0373950_0014056 3300034818 Bacteria 1343
601 Ga0373929_0133123 3300035085 Bacteria 654
602 Ga0373929_0242963 3300035085 Bacteria 520
603 Ga0373940_0007085 3300035088 Bacteria 2516
604 Ga0373940_0164876 3300035088 Bacteria 713
605 Ga0373951_0000463 3300035091 Bacteria 11707
606 Ga0373952_0048318 3300035092 Bacteria 1006
607 Ga0373932_0186273 3300035112 Bacteria 731
608 Ga0373936_0222380 3300035113 Bacteria 838
609 Ga0373945_0193415 3300035116 Bacteria 842
610 Ga0373960_0174214 3300035121 Bacteria 748
611 Ga0373943_0359790 3300035170 Bacteria 835
612 Ga0373946_0276810 3300035171 Bacteria 825
613 Ga0373942_0000479 3300035207 Bacteria 11391
614 Ga0373942_0045512 3300035207 Bacteria 1212
615 Ga0373962_0004423 3300035242 Bacteria 3395
616 Ga0373931_0046447 3300035691 Bacteria 2296
617 Ga0373931_0125226 3300035691 Bacteria 1473
618 Ga0373931_0621784 3300035691 Bacteria 708
619 Ga0373935_0017873 3300035692 Bacteria 4308
620 Ga0373935_0643016 3300035692 Bacteria 778
621 Ga0373935_0862703 3300035692 Bacteria 670
622 Ga0373925_0456924 3300037068 Bacteria 1046
623 Ga0373925_1125641 3300037068 Bacteria 646
624 Ga0395899_0254458 3300037312 Bacteria 1204
625 Ga0395899_0404327 3300037312 Bacteria 903
626 Ga0395899_0590332 3300037312 Bacteria 709
627 Ga0395899_0673174 3300037312 Bacteria 652
628 Ga0395900_0014327 3300037418 Bacteria 8095
629 Ga0395900_0123671 3300037418 Bacteria 2653
630 Ga0395900_0431590 3300037418 Bacteria 1277
631 Ga0395900_1879661 3300037418 Bacteria 509
632 Ga0395898_0021962 3300037466 Bacteria 6464
633 Ga0395898_0052865 3300037466 Bacteria 3968
634 Ga0395898_0072810 3300037466 Bacteria 3319
635 Ga0395898_0185594 3300037466 Bacteria 1987
636 Ga0395905_0932659 3300037471 Bacteria 771
637 Ga0436364_0331973 3300037853 Bacteria 748
638 Ga0436364_0851430 3300037853 Bacteria 1232
639 Ga0395901_0008088 3300038443 Bacteria 10623
640 Ga0395901_0013538 3300038443 Bacteria 8294
641 Ga0395901_0042762 3300038443 Bacteria 4699
642 Ga0395901_0183293 3300038443 Bacteria 2196
643 Ga0436363_1651514 3300039450 Bacteria 1289
644 Ga0439447_053842 3300041407 Bacteria 956
645 Ga0451789_0657542 3300041443 Bacteria 541
646 Ga0451791_1217965 3300041451 Bacteria 712
647 Ga0451793_0887120 3300041452 Bacteria 519
648 Ga0451801_15528 3300041455 Bacteria 828
649 Ga0451802_1574513 3300041460 Bacteria 534
650 Ga0451804_0214233 3300041463 Bacteria 575
651 Ga0451804_0678624 3300041463 Bacteria 568
652 Ga0451807_0691119 3300041486 Bacteria 1219
653 Ga0451835_0487623 3300041492 Bacteria 1052
654 Ga0451837_0823205 3300041494 Bacteria 1003
655 Ga0451839_0748863 3300041496 Bacteria 1220
656 Ga0451841_0159007 3300041498 Bacteria 752
657 Ga0451847_0907213 3300041503 Bacteria 614
658 Ga0451843_0355274 3300041509 Bacteria 529
659 Ga0451853_0669882 3300041512 Bacteria 673
660 Ga0451853_2012304 3300041512 Bacteria 2258
661 Ga0439433_0084542 3300041999 Bacteria 775
662 Ga0439448_0026261 3300042005 Bacteria 1830
663 Ga0439463_025905 3300042016 Bacteria 1472
664 Ga0439463_212223 3300042016 Bacteria 503
665 Ga0450923_111259 3300042125 Bacteria 639
666 Ga0450900_010409 3300042136 Bacteria 1191
667 Ga0450902_029835 3300042137 Bacteria 916
668 Ga0450905_009200 3300042142 Bacteria 1357
669 Ga0439459_0008060 3300042438 Bacteria 1792
670 Ga0439459_0113624 3300042438 Bacteria 676
671 Ga0439459_0152160 3300042438 Bacteria 605
672 Ga0439464_0027423 3300042439 Bacteria 1584
673 Ga0439464_0055266 3300042439 Bacteria 1155
674 Ga0450901_040448 3300042533 Bacteria 525
675 Ga0466969_0112933 3300044656 Bacteria 1270
676 Ga0466969_0521973 3300044656 Bacteria 543
677 Ga0466972_0151683 3300044658 Bacteria 1089
678 Ga0466965_0087939 3300044683 Bacteria 1577
679 Ga0466965_0668230 3300044683 Bacteria 594
680 Ga0466966_0215282 3300044684 Bacteria 1160
681 Ga0466966_0544677 3300044684 Bacteria 698
682 Ga0466966_0829636 3300044684 Bacteria 557
683 Ga0466961_0104065 3300044693 Bacteria 1787
684 Ga0466961_0331429 3300044693 Bacteria 927
685 Ga0466961_0534953 3300044693 Bacteria 706
686 Ga0466963_0012748 3300044694 Bacteria 5149
687 Ga0466963_0387822 3300044694 Bacteria 985
688 Ga0466963_0462324 3300044694 Bacteria 895
689 Ga0466963_0490286 3300044694 Bacteria 867
690 Ga0466963_0746615 3300044694 Bacteria 690
691 Ga0466964_0252763 3300044706 Bacteria 870
692 Ga0466964_0397261 3300044706 Bacteria 719
693 Ga0466964_0704063 3300044706 Bacteria 563
694 Ga0466964_0922303 3300044706 Bacteria 501
695 Ga0466971_0045049 3300044719 Bacteria 1981
696 Ga0466971_0209828 3300044719 Bacteria 921
697 Ga0466971_0402477 3300044719 Bacteria 667
698 Ga0466968_0270107 3300044735 Bacteria 811
699 Ga0466970_0101046 3300044765 Bacteria 1570
700 Ga0466970_0186881 3300044765 Bacteria 1150
701 Ga0466970_0227635 3300044765 Bacteria 1041
702 Ga0466970_0333703 3300044765 Bacteria 859
703 Ga0466970_0371307 3300044765 Bacteria 813
704 Ga0466970_0511510 3300044765 Bacteria 692
705 Ga0466957_0006102 3300044842 Bacteria 6802
706 Ga0466957_0290325 3300044842 Bacteria 1096
707 Ga0466957_0932066 3300044842 Bacteria 622
708 Ga0466957_1119544 3300044842 Bacteria 568
709 Ga0466960_0126172 3300044901 Bacteria 1345
710 Ga0466960_0178241 3300044901 Bacteria 1150
711 Ga0466960_0321500 3300044901 Bacteria 876
712 Ga0466960_0388962 3300044901 Bacteria 801
713 Ga0466960_0605751 3300044901 Bacteria 650
714 Ga0466959_0103930 3300045049 Bacteria 2032
715 Ga0466959_0245006 3300045049 Bacteria 1237
716 Ga0466959_0395638 3300045049 Bacteria 939
717 Ga0466959_0502413 3300045049 Bacteria 819
718 Ga0466959_0637839 3300045049 Bacteria 715
719 Ga0466959_0686772 3300045049 Bacteria 686
720 Ga0466959_0714098 3300045049 Bacteria 671
721 Ga0466958_0006910 3300045836 Bacteria 6207
722 Ga0466958_0069284 3300045836 Bacteria 2156
723 Ga0466958_0292197 3300045836 Bacteria 1045
724 Ga0466958_0574976 3300045836 Bacteria 732
725 Ga0466958_1032283 3300045836 Bacteria 536
726 Ga0466967_0214532 3300045976 Bacteria 1826
727 Ga0466967_0346000 3300045976 Bacteria 1438
728 Ga0466967_0502429 3300045976 Bacteria 1190
729 Ga0466967_1487806 3300045976 Bacteria 674
730 Ga0466967_2261283 3300045976 Bacteria 539
731 Ga0495603_0505647 3300046455 Bacteria 692
732 Ga0495629_0029225 3300046459 Bacteria 3911
733 Ga0495638_0239364 3300046460 Bacteria 1006
734 Ga0495641_0558516 3300046461 Bacteria 523
735 Ga0495582_0581073 3300046473 Bacteria 648
736 Ga0495585_0184036 3300046492 Bacteria 1073
737 Ga0495616_0340944 3300046513 Bacteria 626
738 Ga0495631_0099125 3300046518 Bacteria 1254
739 Ga0495632_0021539 3300046519 Bacteria 3472
740 Ga0495632_0052375 3300046519 Bacteria 2007
741 Ga0495644_0216348 3300046523 Bacteria 740
742 Ga0495654_0186332 3300046530 Bacteria 896
743 Ga0495640_0579224 3300046533 Bacteria 679
744 Ga0495609_0215830 3300046538 Bacteria 798
745 Ga0495621_0118080 3300046539 Bacteria 1023
746 Ga0495656_0119943 3300046615 Bacteria 1240
747 Ga0495656_0307750 3300046615 Bacteria 813
