F490944

General Info

Members Datasets Scaffolds Average Seq Length
1156 524 2312 167

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0314542|Ga0395905_0314542_288_896
Length 202
Sequence MQIVLVAQYTENDAVFFIVFPHEEARCWATRRIAMGLFTRDIKTMDDLFVHQLQDIYYAEKQLVKALPKMAEKANDNQLKQGFLGHLEQTKGHVTRLEQVFQMHGVTPKAVTCPAIDGIIEEADEVAGEVADKQVLDAALINAAQAAEHYEITRYGTLVTWAKRLGRNDCAAVLQKTLDEEKATDKKLTQLAESGINLKAAS

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
125 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
144 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
145 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
162 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300023684 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
246 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
252 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
255 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
260 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
261 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
262 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
263 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
264 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
265 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
266 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
267 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
268 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
271 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
272 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
273 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
274 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
275 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
276 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
281 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
292 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
293 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
294 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
295 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
296 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
297 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
315 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
332 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
333 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
334 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
344 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
349 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
350 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
351 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
352 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
353 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
354 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
355 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
359 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
360 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
361 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
366 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
367 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
368 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
369 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
370 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
371 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
374 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
375 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
376 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
377 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
378 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
379 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
380 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
381 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
384 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
385 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
402 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
403 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
404 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
426 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
427 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
428 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
429 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
430 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
431 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
432 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
433 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
434 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
435 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
436 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
439 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
440 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
443 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
444 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
445 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
446 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
447 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
448 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
449 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
452 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
453 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
454 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
455 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
456 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
457 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
458 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
459 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
460 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
461 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
462 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
463 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
464 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
465 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
466 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
467 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
468 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
469 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
470 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
471 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
472 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
473 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
474 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
475 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
476 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
477 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
478 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
479 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
480 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
481 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
482 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
483 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
484 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
485 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
486 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
487 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
490 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
491 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
492 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
493 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
494 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
495 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
496 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
497 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
498 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
499 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
500 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
508 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
509 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
510 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
511 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
512 2643221651 Afipia sp. Root123D2 Isolate Unclassified
513 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
514 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
515 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
516 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
517 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
518 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
519 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
520 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
521 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
522 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
523 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
524 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.18
Metatranscriptomes 7.44
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.09
Nodule 0.43
Rhizoplane 5.28
Rhizosphere 81.75
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0314542 3300037471 Bacteria 1455
2 SwRhRL2b_contig_3951670 2162886007 Bacteria 800
3 JGI24746J21847_1021252 3300001977 Bacteria 907
4 JGI24747J21853_1042903 3300001978 Bacteria 539
5 JGI24740J21852_10024470 3300001979 Bacteria 2048
6 JGI24739J22299_10007360 3300001989 Bacteria 4133
7 JGI24737J22298_10008541 3300001990 Bacteria 3425
8 JGI24737J22298_10126944 3300001990 Bacteria 753
9 JGI24743J22301_10050615 3300001991 Bacteria 846
10 JGI24735J21928_10013907 3300002067 Bacteria 2524
11 JGI24750J21931_1036810 3300002070 Bacteria 734
12 JGI24749J21850_1023924 3300002076 Bacteria 868
13 JGI24744J21845_10067843 3300002077 Bacteria 651
14 JGI24033J26618_1025586 3300002155 Bacteria 775
15 JGI24034J26672_10035091 3300002239 Bacteria 828
16 JGI24742J22300_10042532 3300002244 Bacteria 812
17 JGI24742J22300_10059722 3300002244 Bacteria 699
18 JGI24751J29686_10018533 3300002459 Bacteria 1440
19 JGI25406J46586_10002904 3300003203 Bacteria 8083
20 Ga0006777J48905_1012696 3300003308 Bacteria 553
21 Ga0006777J48905_1040219 3300003308 Bacteria 567
22 Ga0006777J48905_1058774 3300003308 Bacteria 953
23 Ga0006781J51513_1035190 3300003568 Bacteria 587
24 Ga0007410J51695_1043051 3300003574 Bacteria 586
25 Ga0007409J51694_1088714 3300003575 Bacteria 562
26 Ga0007429J51699_1021511 3300003579 Bacteria 651
27 Ga0007429J51699_1059805 3300003579 Bacteria 589
28 JGI25404J52841_10022797 3300003659 Bacteria 1352
29 JGI25404J52841_10033517 3300003659 Bacteria 1094
30 Ga0032354_1012960 3300003693 Bacteria 654
31 Ga0032354_1047272 3300003693 Bacteria 546
32 Ga0032354_1052366 3300003693 Bacteria 825
33 Ga0006780_1021799 3300003735 Bacteria 605
34 Ga0058863_11574013 3300004799 Bacteria 670
35 Ga0058860_12115543 3300004801 Bacteria 611
36 Ga0058860_12149836 3300004801 Bacteria 713
37 Ga0065715_10500263 3300005293 Bacteria 780
38 Ga0065707_10331906 3300005295 Bacteria 948
39 Ga0070658_10122009 3300005327 Bacteria 2166
40 Ga0070658_10719580 3300005327 Bacteria 867
41 Ga0070676_10214685 3300005328 Bacteria 1268
42 Ga0070683_100116918 3300005329 Bacteria 2518
43 Ga0070683_100186787 3300005329 Bacteria 1967
44 Ga0070690_100312075 3300005330 Bacteria 1131
45 Ga0070670_100036037 3300005331 Bacteria 4258
46 Ga0070670_100131914 3300005331 Bacteria 2158
47 Ga0070670_101179141 3300005331 Bacteria 700
48 Ga0068869_100143438 3300005334 Bacteria 1846
49 Ga0068869_100177601 3300005334 Bacteria 1668
50 Ga0068869_100313946 3300005334 Bacteria 1269
51 Ga0070666_10091734 3300005335 Bacteria 2087
52 Ga0070666_10316492 3300005335 Bacteria 1113
53 Ga0070680_100013974 3300005336 Bacteria 6267
54 Ga0070682_100068797 3300005337 Bacteria 2259
55 Ga0070682_100095633 3300005337 Bacteria 1951
56 Ga0070682_100479432 3300005337 Bacteria 959
57 Ga0068868_100147810 3300005338 Bacteria 1933
58 Ga0068868_100725833 3300005338 Bacteria 891
59 Ga0068868_100968955 3300005338 Bacteria 776
60 Ga0070660_100235492 3300005339 Bacteria 1490
61 Ga0070660_100278994 3300005339 Bacteria 1367
62 Ga0070660_100834516 3300005339 Bacteria 776
63 Ga0070660_100857848 3300005339 Bacteria 765
64 Ga0070689_100032271 3300005340 Bacteria 3982
65 Ga0070691_10075852 3300005341 Bacteria 1638
66 Ga0070687_100237656 3300005343 Bacteria 1125
67 Ga0070661_100024323 3300005344 Bacteria 4344
68 Ga0070661_100214230 3300005344 Bacteria 1475
69 Ga0070661_100598004 3300005344 Bacteria 891
70 Ga0070692_10548936 3300005345 Bacteria 757
71 Ga0070668_100217633 3300005347 Bacteria 1574
72 Ga0070668_100248629 3300005347 Bacteria 1475
73 Ga0070668_100275195 3300005347 Bacteria 1404
74 Ga0070669_100129738 3300005353 Bacteria 1932
75 Ga0070669_100335643 3300005353 Bacteria 1224
76 Ga0070671_100063284 3300005355 Bacteria 3080
77 Ga0070671_100172520 3300005355 Bacteria 1829
78 Ga0070671_101044787 3300005355 Bacteria 717
79 Ga0070674_100068947 3300005356 Bacteria 2493
80 Ga0070674_100654750 3300005356 Bacteria 893
81 Ga0070673_100169492 3300005364 Bacteria 1862
82 Ga0070673_100474346 3300005364 Bacteria 1128
83 Ga0070673_100737795 3300005364 Bacteria 906
84 Ga0070688_100130134 3300005365 Bacteria 1697
85 Ga0070688_100199709 3300005365 Bacteria 1398
86 Ga0070659_100044581 3300005366 Bacteria 3473
87 Ga0070659_100123679 3300005366 Bacteria 2097
88 Ga0070659_100224555 3300005366 Bacteria 1551
89 Ga0070659_100299217 3300005366 Bacteria 1341
90 Ga0070659_100666840 3300005366 Bacteria 898
91 Ga0070659_101470739 3300005366 Bacteria 607
92 Ga0070667_100042228 3300005367 Bacteria 3826
93 Ga0070667_100291770 3300005367 Bacteria 1467
94 Ga0070667_100461147 3300005367 Bacteria 1162
95 Ga0070703_10168139 3300005406 Bacteria 838
96 Ga0070703_10207770 3300005406 Bacteria 772
97 Ga0070709_10001015 3300005434 Bacteria 15518
98 Ga0070714_100008787 3300005435 Bacteria 7901
99 Ga0070714_100160074 3300005435 Bacteria 2036
100 Ga0070714_101523020 3300005435 Bacteria 653
101 Ga0070713_100002311 3300005436 Bacteria 12409
102 Ga0070713_100102531 3300005436 Bacteria 2482
103 Ga0070713_100504541 3300005436 Bacteria 1142
104 Ga0070710_10013948 3300005437 Bacteria 4035
105 Ga0070710_10446128 3300005437 Bacteria 876
106 Ga0070710_10557628 3300005437 Bacteria 792
107 Ga0070701_10170254 3300005438 Bacteria 1268
108 Ga0070701_10182050 3300005438 Bacteria 1231
109 Ga0070711_100147022 3300005439 Bacteria 1773
110 Ga0070711_100184808 3300005439 Bacteria 1598
111 Ga0070705_100354370 3300005440 Bacteria 1071
112 Ga0070705_100414755 3300005440 Bacteria 1001
113 Ga0070700_100014021 3300005441 Bacteria 4518
114 Ga0070700_100258660 3300005441 Bacteria 1252
115 Ga0070700_100959397 3300005441 Bacteria 700
116 Ga0070694_100085125 3300005444 Bacteria 2207
117 Ga0070694_100153679 3300005444 Bacteria 1683
118 Ga0070694_100299584 3300005444 Bacteria 1231
119 Ga0070694_100502318 3300005444 Bacteria 965
120 Ga0070663_100008060 3300005455 Bacteria 6460
121 Ga0070663_100086075 3300005455 Bacteria 2320
122 Ga0070663_100113623 3300005455 Bacteria 2038
123 Ga0070663_100159559 3300005455 Bacteria 1735
124 Ga0070663_100182877 3300005455 Bacteria 1627
125 Ga0070663_100420146 3300005455 Bacteria 1096
126 Ga0070663_100773989 3300005455 Bacteria 821
127 Ga0070663_100809046 3300005455 Bacteria 804
128 Ga0070678_100135175 3300005456 Bacteria 1965
129 Ga0070678_100418545 3300005456 Bacteria 1167
130 Ga0070678_100855993 3300005456 Bacteria 829
131 Ga0070662_100054508 3300005457 Bacteria 2897
132 Ga0070662_100057011 3300005457 Bacteria 2837
133 Ga0070662_100084041 3300005457 Bacteria 2377
134 Ga0070662_100230727 3300005457 Bacteria 1481
135 Ga0070662_101063909 3300005457 Bacteria 694
136 Ga0070681_10013083 3300005458 Bacteria 8240
137 Ga0070681_10070681 3300005458 Bacteria 3455
138 Ga0070685_10251199 3300005466 Bacteria 1172
139 Ga0070698_100053016 3300005471 Bacteria 4124
140 Ga0070679_100126829 3300005530 Bacteria 2534
141 Ga0070679_100267934 3300005530 Bacteria 1662
142 Ga0070679_100652430 3300005530 Bacteria 995
143 Ga0070679_100754742 3300005530 Bacteria 916
144 Ga0070684_100092938 3300005535 Bacteria 2685
145 Ga0070684_100626745 3300005535 Bacteria 1000
146 Ga0070697_100064835 3300005536 Bacteria 2984
147 Ga0068853_100004957 3300005539 Bacteria 10372
148 Ga0068853_100039011 3300005539 Bacteria 4049
149 Ga0068853_100130476 3300005539 Bacteria 2249
150 Ga0068853_100663727 3300005539 Bacteria 993
151 Ga0068853_100767883 3300005539 Bacteria 922
152 Ga0070672_100586816 3300005543 Bacteria 970
153 Ga0070686_100050014 3300005544 Bacteria 2654
154 Ga0070686_100404916 3300005544 Bacteria 1039
155 Ga0070686_100665765 3300005544 Bacteria 827
156 Ga0070695_100042844 3300005545 Bacteria 2875
157 Ga0070695_100315310 3300005545 Bacteria 1160
158 Ga0070696_100000971 3300005546 Bacteria 18578
159 Ga0070696_100044480 3300005546 Bacteria 3075
160 Ga0070696_100246081 3300005546 Bacteria 1350
161 Ga0070693_100017592 3300005547 Bacteria 3719
162 Ga0070693_100987912 3300005547 Bacteria 636
163 Ga0070693_100988161 3300005547 Bacteria 636
164 Ga0070665_100003902 3300005548 Bacteria 15759
165 Ga0070665_100053521 3300005548 Bacteria 4048
166 Ga0070665_100113980 3300005548 Bacteria 2706
167 Ga0070665_100546810 3300005548 Bacteria 1170
168 Ga0070665_100550745 3300005548 Bacteria 1166
169 Ga0070665_100891149 3300005548 Bacteria 902
170 Ga0070704_100181227 3300005549 Bacteria 1685
171 Ga0070704_100238813 3300005549 Bacteria 1486
172 Ga0068855_100075381 3300005563 Bacteria 3917
173 Ga0068855_100110751 3300005563 Bacteria 3151
174 Ga0068855_100227171 3300005563 Bacteria 2091
175 Ga0068855_100272230 3300005563 Bacteria 1883
176 Ga0068855_100337368 3300005563 Bacteria 1663
177 Ga0070664_100351050 3300005564 Bacteria 1342
178 Ga0070664_100481716 3300005564 Bacteria 1142
179 Ga0068857_100020850 3300005577 Bacteria 5765
180 Ga0068857_100334791 3300005577 Bacteria 1399
181 Ga0068854_100006791 3300005578 Bacteria 7294
182 Ga0068854_100006800 3300005578 Bacteria 7290
183 Ga0068854_101698589 3300005578 Bacteria 577
184 Ga0068854_101707607 3300005578 Bacteria 576
185 Ga0068856_100000363 3300005614 Bacteria 49777
186 Ga0068856_100028283 3300005614 Bacteria 5473
187 Ga0068856_100154754 3300005614 Bacteria 2302
188 Ga0068856_100411333 3300005614 Bacteria 1372
189 Ga0070702_100003979 3300005615 Bacteria 6703
190 Ga0070702_100104963 3300005615 Bacteria 1740
191 Ga0068852_100005807 3300005616 Bacteria 8861
192 Ga0068852_100391373 3300005616 Bacteria 1365
193 Ga0068859_100117890 3300005617 Bacteria 2720
194 Ga0068859_100224959 3300005617 Bacteria 1964
195 Ga0068864_100064661 3300005618 Bacteria 3173
196 Ga0068864_100109309 3300005618 Bacteria 2461
197 Ga0068864_101347514 3300005618 Bacteria 715
198 Ga0068866_10418506 3300005718 Bacteria 869
199 Ga0068861_100028388 3300005719 Bacteria 4082
200 Ga0068861_100101152 3300005719 Bacteria 2292
201 Ga0068861_100152343 3300005719 Bacteria 1898
202 Ga0068851_10009198 3300005834 Bacteria 4587
203 Ga0068851_10034585 3300005834 Bacteria 2523
204 Ga0068851_10147229 3300005834 Bacteria 1285
205 Ga0068870_10049659 3300005840 Bacteria 2214
206 Ga0068863_100020353 3300005841 Bacteria 6344
207 Ga0068858_100249886 3300005842 Bacteria 1684
208 Ga0068858_100482037 3300005842 Bacteria 1197
209 Ga0068858_101021531 3300005842 Bacteria 810
210 Ga0068860_100061571 3300005843 Bacteria 3565
211 Ga0068860_100067286 3300005843 Bacteria 3404
212 Ga0068860_101207093 3300005843 Bacteria 777
213 Ga0068862_100131627 3300005844 Bacteria 2213
214 Ga0068862_100889847 3300005844 Bacteria 875
215 Ga0081455_10000633 3300005937 Bacteria 45582
216 Ga0081455_10045282 3300005937 Bacteria 3829
217 Ga0081540_1001350 3300005983 Bacteria 21352
218 Ga0081540_1005948 3300005983 Bacteria 9003
219 Ga0081540_1013070 3300005983 Bacteria 5422
220 Ga0081540_1023275 3300005983 Bacteria 3629
221 Ga0081539_10000864 3300005985 Bacteria 58047
222 Ga0081539_10064473 3300005985 Bacteria 1993
223 Ga0070717_10008605 3300006028 Bacteria 7627
224 Ga0070717_10207693 3300006028 Bacteria 1718
225 Ga0070717_10349425 3300006028 Bacteria 1322
226 Ga0075365_10007938 3300006038 Bacteria 5983
227 Ga0075365_10142814 3300006038 Bacteria 1662
228 Ga0075365_10262762 3300006038 Bacteria 1214
229 Ga0075365_10600407 3300006038 Bacteria 778
230 Ga0075368_10022861 3300006042 Bacteria 2383
231 Ga0075363_100001181 3300006048 Bacteria 9618
232 Ga0075364_10025549 3300006051 Bacteria 3760
233 Ga0075364_10136743 3300006051 Bacteria 1647
234 Ga0075364_10194511 3300006051 Bacteria 1374
235 Ga0070716_100019318 3300006173 Bacteria 3560
236 Ga0070712_100006584 3300006175 Bacteria 7215
237 Ga0075362_10020047 3300006177 Bacteria 2790
238 Ga0075362_10227062 3300006177 Bacteria 914
239 Ga0075362_10246177 3300006177 Bacteria 879
240 Ga0075367_10001700 3300006178 Bacteria 9620
241 Ga0075367_10017229 3300006178 Bacteria 3962
242 Ga0075367_10065669 3300006178 Bacteria 2173
243 Ga0075367_10249851 3300006178 Bacteria 1112
244 Ga0075369_10091556 3300006186 Bacteria 1357
245 Ga0075369_10245394 3300006186 Bacteria 831
246 Ga0075366_10845597 3300006195 Bacteria 569
247 Ga0097621_100026518 3300006237 Bacteria 4546
248 Ga0097621_100074213 3300006237 Bacteria 2817
249 Ga0097621_100316295 3300006237 Bacteria 1382
250 Ga0075370_10020128 3300006353 Bacteria 3643
251 Ga0075370_10028239 3300006353 Bacteria 3118
252 Ga0068871_100035821 3300006358 Bacteria 3946
253 Ga0068871_100104255 3300006358 Bacteria 2379
254 Ga0075428_100070086 3300006844 Bacteria 3833
255 Ga0075430_100109997 3300006846 Bacteria 2298
256 Ga0075430_100917106 3300006846 Bacteria 722
257 Ga0075431_100465897 3300006847 Bacteria 1258
258 Ga0075433_10809127 3300006852 Bacteria 819
259 Ga0075433_10833840 3300006852 Bacteria 805
260 Ga0075434_100044641 3300006871 Bacteria 4396
261 Ga0075434_100125713 3300006871 Bacteria 2581
262 Ga0075434_100510301 3300006871 Bacteria 1223
263 Ga0068865_100001775 3300006881 Bacteria 12654
264 Ga0075436_100005858 3300006914 Bacteria 8445
265 Ga0075436_100692290 3300006914 Unclassified 755
266 Ga0075436_101191223 3300006914 Bacteria 575
267 Ga0097620_100117884 3300006931 Bacteria 2720
268 Ga0097620_100224948 3300006931 Bacteria 1964
269 Ga0075435_100073638 3300007076 Bacteria 2793
270 Ga0075435_100111808 3300007076 Bacteria 2272
271 Ga0075435_100468897 3300007076 Bacteria 1087
272 Ga0099794_10381339 3300007265 Bacteria 735
273 Ga0099795_10021043 3300007788 Bacteria 2134
274 Ga0099795_10030236 3300007788 Bacteria 1857
275 Ga0099795_10048728 3300007788 Bacteria 1535
276 Ga0105251_10097573 3300009011 Bacteria 1345
277 Ga0105251_10313106 3300009011 Bacteria 713
278 Ga0105244_10088248 3300009036 Bacteria 1528
279 Ga0105250_10030865 3300009092 Bacteria 2154
280 Ga0105250_10046623 3300009092 Bacteria 1738
281 Ga0105240_10016715 3300009093 Bacteria 9924
282 Ga0105240_10030730 3300009093 Bacteria 6976
283 Ga0105240_10196998 3300009093 Bacteria 2364
284 Ga0105240_12090505 3300009093 Bacteria 588
285 Ga0111539_10315761 3300009094 Bacteria 1818
286 Ga0111539_10663958 3300009094 Bacteria 1214
287 Ga0105245_10312564 3300009098 Bacteria 1545
288 Ga0105245_10359871 3300009098 Bacteria 1444
289 Ga0105245_10530627 3300009098 Bacteria 1197
290 Ga0105245_10791723 3300009098 Bacteria 986
291 Ga0105245_10968353 3300009098 Bacteria 894