748 Ga0495668_0250283 3300046616 Bacteria 970
749 Ga0495661_0406478 3300046665 Bacteria 661
750 Ga0495588_0307163 3300046674 Bacteria 835
751 Ga0495657_0454280 3300046675 Bacteria 750
752 Ga0495658_0456178 3300046683 Bacteria 817
753 Ga0495669_0019422 3300046684 Bacteria 2933
754 Ga0495613_1004268 3300046689 Bacteria 536
755 Ga0495624_0297375 3300046690 Bacteria 974
756 Ga0495670_0130068 3300046691 Bacteria 1312
757 Ga0495581_0099232 3300047315 Bacteria 1692
758 Ga0495581_0106714 3300047315 Bacteria 1628
759 Ga0495676_0568775 3300047321 Bacteria 740
760 Ga0495680_0846079 3300047322 Bacteria 595
761 Ga0495675_0402568 3300047444 Bacteria 798
762 Ga0495677_0028270 3300047445 Bacteria 2036
763 Ga0495685_254956 3300047447 Bacteria 556
764 Ga0495593_0271436 3300047673 Bacteria 849
765 Ga0495614_0552418 3300048089 Bacteria 551
766 Ga0495615_0064206 3300048090 Bacteria 976
767 Ga0496100_0577715 3300048903 Bacteria 871
768 Ga0496102_0071684 3300048905 Bacteria 3181
769 Ga0496102_0989376 3300048905 Bacteria 762
770 Ga0496104_0006275 3300048907 Bacteria 10451
771 Ga0496104_0544843 3300048907 Bacteria 1071
772 Ga0496105_0051832 3300048908 Bacteria 3388
773 Ga0496105_0679476 3300048908 Bacteria 792
774 Ga0496105_0859331 3300048908 Bacteria 686
775 Ga0496106_0014813 3300048909 Bacteria 5766
776 Ga0496106_0210540 3300048909 Bacteria 1549
777 Ga0496106_1054841 3300048909 Bacteria 638
778 Ga0496107_0036486 3300048910 Bacteria 3526
779 Ga0496107_0474447 3300048910 Bacteria 929
780 Ga0496108_0000043 3300048911 Bacteria 146005
781 Ga0496108_0023561 3300048911 Bacteria 5067
782 Ga0496108_0207592 3300048911 Bacteria 1700
783 Ga0496108_1409722 3300048911 Bacteria 582
784 Ga0496109_0679033 3300048912 Bacteria 967
785 Ga0496109_0948459 3300048912 Bacteria 798
786 Ga0496110_0006221 3300048913 Bacteria 9417
787 Ga0496110_0850028 3300048913 Bacteria 818
788 Ga0496111_0145743 3300048914 Bacteria 1755
789 Ga0496111_0830552 3300048914 Bacteria 668
790 Ga0496112_0084231 3300048915 Bacteria 3144
791 Ga0496112_0210360 3300048915 Bacteria 1902
792 Ga0496112_0809318 3300048915 Bacteria 861
793 Ga0496113_0098655 3300048916 Bacteria 2261
794 Ga0496113_0183972 3300048916 Bacteria 1657
795 Ga0496113_0548820 3300048916 Bacteria 927
796 Ga0496114_0955653 3300048917 Bacteria 739
797 Ga0496114_1766659 3300048917 Bacteria 507
798 Ga0496115_0036607 3300048918 Bacteria 3887
799 Ga0496115_0215335 3300048918 Bacteria 1586
800 Ga0496115_0519805 3300048918 Bacteria 955
801 Ga0496126_0039353 3300048929 Bacteria 4388
802 Ga0496126_1104051 3300048929 Bacteria 589
803 Ga0501306_015842 3300049127 Bacteria 1007
804 Ga0501306_041094 3300049127 Bacteria 717
805 Ga0501306_042794 3300049127 Bacteria 707
806 Ga0501306_060023 3300049127 Bacteria 625
807 Ga0501306_107771 3300049127 Bacteria 504
808 Ga0501308_013417 3300049128 Bacteria 947
809 Ga0501308_037168 3300049128 Bacteria 674
810 Ga0501308_038362 3300049128 Bacteria 667
811 Ga0501309_019895 3300049129 Bacteria 936
812 Ga0501309_047685 3300049129 Bacteria 667
813 Ga0501309_057543 3300049129 Bacteria 621
814 Ga0501309_077048 3300049129 Bacteria 555
815 Ga0501310_015665 3300049130 Bacteria 902
816 Ga0501310_022772 3300049130 Bacteria 793
817 Ga0501310_045021 3300049130 Bacteria 625
818 Ga0501310_052217 3300049130 Bacteria 593
819 Ga0501341_07343 3300049131 Bacteria 689
820 Ga0501341_11037 3300049131 Bacteria 600
821 Ga0501341_15040 3300049131 Bacteria 541
822 Ga0501304_010765 3300049160 Bacteria 804
823 Ga0501305_059256 3300049161 Bacteria 656
824 Ga0501305_066644 3300049161 Bacteria 628
825 Ga0501307_020498 3300049162 Bacteria 855
826 Ga0501307_043099 3300049162 Bacteria 660
827 Ga0501307_049787 3300049162 Bacteria 627
828 Ga0501294_011007 3300049517 Bacteria 898
829 Ga0501311_024050 3300049527 Bacteria 847
830 Ga0501312_004720 3300049528 Bacteria 1621
831 Ga0501312_020483 3300049528 Bacteria 979
832 Ga0501313_016430 3300049529 Bacteria 889
833 Ga0501313_050527 3300049529 Bacteria 574
834 Ga0501314_004579 3300049530 Bacteria 1151
835 Ga0501314_008510 3300049530 Bacteria 928
836 Ga0501314_033788 3300049530 Bacteria 577
837 Ga0501315_021741 3300049531 Bacteria 870
838 Ga0501315_032613 3300049531 Bacteria 757
839 Ga0501316_032470 3300049532 Bacteria 703
840 Ga0501316_038761 3300049532 Bacteria 659
841 Ga0501317_009803 3300049533 Bacteria 1132
842 Ga0501317_022426 3300049533 Bacteria 865
843 Ga0501317_024948 3300049533 Bacteria 835
844 Ga0501318_002847 3300049534 Bacteria 1537
845 Ga0501318_014714 3300049534 Bacteria 926
846 Ga0501318_027680 3300049534 Bacteria 755
847 Ga0501318_034788 3300049534 Bacteria 700
848 Ga0501318_035505 3300049534 Bacteria 695
849 Ga0501318_035750 3300049534 Bacteria 693
850 Ga0501318_043480 3300049534 Bacteria 649
851 Ga0501319_001908 3300049535 Bacteria 1268
852 Ga0501319_002279 3300049535 Bacteria 1203
853 Ga0501320_025583 3300049536 Bacteria 708
854 Ga0501320_027277 3300049536 Bacteria 694
855 Ga0501320_028453 3300049536 Bacteria 684
856 Ga0501320_046231 3300049536 Bacteria 583
857 Ga0501321_021705 3300049537 Bacteria 803
858 Ga0501321_025001 3300049537 Bacteria 767
859 Ga0501321_039197 3300049537 Bacteria 661
860 Ga0501321_043159 3300049537 Bacteria 640
861 Ga0501322_000554 3300049538 Bacteria 1805
862 Ga0501322_011003 3300049538 Bacteria 703
863 Ga0501323_038903 3300049539 Bacteria 691
864 Ga0501323_039272 3300049539 Bacteria 689
865 Ga0501323_092161 3300049539 Bacteria 506
866 Ga0501324_003187 3300049540 Bacteria 1244
867 Ga0501324_003960 3300049540 Bacteria 1159
868 Ga0501324_008952 3300049540 Bacteria 890
869 Ga0501324_018450 3300049540 Bacteria 698
870 Ga0501324_019575 3300049540 Bacteria 684
871 Ga0501324_026983 3300049540 Bacteria 612
872 Ga0501325_008439 3300049541 Bacteria 894
873 Ga0501325_011558 3300049541 Bacteria 818
874 Ga0501325_020811 3300049541 Bacteria 690
875 Ga0501325_053628 3300049541 Bacteria 518
876 Ga0501325_056154 3300049541 Bacteria 511
877 Ga0501326_06330 3300049542 Bacteria 659
878 Ga0501330_008147 3300049546 Bacteria 715
879 Ga0501330_009879 3300049546 Bacteria 671
880 Ga0501332_09188 3300049548 Bacteria 649
881 Ga0501333_004109 3300049549 Bacteria 908
882 Ga0501336_010878 3300049552 Bacteria 734
883 Ga0501337_004918 3300049553 Bacteria 884
884 Ga0501340_001733 3300049556 Bacteria 1208
885 Ga0501340_012472 3300049556 Bacteria 645
886 Ga0501031_0032070 3300049568 Bacteria 3426
887 Ga0501031_0251952 3300049568 Bacteria 1147
888 Ga0501031_0255011 3300049568 Bacteria 1140
889 Ga0501032_0025353 3300049569 Bacteria 4088
890 Ga0501032_0027327 3300049569 Bacteria 3921
891 Ga0501032_0099412 3300049569 Bacteria 1927
892 Ga0501032_0129448 3300049569 Bacteria 1666
893 Ga0501033_0500218 3300049570 Bacteria 841
894 Ga0501034_0043245 3300049571 Bacteria 4560
895 Ga0501034_0288249 3300049571 Bacteria 1580
896 Ga0501034_0716403 3300049571 Bacteria 898
897 Ga0501036_0271293 3300049572 Bacteria 1420