292 Ga0105247_10095694 3300009101 Bacteria 1891
293 Ga0114129_10037544 3300009147 Bacteria 6839
294 Ga0114129_10784305 3300009147 Bacteria 1217
295 Ga0105243_10076785 3300009148 Bacteria 2715
296 Ga0105243_10319515 3300009148 Bacteria 1414
297 Ga0105243_10501399 3300009148 Bacteria 1150
298 Ga0105241_10066421 3300009174 Bacteria 2789
299 Ga0105241_10070808 3300009174 Bacteria 2706
300 Ga0105241_10406303 3300009174 Bacteria 1196
301 Ga0105241_10493630 3300009174 Bacteria 1090
302 Ga0105242_10022368 3300009176 Bacteria 4970
303 Ga0105242_10322965 3300009176 Bacteria 1416
304 Ga0105248_10061998 3300009177 Bacteria 4199
305 Ga0105248_10272244 3300009177 Bacteria 1907
306 Ga0105237_10040252 3300009545 Bacteria 4714
307 Ga0105237_10176281 3300009545 Bacteria 2138
308 Ga0105237_10317584 3300009545 Bacteria 1561
309 Ga0105237_10396831 3300009545 Bacteria 1384
310 Ga0105238_10012175 3300009551 Bacteria 8671
311 Ga0105238_10035982 3300009551 Bacteria 5033
312 Ga0105238_10049838 3300009551 Bacteria 4216
313 Ga0105238_10102283 3300009551 Bacteria 2847
314 Ga0105238_10264456 3300009551 Bacteria 1700
315 Ga0105238_10347316 3300009551 Bacteria 1472
316 Ga0105249_10074945 3300009553 Bacteria 3133
317 Ga0105249_10092015 3300009553 Bacteria 2839
318 Ga0105249_10133651 3300009553 Bacteria 2371
319 Ga0099796_10061656 3300010159 Bacteria 1331
320 Ga0105239_10091468 3300010375 Bacteria 3357
321 Ga0105239_10152572 3300010375 Bacteria 2578
322 Ga0105239_10153070 3300010375 Bacteria 2574
323 Ga0105239_10428627 3300010375 Bacteria 1499
324 Ga0105239_10560225 3300010375 Bacteria 1302
325 Ga0105239_10644628 3300010375 Bacteria 1210
326 Ga0105239_11920494 3300010375 Bacteria 687
327 Ga0105246_10095430 3300011119 Bacteria 2153
328 Ga0105246_10547708 3300011119 Bacteria 991
329 Ga0105246_10581741 3300011119 Bacteria 964
330 Ga0157344_1004409 3300012476 Bacteria 837
331 Ga0157326_1003126 3300012513 Bacteria 1751
332 Ga0157373_10585099 3300013100 Bacteria 812
333 Ga0157373_10730117 3300013100 Bacteria 727
334 Ga0157370_10158045 3300013104 Bacteria 2109
335 Ga0157370_10538178 3300013104 Bacteria 1071
336 Ga0157370_10810914 3300013104 Bacteria 851
337 Ga0157374_10510630 3300013296 Bacteria 1207
338 Ga0157378_10074128 3300013297 Bacteria 3062
339 Ga0157378_10077086 3300013297 Bacteria 3005
340 Ga0157378_10367816 3300013297 Bacteria 1409
341 Ga0157378_10661797 3300013297 Bacteria 1061
342 Ga0163162_10010007 3300013306 Bacteria 9221
343 Ga0163162_10321503 3300013306 Bacteria 1680
344 Ga0163162_10394122 3300013306 Bacteria 1517
345 Ga0157372_10218610 3300013307 Bacteria 2208
346 Ga0157372_10855203 3300013307 Bacteria 1056
347 Ga0157375_10724238 3300013308 Bacteria 1147
348 Ga0163163_10064503 3300014325 Bacteria 3634
349 Ga0163163_10075022 3300014325 Bacteria 3375
350 Ga0163163_11988878 3300014325 Bacteria 641
351 Ga0157380_10186461 3300014326 Bacteria 1827
352 Ga0157380_10215780 3300014326 Bacteria 1713
353 Ga0157380_10426265 3300014326 Bacteria 1267
354 Ga0157380_12527629 3300014326 Bacteria 579
355 Ga0157377_10048477 3300014745 Bacteria 2383
356 Ga0157376_10188927 3300014969 Bacteria 1888
357 Ga0157376_10267523 3300014969 Bacteria 1604
358 Ga0157376_11224350 3300014969 Bacteria 779
359 Ga0163161_10112438 3300017792 Bacteria 2037
360 Ga0197907_10889824 3300020069 Bacteria 574
361 Ga0197907_11053528 3300020069 Bacteria 633
362 Ga0197907_11501374 3300020069 Unclassified 664
363 Ga0206356_10247621 3300020070 Bacteria 626
364 Ga0206356_10594276 3300020070 Bacteria 568
365 Ga0206356_11474439 3300020070 Bacteria 620
366 Ga0206356_11572529 3300020070 Bacteria 629
367 Ga0206356_11733153 3300020070 Bacteria 582
368 Ga0206356_11743097 3300020070 Bacteria 581
369 Ga0206356_11836906 3300020070 Bacteria 1183
370 Ga0206349_1020691 3300020075 Bacteria 556
371 Ga0206349_1186858 3300020075 Bacteria 588
372 Ga0206349_1197767 3300020075 Bacteria 550
373 Ga0206349_1262994 3300020075 Bacteria 882
374 Ga0206349_1463205 3300020075 Bacteria 572
375 Ga0206349_1946070 3300020075 Bacteria 691
376 Ga0206355_1093692 3300020076 Bacteria 615
377 Ga0206355_1113466 3300020076 Bacteria 587
378 Ga0206355_1164344 3300020076 Unclassified 1069
379 Ga0206355_1358260 3300020076 Bacteria 668
380 Ga0206355_1367435 3300020076 Bacteria 586
381 Ga0206351_10032476 3300020077 Bacteria 639
382 Ga0206351_10751612 3300020077 Bacteria 609
383 Ga0206352_10138666 3300020078 Bacteria 618
384 Ga0206350_10122239 3300020080 Bacteria 592
385 Ga0206350_10365195 3300020080 Bacteria 665
386 Ga0206350_10388215 3300020080 Bacteria 633
387 Ga0206350_10511773 3300020080 Bacteria 590
388 Ga0206350_10646272 3300020080 Bacteria 632
389 Ga0206350_10677610 3300020080 Bacteria 719
390 Ga0206350_10924274 3300020080 Bacteria 634
391 Ga0206350_11081022 3300020080 Bacteria 674
392 Ga0206350_11355059 3300020080 Bacteria 567
393 Ga0206354_10089617 3300020081 Bacteria 1824
394 Ga0206354_11086759 3300020081 Bacteria 708
395 Ga0206354_11428798 3300020081 Bacteria 589
396 Ga0206353_10116796 3300020082 Bacteria 1490
397 Ga0206353_10362445 3300020082 Bacteria 902
398 Ga0206353_10411745 3300020082 Bacteria 651
399 Ga0206353_10504062 3300020082 Bacteria 579
400 Ga0206353_10883923 3300020082 Bacteria 855
401 Ga0206353_11374616 3300020082 Bacteria 681
402 Ga0206353_11504878 3300020082 Bacteria 604
403 Ga0206353_11657362 3300020082 Bacteria 592
404 Ga0154015_1321397 3300020610 Bacteria 725
405 Ga0224712_10182083 3300022467 Bacteria 947
406 Ga0224712_10278123 3300022467 Bacteria 778
407 Ga0224712_10295154 3300022467 Bacteria 757
408 Ga0224712_10304103 3300022467 Bacteria 746
409 Ga0224712_10305207 3300022467 Bacteria 745
410 Ga0224712_10448592 3300022467 Bacteria 619
411 Ga0224712_10488207 3300022467 Bacteria 594
412 Ga0224712_10494070 3300022467 Bacteria 591
413 Ga0224712_10511958 3300022467 Bacteria 581
414 Ga0247551_102201 3300023552 Bacteria 703
415 Ga0247523_112525 3300023684 Bacteria 697
416 Ga0209455_1002093 3300025272 Bacteria 7978
417 Ga0209758_1008352 3300025297 Bacteria 6736
418 Ga0207426_1075567 3300025302 Bacteria 927
419 Ga0207656_10126512 3300025321 Bacteria 1194
420 Ga0207656_10163908 3300025321 Bacteria 1059
421 Ga0207713_1073333 3300025735 Bacteria 1256
422 Ga0207653_10007478 3300025885 Bacteria 3405
423 Ga0207653_10039302 3300025885 Bacteria 1549
424 Ga0207692_10027517 3300025898 Bacteria 2679
425 Ga0207642_10081749 3300025899 Bacteria 1571
426 Ga0207642_10230011 3300025899 Bacteria 1041
427 Ga0207710_10011489 3300025900 Bacteria 3728
428 Ga0207688_10000896 3300025901 Bacteria 15032
429 Ga0207680_10009686 3300025903 Bacteria 4791
430 Ga0207680_10601969 3300025903 Bacteria 786
431 Ga0207647_10005519 3300025904 Bacteria 9261
432 Ga0207647_10086076 3300025904 Bacteria 1879
433 Ga0207647_10091272 3300025904 Bacteria 1816
434 Ga0207699_10000463 3300025906 Bacteria 20679
435 Ga0207699_10107996 3300025906 Bacteria 1779
436 Ga0207645_10005784 3300025907 Bacteria 8919
437 Ga0207645_10227158 3300025907 Bacteria 1231
438 Ga0207645_10336316 3300025907 Bacteria 1009
439 Ga0207643_10005864 3300025908 Bacteria 6561
440 Ga0207705_10109530 3300025909 Bacteria 2039
441 Ga0207705_10177512 3300025909 Bacteria 1606
442 Ga0207705_10690578 3300025909 Bacteria 793
443 Ga0207684_11024328 3300025910 Bacteria 690
444 Ga0207654_10002142 3300025911 Bacteria 10111
445 Ga0207654_10126759 3300025911 Bacteria 1611
446 Ga0207654_10156278 3300025911 Bacteria 1469
447 Ga0207654_10550951 3300025911 Bacteria 819
448 Ga0207707_10014498 3300025912 Bacteria 6863
449 Ga0207707_10024561 3300025912 Bacteria 5275
450 Ga0207695_10015064 3300025913 Bacteria 9121
451 Ga0207695_10056580 3300025913 Bacteria 4080
452 Ga0207671_10008930 3300025914 Bacteria 8436
453 Ga0207671_10073879 3300025914 Bacteria 2548
454 Ga0207671_10170843 3300025914 Bacteria 1688
455 Ga0207671_10223604 3300025914 Bacteria 1475
456 Ga0207671_10716188 3300025914 Bacteria 796
457 Ga0207671_10968571 3300025914 Bacteria 671
458 Ga0207693_10000640 3300025915 Bacteria 31338
459 Ga0207693_10037124 3300025915 Bacteria 3840
460 Ga0207693_10070055 3300025915 Bacteria 2744
461 Ga0207663_10373124 3300025916 Bacteria 1085
462 Ga0207663_11025368 3300025916 Bacteria 662
463 Ga0207662_10006236 3300025918 Bacteria 6419
464 Ga0207657_10006779 3300025919 Bacteria 11827
465 Ga0207657_10042348 3300025919 Bacteria 4018
466 Ga0207657_10386797 3300025919 Bacteria 1101
467 Ga0207649_10037057 3300025920 Bacteria 2943
468 Ga0207649_10073668 3300025920 Bacteria 2188
469 Ga0207652_10014385 3300025921 Bacteria 6411
470 Ga0207652_10227920 3300025921 Bacteria 1679
471 Ga0207694_10000275 3300025924 Bacteria 48774
472 Ga0207694_10128284 3300025924 Bacteria 2031
473 Ga0207694_10151091 3300025924 Bacteria 1871
474 Ga0207650_10179565 3300025925 Bacteria 1686
475 Ga0207659_10524947 3300025926 Bacteria 1004
476 Ga0207659_10779263 3300025926 Bacteria 821
477 Ga0207687_10074887 3300025927 Bacteria 2428
478 Ga0207687_10300546 3300025927 Bacteria 1293
479 Ga0207700_10135523 3300025928 Bacteria 2016
480 Ga0207700_10981429 3300025928 Bacteria 756
481 Ga0207664_10163043 3300025929 Bacteria 1902
482 Ga0207664_10332650 3300025929 Bacteria 1342
483 Ga0207664_11066688 3300025929 Bacteria 723
484 Ga0207644_10026008 3300025931 Bacteria 4028
485 Ga0207644_10065213 3300025931 Bacteria 2648
486 Ga0207644_10746250 3300025931 Bacteria 817
487 Ga0207690_10099075 3300025932 Bacteria 2077
488 Ga0207690_10224525 3300025932 Bacteria 1439
489 Ga0207706_10007357 3300025933 Bacteria 10175
490 Ga0207706_10059285 3300025933 Bacteria 3371
491 Ga0207706_10067153 3300025933 Bacteria 3155
492 Ga0207706_10186103 3300025933 Bacteria 1823
493 Ga0207706_10482924 3300025933 Bacteria 1070
494 Ga0207686_10074963 3300025934 Bacteria 2188
495 Ga0207686_10247460 3300025934 Bacteria 1301
496 Ga0207709_10139546 3300025935 Bacteria 1664
497 Ga0207709_10560673 3300025935 Bacteria 900
498 Ga0207709_10569188 3300025935 Bacteria 893
499 Ga0207670_10186147 3300025936 Bacteria 1567
500 Ga0207670_10228092 3300025936 Bacteria 1429
501 Ga0207669_10529931 3300025937 Bacteria 947
502 Ga0207669_10983171 3300025937 Bacteria 708
503 Ga0207704_10004344 3300025938 Bacteria 6482
504 Ga0207665_10001240 3300025939 Bacteria 17200
505 Ga0207691_10016710 3300025940 Bacteria 6968
506 Ga0207691_10037607 3300025940 Bacteria 4481
507 Ga0207711_10028906 3300025941 Bacteria 4670
508 Ga0207711_10030859 3300025941 Bacteria 4521
509 Ga0207711_10815829 3300025941 Bacteria 869
510 Ga0207689_10002364 3300025942 Bacteria 17614
511 Ga0207689_10424621 3300025942 Bacteria 1109
512 Ga0207689_10572682 3300025942 Unclassified 949
513 Ga0207661_10055213 3300025944 Bacteria 3185
514 Ga0207661_10127093 3300025944 Bacteria 2178
515 Ga0207661_10968211 3300025944 Bacteria 784
516 Ga0207679_11108163 3300025945 Unclassified 726
517 Ga0207667_10061756 3300025949 Bacteria 3920
518 Ga0207651_10357019 3300025960 Bacteria 1232
519 Ga0207651_10421006 3300025960 Bacteria 1140
520 Ga0207651_10782063 3300025960 Bacteria 845
521 Ga0207712_10434904 3300025961 Bacteria 1110
522 Ga0207668_10023778 3300025972 Bacteria 3944
523 Ga0207668_10125228 3300025972 Bacteria 1953
524 Ga0207668_10281391 3300025972 Bacteria 1364
525 Ga0207640_10062060 3300025981 Bacteria 2478
526 Ga0207640_10148236 3300025981 Bacteria 1720
527 Ga0207658_10028993 3300025986 Bacteria 3903
528 Ga0207658_10134836 3300025986 Bacteria 1989
529 Ga0207677_11102657 3300026023 Bacteria 724
530 Ga0207703_10205828 3300026035 Bacteria 1751
531 Ga0207703_10351960 3300026035 Bacteria 1356
532 Ga0207703_10393125 3300026035 Bacteria 1285
533 Ga0207639_10056687 3300026041 Bacteria 3004
534 Ga0207639_10126168 3300026041 Bacteria 2111
535 Ga0207678_10013706 3300026067 Bacteria 7122
536 Ga0207678_10043711 3300026067 Bacteria 3876