898 Ga0501036_0683565 3300049572 Bacteria 848
899 Ga0501037_0015377 3300049573 Bacteria 5631
900 Ga0501037_0023357 3300049573 Bacteria 4573
901 Ga0501038_0003477 3300049574 Bacteria 14673
902 Ga0501038_0419031 3300049574 Bacteria 1033
903 Ga0501038_0805865 3300049574 Bacteria 698
904 Ga0501039_0020664 3300049575 Bacteria 5045
905 Ga0501039_0436639 3300049575 Bacteria 1028
906 Ga0501039_0700846 3300049575 Bacteria 792
907 Ga0501040_1020907 3300049576 Bacteria 600
908 Ga0501042_0348768 3300049578 Bacteria 1071
909 Ga0501042_0433902 3300049578 Bacteria 952
910 Ga0501043_0009715 3300049579 Bacteria 7540
911 Ga0501043_0065711 3300049579 Bacteria 2848
912 Ga0501043_0912995 3300049579 Bacteria 629
913 Ga0501043_1032153 3300049579 Bacteria 584
914 Ga0501046_0525250 3300049580 Bacteria 846
915 Ga0501046_0604004 3300049580 Bacteria 778
916 Ga0501047_0000278 3300049581 Bacteria 59271
917 Ga0501047_0000811 3300049581 Bacteria 32563
918 Ga0501047_0053457 3300049581 Bacteria 3905
919 Ga0501047_0109201 3300049581 Bacteria 2649
920 Ga0501047_1395960 3300049581 Bacteria 515
921 Ga0501048_0000853 3300049582 Bacteria 22450
922 Ga0501048_0511053 3300049582 Bacteria 861
923 Ga0501048_0733973 3300049582 Bacteria 709
924 Ga0501068_0226302 3300049584 Bacteria 1189
925 Ga0501068_0454140 3300049584 Bacteria 829
926 Ga0501069_0324486 3300049585 Bacteria 905
927 Ga0501070_0018107 3300049586 Bacteria 5909
928 Ga0501070_0084253 3300049586 Bacteria 2632
929 Ga0501070_0553621 3300049586 Bacteria 920
930 Ga0501071_0288416 3300049587 Bacteria 1243
931 Ga0501071_0463056 3300049587 Bacteria 971
932 Ga0501072_0852645 3300049588 Bacteria 712
933 Ga0501072_1485199 3300049588 Bacteria 523
934 Ga0501073_0188088 3300049589 Bacteria 1429
935 Ga0501073_1127616 3300049589 Bacteria 539
936 Ga0501073_1128844 3300049589 Bacteria 539
937 Ga0501074_0018515 3300049590 Bacteria 5060
938 Ga0501075_0243915 3300049591 Bacteria 1370
939 Ga0501075_0578735 3300049591 Bacteria 857
940 Ga0501076_1129738 3300049592 Bacteria 645
941 Ga0501077_0505915 3300049593 Bacteria 775
942 Ga0501202_138270 3300049652 Bacteria 627
943 Ga0501206_073400 3300049653 Bacteria 583
944 Ga0501206_095777 3300049653 Bacteria 533
945 Ga0501243_038166 3300049675 Bacteria 837
946 Ga0501250_004678 3300049680 Bacteria 1374
947 Ga0501253_076304 3300049683 Bacteria 749
948 Ga0501221_187885 3300049704 Bacteria 568
949 Ga0501080_0004134 3300049742 Bacteria 12866
950 Ga0501080_0025709 3300049742 Bacteria 5468
951 Ga0501080_0862801 3300049742 Bacteria 791
952 Ga0501081_0091990 3300049743 Bacteria 2134
953 Ga0501081_0501284 3300049743 Bacteria 905
954 Ga0501271_063174 3300049768 Bacteria 523
955 Ga0501281_16014 3300049777 Bacteria 557
956 Ga0501035_0038436 3300049822 Bacteria 4333
957 Ga0501035_0202932 3300049822 Bacteria 1699
958 Ga0501044_0074873 3300049823 Bacteria 3438
959 Ga0501044_0095420 3300049823 Bacteria 2997
960 Ga0501044_0105745 3300049823 Bacteria 2827
961 Ga0501044_0551129 3300049823 Bacteria 1050
962 Ga0501045_0065355 3300049824 Bacteria 2671
963 Ga0501045_0759188 3300049824 Bacteria 715
964 Ga0501212_016793 3300049851 Bacteria 1102
965 nmdc:mga03n38_186314_c1 3300050490 Bacteria 1066
966 nmdc:mga06z11_516640_c1 3300050494 Bacteria 724
967 nmdc:mga05p37_123655_c1 3300050507 Bacteria 2241
968 nmdc:mga05p37_162208_c1 3300050507 Bacteria 2729
969 nmdc:mga05p37_177510_c1 3300050507 Bacteria 2594
970 nmdc:mga05p37_1822883_c1 3300050507 Bacteria 586
971 nmdc:mga05p37_363629_c1 3300050507 Bacteria 1700
972 nmdc:mga05p37_716771_c1 3300050507 Bacteria 1109
973 nmdc:mga05p37_7235_c1 3300050507 Bacteria 13094
974 nmdc:mga05p37_834097_c1 3300050507 Bacteria 1003
975 nmdc:mga09592_24046_c1 3300050508 Bacteria 5036
976 nmdc:mga09592_271995_c1 3300050508 Bacteria 1469
977 nmdc:mga09592_3032_c1 3300050508 Bacteria 13623
978 nmdc:mga09592_425863_c1 3300050508 Bacteria 1146
979 nmdc:mga09592_96028_c1 3300050508 Bacteria 2535
980 nmdc:mga0qj67_35737_c1 3300050509 Bacteria 3886
981 nmdc:mga06r32_235136_c1 3300050510 Bacteria 1820
982 nmdc:mga06r32_33048_c1 3300050510 Bacteria 4872
983 nmdc:mga06r32_545733_c1 3300050510 Bacteria 1133
984 nmdc:mga06r32_880541_c1 3300050510 Bacteria 853
985 nmdc:mga06r32_895258_c1 3300050510 Bacteria 844
986 nmdc:mga08y16_1607870_c1 3300050511 Bacteria 607
987 nmdc:mga08y16_36056_c1 3300050511 Bacteria 5194
988 nmdc:mga0n895_486326_c1 3300050512 Bacteria 1244
989 nmdc:mga0n895_56468_c1 3300050512 Bacteria 3868
990 nmdc:mga0n895_776852_c1 3300050512 Bacteria 949
991 nmdc:mga0rr50_43762_c1 3300050513 Bacteria 3280
992 nmdc:mga08x19_3249_c1 3300050514 Bacteria 9738
993 nmdc:mga0a205_1925_c1 3300050515 Bacteria 18037
994 nmdc:mga0a205_493254_c1 3300050515 Bacteria 1082
995 Ga0495655_0336295 3300053083 Bacteria 526
996 Ga0500578_0187199 3300053086 Bacteria 1273
997 Ga0500643_001399 3300053087 Bacteria 13942
998 Ga0500644_0006960 3300053088 Bacteria 2923
999 Ga0500644_0050399 3300053088 Bacteria 1425
1000 Ga0500644_0177867 3300053088 Bacteria 869
1001 Ga0500646_0005473 3300053090 Bacteria 3211
1002 Ga0500651_0042524 3300053093 Bacteria 2863
1003 Ga0500641_0008601 3300053096 Bacteria 3649
1004 Ga0500641_0013366 3300053096 Bacteria 3015
1005 Ga0500650_0055724 3300053098 Bacteria 1841
1006 Ga0500660_115897 3300053100 Bacteria 1129
1007 Ga0500556_0054639 3300053104 Bacteria 1455
1008 Ga0500562_032531 3300053108 Bacteria 1377
1009 Ga0500569_001934 3300053109 Bacteria 4008
1010 Ga0500594_0057890 3300053118 Bacteria 1109
1011 Ga0500621_130042 3300053126 Bacteria 966
1012 Ga0500652_002002 3300053131 Bacteria 6138
1013 Ga0500658_0217687 3300053134 Bacteria 875
1014 Ga0500579_078834 3300053143 Bacteria 1855
1015 Ga0500588_0002195 3300053146 Bacteria 3914
1016 Ga0500588_0084668 3300053146 Bacteria 1067
1017 Ga0500589_157930 3300053147 Bacteria 915
1018 Ga0500622_0138576 3300053156 Bacteria 1163
1019 Ga0500630_285297 3300053159 Bacteria 548
1020 Ga0500633_0251722 3300053160 Bacteria 656
1021 Ga0500634_0377664 3300053161 Bacteria 531
1022 Ga0587084_011899 3300059477 Bacteria 1168
1023 Ga0587084_032338 3300059477 Bacteria 849
1024 Ga0587084_034181 3300059477 Bacteria 834
1025 Ga0587084_083035 3300059477 Bacteria 623
1026 Ga0587084_102646 3300059477 Bacteria 582
1027 Ga0587093_006992 3300059478 Bacteria 1247
1028 Ga0587093_022718 3300059478 Bacteria 852
1029 Ga0587066_055425 3300059490 Bacteria 794
1030 Ga0587066_117250 3300059490 Bacteria 624
1031 Ga0587070_051962 3300059491 Bacteria 821
1032 Ga0587070_117878 3300059491 Bacteria 631
1033 Ga0587070_185580 3300059491 Bacteria 544
1034 Ga0587073_0080963 3300059492 Bacteria 806
1035 Ga0587073_0266780 3300059492 Bacteria 544
1036 Ga0587073_0273658 3300059492 Bacteria 539
1037 Ga0587077_086063 3300059493 Bacteria 730
1038 Ga0587077_176178 3300059493 Bacteria 576
1039 Ga0587080_011481 3300059503 Bacteria 1324
1040 Ga0587080_012877 3300059503 Bacteria 1272