537 Ga0207678_10047593 3300026067 Bacteria 3708
538 Ga0207678_10094228 3300026067 Bacteria 2558
539 Ga0207678_10143127 3300026067 Bacteria 2041
540 Ga0207678_10368890 3300026067 Bacteria 1240
541 Ga0207678_10396695 3300026067 Bacteria 1194
542 Ga0207678_10459519 3300026067 Bacteria 1107
543 Ga0207678_11083551 3300026067 Bacteria 709
544 Ga0207708_10001706 3300026075 Bacteria 16253
545 Ga0207702_10000026 3300026078 Bacteria 186067
546 Ga0207702_10000261 3300026078 Bacteria 61023
547 Ga0207702_10018370 3300026078 Bacteria 5785
548 Ga0207702_10122685 3300026078 Bacteria 2328
549 Ga0207702_10189685 3300026078 Bacteria 1898
550 Ga0207641_10152237 3300026088 Bacteria 2095
551 Ga0207641_11075545 3300026088 Unclassified 802
552 Ga0207648_10001075 3300026089 Bacteria 30605
553 Ga0207648_10918263 3300026089 Bacteria 818
554 Ga0207676_10144444 3300026095 Bacteria 2041
555 Ga0207676_10557049 3300026095 Bacteria 1096
556 Ga0207676_11575435 3300026095 Bacteria 654
557 Ga0207674_10010326 3300026116 Bacteria 10586
558 Ga0207674_10011498 3300026116 Bacteria 9941
559 Ga0207674_10095357 3300026116 Bacteria 2961
560 Ga0207675_100019330 3300026118 Bacteria 6356
561 Ga0207675_100075468 3300026118 Bacteria 3156
562 Ga0207675_100078028 3300026118 Bacteria 3103
563 Ga0207675_100459020 3300026118 Bacteria 1263
564 Ga0207683_10005431 3300026121 Bacteria 10918
565 Ga0207683_10231562 3300026121 Bacteria 1685
566 Ga0207683_10529706 3300026121 Bacteria 1089
567 Ga0207683_11079303 3300026121 Bacteria 745
568 Ga0207698_10502536 3300026142 Bacteria 1180
569 Ga0207698_10726318 3300026142 Bacteria 990
570 Ga0207698_10935451 3300026142 Bacteria 875
571 Ga0209588_1076492 3300027671 Bacteria 1082
572 Ga0209813_10075398 3300027866 Bacteria 1105
573 Ga0207428_10039794 3300027907 Bacteria 3817
574 Ga0207428_10557741 3300027907 Bacteria 828
575 Ga0268266_10061845 3300028379 Bacteria 3229
576 Ga0268266_10089000 3300028379 Bacteria 2702
577 Ga0268266_10091874 3300028379 Bacteria 2662
578 Ga0268266_10270862 3300028379 Bacteria 1576
579 Ga0268266_10615691 3300028379 Bacteria 1043
580 Ga0268266_10757559 3300028379 Bacteria 937
581 Ga0268265_10054641 3300028380 Bacteria 3031
582 Ga0268265_10220268 3300028380 Bacteria 1660
583 Ga0268265_10227273 3300028380 Bacteria 1637
584 Ga0268264_10328562 3300028381 Bacteria 1448
585 Ga0268264_10424356 3300028381 Bacteria 1283
586 Ga0268264_10583177 3300028381 Bacteria 1100
587 Ga0307515_10163003 3300028794 Bacteria 2263
588 Ga0307515_10419659 3300028794 Bacteria 959
589 Ga0265766_1015316 3300030863 Bacteria 591
590 Ga0265328_10244845 3300031239 Bacteria 686
591 Ga0265325_10001626 3300031241 Bacteria 15661
592 Ga0265325_10011302 3300031241 Bacteria 5130
593 Ga0265339_10005018 3300031249 Bacteria 8901
594 Ga0307513_10154734 3300031456 Bacteria 2195
595 Ga0307513_10445618 3300031456 Bacteria 1020
596 Ga0307509_10508846 3300031507 Bacteria 887
597 Ga0307509_10577547 3300031507 Bacteria 799
598 Ga0307408_100421690 3300031548 Bacteria 1151
599 Ga0307408_100536846 3300031548 Bacteria 1030
600 Ga0310117_124297 3300031592 Bacteria 597
601 Ga0265313_10004507 3300031595 Bacteria 10658
602 Ga0265313_10030909 3300031595 Bacteria 2750
603 Ga0265313_10054763 3300031595 Bacteria 1893
604 Ga0307508_10146318 3300031616 Bacteria 1967
605 Ga0265342_10059304 3300031712 Bacteria 2261
606 Ga0316043_127489 3300031828 Bacteria 583
607 Ga0307406_10316115 3300031901 Bacteria 1206
608 Ga0307416_100168750 3300032002 Bacteria 2034
609 Ga0307415_100036591 3300032126 Bacteria 3218
610 Ga0307507_10213161 3300033179 Bacteria 1313
611 Ga0307510_10062648 3300033180 Bacteria 3798
612 Ga0307510_10440666 3300033180 Bacteria 744
613 Ga0373948_0008489 3300034817 Bacteria 1750
614 Ga0373958_0001587 3300034819 Bacteria 3078
615 Ga0373926_0005541 3300035083 Bacteria 4164
616 Ga0373934_0054317 3300035086 Bacteria 1590
617 Ga0373944_0000364 3300035089 Bacteria 10277
618 Ga0373944_0010085 3300035089 Bacteria 2569
619 Ga0373944_0097139 3300035089 Unclassified 991
620 Ga0373949_0021242 3300035090 Bacteria 1491
621 Ga0373951_0023092 3300035091 Bacteria 1435
622 Ga0373951_0112944 3300035091 Bacteria 733
623 Ga0373923_0005611 3300035111 Bacteria 4272
624 Ga0373923_0009594 3300035111 Bacteria 3499
625 Ga0373923_0183843 3300035111 Bacteria 961
626 Ga0373936_0008721 3300035113 Bacteria 3819
627 Ga0373936_0081898 3300035113 Bacteria 1344
628 Ga0373939_0133078 3300035114 Unclassified 889
629 Ga0373939_0327484 3300035114 Bacteria 618
630 Ga0373941_0013347 3300035115 Bacteria 2170
631 Ga0373945_0000604 3300035116 Bacteria 10308
632 Ga0373945_0013010 3300035116 Unclassified 2772
633 Ga0373945_0066848 3300035116 Bacteria 1352
634 Ga0373953_0031765 3300035117 Bacteria 2055
635 Ga0373953_0038873 3300035117 Bacteria 1884
636 Ga0373954_0011230 3300035118 Bacteria 3965
637 Ga0373954_0048759 3300035118 Bacteria 1984
638 Ga0373956_0084357 3300035119 Bacteria 1460
639 Ga0373956_0381736 3300035119 Bacteria 672
640 Ga0373957_0003340 3300035120 Bacteria 4729
641 Ga0373957_0062844 3300035120 Bacteria 1441
642 Ga0373943_0006934 3300035170 Bacteria 5082
643 Ga0373943_0031393 3300035170 Bacteria 2520
644 Ga0373946_0029874 3300035171 Bacteria 2172
645 Ga0373946_0033120 3300035171 Bacteria 2078
646 Ga0373955_0002404 3300035172 Bacteria 8159
647 Ga0373955_0007268 3300035172 Bacteria 5084
648 Ga0373955_0114546 3300035172 Bacteria 1562
649 Ga0373961_0002416 3300035241 Bacteria 4853
650 Ga0373962_0112365 3300035242 Unclassified 861
651 Ga0373924_0006081 3300035410 Bacteria 4311
652 Ga0373924_0006172 3300035410 Bacteria 4284
653 Ga0373931_0096660 3300035691 Bacteria 1655
654 Ga0373931_0199953 3300035691 Bacteria 1193
655 Ga0373935_0013235 3300035692 Bacteria 4976
656 Ga0373935_0399675 3300035692 Bacteria 987
657 Ga0373935_0465733 3300035692 Bacteria 914
658 Ga0373935_0800384 3300035692 Bacteria 696
659 Ga0373927_0001118 3300035695 Bacteria 20382
660 Ga0373927_0011708 3300035695 Bacteria 5839
661 Ga0373927_0014273 3300035695 Bacteria 5264
662 Ga0373933_0011886 3300035724 Bacteria 4806
663 Ga0373933_0088546 3300035724 Bacteria 1907
664 Ga0373947_0000372 3300035725 Bacteria 25344
665 Ga0373947_0017773 3300035725 Bacteria 4090
666 Ga0373947_0026529 3300035725 Bacteria 3387
667 Ga0373937_0030143 3300036401 Bacteria 4914
668 Ga0373937_0101470 3300036401 Bacteria 2671
669 Ga0373937_0106945 3300036401 Bacteria 2600
670 Ga0373937_0114684 3300036401 Bacteria 2508
671 Ga0373937_0995412 3300036401 Bacteria 787
672 Ga0310109_046298 3300036534 Bacteria 563
673 Ga0373925_0006079 3300037068 Bacteria 8931
674 Ga0373925_0035309 3300037068 Bacteria 3687
675 Ga0373925_0043061 3300037068 Bacteria 3350
676 Ga0373925_0263159 3300037068 Bacteria 1386
677 Ga0373925_0268518 3300037068 Bacteria 1372
678 Ga0395905_0217267 3300037471 Bacteria 1790
679 Ga0436360_0599366 3300039438 Bacteria 2885
680 Ga0436360_0645480 3300039438 Bacteria 1322
681 Ga0436363_1293311 3300039450 Bacteria 6055
682 Ga0436362_1029460 3300039453 Bacteria 3668
683 Ga0439461_0128559 3300041410 Bacteria 639
684 Ga0451802_0955069 3300041460 Bacteria 661
685 Ga0451833_1205776 3300041491 Bacteria 606
686 Ga0451853_3246118 3300041512 Bacteria 687
687 Ga0466966_0005575 3300044684 Bacteria 8277
688 Ga0466966_0252929 3300044684 Bacteria 1061
689 Ga0466963_0038531 3300044694 Bacteria 3126
690 Ga0466963_0955214 3300044694 Bacteria 604
691 Ga0466968_0005113 3300044735 Bacteria 4908
692 Ga0466959_0010598 3300045049 Bacteria 6598
693 Ga0466959_0329301 3300045049 Bacteria 1043
694 Ga0466959_0444672 3300045049 Bacteria 879
695 Ga0466967_0021546 3300045976 Bacteria 5240
696 Ga0495627_103522 3300046453 Bacteria 811
697 Ga0495592_0001055 3300046454 Bacteria 19077
698 Ga0495592_0010832 3300046454 Bacteria 6878
699 Ga0495603_0014865 3300046455 Bacteria 4709
700 Ga0495603_0024400 3300046455 Bacteria 3657
701 Ga0495603_0026152 3300046455 Bacteria 3526
702 Ga0495603_0223293 3300046455 Bacteria 1087
703 Ga0495590_0030522 3300046457 Bacteria 1888
704 Ga0495629_0003357 3300046459 Bacteria 12088
705 Ga0495629_0019076 3300046459 Bacteria 4903
706 Ga0495629_0112714 3300046459 Bacteria 1896
707 Ga0495629_0177175 3300046459 Bacteria 1478
708 Ga0495638_0105696 3300046460 Bacteria 1677
709 Ga0495638_0127089 3300046460 Bacteria 1501
710 Ga0495641_0012702 3300046461 Bacteria 4688
711 Ga0495651_0009559 3300046462 Bacteria 7449
712 Ga0495651_0039188 3300046462 Bacteria 3690
713 Ga0495651_0055997 3300046462 Bacteria 3029
714 Ga0495651_0099648 3300046462 Bacteria 2166
715 Ga0495653_0008585 3300046463 Bacteria 8375
716 Ga0495653_0017321 3300046463 Bacteria 5860
717 Ga0495653_0267673 3300046463 Bacteria 1127
718 Ga0495580_0013690 3300046472 Bacteria 6180
719 Ga0495580_0222805 3300046472 Bacteria 1296
720 Ga0495582_0011471 3300046473 Bacteria 4882
721 Ga0495582_0031598 3300046473 Bacteria 2910
722 Ga0495639_0004110 3300046475 Bacteria 6235
723 Ga0495662_0003064 3300046476 Bacteria 8427
724 Ga0495662_0362007 3300046476 Bacteria 713
725 Ga0495664_0008779 3300046477 Bacteria 5647
726 Ga0495664_0269855 3300046477 Bacteria 1028
727 Ga0495584_0034642 3300046491 Bacteria 2553
728 Ga0495585_0056846 3300046492 Bacteria 2160
729 Ga0495594_0005321 3300046499 Bacteria 6610
730 Ga0495594_0143479 3300046499 Bacteria 1355
731 Ga0495607_0044310 3300046501 Bacteria 2624
732 Ga0495607_0455181 3300046501 Bacteria 574
733 Ga0495583_0042395 3300046506 Bacteria 2126
734 Ga0495606_0055888 3300046507 Bacteria 2550
735 Ga0495608_0033105 3300046511 Bacteria 3495
736 Ga0495610_0044346 3300046512 Bacteria 2207
737 Ga0495616_0035528 3300046513 Bacteria 2578
738 Ga0495616_0113607 3300046513 Bacteria 1256
739 Ga0495616_0312848 3300046513 Bacteria 661
740 Ga0495618_0002517 3300046514 Bacteria 11741
741 Ga0495618_0045723 3300046514 Bacteria 2762
742 Ga0495618_0722148 3300046514 Bacteria 585
743 Ga0495628_0087042 3300046516 Bacteria 2422
744 Ga0495628_0087330 3300046516 Bacteria 2418
745 Ga0495628_0348576 3300046516 Bacteria 1089
746 Ga0495630_0017717 3300046517 Bacteria 5222
747 Ga0495630_0025849 3300046517 Bacteria 4343
748 Ga0495631_0109239 3300046518 Bacteria 1189
749 Ga0495631_0199360 3300046518 Bacteria 856
750 Ga0495632_0021367 3300046519 Bacteria 3489
751 Ga0495637_0033862 3300046520 Bacteria 2241
752 Ga0495643_0206760 3300046522 Bacteria 939
753 Ga0495644_0002732 3300046523 Bacteria 7000
754 Ga0495663_0046978 3300046525 Bacteria 1328
755 Ga0495666_0006077 3300046526 Bacteria 6079
756 Ga0495666_0020392 3300046526 Bacteria 3285
757 Ga0495666_0152763 3300046526 Bacteria 1073
758 Ga0495652_0108337 3300046529 Bacteria 2239
759 Ga0495652_0145992 3300046529 Bacteria 1854
760 Ga0495665_0032754 3300046531 Bacteria 2780
761 Ga0495640_0006867 3300046533 Bacteria 8966
762 Ga0495640_0051277 3300046533 Bacteria 2836
763 Ga0495640_0183560 3300046533 Bacteria 1332
764 Ga0495586_0087335 3300046535 Bacteria 1719
765 Ga0495586_0230257 3300046535 Bacteria 1054
766 Ga0495587_0026482 3300046536 Bacteria 3536
767 Ga0495587_0051328 3300046536 Bacteria 2438
768 Ga0495598_0058368 3300046537 Bacteria 1183
769 Ga0495598_0067460 3300046537 Bacteria 1119
770 Ga0495609_0033203 3300046538 Bacteria 2343
771 Ga0495621_0013532 3300046539 Bacteria 2566
772 Ga0495597_0092747 3300046542 Bacteria 1280
773 Ga0495622_0006399 3300046557 Bacteria 5467
774 Ga0495633_0009880 3300046558 Bacteria 5241
775 Ga0495633_0018095 3300046558 Bacteria 3584
776 Ga0495667_0008737 3300046559 Bacteria 6882
777 Ga0495667_0020910 3300046559 Bacteria 4416
778 Ga0495667_0078258 3300046559 Bacteria 2150
779 Ga0495667_0106403 3300046559 Bacteria 1813
780 Ga0495656_0000064 3300046615 Bacteria 48582
781 Ga0495656_0046515 3300046615 Bacteria 1836
782 Ga0495656_0048334 3300046615 Bacteria 1807
783 Ga0495668_0025416 3300046616 Bacteria 3364
784 Ga0495634_0026538 3300046642 Bacteria 4041
785 Ga0495634_0047460 3300046642 Bacteria 2893
786 Ga0495611_0105572 3300046648 Bacteria 1310
787 Ga0495611_0124745 3300046648 Bacteria 1201
788 Ga0495611_0226481 3300046648 Bacteria 869
789 Ga0495625_0006076 3300046660 Bacteria 10838
790 Ga0495625_0047212 3300046660 Bacteria 3105
791 Ga0495625_0658367 3300046660 Bacteria 623
792 Ga0495635_0008796 3300046663 Bacteria 7049
793 Ga0495635_0037890 3300046663 Bacteria 3338
794 Ga0495635_0122079 3300046663 Bacteria 1776
795 Ga0495659_0208813 3300046664 Bacteria 803
796 Ga0495661_0036088 3300046665 Bacteria 3097
797 Ga0495661_0150914 3300046665 Bacteria 1255
798 Ga0495661_0225380 3300046665 Bacteria 969
799 Ga0495588_0011011 3300046674 Bacteria 4231
800 Ga0495588_0018681 3300046674 Bacteria 3384
801 Ga0495657_0047604 3300046675 Bacteria 2897
802 Ga0495657_0106638 3300046675 Bacteria 1779
803 Ga0495657_0202029 3300046675 Bacteria 1211
804 Ga0495657_0509451 3300046675 Bacteria 701
805 Ga0495599_0021867 3300046678 Bacteria 3993
806 Ga0495599_0043307 3300046678 Bacteria 2824
807 Ga0495623_0036443 3300046679 Bacteria 3150
808 Ga0495623_0248643 3300046679 Bacteria 1001
809 Ga0495646_0003336 3300046680 Bacteria 9986
810 Ga0495647_0015713 3300046681 Bacteria 2657
811 Ga0495647_0017786 3300046681 Bacteria 2520
812 Ga0495658_0001834 3300046683 Bacteria 10873
813 Ga0495658_0010431 3300046683 Bacteria 4648
814 Ga0495658_0311236 3300046683 Bacteria 997
815 Ga0495658_0444063 3300046683 Bacteria 828
816 Ga0495669_0241913 3300046684 Bacteria 866
817 Ga0495669_0266358 3300046684 Bacteria 823
818 Ga0495613_0033299 3300046689 Bacteria 3829
819 Ga0495613_0102619 3300046689 Bacteria 2065
820 Ga0495613_0182144 3300046689 Bacteria 1487
821 Ga0495613_0819128 3300046689 Bacteria 607
822 Ga0495624_0005807 3300046690 Bacteria 8837
823 Ga0495624_0045904 3300046690 Bacteria 2779
824 Ga0495670_0090641 3300046691 Bacteria 1564
825 Ga0495671_0013849 3300046692 Bacteria 4351
826 Ga0495589_0247988 3300046794 Bacteria 832
827 Ga0495600_0000716 3300046809 Bacteria 17441
828 Ga0495600_0001994 3300046809 Bacteria 11472
829 Ga0495600_0181124 3300046809 Bacteria 1358
830 Ga0495660_0128889 3300046810 Bacteria 1271
831 Ga0495660_0343500 3300046810 Bacteria 665
832 Ga0495581_0020045 3300047315 Bacteria 3882
833 Ga0495581_0072896 3300047315 Bacteria 1987
834 Ga0495581_0073317 3300047315 Bacteria 1981
835 Ga0495604_0025973 3300047317 Bacteria 4665
836 Ga0495604_0039798 3300047317 Bacteria 3693
837 Ga0495604_0054739 3300047317 Bacteria 3077
838 Ga0495636_0095471 3300047318 Bacteria 1295
839 Ga0495674_0088487 3300047319 Bacteria 2648
840 Ga0495674_0345361 3300047319 Bacteria 1209
841 Ga0495672_0079076 3300047320 Bacteria 1837
842 Ga0495676_0030061 3300047321 Bacteria 4617
843 Ga0495676_0050140 3300047321 Bacteria 3350
844 Ga0495676_0052812 3300047321 Bacteria 3242
845 Ga0495676_0346310 3300047321 Unclassified 994
846 Ga0495680_0011117 3300047322 Bacteria 7991
847 Ga0495680_0014218 3300047322 Bacteria 6903
848 Ga0495680_0045137 3300047322 Bacteria 3481
849 Ga0495680_0301870 3300047322 Bacteria 1124
850 Ga0495675_0104372 3300047444 Bacteria 1771
851 Ga0495675_0154536 3300047444 Bacteria 1416
852 Ga0495673_0035535 3300047469 Bacteria 2295
853 Ga0495684_0003050 3300047471 Bacteria 13176
854 Ga0495684_0006284 3300047471 Bacteria 9233
855 Ga0495684_0022194 3300047471 Bacteria 4886
856 Ga0495684_0220457 3300047471 Bacteria 1391
857 Ga0495684_0324079 3300047471 Bacteria 1101
858 Ga0495684_0332537 3300047471 Bacteria 1083
859 Ga0495686_0017077 3300047472 Bacteria 4900
860 Ga0495686_0223799 3300047472 Bacteria 1069
861 Ga0495593_0003538 3300047673 Bacteria 9347
862 Ga0495593_0003546 3300047673 Bacteria 9336
863 Ga0495593_0007526 3300047673 Bacteria 6367
864 Ga0495593_0029887 3300047673 Bacteria 2985
865 Ga0495593_0093302 3300047673 Bacteria 1549
866 Ga0495602_0086153 3300048088 Bacteria 2623
867 Ga0495602_0094544 3300048088 Bacteria 2469
868 Ga0495602_0215159 3300048088 Bacteria 1455
869 Ga0495602_0237050 3300048088 Bacteria 1367
870 Ga0495602_0271223 3300048088 Bacteria 1254
871 Ga0495602_0561486 3300048088 Bacteria 790
872 Ga0495614_0012122 3300048089 Bacteria 3786
873 Ga0495626_0086193 3300048091 Bacteria 1388
874 Ga0495626_0260181 3300048091 Bacteria 694
875 Ga0496100_0007837 3300048903 Bacteria 5926
876 Ga0496100_0100720 3300048903 Bacteria 1990
877 Ga0496101_0138194 3300048904 Bacteria 1855
878 Ga0496101_0266194 3300048904 Bacteria 1338
879 Ga0496101_0401158 3300048904 Bacteria 1080
880 Ga0496102_0032922 3300048905 Bacteria 4658
881 Ga0496102_0041408 3300048905 Bacteria 4171
882 Ga0496102_0061565 3300048905 Bacteria 3435
883 Ga0496102_0123500 3300048905 Bacteria 2419
884 Ga0496102_0131901 3300048905 Bacteria 2339
885 Ga0496102_0362100 3300048905 Bacteria 1365
886 Ga0496103_0071414 3300048906 Bacteria 2172
887 Ga0496103_0097141 3300048906 Bacteria 1862
888 Ga0496103_0381642 3300048906 Bacteria 905
889 Ga0496104_0008842 3300048907 Bacteria 8953
890 Ga0496104_0219238 3300048907 Bacteria 1815
891 Ga0496104_0926033 3300048907 Bacteria 776
892 Ga0496105_0162145 3300048908 Bacteria 1835
893 Ga0496105_0502104 3300048908 Bacteria 952
894 Ga0496105_0585446 3300048908 Unclassified 867
895 Ga0496106_0029877 3300048909 Bacteria 4062
896 Ga0496106_0041002 3300048909 Bacteria 3468
897 Ga0496106_0097958 3300048909 Bacteria 2271
898 Ga0496107_0138809 3300048910 Bacteria 1796
899 Ga0496107_0473597 3300048910 Bacteria 929
900 Ga0496107_1142889 3300048910 Bacteria 561
901 Ga0496108_0005621 3300048911 Bacteria 10146
902 Ga0496108_0181363 3300048911 Bacteria 1823
903 Ga0496109_0076356 3300048912 Bacteria 3081
904 Ga0496109_0315076 3300048912 Bacteria 1476
905 Ga0496109_0328581 3300048912 Bacteria 1443
906 Ga0496110_0065588 3300048913 Bacteria 3210
907 Ga0496110_0320163 3300048913 Bacteria 1413
908 Ga0496110_0384154 3300048913 Bacteria 1279
909 Ga0496110_0430367 3300048913 Bacteria 1203
910 Ga0496110_0453250 3300048913 Bacteria 1169
911 Ga0496111_0048697 3300048914 Bacteria 3053
912 Ga0496111_0219840 3300048914 Bacteria 1411
913 Ga0496111_0454743 3300048914 Unclassified 944
914 Ga0496112_0006027 3300048915 Bacteria 10582
915 Ga0496112_0331113 3300048915 Bacteria 1466
916 Ga0496112_0406145 3300048915 Bacteria 1301
917 Ga0496112_0776215 3300048915 Bacteria 884
918 Ga0496113_0030783 3300048916 Bacteria 3887
919 Ga0496113_0130337 3300048916 Bacteria 1973
920 Ga0496113_0149706 3300048916 Bacteria 1840
921 Ga0496113_0163115 3300048916 Bacteria 1762
922 Ga0496114_0060904 3300048917 Bacteria 3155
923 Ga0496114_0152579 3300048917 Bacteria 2004
924 Ga0496114_0208628 3300048917 Bacteria 1713
925 Ga0496114_0307910 3300048917 Bacteria 1399
926 Ga0496114_0333238 3300048917 Bacteria 1341
927 Ga0496115_0033633 3300048918 Bacteria 4048
928 Ga0496115_0046778 3300048918 Bacteria 3459
929 Ga0496115_0121803 3300048918 Bacteria 2147
930 Ga0496115_0214364 3300048918 Bacteria 1590
931 Ga0496115_0215701 3300048918 Bacteria 1584
932 Ga0496115_0231623 3300048918 Bacteria 1523
933 Ga0496115_0353296 3300048918 Bacteria 1198
934 Ga0496116_0349539 3300048919 Bacteria 678
935 Ga0496117_0202176 3300048920 Bacteria 1121
936 Ga0496118_0059696 3300048921 Bacteria 2837
937 Ga0496118_0116918 3300048921 Bacteria 1751
938 Ga0496118_0224777 3300048921 Bacteria 1089
939 Ga0496120_0080935 3300048923 Bacteria 1759
940 Ga0496120_0131365 3300048923 Bacteria 1282
941 Ga0496121_0000300 3300048924 Bacteria 102506
942 Ga0496121_0026815 3300048924 Bacteria 5413
943 Ga0496121_0027734 3300048924 Bacteria 5293
944 Ga0496121_0041567 3300048924 Bacteria 4016
945 Ga0496121_0074274 3300048924 Bacteria 2720
946 Ga0496121_0179884 3300048924 Bacteria 1527
947 Ga0496121_0279163 3300048924 Bacteria 1144
948 Ga0496121_0592625 3300048924 Bacteria 685
949 Ga0496121_0597692 3300048924 Bacteria 681
950 Ga0496122_0010659 3300048925 Bacteria 9438
951 Ga0496122_0082401 3300048925 Bacteria 2234
952 Ga0496122_0246162 3300048925 Bacteria 1004
953 Ga0496123_0072978 3300048926 Bacteria 2132
954 Ga0496123_0073217 3300048926 Bacteria 2126
955 Ga0496123_0181476 3300048926 Bacteria 1099
956 Ga0496124_0215824 3300048927 Bacteria 1447
957 Ga0496124_0305892 3300048927 Bacteria 1146
958 Ga0496125_0000063 3300048928 Bacteria 250260
959 Ga0496125_0057601 3300048928 Bacteria 3145
960 Ga0496126_0008064 3300048929 Bacteria 11410
961 Ga0496126_0008100 3300048929 Bacteria 11382
962 Ga0496126_0031081 3300048929 Bacteria 5049
963 Ga0496126_0099390 3300048929 Bacteria 2548
964 Ga0496126_0133791 3300048929 Bacteria 2140
965 Ga0496126_0139126 3300048929 Bacteria 2092
966 Ga0496126_0174394 3300048929 Bacteria 1830
967 Ga0496126_0254741 3300048929 Bacteria 1461
968 Ga0501031_0502400 3300049568 Bacteria 782
969 Ga0501032_0001391 3300049569 Bacteria 19212
970 Ga0501033_0000304 3300049570 Bacteria 46485
971 Ga0501033_0257829 3300049570 Bacteria 1235
972 Ga0501034_0028770 3300049571 Bacteria 5654
973 Ga0501034_0061482 3300049571 Bacteria 3771
974 Ga0501036_0093458 3300049572 Bacteria 2541
975 Ga0501036_0117424 3300049572 Bacteria 2247
976 Ga0501037_0000154 3300049573 Bacteria 64077
977 Ga0501037_0202150 3300049573 Bacteria 1404
978 Ga0501037_0322494 3300049573 Bacteria 1069
979 Ga0501038_0465060 3300049574 Bacteria 971
980 Ga0501038_0951447 3300049574 Bacteria 632
981 Ga0501039_0190507 3300049575 Bacteria 1613
982 Ga0501041_0009638 3300049577 Bacteria 5694
983 Ga0501041_0433754 3300049577 Bacteria 834
984 Ga0501042_0027891 3300049578 Bacteria 3973
985 Ga0501043_0000007 3300049579 Bacteria 224595
986 Ga0501043_0337856 3300049579 Bacteria 1146
987 Ga0501047_0000740 3300049581 Bacteria 34045
988 Ga0501047_0036680 3300049581 Bacteria 4739
989 Ga0501047_0124460 3300049581 Bacteria 2459
990 Ga0501047_0462930 3300049581 Bacteria 1097
991 Ga0501048_0048949 3300049582 Bacteria 3014
992 Ga0501067_0027605 3300049583 Bacteria 3146
993 Ga0501067_0159701 3300049583 Bacteria 1255
994 Ga0501067_0197413 3300049583 Bacteria 1121
995 Ga0501067_0650151 3300049583 Bacteria 592
996 Ga0501068_0180196 3300049584 Bacteria 1336
997 Ga0501068_0342319 3300049584 Bacteria 960
998 Ga0501069_0000027 3300049585 Bacteria 106217
999 Ga0501069_0019796 3300049585 Bacteria 3641
1000 Ga0501069_0061284 3300049585 Bacteria 2100
1001 Ga0501069_0299895 3300049585 Bacteria 942
1002 Ga0501070_0000160 3300049586 Bacteria 61662
1003 Ga0501070_0000457 3300049586 Bacteria 37005
1004 Ga0501070_0039896 3300049586 Bacteria 3915
1005 Ga0501070_0064803 3300049586 Bacteria 3025
1006 Ga0501070_0067828 3300049586 Bacteria 2954
1007 Ga0501071_0006794 3300049587 Bacteria 7452
1008 Ga0501071_0462787 3300049587 Bacteria 971
1009 Ga0501071_0745146 3300049587 Bacteria 755
1010 Ga0501072_1048843 3300049588 Bacteria 635
1011 Ga0501073_0017148 3300049589 Bacteria 5245
1012 Ga0501073_0027588 3300049589 Bacteria 4060
1013 Ga0501074_0000066 3300049590 Bacteria 50258
1014 Ga0501074_0025835 3300049590 Bacteria 4261
1015 Ga0501074_0037426 3300049590 Bacteria 3517
1016 Ga0501074_0781597 3300049590 Bacteria 673
1017 Ga0501075_0029046 3300049591 Bacteria 4087
1018 Ga0501076_0011562 3300049592 Bacteria 6582
1019 Ga0501077_0022301 3300049593 Bacteria 4010
1020 Ga0501079_0387449 3300049741 Bacteria 1096
1021 Ga0501080_0000667 3300049742 Bacteria 27300
1022 Ga0501080_0002747 3300049742 Bacteria 15450
1023 Ga0501080_0053345 3300049742 Bacteria 3763
1024 Ga0501081_0218907 3300049743 Bacteria 1384
1025 Ga0501083_0000012 3300049744 Bacteria 178668
1026 Ga0501083_0053745 3300049744 Bacteria 2704
1027 Ga0501083_0284373 3300049744 Bacteria 1076
1028 Ga0501035_0000073 3300049822 Bacteria 122603
1029 Ga0501035_0000806 3300049822 Bacteria 33416
1030 Ga0501035_0004991 3300049822 Bacteria 12570