1041 Ga0587080_160302 3300059503 Bacteria 527
1042 Ga0587082_178140 3300059504 Bacteria 519
1043 Ga0587083_0031125 3300059505 Bacteria 1063
1044 Ga0587083_0032986 3300059505 Bacteria 1042
1045 Ga0587083_0036588 3300059505 Bacteria 1006
1046 Ga0587083_0096390 3300059505 Bacteria 730
1047 Ga0587083_0118035 3300059505 Bacteria 682
1048 Ga0587083_0129878 3300059505 Bacteria 660
1049 Ga0587083_0163716 3300059505 Bacteria 610
1050 Ga0587083_0201997 3300059505 Bacteria 568
1051 Ga0587085_011491 3300059506 Bacteria 1196
1052 Ga0587085_019890 3300059506 Bacteria 1010
1053 Ga0587085_101757 3300059506 Bacteria 608
1054 Ga0587086_018073 3300059507 Bacteria 936
1055 Ga0587086_023672 3300059507 Bacteria 858
1056 Ga0587088_050557 3300059508 Bacteria 813
1057 Ga0587088_056450 3300059508 Bacteria 784
1058 Ga0587089_016154 3300059509 Bacteria 992
1059 Ga0587090_015681 3300059510 Bacteria 1124
1060 Ga0587090_044881 3300059510 Bacteria 791
1061 Ga0587090_121466 3300059510 Bacteria 567
1062 Ga0587091_012183 3300059511 Bacteria 1356
1063 Ga0587091_023594 3300059511 Bacteria 1097
1064 Ga0587091_025987 3300059511 Bacteria 1063
1065 Ga0587091_102323 3300059511 Bacteria 673
1066 Ga0587092_004442 3300059512 Bacteria 1672
1067 Ga0587092_030061 3300059512 Bacteria 893
1068 Ga0587092_049007 3300059512 Bacteria 759
1069 Ga0587092_052695 3300059512 Bacteria 741
1070 Ga0587092_088680 3300059512 Bacteria 621
1071 Ga0587094_040989 3300059513 Bacteria 754
1072 Ga0587094_051581 3300059513 Bacteria 698
1073 Ga0587098_005401 3300059604 Bacteria 1252
1074 Ga0587098_039472 3300059604 Bacteria 682
1075 Ga0587098_065869 3300059604 Bacteria 578
1076 Ga0587106_004030 3300059605 Bacteria 1588
1077 Ga0587106_028574 3300059605 Bacteria 881
1078 Ga0587106_074765 3300059605 Bacteria 649
1079 Ga0587106_122465 3300059605 Bacteria 553
1080 Ga0587125_002113 3300059607 Bacteria 1553
1081 Ga0587129_008560 3300059608 Bacteria 760
1082 Ga0587099_006116 3300059622 Bacteria 1104
1083 Ga0587101_016593 3300059623 Bacteria 1011
1084 Ga0587109_049071 3300059624 Bacteria 860
1085 Ga0587109_076477 3300059624 Bacteria 733
1086 Ga0587109_093501 3300059624 Bacteria 682
1087 Ga0587109_101306 3300059624 Bacteria 662
1088 Ga0587115_033939 3300059626 Bacteria 770
1089 Ga0587115_081177 3300059626 Bacteria 575
1090 Ga0587117_024422 3300059627 Bacteria 869
1091 Ga0587117_064563 3300059627 Bacteria 636
1092 Ga0587122_036941 3300059628 Bacteria 595
1093 Ga0587127_006350 3300059629 Bacteria 834
1094 Ga0587128_017047 3300059630 Bacteria 1071
1095 Ga0587128_053654 3300059630 Bacteria 743
1096 Ga0587128_125004 3300059630 Bacteria 564
1097 Ga0587062_003426 3300059639 Bacteria 1602
1098 Ga0587067_049243 3300059640 Bacteria 847
1099 Ga0587068_019156 3300059641 Bacteria 1107
1100 Ga0587068_053142 3300059641 Bacteria 763
1101 Ga0587069_154504 3300059642 Bacteria 512
1102 Ga0587072_029663 3300059643 Bacteria 1016
1103 Ga0587072_078861 3300059643 Bacteria 708
1104 Ga0587072_196961 3300059643 Bacteria 510
1105 Ga0587075_053087 3300059644 Bacteria 712
1106 Ga0587076_006901 3300059645 Bacteria 1531
1107 Ga0587076_111178 3300059645 Bacteria 624
1108 Ga0587076_147397 3300059645 Bacteria 568
1109 Ga0587076_155865 3300059645 Bacteria 558
1110 Ga0587078_063842 3300059646 Bacteria 563
1111 Ga0587079_112206 3300059647 Bacteria 664
1112 Ga0587079_190887 3300059647 Bacteria 554
1113 Ga0587079_191740 3300059647 Bacteria 553
1114 Ga0587107_020410 3300059652 Bacteria 918
1115 Ga0587107_034467 3300059652 Bacteria 788
1116 Ga0587107_109028 3300059652 Bacteria 557
1117 Ga0587108_003256 3300059653 Bacteria 1139
1118 Ga0587108_018973 3300059653 Bacteria 642
1119 Ga0587110_036107 3300059654 Bacteria 620
1120 Ga0587114_009789 3300059655 Bacteria 1157
1121 Ga0587114_011482 3300059655 Bacteria 1105
1122 Ga0587114_100857 3300059655 Bacteria 562
1123 Ga0587118_22038 3300059657 Bacteria 534
1124 Ga0587119_004905 3300059658 Bacteria 1350
1125 Ga0587119_020492 3300059658 Bacteria 840
1126 Ga0587120_013445 3300059659 Bacteria 723
1127 Ga0587071_013067 3300060344 Bacteria 1425
1128 Ga0587071_065132 3300060344 Bacteria 782
1129 Ga0587071_072454 3300060344 Bacteria 753
1130 Ga0587071_108677 3300060344 Bacteria 650
1131 Ga0587071_142931 3300060344 Bacteria 589
1132 Ga0587071_159053 3300060344 Bacteria 567
1133 Ga0587111_0052099 3300060346 Bacteria 907
1134 Ga0587111_0182057 3300060346 Bacteria 585
1135 Ga0501082_0538361 3300060353 Bacteria 1021
1136 Ga0466962_0029867 3300061719 Bacteria 2609
1137 Ga0466962_0186980 3300061719 Bacteria 1010
1138 Ga0466962_0192437 3300061719 Bacteria 995
1139 Ga0466962_0728950 3300061719 Bacteria 509
1140 Ga0530510_0444541 3300061734 Bacteria 980
1141 2501945902 2501939600 Bacteria 6907073
1142 2515496689 2515154088 Bacteria 5526283
1143 2515718310 2515154129 Bacteria 5584369
1144 2515756928 2515154137 Bacteria 5711575
1145 2516083530 2515154202 Bacteria 5471270
1146 2516089466 2515154203 Bacteria 5458536
1147 2623497648 2622736605 Bacteria 4992138
1148 2623585036 2622736626 Bacteria 7181580
1149 2772644892 2772190715 Bacteria 6959372
1150 2867510880 2867507094 Bacteria 6506033
1151 2996223711 2996221748 Bacteria 6799777
1152 649810773 649633069 Bacteria 6962533
1153 8003835116 8003830390 Bacteria 6541657
1154 8003862015 8003856774 Bacteria 7675274
1155 8003872925 8003870546 Bacteria 7396674
1156 8055412841 8055412473 Bacteria 6257500
1157 Ga0395900_0314590
1158 bgg_mtDRAFT_1028703
1159 JGI24752J21851_1001457
1160 JGI24737J22298_10125765
1161 JGI24743J22301_10011093
1162 JGI24735J21928_10104889
1163 JGI24745J21846_1007554
1164 JGI24033J26618_1002668
1165 JGI24751J29686_10002090
1166 Ga0006759J45824_1021421
1167 Ga0006759J45824_1044275
1168 JGI25406J46586_10026916
1169 JGI25406J46586_10071578
1170 JGI25406J46586_10115402
1171 Ga0007427J51700_112200
1172 Ga0006781J51513_1011028
1173 Ga0007410J51695_1032800
1174 Ga0007409J51694_1019784
1175 Ga0007416J51690_1032530
1176 Ga0007429J51699_1019317
1177 Ga0007429J51699_1024229
1178 Ga0007429J51699_1027973
1179 JGI25404J52841_10003021
1180 Ga0032354_1016850
1181 Ga0006780_1007700
1182 Ga0058863_10025403
1183 Ga0058863_10092824
1184 Ga0058863_11918314
1185 Ga0058861_10005407
1186 Ga0058861_10056599
1187 Ga0058861_10061286
1188 Ga0058861_12074364
1189 Ga0058860_12144835
1190 Ga0058862_12840177
1191 Ga0070658_10013033
1192 Ga0070658_10066569
1193 Ga0070658_10251817
1194 Ga0070658_10821661
1195 Ga0070658_11375985
1196 Ga0070676_10033824
1197 Ga0070676_10576225
1198 Ga0070676_11003862
1199 Ga0070683_100012328
1200 Ga0070683_100139274
1201 Ga0070683_100501523
1202 Ga0070683_100610950
1203 Ga0070683_100714779
1204 Ga0070683_101829162
1205 Ga0070690_100679803
1206 Ga0070670_100035439
1207 Ga0070677_10765478
1208 Ga0068869_100267928
1209 Ga0070666_10803093
1210 Ga0070680_100013480
1211 Ga0070680_100066109
1212 Ga0070680_100779747
1213 Ga0070682_100095043
1214 Ga0070682_100323753
1215 Ga0070682_100827531
1216 Ga0068868_100052866
1217 Ga0068868_100479911
1218 Ga0068868_101009345
1219 Ga0070660_100131054
1220 Ga0070660_100592342
1221 Ga0070689_100100064
1222 Ga0070689_101539684
1223 Ga0070691_10004434
1224 Ga0070687_100085942
1225 Ga0070692_10006088
1226 Ga0070692_10159601
1227 Ga0070668_100345821
1228 Ga0070669_100825923
1229 Ga0070669_101880896
1230 Ga0070675_100061737
1231 Ga0070675_100385802
1232 Ga0070675_101001669
1233 Ga0070671_100012167
1234 Ga0070671_100365181
1235 Ga0070671_101088773
1236 Ga0070673_100078654
1237 Ga0070688_100267788
1238 Ga0070659_100167676
1239 Ga0070659_100404644
1240 Ga0070659_101656958
1241 Ga0070667_100280114
1242 Ga0070709_10007508
1243 Ga0070714_100046956
1244 Ga0070714_100157812
1245 Ga0070714_100189300
1246 Ga0070714_100468881
1247 Ga0070713_100005007
1248 Ga0070713_100489194
1249 Ga0070713_100511904
1250 Ga0070713_101174224
1251 Ga0070713_102071782
1252 Ga0070710_10483697
1253 Ga0070710_10760959
1254 Ga0070701_10338638
1255 Ga0070701_10748916
1256 Ga0070711_100013620
1257 Ga0070711_101201976
1258 Ga0070705_100134274
1259 Ga0070705_100633146
1260 Ga0070700_100403361
1261 Ga0070694_100531927
1262 Ga0070694_100596698
1263 Ga0070663_100133106
1264 Ga0070663_100133371
1265 Ga0070663_101529568
1266 Ga0070678_100046927
1267 Ga0070678_100134588
1268 Ga0070678_100142868
1269 Ga0070662_100065234
1270 Ga0070681_10104714
1271 Ga0070681_10354040
1272 Ga0070681_10976429
1273 Ga0070681_11130163
1274 Ga0070681_11474233
1275 Ga0070681_11530958
1276 Ga0068867_100358505
1277 Ga0070679_100031334
1278 Ga0070679_100239703
1279 Ga0070679_100772996
1280 Ga0070679_101020353
1281 Ga0070679_101304760
1282 Ga0070684_100060826
1283 Ga0070684_100850629
1284 Ga0068853_100024387
1285 Ga0068853_102445376
1286 Ga0070672_100064670
1287 Ga0070686_100081289
1288 Ga0070686_100886874
1289 Ga0070695_100913122
1290 Ga0070696_100696223
1291 Ga0070696_100820698
1292 Ga0070696_100843936
1293 Ga0070693_100003210
1294 Ga0070693_100401384
1295 Ga0070665_100042246
1296 Ga0070665_100612675
1297 Ga0070665_100668844
1298 Ga0070704_100980021
1299 Ga0070704_102199975
1300 Ga0068855_100229904
1301 Ga0068855_100305134
1302 Ga0070664_100308084
1303 Ga0070664_102198292
1304 Ga0068857_100239211
1305 Ga0068857_100259122
1306 Ga0068854_100132819
1307 Ga0068854_100395199
1308 Ga0068856_100266290
1309 Ga0068856_100917903
1310 Ga0068856_102156339
1311 Ga0070702_100000953
1312 Ga0070702_100242670
1313 Ga0068852_100613103
1314 Ga0068852_100943830
1315 Ga0068852_100985163
1316 Ga0068859_100081856
1317 Ga0068859_100128534
1318 Ga0068864_100063717
1319 Ga0068864_100100693
1320 Ga0068866_10512531
1321 Ga0068851_10003041
1322 Ga0068870_10001758
1323 Ga0068863_100292689
1324 Ga0068858_100095043
1325 Ga0068858_100738686
1326 Ga0068860_100028365
1327 Ga0068862_100771674
1328 Ga0068862_100869526
1329 Ga0068862_102770054
1330 Ga0081455_10150567
1331 Ga0081455_10280882
1332 Ga0081540_1017209
1333 Ga0081540_1022585
1334 Ga0081540_1060450
1335 Ga0081540_1314996
1336 Ga0081539_10008334
1337 Ga0081539_10011295
1338 Ga0081539_10053681
1339 Ga0081539_10132442
1340 Ga0081539_10389903
1341 Ga0070717_10074289
1342 Ga0070717_10123383
1343 Ga0075432_10054172
1344 Ga0070715_10299533
1345 Ga0070716_100164942
1346 Ga0070716_100503517
1347 Ga0070712_100085634
1348 Ga0097621_100795528
1349 Ga0068871_100043334
1350 Ga0075428_100023645
1351 Ga0075428_100089494
1352 Ga0075428_100238187
1353 Ga0075428_100815623
1354 Ga0075428_101640037
1355 Ga0075430_100003583
1356 Ga0075430_100292385
1357 Ga0075430_101305486
1358 Ga0075431_100089013
1359 Ga0075431_100105026
1360 Ga0075431_100119295
1361 Ga0075431_100177640
1362 Ga0075431_101034013
1363 Ga0075433_10047966
1364 Ga0075433_10979032
1365 Ga0075433_11665201
1366 Ga0075434_100049646
1367 Ga0075434_101975484
1368 Ga0075429_100149559
1369 Ga0075429_100171779
1370 Ga0075429_100278238
1371 Ga0075436_100003595
1372 Ga0097620_100081856
1373 Ga0097620_100128547
1374 Ga0105251_10037521
1375 Ga0105240_10081735
1376 Ga0105240_11168661
1377 Ga0111539_10091653
1378 Ga0111539_10327737
1379 Ga0111539_12271715
1380 Ga0111539_12798881
1381 Ga0105245_10395692
1382 Ga0105245_12754434
1383 Ga0105245_12795465
1384 Ga0105247_10013340
1385 Ga0114129_10015903
1386 Ga0114129_10044905
1387 Ga0114129_10142435
1388 Ga0114129_10230488
1389 Ga0114129_10527242
1390 Ga0114129_10835379
1391 Ga0114129_10872219
1392 Ga0114129_12282675
1393 Ga0105241_10080948
1394 Ga0105242_11898839
1395 Ga0105242_13121408
1396 Ga0105248_11490908
1397 Ga0105237_10013649
1398 Ga0105238_10061533
1399 Ga0105238_10649963
1400 Ga0105238_10905233
1401 Ga0105238_11355228
1402 Ga0105249_11051021
1403 Ga0105249_11493303
1404 Ga0105249_12843378
1405 Ga0130084_1087343
1406 Ga0130085_1104886
1407 Ga0105239_10330290
1408 Ga0105239_11325585
1409 Ga0105246_10003630
1410 Ga0105246_10833396
1411 Ga0105246_10854410
1412 Ga0105246_11289311
1413 Ga0157320_1010361
1414 Ga0157318_1018656
1415 Ga0157342_1028164
1416 Ga0157326_1009506
1417 Ga0154010_141469
1418 Ga0157373_10093996
1419 Ga0157371_10040913
1420 Ga0157371_10251184
1421 Ga0157370_10020407
1422 Ga0157370_10480970
1423 Ga0157370_10789993
1424 Ga0157370_11166939
1425 Ga0157369_10340722
1426 Ga0157369_10484200
1427 Ga0157369_10950529
1428 Ga0157369_11699054
1429 Ga0157374_10101023
1430 Ga0157374_10959465
1431 Ga0157378_10870191
1432 Ga0157372_11118046
1433 Ga0157372_11753016
1434 Ga0157372_12673868
1435 Ga0157375_10342053
1436 Ga0157375_10860112
1437 Ga0157375_12321951
1438 Ga0157375_12651894
1439 Ga0163163_10376126
1440 Ga0163163_11007748
1441 Ga0163163_11063056
1442 Ga0163163_12711349
1443 Ga0157380_11593304
1444 Ga0157380_13285738
1445 Ga0182008_10190489
1446 Ga0157377_10002911
1447 Ga0157377_10689081
1448 Ga0157379_10140306
1449 Ga0157379_10226154
1450 Ga0157376_10309994
1451 Ga0157376_11216712
1452 Ga0157376_11865405
1453 Ga0197907_10356475
1454 Ga0197907_10391573
1455 Ga0197907_10511654
1456 Ga0197907_10633838
1457 Ga0197907_10731388
1458 Ga0197907_10949401
1459 Ga0197907_11188081
1460 Ga0197907_11471494
1461 Ga0206356_10887482
1462 Ga0206356_11031005
1463 Ga0206356_11040059
1464 Ga0206356_11094015
1465 Ga0206356_11833246
1466 Ga0206356_11858767
1467 Ga0206349_1016341
1468 Ga0206349_1049485
1469 Ga0206349_1548026
1470 Ga0206355_1084914
1471 Ga0206355_1118041
1472 Ga0206355_1126517
1473 Ga0206355_1417974
1474 Ga0206355_1460842
1475 Ga0206355_1655392
1476 Ga0206351_10483280
1477 Ga0206351_10502929
1478 Ga0206351_10513026
1479 Ga0206351_10610955
1480 Ga0206351_10889650
1481 Ga0206352_10667226
1482 Ga0206352_10726005
1483 Ga0206352_10986910
1484 Ga0206352_11141801
1485 Ga0206350_10170609
1486 Ga0206350_10257355
1487 Ga0206350_10804271
1488 Ga0206350_10851205
1489 Ga0206350_11401277
1490 Ga0206354_10000715
1491 Ga0206354_10035765
1492 Ga0206354_10452546
1493 Ga0206354_10472065
1494 Ga0206354_10516190
1495 Ga0206354_10596477
1496 Ga0206354_11181496
1497 Ga0206353_10117959