1031 Ga0501035_0012174 3300049822 Bacteria 7956
1032 Ga0501044_0000118 3300049823 Bacteria 95218
1033 Ga0501044_0063285 3300049823 Bacteria 3780
1034 Ga0501044_0084403 3300049823 Bacteria 3210
1035 Ga0501044_0101385 3300049823 Bacteria 2896
1036 Ga0501045_0008186 3300049824 Bacteria 7281
1037 nmdc:mga03n38_1260_c1 3300050490 Bacteria 7117
1038 nmdc:mga03n38_313483_c1 3300050490 Bacteria 845
1039 nmdc:mga00v17_36886_c1 3300050491 Bacteria 2916
1040 nmdc:mga00v17_505748_c1 3300050491 Bacteria 783
1041 nmdc:mga0yw44_42149_c1 3300050492 Bacteria 2721
1042 nmdc:mga0k408_92180_c1 3300050493 Bacteria 1780
1043 nmdc:mga06z11_105767_c1 3300050494 Bacteria 1551
1044 nmdc:mga06z11_185807_c1 3300050494 Bacteria 1201
1045 nmdc:mga06z11_2201_c1 3300050494 Bacteria 7403
1046 nmdc:mga06z11_82275_c1 3300050494 Bacteria 1730
1047 nmdc:mga04h51_90062_c1 3300050495 Bacteria 1103
1048 nmdc:mga07m45_135581_c1 3300050496 Bacteria 1425
1049 nmdc:mga07m45_14332_c1 3300050496 Bacteria 4221
1050 nmdc:mga05p37_16785_c1 3300050507 Bacteria 8826
1051 nmdc:mga08y16_263276_c1 3300050511 Bacteria 1780
1052 nmdc:mga08y16_514553_c1 3300050511 Bacteria 1215
1053 nmdc:mga08y16_792478_c1 3300050511 Bacteria 941
1054 nmdc:mga0n895_54520_c1 3300050512 Bacteria 3933
1055 nmdc:mga0n895_574276_c1 3300050512 Bacteria 1132
1056 nmdc:mga0rr50_30428_c1 3300050513 Bacteria 3822
1057 nmdc:mga0rr50_400664_c1 3300050513 Bacteria 1159
1058 nmdc:mga0rr50_84036_c1 3300050513 Bacteria 2463
1059 nmdc:mga08x19_385_c1 3300050514 Bacteria 31031
1060 nmdc:mga08x19_567685_c1 3300050514 Bacteria 803
1061 nmdc:mga08x19_78001_c1 3300050514 Bacteria 2170
1062 nmdc:mga0a205_59017_c1 3300050515 Bacteria 3706
1063 nmdc:mga0sz30_276759_c1 3300050516 Bacteria 748
1064 Ga0495601_0006582 3300053077 Bacteria 6795
1065 Ga0495601_0042864 3300053077 Bacteria 2841
1066 Ga0495601_0052397 3300053077 Bacteria 2576
1067 Ga0495601_0243152 3300053077 Bacteria 1175
1068 Ga0495601_0622022 3300053077 Unclassified 692
1069 Ga0495601_0729729 3300053077 Bacteria 631
1070 Ga0495612_0008895 3300053078 Bacteria 4069
1071 Ga0495612_0021744 3300053078 Bacteria 2573
1072 Ga0495595_0015072 3300053084 Bacteria 3291
1073 Ga0495595_0022370 3300053084 Bacteria 2775
1074 Ga0495595_0118598 3300053084 Bacteria 1288
1075 Ga0495595_0335813 3300053084 Bacteria 762
1076 Ga0495619_0001498 3300053085 Bacteria 15394
1077 Ga0495619_0003381 3300053085 Bacteria 10311
1078 Ga0495619_0015555 3300053085 Bacteria 4814
1079 Ga0495619_0057783 3300053085 Bacteria 2574
1080 Ga0500578_0099973 3300053086 Bacteria 1836
1081 Ga0500643_020438 3300053087 Bacteria 2165
1082 Ga0500644_0129367 3300053088 Bacteria 992
1083 Ga0500581_350604 3300053089 Bacteria 559
1084 Ga0500646_0012929 3300053090 Bacteria 2159
1085 Ga0500583_0128116 3300053092 Bacteria 1258
1086 Ga0500651_0131840 3300053093 Bacteria 1511
1087 Ga0500641_0014666 3300053096 Bacteria 2894
1088 Ga0500641_0040818 3300053096 Bacteria 1875
1089 Ga0500650_0003179 3300053098 Bacteria 5640
1090 Ga0500555_010336 3300053103 Bacteria 2675
1091 Ga0500556_0000015 3300053104 Bacteria 202598
1092 Ga0500562_021012 3300053108 Bacteria 1695
1093 Ga0500569_002523 3300053109 Bacteria 3621
1094 Ga0500569_113399 3300053109 Bacteria 898
1095 Ga0500592_002541 3300053116 Bacteria 2929
1096 Ga0500594_0007830 3300053118 Bacteria 2422
1097 Ga0500618_030349 3300053125 Bacteria 1272
1098 Ga0500642_0069549 3300053130 Bacteria 1599
1099 Ga0500652_000308 3300053131 Bacteria 17703
1100 Ga0500655_032263 3300053133 Bacteria 1011
1101 Ga0500658_0043021 3300053134 Bacteria 1817
1102 Ga0500658_0162204 3300053134 Bacteria 1012
1103 Ga0500559_0027141 3300053136 Bacteria 2443
1104 Ga0500561_0098936 3300053137 Bacteria 872
1105 Ga0500568_0001108 3300053139 Bacteria 18102
1106 Ga0500568_0002973 3300053139 Bacteria 9699
1107 Ga0500588_0026501 3300053146 Bacteria 1622
1108 Ga0500589_144075 3300053147 Bacteria 978
1109 Ga0500603_264010 3300053150 Bacteria 555
1110 Ga0500604_0001327 3300053151 Bacteria 6881
1111 Ga0500616_0000041 3300053153 Bacteria 359328
1112 Ga0500622_0002439 3300053156 Bacteria 13426
1113 Ga0500627_0027269 3300053158 Bacteria 2363
1114 Ga0500633_0164550 3300053160 Bacteria 832
1115 Ga0500636_0006978 3300053177 Bacteria 6512
1116 Ga0500637_0324071 3300053178 Bacteria 831
1117 Ga0500570_068096 3300053724 Bacteria 1678
1118 Ga0500611_020368 3300053727 Bacteria 1251
1119 Ga0500645_049728 3300053730 Bacteria 1225
1120 Ga0500645_141472 3300053730 Bacteria 665
1121 Ga0500645_172834 3300053730 Bacteria 590
1122 Ga0500656_064851 3300053732 Bacteria 554
1123 Ga0501084_0256827 3300054114 Bacteria 1475
1124 Ga0501084_0305024 3300054114 Bacteria 1345
1125 Ga0590075_102911 3300059424 Bacteria 744
1126 Ga0587073_0070410 3300059492 Bacteria 844
1127 Ga0587073_0089077 3300059492 Bacteria 781
1128 Ga0587073_0147584 3300059492 Bacteria 662
1129 Ga0587073_0183640 3300059492 Bacteria 616
1130 Ga0587077_090800 3300059493 Bacteria 718
1131 Ga0587080_064058 3300059503 Bacteria 722
1132 Ga0587082_073584 3300059504 Bacteria 699
1133 Ga0587082_084638 3300059504 Bacteria 667
1134 Ga0587088_137651 3300059508 Bacteria 580
1135 Ga0587129_011806 3300059608 Bacteria 691
1136 Ga0587072_094761 3300059643 Bacteria 662
1137 Ga0501082_0043509 3300060353 Bacteria 3872
1138 Ga0501082_0169930 3300060353 Bacteria 1895
1139 Ga0501082_1428585 3300060353 Bacteria 604
1140 Ga0530510_0080336 3300061734 Bacteria 2373
1141 2513673199 2513237098 Bacteria 9902361
1142 2513695404 2513237101 Bacteria 7952346
1143 2603860801 2602042107 Bacteria 6226103
1144 2644289600 2643221651 Bacteria 4798932
1145 2738744710 2738541281 Bacteria 5112672
1146 2739353940 2738543032 Bacteria 5115625
1147 2857524756 2857524615 Bacteria 6615449
1148 2874612225 2874604998 Bacteria 7834745
1149 2889042007 2889033259 Bacteria 9099371
1150 2893069277 2893066018 Bacteria 6158120
1151 2902411331 2902405164 Bacteria 6784948
1152 2919078640 2919073203 Bacteria 6531949
1153 2922386792 2922386360 Bacteria 7017218
1154 8001848798 8001845381 Bacteria 5804942
1155 8006964993 8006964411 Bacteria 8966052
1156 8006988641 8006984368 Bacteria 9651211
1157 Ga0395905_0314542
1158 SwRhRL2b_contig_3951670
1159 JGI24746J21847_1021252
1160 JGI24747J21853_1042903
1161 JGI24740J21852_10024470
1162 JGI24739J22299_10007360
1163 JGI24737J22298_10008541
1164 JGI24737J22298_10126944
1165 JGI24743J22301_10050615
1166 JGI24735J21928_10013907
1167 JGI24750J21931_1036810
1168 JGI24749J21850_1023924
1169 JGI24744J21845_10067843
1170 JGI24033J26618_1025586
1171 JGI24034J26672_10035091
1172 JGI24742J22300_10042532
1173 JGI24742J22300_10059722
1174 JGI24751J29686_10018533
1175 JGI25406J46586_10002904
1176 Ga0006777J48905_1012696
1177 Ga0006777J48905_1040219
1178 Ga0006777J48905_1058774
1179 Ga0006781J51513_1035190
1180 Ga0007410J51695_1043051
1181 Ga0007409J51694_1088714
1182 Ga0007429J51699_1021511
1183 Ga0007429J51699_1059805
1184 JGI25404J52841_10022797
1185 JGI25404J52841_10033517
1186 Ga0032354_1012960
1187 Ga0032354_1047272
1188 Ga0032354_1052366
1189 Ga0006780_1021799
1190 Ga0058863_11574013
1191 Ga0058860_12115543
1192 Ga0058860_12149836
1193 Ga0065715_10500263
1194 Ga0065707_10331906
1195 Ga0070658_10122009
1196 Ga0070658_10719580
1197 Ga0070676_10214685
1198 Ga0070683_100116918
1199 Ga0070683_100186787
1200 Ga0070690_100312075
1201 Ga0070670_100036037
1202 Ga0070670_100131914
1203 Ga0070670_101179141
1204 Ga0068869_100143438
1205 Ga0068869_100177601
1206 Ga0068869_100313946
1207 Ga0070666_10091734
1208 Ga0070666_10316492
1209 Ga0070680_100013974
1210 Ga0070682_100068797
1211 Ga0070682_100095633
1212 Ga0070682_100479432
1213 Ga0068868_100147810
1214 Ga0068868_100725833
1215 Ga0068868_100968955
1216 Ga0070660_100235492
1217 Ga0070660_100278994
1218 Ga0070660_100834516
1219 Ga0070660_100857848
1220 Ga0070689_100032271
1221 Ga0070691_10075852
1222 Ga0070687_100237656
1223 Ga0070661_100024323
1224 Ga0070661_100214230
1225 Ga0070661_100598004
1226 Ga0070692_10548936
1227 Ga0070668_100217633
1228 Ga0070668_100248629
1229 Ga0070668_100275195
1230 Ga0070669_100129738
1231 Ga0070669_100335643
1232 Ga0070671_100063284
1233 Ga0070671_100172520
1234 Ga0070671_101044787
1235 Ga0070674_100068947
1236 Ga0070674_100654750
1237 Ga0070673_100169492
1238 Ga0070673_100474346
1239 Ga0070673_100737795
1240 Ga0070688_100130134
1241 Ga0070688_100199709
1242 Ga0070659_100044581
1243 Ga0070659_100123679
1244 Ga0070659_100224555
1245 Ga0070659_100299217
1246 Ga0070659_100666840
1247 Ga0070659_101470739
1248 Ga0070667_100042228
1249 Ga0070667_100291770
1250 Ga0070667_100461147
1251 Ga0070703_10168139
1252 Ga0070703_10207770
1253 Ga0070709_10001015
1254 Ga0070714_100008787
1255 Ga0070714_100160074
1256 Ga0070714_101523020
1257 Ga0070713_100002311
1258 Ga0070713_100102531
1259 Ga0070713_100504541
1260 Ga0070710_10013948
1261 Ga0070710_10446128
1262 Ga0070710_10557628
1263 Ga0070701_10170254
1264 Ga0070701_10182050
1265 Ga0070711_100147022
1266 Ga0070711_100184808
1267 Ga0070705_100354370
1268 Ga0070705_100414755
1269 Ga0070700_100014021
1270 Ga0070700_100258660
1271 Ga0070700_100959397
1272 Ga0070694_100085125
1273 Ga0070694_100153679
1274 Ga0070694_100299584
1275 Ga0070694_100502318
1276 Ga0070663_100008060
1277 Ga0070663_100086075
1278 Ga0070663_100113623
1279 Ga0070663_100159559
1280 Ga0070663_100182877
1281 Ga0070663_100420146
1282 Ga0070663_100773989
1283 Ga0070663_100809046
1284 Ga0070678_100135175
1285 Ga0070678_100418545
1286 Ga0070678_100855993
1287 Ga0070662_100054508
1288 Ga0070662_100057011
1289 Ga0070662_100084041
1290 Ga0070662_100230727
1291 Ga0070662_101063909
1292 Ga0070681_10013083
1293 Ga0070681_10070681
1294 Ga0070685_10251199
1295 Ga0070698_100053016
1296 Ga0070679_100126829
1297 Ga0070679_100267934
1298 Ga0070679_100652430
1299 Ga0070679_100754742
1300 Ga0070684_100092938
1301 Ga0070684_100626745
1302 Ga0070697_100064835
1303 Ga0068853_100004957
1304 Ga0068853_100039011
1305 Ga0068853_100130476
1306 Ga0068853_100663727
1307 Ga0068853_100767883
1308 Ga0070672_100586816
1309 Ga0070686_100050014
1310 Ga0070686_100404916
1311 Ga0070686_100665765
1312 Ga0070695_100042844
1313 Ga0070695_100315310
1314 Ga0070696_100000971
1315 Ga0070696_100044480
1316 Ga0070696_100246081
1317 Ga0070693_100017592
1318 Ga0070693_100987912
1319 Ga0070693_100988161
1320 Ga0070665_100003902
1321 Ga0070665_100053521
1322 Ga0070665_100113980
1323 Ga0070665_100546810
1324 Ga0070665_100550745
1325 Ga0070665_100891149
1326 Ga0070704_100181227
1327 Ga0070704_100238813
1328 Ga0068855_100075381
1329 Ga0068855_100110751
1330 Ga0068855_100227171
1331 Ga0068855_100272230
1332 Ga0068855_100337368
1333 Ga0070664_100351050
1334 Ga0070664_100481716
1335 Ga0068857_100020850
1336 Ga0068857_100334791
1337 Ga0068854_100006791
1338 Ga0068854_100006800
1339 Ga0068854_101698589
1340 Ga0068854_101707607
1341 Ga0068856_100000363
1342 Ga0068856_100028283
1343 Ga0068856_100154754
1344 Ga0068856_100411333
1345 Ga0070702_100003979
1346 Ga0070702_100104963
1347 Ga0068852_100005807
1348 Ga0068852_100391373
1349 Ga0068859_100117890
1350 Ga0068859_100224959
1351 Ga0068864_100064661
1352 Ga0068864_100109309
1353 Ga0068864_101347514
1354 Ga0068866_10418506
1355 Ga0068861_100028388
1356 Ga0068861_100101152
1357 Ga0068861_100152343
1358 Ga0068851_10009198
1359 Ga0068851_10034585
1360 Ga0068851_10147229
1361 Ga0068870_10049659
1362 Ga0068863_100020353
1363 Ga0068858_100249886
1364 Ga0068858_100482037
1365 Ga0068858_101021531
1366 Ga0068860_100061571
1367 Ga0068860_100067286
1368 Ga0068860_101207093
1369 Ga0068862_100131627
1370 Ga0068862_100889847
1371 Ga0081455_10000633
1372 Ga0081455_10045282
1373 Ga0081540_1001350
1374 Ga0081540_1005948
1375 Ga0081540_1013070
1376 Ga0081540_1023275