1498 Ga0206353_10239640
1499 Ga0206353_10453711
1500 Ga0206353_10868437
1501 Ga0206353_11113762
1502 Ga0206353_11610083
1503 Ga0206353_11979475
1504 Ga0154015_1321943
1505 Ga0154015_1469900
1506 Ga0154015_1675764
1507 Ga0224712_10005659
1508 Ga0224712_10010082
1509 Ga0224712_10010159
1510 Ga0224712_10023728
1511 Ga0224712_10064587
1512 Ga0224712_10380125
1513 Ga0224712_10506907
1514 Ga0224712_10513384
1515 Ga0207713_1041726
1516 Ga0207692_10070446
1517 Ga0207692_10262544
1518 Ga0207642_10204093
1519 Ga0207710_10014134
1520 Ga0207647_10082211
1521 Ga0207647_10417567
1522 Ga0207645_10017688
1523 Ga0207643_10002089
1524 Ga0207643_10297476
1525 Ga0207705_10007931
1526 Ga0207705_10015200
1527 Ga0207654_10013204
1528 Ga0207654_11256021
1529 Ga0207707_10028012
1530 Ga0207707_10084168
1531 Ga0207707_10388364
1532 Ga0207707_10461843
1533 Ga0207695_10086383
1534 Ga0207671_10095680
1535 Ga0207671_11132095
1536 Ga0207693_10028753
1537 Ga0207693_10064337
1538 Ga0207693_10287117
1539 Ga0207663_10122605
1540 Ga0207663_10523937
1541 Ga0207663_10870615
1542 Ga0207660_10055414
1543 Ga0207660_10609576
1544 Ga0207662_10034135
1545 Ga0207662_10475906
1546 Ga0207657_10185805
1547 Ga0207657_10420469
1548 Ga0207649_10004433
1549 Ga0207649_10070500
1550 Ga0207649_10282445
1551 Ga0207652_10004203
1552 Ga0207652_10061664
1553 Ga0207652_10083068
1554 Ga0207652_10090147
1555 Ga0207652_10609864
1556 Ga0207694_10169497
1557 Ga0207694_10197643
1558 Ga0207650_10011563
1559 Ga0207659_10042850
1560 Ga0207659_10695293
1561 Ga0207659_11353852
1562 Ga0207687_10202761
1563 Ga0207700_10003264
1564 Ga0207700_10034290
1565 Ga0207700_10808439
1566 Ga0207700_10866059
1567 Ga0207700_11017347
1568 Ga0207664_10010419
1569 Ga0207664_11670779
1570 Ga0207664_11742984
1571 Ga0207644_10018730
1572 Ga0207690_10015527
1573 Ga0207690_11026227
1574 Ga0207690_11200792
1575 Ga0207690_11406743
1576 Ga0207706_10030233
1577 Ga0207706_11467437
1578 Ga0207686_11487021
1579 Ga0207670_10053403
1580 Ga0207670_10192108
1581 Ga0207670_10628470
1582 Ga0207665_10238338
1583 Ga0207665_10254816
1584 Ga0207691_10021575
1585 Ga0207711_11032478
1586 Ga0207711_11452298
1587 Ga0207661_10039485
1588 Ga0207661_10141404
1589 Ga0207661_10621201
1590 Ga0207661_11740550
1591 Ga0207679_10003731
1592 Ga0207679_10289028
1593 Ga0207679_10917863
1594 Ga0207679_11831436
1595 Ga0207667_10435483
1596 Ga0207667_10523275
1597 Ga0207651_11077952
1598 Ga0207712_11009142
1599 Ga0207712_11073256
1600 Ga0207668_10031521
1601 Ga0207668_11931043
1602 Ga0207640_11360506
1603 Ga0207658_12121673
1604 Ga0207677_10167050
1605 Ga0207677_10255235
1606 Ga0207703_10317468
1607 Ga0207639_10072464
1608 Ga0207639_11366650
1609 Ga0207639_11820156
1610 Ga0207678_10858285
1611 Ga0207678_10959994
1612 Ga0207678_11215445
1613 Ga0207708_10119093
1614 Ga0207708_10638490
1615 Ga0207702_10017073
1616 Ga0207702_10072516
1617 Ga0207641_10007209
1618 Ga0207641_10110520
1619 Ga0207648_10406847
1620 Ga0207676_10002451
1621 Ga0207676_10286665
1622 Ga0207674_10043063
1623 Ga0207674_10104826
1624 Ga0207675_100028646
1625 Ga0207675_100332863
1626 Ga0207683_10031983
1627 Ga0207683_10218976
1628 Ga0207683_10306387
1629 Ga0207683_11506685
1630 Ga0207698_10023796
1631 Ga0207698_10638913
1632 Ga0207428_10002902
1633 Ga0268266_10036855
1634 Ga0268266_10106164
1635 Ga0268265_11272482
1636 Ga0268264_10281820
1637 Ga0307517_10118346
1638 Ga0307515_10001812
1639 Ga0307515_10051195
1640 Ga0307515_10104593
1641 Ga0307511_10116992
1642 Ga0307512_10007298
1643 Ga0307513_10017932
1644 Ga0307513_10103919
1645 Ga0307513_10112852
1646 Ga0307513_10266258
1647 Ga0307408_100261093
1648 Ga0307408_100264370
1649 Ga0307408_100337570
1650 Ga0307408_101138352
1651 Ga0307408_101445278
1652 Ga0307408_101931294
1653 Ga0307508_10003351
1654 Ga0307508_10012047
1655 Ga0307508_10179119
1656 Ga0307508_10463955
1657 Ga0307514_10413159
1658 Ga0307516_10023078
1659 Ga0307516_10049250
1660 Ga0307516_10080069
1661 Ga0307405_10076719
1662 Ga0307405_10161360
1663 Ga0307405_10218801
1664 Ga0307405_10236329
1665 Ga0307405_10273516
1666 Ga0307405_10589329
1667 Ga0307405_10972683
1668 Ga0307413_10340662
1669 Ga0307413_10356678
1670 Ga0307413_10394382
1671 Ga0307413_10504691
1672 Ga0307413_10534963
1673 Ga0307413_10746142
1674 Ga0307413_10881248
1675 Ga0307413_11377922
1676 Ga0307413_11479240
1677 Ga0307518_10284046
1678 Ga0307410_10109410
1679 Ga0307410_10191571
1680 Ga0307410_10236459
1681 Ga0307410_10391672
1682 Ga0307410_10693864
1683 Ga0307410_10929522
1684 Ga0307410_11315877
1685 Ga0307410_11636273
1686 Ga0307410_12049908
1687 Ga0326468_10001157
1688 Ga0307406_10024435
1689 Ga0307406_10028359
1690 Ga0307406_10177088
1691 Ga0307406_10188837
1692 Ga0307406_10518339
1693 Ga0307406_10876782
1694 Ga0307406_11152717
1695 Ga0307406_11232334
1696 Ga0307407_10035608
1697 Ga0307407_10039561
1698 Ga0307407_10253678
1699 Ga0307407_10279627
1700 Ga0307407_10339391
1701 Ga0307407_10366312
1702 Ga0307407_11022059
1703 Ga0307412_10065395
1704 Ga0307412_10095271
1705 Ga0307412_10325618
1706 Ga0307412_10910006
1707 Ga0307412_11251693
1708 Ga0307409_100017545
1709 Ga0307409_100052854
1710 Ga0307409_100094193
1711 Ga0307409_100341855
1712 Ga0307409_100476313
1713 Ga0307409_100635273
1714 Ga0307409_100886394
1715 Ga0307409_100930118
1716 Ga0307409_101047794
1717 Ga0307409_101632127
1718 Ga0307409_102331514
1719 Ga0307409_102407541
1720 Ga0307416_100014883
1721 Ga0307416_100036084
1722 Ga0307416_100064521
1723 Ga0307416_100154192
1724 Ga0307416_100189090
1725 Ga0307416_100330505
1726 Ga0307416_100644594
1727 Ga0307416_100727581
1728 Ga0307416_101050605
1729 Ga0307416_101336454
1730 Ga0307416_101505571
1731 Ga0307416_103395600
1732 Ga0307416_103497754
1733 Ga0307414_10225085
1734 Ga0307414_10461493
1735 Ga0307414_10702795
1736 Ga0307414_11126115
1737 Ga0307414_11486590
1738 Ga0307414_11495097
1739 Ga0307411_10056847
1740 Ga0307411_10101205
1741 Ga0307411_10200982
1742 Ga0307411_11262069
1743 Ga0307411_11412900
1744 Ga0307411_11665949
1745 Ga0307415_100008029
1746 Ga0307415_100033892
1747 Ga0307415_100131993
1748 Ga0307415_100236273
1749 Ga0307415_100308833
1750 Ga0307415_100369152
1751 Ga0307415_100513396
1752 Ga0307415_100608634
1753 Ga0307415_101022041
1754 Ga0307415_101117753
1755 Ga0307415_102286906
1756 Ga0373950_0014056
1757 Ga0373929_0133123
1758 Ga0373929_0242963
1759 Ga0373940_0007085
1760 Ga0373940_0164876
1761 Ga0373951_0000463
1762 Ga0373952_0048318
1763 Ga0373932_0186273
1764 Ga0373936_0222380
1765 Ga0373945_0193415
1766 Ga0373960_0174214
1767 Ga0373943_0359790
1768 Ga0373946_0276810
1769 Ga0373942_0000479
1770 Ga0373942_0045512
1771 Ga0373962_0004423
1772 Ga0373931_0046447
1773 Ga0373931_0125226
1774 Ga0373931_0621784
1775 Ga0373935_0017873
1776 Ga0373935_0643016
1777 Ga0373935_0862703
1778 Ga0373925_0456924
1779 Ga0373925_1125641
1780 Ga0395899_0254458
1781 Ga0395899_0404327
1782 Ga0395899_0590332
1783 Ga0395899_0673174
1784 Ga0395900_0014327
1785 Ga0395900_0123671
1786 Ga0395900_0431590
1787 Ga0395900_1879661
1788 Ga0395898_0021962
1789 Ga0395898_0052865
1790 Ga0395898_0072810
1791 Ga0395898_0185594
1792 Ga0395905_0932659
1793 Ga0436364_0331973
1794 Ga0436364_0851430
1795 Ga0395901_0008088
1796 Ga0395901_0013538
1797 Ga0395901_0042762
1798 Ga0395901_0183293
1799 Ga0436363_1651514
1800 Ga0439447_053842
1801 Ga0451789_0657542
1802 Ga0451791_1217965
1803 Ga0451793_0887120
1804 Ga0451801_15528
1805 Ga0451802_1574513
1806 Ga0451804_0214233
1807 Ga0451804_0678624
1808 Ga0451807_0691119
1809 Ga0451835_0487623
1810 Ga0451837_0823205
1811 Ga0451839_0748863
1812 Ga0451841_0159007
1813 Ga0451847_0907213
1814 Ga0451843_0355274
1815 Ga0451853_0669882
1816 Ga0451853_2012304
1817 Ga0439433_0084542
1818 Ga0439448_0026261
1819 Ga0439463_025905
1820 Ga0439463_212223
1821 Ga0450923_111259
1822 Ga0450900_010409
1823 Ga0450902_029835
1824 Ga0450905_009200
1825 Ga0439459_0008060
1826 Ga0439459_0113624
1827 Ga0439459_0152160
1828 Ga0439464_0027423
1829 Ga0439464_0055266
1830 Ga0450901_040448
1831 Ga0466969_0112933
1832 Ga0466969_0521973
1833 Ga0466972_0151683
1834 Ga0466965_0087939
1835 Ga0466965_0668230
1836 Ga0466966_0215282
1837 Ga0466966_0544677
1838 Ga0466966_0829636
1839 Ga0466961_0104065
1840 Ga0466961_0331429
1841 Ga0466961_0534953
1842 Ga0466963_0012748
1843 Ga0466963_0387822
1844 Ga0466963_0462324
1845 Ga0466963_0490286
1846 Ga0466963_0746615
1847 Ga0466964_0252763
1848 Ga0466964_0397261
1849 Ga0466964_0704063
1850 Ga0466964_0922303
1851 Ga0466971_0045049
1852 Ga0466971_0209828
1853 Ga0466971_0402477
1854 Ga0466968_0270107
1855 Ga0466970_0101046
1856 Ga0466970_0186881
1857 Ga0466970_0227635
1858 Ga0466970_0333703
1859 Ga0466970_0371307
1860 Ga0466970_0511510
1861 Ga0466957_0006102
1862 Ga0466957_0290325
1863 Ga0466957_0932066
1864 Ga0466957_1119544
1865 Ga0466960_0126172
1866 Ga0466960_0178241
1867 Ga0466960_0321500
1868 Ga0466960_0388962
1869 Ga0466960_0605751
1870 Ga0466959_0103930
1871 Ga0466959_0245006
1872 Ga0466959_0395638
1873 Ga0466959_0502413
1874 Ga0466959_0637839
1875 Ga0466959_0686772
1876 Ga0466959_0714098
1877 Ga0466958_0006910
1878 Ga0466958_0069284
1879 Ga0466958_0292197
1880 Ga0466958_0574976
1881 Ga0466958_1032283
1882 Ga0466967_0214532
1883 Ga0466967_0346000
1884 Ga0466967_0502429
1885 Ga0466967_1487806
1886 Ga0466967_2261283
1887 Ga0495603_0505647
1888 Ga0495629_0029225
1889 Ga0495638_0239364
1890 Ga0495641_0558516
1891 Ga0495582_0581073
1892 Ga0495585_0184036
1893 Ga0495616_0340944
1894 Ga0495631_0099125
1895 Ga0495632_0021539
1896 Ga0495632_0052375
1897 Ga0495644_0216348
1898 Ga0495654_0186332
1899 Ga0495640_0579224
1900 Ga0495609_0215830
1901 Ga0495621_0118080
1902 Ga0495656_0119943
1903 Ga0495656_0307750
1904 Ga0495668_0250283
1905 Ga0495661_0406478
1906 Ga0495588_0307163
1907 Ga0495657_0454280
1908 Ga0495658_0456178
1909 Ga0495669_0019422
1910 Ga0495613_1004268
1911 Ga0495624_0297375
1912 Ga0495670_0130068
1913 Ga0495581_0099232
1914 Ga0495581_0106714
1915 Ga0495676_0568775
1916 Ga0495680_0846079
1917 Ga0495675_0402568
1918 Ga0495677_0028270
1919 Ga0495685_254956
1920 Ga0495593_0271436
1921 Ga0495614_0552418
1922 Ga0495615_0064206
1923 Ga0496100_0577715
1924 Ga0496102_0071684
1925 Ga0496102_0989376
1926 Ga0496104_0006275
1927 Ga0496104_0544843
1928 Ga0496105_0051832
1929 Ga0496105_0679476
1930 Ga0496105_0859331
1931 Ga0496106_0014813
1932 Ga0496106_0210540
1933 Ga0496106_1054841
1934 Ga0496107_0036486
1935 Ga0496107_0474447
1936 Ga0496108_0000043
1937 Ga0496108_0023561
1938 Ga0496108_0207592
1939 Ga0496108_1409722
1940 Ga0496109_0679033
1941 Ga0496109_0948459
1942 Ga0496110_0006221
1943 Ga0496110_0850028
1944 Ga0496111_0145743
1945 Ga0496111_0830552
1946 Ga0496112_0084231
1947 Ga0496112_0210360
1948 Ga0496112_0809318
1949 Ga0496113_0098655
1950 Ga0496113_0183972
1951 Ga0496113_0548820
1952 Ga0496114_0955653
1953 Ga0496114_1766659
1954 Ga0496115_0036607
1955 Ga0496115_0215335
1956 Ga0496115_0519805
1957 Ga0496126_0039353
1958 Ga0496126_1104051
1959 Ga0501306_015842
1960 Ga0501306_041094
1961 Ga0501306_042794
1962 Ga0501306_060023
1963 Ga0501306_107771
1964 Ga0501308_013417
1965 Ga0501308_037168
1966 Ga0501308_038362
1967 Ga0501309_019895
1968 Ga0501309_047685
1969 Ga0501309_057543
1970 Ga0501309_077048
1971 Ga0501310_015665
1972 Ga0501310_022772
1973 Ga0501310_045021
1974 Ga0501310_052217
1975 Ga0501341_07343
1976 Ga0501341_11037
1977 Ga0501341_15040
1978 Ga0501304_010765
1979 Ga0501305_059256
1980 Ga0501305_066644
1981 Ga0501307_020498
1982 Ga0501307_043099
1983 Ga0501307_049787
1984 Ga0501294_011007
1985 Ga0501311_024050
1986 Ga0501312_004720
1987 Ga0501312_020483
1988 Ga0501313_016430
1989 Ga0501313_050527
1990 Ga0501314_004579
1991 Ga0501314_008510
1992 Ga0501314_033788
1993 Ga0501315_021741
1994 Ga0501315_032613
1995 Ga0501316_032470
1996 Ga0501316_038761
1997 Ga0501317_009803
1998 Ga0501317_022426
1999 Ga0501317_024948
2000 Ga0501318_002847
2001 Ga0501318_014714
2002 Ga0501318_027680
2003 Ga0501318_034788
2004 Ga0501318_035505
2005 Ga0501318_035750
2006 Ga0501318_043480
2007 Ga0501319_001908
2008 Ga0501319_002279
2009 Ga0501320_025583
2010 Ga0501320_027277
2011 Ga0501320_028453
2012 Ga0501320_046231
2013 Ga0501321_021705
2014 Ga0501321_025001
2015 Ga0501321_039197
2016 Ga0501321_043159
2017 Ga0501322_000554
2018 Ga0501322_011003
2019 Ga0501323_038903
2020 Ga0501323_039272
2021 Ga0501323_092161
2022 Ga0501324_003187
2023 Ga0501324_003960
2024 Ga0501324_008952
2025 Ga0501324_018450
2026 Ga0501324_019575
2027 Ga0501324_026983
2028 Ga0501325_008439
2029 Ga0501325_011558
2030 Ga0501325_020811
2031 Ga0501325_053628
2032 Ga0501325_056154
2033 Ga0501326_06330
2034 Ga0501330_008147
2035 Ga0501330_009879
2036 Ga0501332_09188
2037 Ga0501333_004109
2038 Ga0501336_010878
2039 Ga0501337_004918
2040 Ga0501340_001733
2041 Ga0501340_012472
2042 Ga0501031_0032070
2043 Ga0501031_0251952
2044 Ga0501031_0255011
2045 Ga0501032_0025353
2046 Ga0501032_0027327
2047 Ga0501032_0099412
2048 Ga0501032_0129448
2049 Ga0501033_0500218
2050 Ga0501034_0043245
2051 Ga0501034_0288249
2052 Ga0501034_0716403
2053 Ga0501036_0271293
2054 Ga0501036_0683565
2055 Ga0501037_0015377
2056 Ga0501037_0023357
2057 Ga0501038_0003477
2058 Ga0501038_0419031
2059 Ga0501038_0805865
2060 Ga0501039_0020664
2061 Ga0501039_0436639
2062 Ga0501039_0700846
2063 Ga0501040_1020907
2064 Ga0501042_0348768
2065 Ga0501042_0433902
2066 Ga0501043_0009715
2067 Ga0501043_0065711
2068 Ga0501043_0912995
2069 Ga0501043_1032153
2070 Ga0501046_0525250
2071 Ga0501046_0604004
2072 Ga0501047_0000278
2073 Ga0501047_0000811
2074 Ga0501047_0053457
2075 Ga0501047_0109201
2076 Ga0501047_1395960
2077 Ga0501048_0000853
2078 Ga0501048_0511053
2079 Ga0501048_0733973
2080 Ga0501068_0226302
2081 Ga0501068_0454140
2082 Ga0501069_0324486
2083 Ga0501070_0018107
2084 Ga0501070_0084253