1377 Ga0081539_10000864
1378 Ga0081539_10064473
1379 Ga0070717_10008605
1380 Ga0070717_10207693
1381 Ga0070717_10349425
1382 Ga0075365_10007938
1383 Ga0075365_10142814
1384 Ga0075365_10262762
1385 Ga0075365_10600407
1386 Ga0075368_10022861
1387 Ga0075363_100001181
1388 Ga0075364_10025549
1389 Ga0075364_10136743
1390 Ga0075364_10194511
1391 Ga0070716_100019318
1392 Ga0070712_100006584
1393 Ga0075362_10020047
1394 Ga0075362_10227062
1395 Ga0075362_10246177
1396 Ga0075367_10001700
1397 Ga0075367_10017229
1398 Ga0075367_10065669
1399 Ga0075367_10249851
1400 Ga0075369_10091556
1401 Ga0075369_10245394
1402 Ga0075366_10845597
1403 Ga0097621_100026518
1404 Ga0097621_100074213
1405 Ga0097621_100316295
1406 Ga0075370_10020128
1407 Ga0075370_10028239
1408 Ga0068871_100035821
1409 Ga0068871_100104255
1410 Ga0075428_100070086
1411 Ga0075430_100109997
1412 Ga0075430_100917106
1413 Ga0075431_100465897
1414 Ga0075433_10809127
1415 Ga0075433_10833840
1416 Ga0075434_100044641
1417 Ga0075434_100125713
1418 Ga0075434_100510301
1419 Ga0068865_100001775
1420 Ga0075436_100005858
1421 Ga0075436_100692290
1422 Ga0075436_101191223
1423 Ga0097620_100117884
1424 Ga0097620_100224948
1425 Ga0075435_100073638
1426 Ga0075435_100111808
1427 Ga0075435_100468897
1428 Ga0099794_10381339
1429 Ga0099795_10021043
1430 Ga0099795_10030236
1431 Ga0099795_10048728
1432 Ga0105251_10097573
1433 Ga0105251_10313106
1434 Ga0105244_10088248
1435 Ga0105250_10030865
1436 Ga0105250_10046623
1437 Ga0105240_10016715
1438 Ga0105240_10030730
1439 Ga0105240_10196998
1440 Ga0105240_12090505
1441 Ga0111539_10315761
1442 Ga0111539_10663958
1443 Ga0105245_10312564
1444 Ga0105245_10359871
1445 Ga0105245_10530627
1446 Ga0105245_10791723
1447 Ga0105245_10968353
1448 Ga0105247_10095694
1449 Ga0114129_10037544
1450 Ga0114129_10784305
1451 Ga0105243_10076785
1452 Ga0105243_10319515
1453 Ga0105243_10501399
1454 Ga0105241_10066421
1455 Ga0105241_10070808
1456 Ga0105241_10406303
1457 Ga0105241_10493630
1458 Ga0105242_10022368
1459 Ga0105242_10322965
1460 Ga0105248_10061998
1461 Ga0105248_10272244
1462 Ga0105237_10040252
1463 Ga0105237_10176281
1464 Ga0105237_10317584
1465 Ga0105237_10396831
1466 Ga0105238_10012175
1467 Ga0105238_10035982
1468 Ga0105238_10049838
1469 Ga0105238_10102283
1470 Ga0105238_10264456
1471 Ga0105238_10347316
1472 Ga0105249_10074945
1473 Ga0105249_10092015
1474 Ga0105249_10133651
1475 Ga0099796_10061656
1476 Ga0105239_10091468
1477 Ga0105239_10152572
1478 Ga0105239_10153070
1479 Ga0105239_10428627
1480 Ga0105239_10560225
1481 Ga0105239_10644628
1482 Ga0105239_11920494
1483 Ga0105246_10095430
1484 Ga0105246_10547708
1485 Ga0105246_10581741
1486 Ga0157344_1004409
1487 Ga0157326_1003126
1488 Ga0157373_10585099
1489 Ga0157373_10730117
1490 Ga0157370_10158045
1491 Ga0157370_10538178
1492 Ga0157370_10810914
1493 Ga0157374_10510630
1494 Ga0157378_10074128
1495 Ga0157378_10077086
1496 Ga0157378_10367816
1497 Ga0157378_10661797
1498 Ga0163162_10010007
1499 Ga0163162_10321503
1500 Ga0163162_10394122
1501 Ga0157372_10218610
1502 Ga0157372_10855203
1503 Ga0157375_10724238
1504 Ga0163163_10064503
1505 Ga0163163_10075022
1506 Ga0163163_11988878
1507 Ga0157380_10186461
1508 Ga0157380_10215780
1509 Ga0157380_10426265
1510 Ga0157380_12527629
1511 Ga0157377_10048477
1512 Ga0157376_10188927
1513 Ga0157376_10267523
1514 Ga0157376_11224350
1515 Ga0163161_10112438
1516 Ga0197907_10889824
1517 Ga0197907_11053528
1518 Ga0197907_11501374
1519 Ga0206356_10247621
1520 Ga0206356_10594276
1521 Ga0206356_11474439
1522 Ga0206356_11572529
1523 Ga0206356_11733153
1524 Ga0206356_11743097
1525 Ga0206356_11836906
1526 Ga0206349_1020691
1527 Ga0206349_1186858
1528 Ga0206349_1197767
1529 Ga0206349_1262994
1530 Ga0206349_1463205
1531 Ga0206349_1946070
1532 Ga0206355_1093692
1533 Ga0206355_1113466
1534 Ga0206355_1164344
1535 Ga0206355_1358260
1536 Ga0206355_1367435
1537 Ga0206351_10032476
1538 Ga0206351_10751612
1539 Ga0206352_10138666
1540 Ga0206350_10122239
1541 Ga0206350_10365195
1542 Ga0206350_10388215
1543 Ga0206350_10511773
1544 Ga0206350_10646272
1545 Ga0206350_10677610
1546 Ga0206350_10924274
1547 Ga0206350_11081022
1548 Ga0206350_11355059
1549 Ga0206354_10089617
1550 Ga0206354_11086759
1551 Ga0206354_11428798
1552 Ga0206353_10116796
1553 Ga0206353_10362445
1554 Ga0206353_10411745
1555 Ga0206353_10504062
1556 Ga0206353_10883923
1557 Ga0206353_11374616
1558 Ga0206353_11504878
1559 Ga0206353_11657362
1560 Ga0154015_1321397
1561 Ga0224712_10182083
1562 Ga0224712_10278123
1563 Ga0224712_10295154
1564 Ga0224712_10304103
1565 Ga0224712_10305207
1566 Ga0224712_10448592
1567 Ga0224712_10488207
1568 Ga0224712_10494070
1569 Ga0224712_10511958
1570 Ga0247551_102201
1571 Ga0247523_112525
1572 Ga0209455_1002093
1573 Ga0209758_1008352
1574 Ga0207426_1075567
1575 Ga0207656_10126512
1576 Ga0207656_10163908
1577 Ga0207713_1073333
1578 Ga0207653_10007478
1579 Ga0207653_10039302
1580 Ga0207692_10027517
1581 Ga0207642_10081749
1582 Ga0207642_10230011
1583 Ga0207710_10011489
1584 Ga0207688_10000896
1585 Ga0207680_10009686
1586 Ga0207680_10601969
1587 Ga0207647_10005519
1588 Ga0207647_10086076
1589 Ga0207647_10091272
1590 Ga0207699_10000463
1591 Ga0207699_10107996
1592 Ga0207645_10005784
1593 Ga0207645_10227158
1594 Ga0207645_10336316
1595 Ga0207643_10005864
1596 Ga0207705_10109530
1597 Ga0207705_10177512
1598 Ga0207705_10690578
1599 Ga0207684_11024328
1600 Ga0207654_10002142
1601 Ga0207654_10126759
1602 Ga0207654_10156278
1603 Ga0207654_10550951
1604 Ga0207707_10014498
1605 Ga0207707_10024561
1606 Ga0207695_10015064
1607 Ga0207695_10056580
1608 Ga0207671_10008930
1609 Ga0207671_10073879
1610 Ga0207671_10170843
1611 Ga0207671_10223604
1612 Ga0207671_10716188
1613 Ga0207671_10968571
1614 Ga0207693_10000640
1615 Ga0207693_10037124
1616 Ga0207693_10070055
1617 Ga0207663_10373124
1618 Ga0207663_11025368
1619 Ga0207662_10006236
1620 Ga0207657_10006779
1621 Ga0207657_10042348
1622 Ga0207657_10386797
1623 Ga0207649_10037057
1624 Ga0207649_10073668
1625 Ga0207652_10014385
1626 Ga0207652_10227920
1627 Ga0207694_10000275
1628 Ga0207694_10128284
1629 Ga0207694_10151091
1630 Ga0207650_10179565
1631 Ga0207659_10524947
1632 Ga0207659_10779263
1633 Ga0207687_10074887
1634 Ga0207687_10300546
1635 Ga0207700_10135523
1636 Ga0207700_10981429
1637 Ga0207664_10163043
1638 Ga0207664_10332650
1639 Ga0207664_11066688
1640 Ga0207644_10026008
1641 Ga0207644_10065213
1642 Ga0207644_10746250
1643 Ga0207690_10099075
1644 Ga0207690_10224525
1645 Ga0207706_10007357
1646 Ga0207706_10059285
1647 Ga0207706_10067153
1648 Ga0207706_10186103
1649 Ga0207706_10482924
1650 Ga0207686_10074963
1651 Ga0207686_10247460
1652 Ga0207709_10139546
1653 Ga0207709_10560673
1654 Ga0207709_10569188
1655 Ga0207670_10186147
1656 Ga0207670_10228092
1657 Ga0207669_10529931
1658 Ga0207669_10983171
1659 Ga0207704_10004344
1660 Ga0207665_10001240
1661 Ga0207691_10016710
1662 Ga0207691_10037607
1663 Ga0207711_10028906
1664 Ga0207711_10030859
1665 Ga0207711_10815829
1666 Ga0207689_10002364
1667 Ga0207689_10424621
1668 Ga0207689_10572682
1669 Ga0207661_10055213
1670 Ga0207661_10127093
1671 Ga0207661_10968211
1672 Ga0207679_11108163
1673 Ga0207667_10061756
1674 Ga0207651_10357019
1675 Ga0207651_10421006
1676 Ga0207651_10782063
1677 Ga0207712_10434904
1678 Ga0207668_10023778
1679 Ga0207668_10125228
1680 Ga0207668_10281391
1681 Ga0207640_10062060
1682 Ga0207640_10148236
1683 Ga0207658_10028993
1684 Ga0207658_10134836
1685 Ga0207677_11102657
1686 Ga0207703_10205828
1687 Ga0207703_10351960
1688 Ga0207703_10393125
1689 Ga0207639_10056687
1690 Ga0207639_10126168
1691 Ga0207678_10013706
1692 Ga0207678_10043711
1693 Ga0207678_10047593
1694 Ga0207678_10094228
1695 Ga0207678_10143127
1696 Ga0207678_10368890
1697 Ga0207678_10396695
1698 Ga0207678_10459519
1699 Ga0207678_11083551
1700 Ga0207708_10001706
1701 Ga0207702_10000026
1702 Ga0207702_10000261
1703 Ga0207702_10018370
1704 Ga0207702_10122685
1705 Ga0207702_10189685
1706 Ga0207641_10152237
1707 Ga0207641_11075545
1708 Ga0207648_10001075
1709 Ga0207648_10918263
1710 Ga0207676_10144444
1711 Ga0207676_10557049
1712 Ga0207676_11575435
1713 Ga0207674_10010326
1714 Ga0207674_10011498
1715 Ga0207674_10095357
1716 Ga0207675_100019330
1717 Ga0207675_100075468
1718 Ga0207675_100078028
1719 Ga0207675_100459020
1720 Ga0207683_10005431
1721 Ga0207683_10231562
1722 Ga0207683_10529706
1723 Ga0207683_11079303
1724 Ga0207698_10502536
1725 Ga0207698_10726318
1726 Ga0207698_10935451
1727 Ga0209588_1076492
1728 Ga0209813_10075398
1729 Ga0207428_10039794
1730 Ga0207428_10557741
1731 Ga0268266_10061845
1732 Ga0268266_10089000
1733 Ga0268266_10091874
1734 Ga0268266_10270862
1735 Ga0268266_10615691
1736 Ga0268266_10757559
1737 Ga0268265_10054641
1738 Ga0268265_10220268
1739 Ga0268265_10227273
1740 Ga0268264_10328562
1741 Ga0268264_10424356
1742 Ga0268264_10583177
1743 Ga0307515_10163003
1744 Ga0307515_10419659
1745 Ga0265766_1015316
1746 Ga0265328_10244845
1747 Ga0265325_10001626
1748 Ga0265325_10011302
1749 Ga0265339_10005018
1750 Ga0307513_10154734
1751 Ga0307513_10445618
1752 Ga0307509_10508846
1753 Ga0307509_10577547
1754 Ga0307408_100421690
1755 Ga0307408_100536846
1756 Ga0310117_124297
1757 Ga0265313_10004507
1758 Ga0265313_10030909
1759 Ga0265313_10054763
1760 Ga0307508_10146318
1761 Ga0265342_10059304
1762 Ga0316043_127489
1763 Ga0307406_10316115
1764 Ga0307416_100168750
1765 Ga0307415_100036591
1766 Ga0307507_10213161
1767 Ga0307510_10062648
1768 Ga0307510_10440666
1769 Ga0373948_0008489
1770 Ga0373958_0001587
1771 Ga0373926_0005541
1772 Ga0373934_0054317
1773 Ga0373944_0000364
1774 Ga0373944_0010085
1775 Ga0373944_0097139
1776 Ga0373949_0021242
1777 Ga0373951_0023092
1778 Ga0373951_0112944
1779 Ga0373923_0005611
1780 Ga0373923_0009594
1781 Ga0373923_0183843
1782 Ga0373936_0008721
1783 Ga0373936_0081898
1784 Ga0373939_0133078
1785 Ga0373939_0327484
1786 Ga0373941_0013347
1787 Ga0373945_0000604
1788 Ga0373945_0013010
1789 Ga0373945_0066848
1790 Ga0373953_0031765
1791 Ga0373953_0038873
1792 Ga0373954_0011230
1793 Ga0373954_0048759
1794 Ga0373956_0084357
1795 Ga0373956_0381736
1796 Ga0373957_0003340
1797 Ga0373957_0062844
1798 Ga0373943_0006934
1799 Ga0373943_0031393
1800 Ga0373946_0029874
1801 Ga0373946_0033120
1802 Ga0373955_0002404
1803 Ga0373955_0007268
1804 Ga0373955_0114546
1805 Ga0373961_0002416
1806 Ga0373962_0112365
1807 Ga0373924_0006081
1808 Ga0373924_0006172
1809 Ga0373931_0096660
1810 Ga0373931_0199953
1811 Ga0373935_0013235
1812 Ga0373935_0399675
1813 Ga0373935_0465733
1814 Ga0373935_0800384
1815 Ga0373927_0001118
1816 Ga0373927_0011708
1817 Ga0373927_0014273
1818 Ga0373933_0011886
1819 Ga0373933_0088546
1820 Ga0373947_0000372
1821 Ga0373947_0017773
1822 Ga0373947_0026529
1823 Ga0373937_0030143
1824 Ga0373937_0101470
1825 Ga0373937_0106945
1826 Ga0373937_0114684
1827 Ga0373937_0995412
1828 Ga0310109_046298
1829 Ga0373925_0006079
1830 Ga0373925_0035309
1831 Ga0373925_0043061
1832 Ga0373925_0263159
1833 Ga0373925_0268518
1834 Ga0395905_0217267
1835 Ga0436360_0599366
1836 Ga0436360_0645480
1837 Ga0436363_1293311
1838 Ga0436362_1029460
1839 Ga0439461_0128559
1840 Ga0451802_0955069
1841 Ga0451833_1205776
1842 Ga0451853_3246118
1843 Ga0466966_0005575
1844 Ga0466966_0252929
1845 Ga0466963_0038531
1846 Ga0466963_0955214
1847 Ga0466968_0005113
1848 Ga0466959_0010598
1849 Ga0466959_0329301
1850 Ga0466959_0444672
1851 Ga0466967_0021546
1852 Ga0495627_103522
1853 Ga0495592_0001055
1854 Ga0495592_0010832
1855 Ga0495603_0014865
1856 Ga0495603_0024400
1857 Ga0495603_0026152
1858 Ga0495603_0223293
1859 Ga0495590_0030522
1860 Ga0495629_0003357
1861 Ga0495629_0019076
1862 Ga0495629_0112714
1863 Ga0495629_0177175
1864 Ga0495638_0105696
1865 Ga0495638_0127089
1866 Ga0495641_0012702