2085 Ga0501070_0553621
2086 Ga0501071_0288416
2087 Ga0501071_0463056
2088 Ga0501072_0852645
2089 Ga0501072_1485199
2090 Ga0501073_0188088
2091 Ga0501073_1127616
2092 Ga0501073_1128844
2093 Ga0501074_0018515
2094 Ga0501075_0243915
2095 Ga0501075_0578735
2096 Ga0501076_1129738
2097 Ga0501077_0505915
2098 Ga0501202_138270
2099 Ga0501206_073400
2100 Ga0501206_095777
2101 Ga0501243_038166
2102 Ga0501250_004678
2103 Ga0501253_076304
2104 Ga0501221_187885
2105 Ga0501080_0004134
2106 Ga0501080_0025709
2107 Ga0501080_0862801
2108 Ga0501081_0091990
2109 Ga0501081_0501284
2110 Ga0501271_063174
2111 Ga0501281_16014
2112 Ga0501035_0038436
2113 Ga0501035_0202932
2114 Ga0501044_0074873
2115 Ga0501044_0095420
2116 Ga0501044_0105745
2117 Ga0501044_0551129
2118 Ga0501045_0065355
2119 Ga0501045_0759188
2120 Ga0501212_016793
2121 nmdc:mga03n38_186314_c1
2122 nmdc:mga06z11_516640_c1
2123 nmdc:mga05p37_123655_c1
2124 nmdc:mga05p37_162208_c1
2125 nmdc:mga05p37_177510_c1
2126 nmdc:mga05p37_1822883_c1
2127 nmdc:mga05p37_363629_c1
2128 nmdc:mga05p37_716771_c1
2129 nmdc:mga05p37_7235_c1
2130 nmdc:mga05p37_834097_c1
2131 nmdc:mga09592_24046_c1
2132 nmdc:mga09592_271995_c1
2133 nmdc:mga09592_3032_c1
2134 nmdc:mga09592_425863_c1
2135 nmdc:mga09592_96028_c1
2136 nmdc:mga0qj67_35737_c1
2137 nmdc:mga06r32_235136_c1
2138 nmdc:mga06r32_33048_c1
2139 nmdc:mga06r32_545733_c1
2140 nmdc:mga06r32_880541_c1
2141 nmdc:mga06r32_895258_c1
2142 nmdc:mga08y16_1607870_c1
2143 nmdc:mga08y16_36056_c1
2144 nmdc:mga0n895_486326_c1
2145 nmdc:mga0n895_56468_c1
2146 nmdc:mga0n895_776852_c1
2147 nmdc:mga0rr50_43762_c1
2148 nmdc:mga08x19_3249_c1
2149 nmdc:mga0a205_1925_c1
2150 nmdc:mga0a205_493254_c1
2151 Ga0495655_0336295
2152 Ga0500578_0187199
2153 Ga0500643_001399
2154 Ga0500644_0006960
2155 Ga0500644_0050399
2156 Ga0500644_0177867
2157 Ga0500646_0005473
2158 Ga0500651_0042524
2159 Ga0500641_0008601
2160 Ga0500641_0013366
2161 Ga0500650_0055724
2162 Ga0500660_115897
2163 Ga0500556_0054639
2164 Ga0500562_032531
2165 Ga0500569_001934
2166 Ga0500594_0057890
2167 Ga0500621_130042
2168 Ga0500652_002002
2169 Ga0500658_0217687
2170 Ga0500579_078834
2171 Ga0500588_0002195
2172 Ga0500588_0084668
2173 Ga0500589_157930
2174 Ga0500622_0138576
2175 Ga0500630_285297
2176 Ga0500633_0251722
2177 Ga0500634_0377664
2178 Ga0587084_011899
2179 Ga0587084_032338
2180 Ga0587084_034181
2181 Ga0587084_083035
2182 Ga0587084_102646
2183 Ga0587093_006992
2184 Ga0587093_022718
2185 Ga0587066_055425
2186 Ga0587066_117250
2187 Ga0587070_051962
2188 Ga0587070_117878
2189 Ga0587070_185580
2190 Ga0587073_0080963
2191 Ga0587073_0266780
2192 Ga0587073_0273658
2193 Ga0587077_086063
2194 Ga0587077_176178
2195 Ga0587080_011481
2196 Ga0587080_012877
2197 Ga0587080_160302
2198 Ga0587082_178140
2199 Ga0587083_0031125
2200 Ga0587083_0032986
2201 Ga0587083_0036588
2202 Ga0587083_0096390
2203 Ga0587083_0118035
2204 Ga0587083_0129878
2205 Ga0587083_0163716
2206 Ga0587083_0201997
2207 Ga0587085_011491
2208 Ga0587085_019890
2209 Ga0587085_101757
2210 Ga0587086_018073
2211 Ga0587086_023672
2212 Ga0587088_050557
2213 Ga0587088_056450
2214 Ga0587089_016154
2215 Ga0587090_015681
2216 Ga0587090_044881
2217 Ga0587090_121466
2218 Ga0587091_012183
2219 Ga0587091_023594
2220 Ga0587091_025987
2221 Ga0587091_102323
2222 Ga0587092_004442
2223 Ga0587092_030061
2224 Ga0587092_049007
2225 Ga0587092_052695
2226 Ga0587092_088680
2227 Ga0587094_040989
2228 Ga0587094_051581
2229 Ga0587098_005401
2230 Ga0587098_039472
2231 Ga0587098_065869
2232 Ga0587106_004030
2233 Ga0587106_028574
2234 Ga0587106_074765
2235 Ga0587106_122465
2236 Ga0587125_002113
2237 Ga0587129_008560
2238 Ga0587099_006116
2239 Ga0587101_016593
2240 Ga0587109_049071
2241 Ga0587109_076477
2242 Ga0587109_093501
2243 Ga0587109_101306
2244 Ga0587115_033939
2245 Ga0587115_081177
2246 Ga0587117_024422
2247 Ga0587117_064563
2248 Ga0587122_036941
2249 Ga0587127_006350
2250 Ga0587128_017047
2251 Ga0587128_053654
2252 Ga0587128_125004
2253 Ga0587062_003426
2254 Ga0587067_049243
2255 Ga0587068_019156
2256 Ga0587068_053142
2257 Ga0587069_154504
2258 Ga0587072_029663
2259 Ga0587072_078861
2260 Ga0587072_196961
2261 Ga0587075_053087
2262 Ga0587076_006901
2263 Ga0587076_111178
2264 Ga0587076_147397
2265 Ga0587076_155865
2266 Ga0587078_063842
2267 Ga0587079_112206
2268 Ga0587079_190887
2269 Ga0587079_191740
2270 Ga0587107_020410
2271 Ga0587107_034467
2272 Ga0587107_109028
2273 Ga0587108_003256
2274 Ga0587108_018973
2275 Ga0587110_036107
2276 Ga0587114_009789
2277 Ga0587114_011482
2278 Ga0587114_100857
2279 Ga0587118_22038
2280 Ga0587119_004905
2281 Ga0587119_020492
2282 Ga0587120_013445
2283 Ga0587071_013067
2284 Ga0587071_065132
2285 Ga0587071_072454
2286 Ga0587071_108677
2287 Ga0587071_142931
2288 Ga0587071_159053
2289 Ga0587111_0052099
2290 Ga0587111_0182057
2291 Ga0501082_0538361
2292 Ga0466962_0029867
2293 Ga0466962_0186980
2294 Ga0466962_0192437
2295 Ga0466962_0728950
2296 Ga0530510_0444541
2297 2501945902
2298 2515496689
2299 2515718310
2300 2515756928
2301 2516083530
2302 2516089466
2303 2623497648
2304 2623585036
2305 2772644892
2306 2867510880
2307 2996223711
2308 649810773
2309 8003835116
2310 8003862015
2311 8003872925
2312 8055412841

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

27

58

0.98

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

60

126

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xym-assembly1.cif.gz_U large subunit of mycobacterium smegmatis 0.9671 18 121
5xym-assembly1.cif.gz_U large subunit of mycobacterium smegmatis 0.956 18 121
7mt3-assembly1.cif.gz_U mtb 70s with p/e trna 0.9462 18 120
5o61-assembly1.cif.gz_V the complete structure of the mycobacterium smegmatis 70s ribosome 0.9376 18 121
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9372 16 91
ID Description Score Start End Superfamily
af_P9WHB7_1_104_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9531 18 120 2.30.30.30
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9441 17 119 2.30.30.30
af_P9WHB7_1_104_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9356 18 120 2.30.30.30
af_Q69T55_240_282_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8991 20 53 2.30.30.30
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8805 18 120 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1V2Q2Y1-F1-model_v4 Large ribosomal subunit protein uL24 0.9615 18 121 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A323VGA6-F1-model_v4 Large ribosomal subunit protein uL24 0.9566 18 121 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1V2Q2Y1-F1-model_v4 Large ribosomal subunit protein uL24 0.9527 18 121 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7K1C5Y8-F1-model_v4 Large ribosomal subunit protein uL24 0.9518 18 121 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6J7HUI7-F1-model_v4 Unannotated protein 0.9508 17 121 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map