1867 Ga0495651_0009559
1868 Ga0495651_0039188
1869 Ga0495651_0055997
1870 Ga0495651_0099648
1871 Ga0495653_0008585
1872 Ga0495653_0017321
1873 Ga0495653_0267673
1874 Ga0495580_0013690
1875 Ga0495580_0222805
1876 Ga0495582_0011471
1877 Ga0495582_0031598
1878 Ga0495639_0004110
1879 Ga0495662_0003064
1880 Ga0495662_0362007
1881 Ga0495664_0008779
1882 Ga0495664_0269855
1883 Ga0495584_0034642
1884 Ga0495585_0056846
1885 Ga0495594_0005321
1886 Ga0495594_0143479
1887 Ga0495607_0044310
1888 Ga0495607_0455181
1889 Ga0495583_0042395
1890 Ga0495606_0055888
1891 Ga0495608_0033105
1892 Ga0495610_0044346
1893 Ga0495616_0035528
1894 Ga0495616_0113607
1895 Ga0495616_0312848
1896 Ga0495618_0002517
1897 Ga0495618_0045723
1898 Ga0495618_0722148
1899 Ga0495628_0087042
1900 Ga0495628_0087330
1901 Ga0495628_0348576
1902 Ga0495630_0017717
1903 Ga0495630_0025849
1904 Ga0495631_0109239
1905 Ga0495631_0199360
1906 Ga0495632_0021367
1907 Ga0495637_0033862
1908 Ga0495643_0206760
1909 Ga0495644_0002732
1910 Ga0495663_0046978
1911 Ga0495666_0006077
1912 Ga0495666_0020392
1913 Ga0495666_0152763
1914 Ga0495652_0108337
1915 Ga0495652_0145992
1916 Ga0495665_0032754
1917 Ga0495640_0006867
1918 Ga0495640_0051277
1919 Ga0495640_0183560
1920 Ga0495586_0087335
1921 Ga0495586_0230257
1922 Ga0495587_0026482
1923 Ga0495587_0051328
1924 Ga0495598_0058368
1925 Ga0495598_0067460
1926 Ga0495609_0033203
1927 Ga0495621_0013532
1928 Ga0495597_0092747
1929 Ga0495622_0006399
1930 Ga0495633_0009880
1931 Ga0495633_0018095
1932 Ga0495667_0008737
1933 Ga0495667_0020910
1934 Ga0495667_0078258
1935 Ga0495667_0106403
1936 Ga0495656_0000064
1937 Ga0495656_0046515
1938 Ga0495656_0048334
1939 Ga0495668_0025416
1940 Ga0495634_0026538
1941 Ga0495634_0047460
1942 Ga0495611_0105572
1943 Ga0495611_0124745
1944 Ga0495611_0226481
1945 Ga0495625_0006076
1946 Ga0495625_0047212
1947 Ga0495625_0658367
1948 Ga0495635_0008796
1949 Ga0495635_0037890
1950 Ga0495635_0122079
1951 Ga0495659_0208813
1952 Ga0495661_0036088
1953 Ga0495661_0150914
1954 Ga0495661_0225380
1955 Ga0495588_0011011
1956 Ga0495588_0018681
1957 Ga0495657_0047604
1958 Ga0495657_0106638
1959 Ga0495657_0202029
1960 Ga0495657_0509451
1961 Ga0495599_0021867
1962 Ga0495599_0043307
1963 Ga0495623_0036443
1964 Ga0495623_0248643
1965 Ga0495646_0003336
1966 Ga0495647_0015713
1967 Ga0495647_0017786
1968 Ga0495658_0001834
1969 Ga0495658_0010431
1970 Ga0495658_0311236
1971 Ga0495658_0444063
1972 Ga0495669_0241913
1973 Ga0495669_0266358
1974 Ga0495613_0033299
1975 Ga0495613_0102619
1976 Ga0495613_0182144
1977 Ga0495613_0819128
1978 Ga0495624_0005807
1979 Ga0495624_0045904
1980 Ga0495670_0090641
1981 Ga0495671_0013849
1982 Ga0495589_0247988
1983 Ga0495600_0000716
1984 Ga0495600_0001994
1985 Ga0495600_0181124
1986 Ga0495660_0128889
1987 Ga0495660_0343500
1988 Ga0495581_0020045
1989 Ga0495581_0072896
1990 Ga0495581_0073317
1991 Ga0495604_0025973
1992 Ga0495604_0039798
1993 Ga0495604_0054739
1994 Ga0495636_0095471
1995 Ga0495674_0088487
1996 Ga0495674_0345361
1997 Ga0495672_0079076
1998 Ga0495676_0030061
1999 Ga0495676_0050140
2000 Ga0495676_0052812
2001 Ga0495676_0346310
2002 Ga0495680_0011117
2003 Ga0495680_0014218
2004 Ga0495680_0045137
2005 Ga0495680_0301870
2006 Ga0495675_0104372
2007 Ga0495675_0154536
2008 Ga0495673_0035535
2009 Ga0495684_0003050
2010 Ga0495684_0006284
2011 Ga0495684_0022194
2012 Ga0495684_0220457
2013 Ga0495684_0324079
2014 Ga0495684_0332537
2015 Ga0495686_0017077
2016 Ga0495686_0223799
2017 Ga0495593_0003538
2018 Ga0495593_0003546
2019 Ga0495593_0007526
2020 Ga0495593_0029887
2021 Ga0495593_0093302
2022 Ga0495602_0086153
2023 Ga0495602_0094544
2024 Ga0495602_0215159
2025 Ga0495602_0237050
2026 Ga0495602_0271223
2027 Ga0495602_0561486
2028 Ga0495614_0012122
2029 Ga0495626_0086193
2030 Ga0495626_0260181
2031 Ga0496100_0007837
2032 Ga0496100_0100720
2033 Ga0496101_0138194
2034 Ga0496101_0266194
2035 Ga0496101_0401158
2036 Ga0496102_0032922
2037 Ga0496102_0041408
2038 Ga0496102_0061565
2039 Ga0496102_0123500
2040 Ga0496102_0131901
2041 Ga0496102_0362100
2042 Ga0496103_0071414
2043 Ga0496103_0097141
2044 Ga0496103_0381642
2045 Ga0496104_0008842
2046 Ga0496104_0219238
2047 Ga0496104_0926033
2048 Ga0496105_0162145
2049 Ga0496105_0502104
2050 Ga0496105_0585446
2051 Ga0496106_0029877
2052 Ga0496106_0041002
2053 Ga0496106_0097958
2054 Ga0496107_0138809
2055 Ga0496107_0473597
2056 Ga0496107_1142889
2057 Ga0496108_0005621
2058 Ga0496108_0181363
2059 Ga0496109_0076356
2060 Ga0496109_0315076
2061 Ga0496109_0328581
2062 Ga0496110_0065588
2063 Ga0496110_0320163
2064 Ga0496110_0384154
2065 Ga0496110_0430367
2066 Ga0496110_0453250
2067 Ga0496111_0048697
2068 Ga0496111_0219840
2069 Ga0496111_0454743
2070 Ga0496112_0006027
2071 Ga0496112_0331113
2072 Ga0496112_0406145
2073 Ga0496112_0776215
2074 Ga0496113_0030783
2075 Ga0496113_0130337
2076 Ga0496113_0149706
2077 Ga0496113_0163115
2078 Ga0496114_0060904
2079 Ga0496114_0152579
2080 Ga0496114_0208628
2081 Ga0496114_0307910
2082 Ga0496114_0333238
2083 Ga0496115_0033633
2084 Ga0496115_0046778
2085 Ga0496115_0121803
2086 Ga0496115_0214364
2087 Ga0496115_0215701
2088 Ga0496115_0231623
2089 Ga0496115_0353296
2090 Ga0496116_0349539
2091 Ga0496117_0202176
2092 Ga0496118_0059696
2093 Ga0496118_0116918
2094 Ga0496118_0224777
2095 Ga0496120_0080935
2096 Ga0496120_0131365
2097 Ga0496121_0000300
2098 Ga0496121_0026815
2099 Ga0496121_0027734
2100 Ga0496121_0041567
2101 Ga0496121_0074274
2102 Ga0496121_0179884
2103 Ga0496121_0279163
2104 Ga0496121_0592625
2105 Ga0496121_0597692
2106 Ga0496122_0010659
2107 Ga0496122_0082401
2108 Ga0496122_0246162
2109 Ga0496123_0072978
2110 Ga0496123_0073217
2111 Ga0496123_0181476
2112 Ga0496124_0215824
2113 Ga0496124_0305892
2114 Ga0496125_0000063
2115 Ga0496125_0057601
2116 Ga0496126_0008064
2117 Ga0496126_0008100
2118 Ga0496126_0031081
2119 Ga0496126_0099390
2120 Ga0496126_0133791
2121 Ga0496126_0139126
2122 Ga0496126_0174394
2123 Ga0496126_0254741
2124 Ga0501031_0502400
2125 Ga0501032_0001391
2126 Ga0501033_0000304
2127 Ga0501033_0257829
2128 Ga0501034_0028770
2129 Ga0501034_0061482
2130 Ga0501036_0093458
2131 Ga0501036_0117424
2132 Ga0501037_0000154
2133 Ga0501037_0202150
2134 Ga0501037_0322494
2135 Ga0501038_0465060
2136 Ga0501038_0951447
2137 Ga0501039_0190507
2138 Ga0501041_0009638
2139 Ga0501041_0433754
2140 Ga0501042_0027891
2141 Ga0501043_0000007
2142 Ga0501043_0337856
2143 Ga0501047_0000740
2144 Ga0501047_0036680
2145 Ga0501047_0124460
2146 Ga0501047_0462930
2147 Ga0501048_0048949
2148 Ga0501067_0027605
2149 Ga0501067_0159701
2150 Ga0501067_0197413
2151 Ga0501067_0650151
2152 Ga0501068_0180196
2153 Ga0501068_0342319
2154 Ga0501069_0000027
2155 Ga0501069_0019796
2156 Ga0501069_0061284
2157 Ga0501069_0299895
2158 Ga0501070_0000160
2159 Ga0501070_0000457
2160 Ga0501070_0039896
2161 Ga0501070_0064803
2162 Ga0501070_0067828
2163 Ga0501071_0006794
2164 Ga0501071_0462787
2165 Ga0501071_0745146
2166 Ga0501072_1048843
2167 Ga0501073_0017148
2168 Ga0501073_0027588
2169 Ga0501074_0000066
2170 Ga0501074_0025835
2171 Ga0501074_0037426
2172 Ga0501074_0781597
2173 Ga0501075_0029046
2174 Ga0501076_0011562
2175 Ga0501077_0022301
2176 Ga0501079_0387449
2177 Ga0501080_0000667
2178 Ga0501080_0002747
2179 Ga0501080_0053345
2180 Ga0501081_0218907
2181 Ga0501083_0000012
2182 Ga0501083_0053745
2183 Ga0501083_0284373
2184 Ga0501035_0000073
2185 Ga0501035_0000806
2186 Ga0501035_0004991
2187 Ga0501035_0012174
2188 Ga0501044_0000118
2189 Ga0501044_0063285
2190 Ga0501044_0084403
2191 Ga0501044_0101385
2192 Ga0501045_0008186
2193 nmdc:mga03n38_1260_c1
2194 nmdc:mga03n38_313483_c1
2195 nmdc:mga00v17_36886_c1
2196 nmdc:mga00v17_505748_c1
2197 nmdc:mga0yw44_42149_c1
2198 nmdc:mga0k408_92180_c1
2199 nmdc:mga06z11_105767_c1
2200 nmdc:mga06z11_185807_c1
2201 nmdc:mga06z11_2201_c1
2202 nmdc:mga06z11_82275_c1
2203 nmdc:mga04h51_90062_c1
2204 nmdc:mga07m45_135581_c1
2205 nmdc:mga07m45_14332_c1
2206 nmdc:mga05p37_16785_c1
2207 nmdc:mga08y16_263276_c1
2208 nmdc:mga08y16_514553_c1
2209 nmdc:mga08y16_792478_c1
2210 nmdc:mga0n895_54520_c1
2211 nmdc:mga0n895_574276_c1
2212 nmdc:mga0rr50_30428_c1
2213 nmdc:mga0rr50_400664_c1
2214 nmdc:mga0rr50_84036_c1
2215 nmdc:mga08x19_385_c1
2216 nmdc:mga08x19_567685_c1
2217 nmdc:mga08x19_78001_c1
2218 nmdc:mga0a205_59017_c1
2219 nmdc:mga0sz30_276759_c1
2220 Ga0495601_0006582
2221 Ga0495601_0042864
2222 Ga0495601_0052397
2223 Ga0495601_0243152
2224 Ga0495601_0622022
2225 Ga0495601_0729729
2226 Ga0495612_0008895
2227 Ga0495612_0021744
2228 Ga0495595_0015072
2229 Ga0495595_0022370
2230 Ga0495595_0118598
2231 Ga0495595_0335813
2232 Ga0495619_0001498
2233 Ga0495619_0003381
2234 Ga0495619_0015555
2235 Ga0495619_0057783
2236 Ga0500578_0099973
2237 Ga0500643_020438
2238 Ga0500644_0129367
2239 Ga0500581_350604
2240 Ga0500646_0012929
2241 Ga0500583_0128116
2242 Ga0500651_0131840
2243 Ga0500641_0014666
2244 Ga0500641_0040818
2245 Ga0500650_0003179
2246 Ga0500555_010336
2247 Ga0500556_0000015
2248 Ga0500562_021012
2249 Ga0500569_002523
2250 Ga0500569_113399
2251 Ga0500592_002541
2252 Ga0500594_0007830
2253 Ga0500618_030349
2254 Ga0500642_0069549
2255 Ga0500652_000308
2256 Ga0500655_032263
2257 Ga0500658_0043021
2258 Ga0500658_0162204
2259 Ga0500559_0027141
2260 Ga0500561_0098936
2261 Ga0500568_0001108
2262 Ga0500568_0002973
2263 Ga0500588_0026501
2264 Ga0500589_144075
2265 Ga0500603_264010
2266 Ga0500604_0001327
2267 Ga0500616_0000041
2268 Ga0500622_0002439
2269 Ga0500627_0027269
2270 Ga0500633_0164550
2271 Ga0500636_0006978
2272 Ga0500637_0324071
2273 Ga0500570_068096
2274 Ga0500611_020368
2275 Ga0500645_049728
2276 Ga0500645_141472
2277 Ga0500645_172834
2278 Ga0500656_064851
2279 Ga0501084_0256827
2280 Ga0501084_0305024
2281 Ga0590075_102911
2282 Ga0587073_0070410
2283 Ga0587073_0089077
2284 Ga0587073_0147584
2285 Ga0587073_0183640
2286 Ga0587077_090800
2287 Ga0587080_064058
2288 Ga0587082_073584
2289 Ga0587082_084638
2290 Ga0587088_137651
2291 Ga0587129_011806
2292 Ga0587072_094761
2293 Ga0501082_0043509
2294 Ga0501082_0169930
2295 Ga0501082_1428585
2296 Ga0530510_0080336
2297 2513673199
2298 2513695404
2299 2603860801
2300 2644289600
2301 2738744710
2302 2739353940
2303 2857524756
2304 2874612225
2305 2889042007
2306 2893069277
2307 2902411331
2308 2919078640
2309 2922386792
2310 8001848798
2311 8006964993
2312 8006988641

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05974

DUF892

Domain of unknown function (DUF892)

44

201

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gyq-assembly1.cif.gz_B ycfi, a putative structural protein from rhodopseudomonas palustris. 0.9781 4 155
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9666 7 158
4eru-assembly1.cif.gz_B crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica 0.9657 6 158
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.9549 8 163
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9424 7 158
ID Description Score Start End Superfamily
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9782 4 155 1.20.1260.10
4eruA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9573 6 158 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9507 1 161 1.20.1260.10
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9414 4 155 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9393 1 161 1.20.1260.10
ID Description Score Start End GO Terms
AF-J6IXS8-F1-model_v4 Uncharacterized protein 0.9963 12 166
AF-A0A531KI21-F1-model_v4 Ferritin-like domain-containing protein 0.9963 34 166
AF-A0A2V8EWJ5-F1-model_v4 Ferritin-like domain-containing protein 0.9961 6 166
AF-A0A8B2P258-F1-model_v4 Ferritin-like metal-binding protein YciE 0.9955 8 166
AF-A0A1I7NHL4-F1-model_v4 Ferritin-like metal-binding protein YciE 0.9952 8 166

Map