F490950
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1156 | 677 | 2312 | 203 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2885312484|2885317772 |
| Length | 226 |
| Sequence | KHIEDKPHIEDKPHIEDGPHIEDGPINDRDEERHRAKMAKRKAVQDAEVAAKTVEKGLLIVNTGPGKGKTTAAFGLALRMLGYGKCVGVVQFIKGKWHTGEKDAFAVFGDRVVWHTMGEGFTWETQDLKRDIAAAEAAWAKALELMADPSISLLVLDELNIALRYDYLDLDKVVAALKGRREGLHVVVTGRNAKPALVDAADLVTEMGVTKHHFSAGVKAQQGIEF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 133 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 134 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 254 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 255 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 256 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 336 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 391 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 393 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 396 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 397 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 398 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 399 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 400 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 401 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 402 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 403 | 2512875024 | |||
| 404 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 405 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 406 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 407 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 408 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 409 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 410 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 411 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 412 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 413 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 414 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 415 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 416 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 417 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 418 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 419 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 420 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 421 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 422 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 423 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 424 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 425 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 426 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 427 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 428 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 429 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 430 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 431 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 432 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 433 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 434 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 435 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 436 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 437 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 438 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 439 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 440 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 441 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 442 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 443 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 444 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 445 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 446 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 447 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 448 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 449 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 450 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 451 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 452 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 453 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 454 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 455 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 456 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 457 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 458 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 459 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 460 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 461 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 462 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 463 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 464 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 465 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 466 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 467 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 468 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 469 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 470 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 471 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 472 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 473 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 474 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 475 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 476 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 477 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 478 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 479 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 480 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 481 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 482 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 483 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 484 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 485 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 486 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 487 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 488 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 489 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 490 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 491 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 492 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 493 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 494 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 495 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 496 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 497 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 498 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 499 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 500 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 501 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 502 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 503 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 504 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 505 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 506 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 507 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 508 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 509 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 510 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 511 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 512 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 513 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 514 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 515 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 516 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 517 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 518 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 519 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 520 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 521 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 522 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 523 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 524 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 525 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 526 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 527 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 528 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 529 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 530 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 531 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 532 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 533 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 534 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 535 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 536 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 537 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 538 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 539 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 540 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 541 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 542 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 543 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 544 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 545 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 546 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 547 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 548 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 549 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 550 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 551 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 552 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 553 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 554 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 555 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 556 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 557 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 558 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 559 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 560 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 561 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 562 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 563 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 564 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 565 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 566 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 567 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 568 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 569 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 570 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 571 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 572 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 573 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 574 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 575 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 576 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 577 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 578 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 579 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 580 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 581 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 582 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 583 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 584 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 585 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 586 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 587 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 588 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 589 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 590 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 591 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 592 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 593 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 594 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 595 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 596 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 597 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 598 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 599 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 600 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 601 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 602 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 603 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 604 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 605 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 606 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 607 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 608 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 609 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 610 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 611 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 612 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 613 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 614 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 615 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 616 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 617 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 618 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 619 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 620 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 621 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 622 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 623 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 624 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 625 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 626 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 627 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 628 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 629 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 630 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 631 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 632 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 633 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 634 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 635 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 636 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 637 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 638 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 639 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 640 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 641 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 642 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 643 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 644 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 645 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 646 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 647 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 648 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 649 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 650 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 651 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 652 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 653 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 654 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 655 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 656 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 657 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 658 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 659 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 660 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 661 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 662 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 663 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 664 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 665 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 666 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 667 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 668 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 669 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 670 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 671 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 672 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 673 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 674 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 675 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 676 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 677 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.26 |
| Metatranscriptomes | 0.26 |
| Isolates | 24.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.84 |
| Nodule | 21.19 |
| Rhizoplane | 7.44 |
| Rhizosphere | 60.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10050467 | 3300001989 | Bacteria | 1345 |
| 2 | JGI24750J21931_1000910 | 3300002070 | Bacteria | 4007 |
| 3 | JGI24738J21930_10043045 | 3300002075 | Bacteria | 918 |
| 4 | JGI24742J22300_10017176 | 3300002244 | Bacteria | 1223 |
| 5 | JGI25156J39149_1013582 | 3300002705 | Bacteria | 1720 |
| 6 | JGI25157J39369_1000997 | 3300002741 | Bacteria | 13180 |
| 7 | JGI25406J46586_10139439 | 3300003203 | Bacteria | 710 |
| 8 | JGI25165J46597_1000169 | 3300003214 | Bacteria | 103007 |
| 9 | Ga0055542_1000200 | 3300003762 | Bacteria | 73349 |
| 10 | JGI25405J52794_10002905 | 3300003911 | Bacteria | 2983 |
| 11 | Ga0070676_10196879 | 3300005328 | Bacteria | 1319 |
| 12 | Ga0070670_100008924 | 3300005331 | Bacteria | 8561 |
| 13 | Ga0070670_100026922 | 3300005331 | Bacteria | 4946 |
| 14 | Ga0068869_100020500 | 3300005334 | Bacteria | 4533 |
| 15 | Ga0070680_100033129 | 3300005336 | Bacteria | 4162 |
| 16 | Ga0070680_100339604 | 3300005336 | Bacteria | 1276 |
| 17 | Ga0070682_100017788 | 3300005337 | Bacteria | 4146 |
| 18 | Ga0070682_100039512 | 3300005337 | Bacteria | 2900 |
| 19 | Ga0068868_100020483 | 3300005338 | Bacteria | 4971 |
| 20 | Ga0070660_100055566 | 3300005339 | Bacteria | 3060 |
| 21 | Ga0070660_100112319 | 3300005339 | Bacteria | 2169 |
| 22 | Ga0070660_100112987 | 3300005339 | Bacteria | 2162 |
| 23 | Ga0070689_100009010 | 3300005340 | Bacteria | 7065 |
| 24 | Ga0070689_100164065 | 3300005340 | Bacteria | 1797 |
| 25 | Ga0070691_10070081 | 3300005341 | Bacteria | 1700 |
| 26 | Ga0070687_100023504 | 3300005343 | Bacteria | 2930 |
| 27 | Ga0070661_100152449 | 3300005344 | Bacteria | 1748 |
| 28 | Ga0070692_10272221 | 3300005345 | Bacteria | 1023 |
| 29 | Ga0070668_100022994 | 3300005347 | Bacteria | 4712 |
| 30 | Ga0070669_100028839 | 3300005353 | Bacteria | 3997 |
| 31 | Ga0070675_100038027 | 3300005354 | Bacteria | 3921 |
| 32 | Ga0070671_100005178 | 3300005355 | Bacteria | 10386 |
| 33 | Ga0070671_100115795 | 3300005355 | Bacteria | 2254 |
| 34 | Ga0070671_100475128 | 3300005355 | Bacteria | 1074 |
| 35 | Ga0070674_100134885 | 3300005356 | Bacteria | 1845 |
| 36 | Ga0070674_100524366 | 3300005356 | Bacteria | 990 |
| 37 | Ga0070673_100002387 | 3300005364 | Bacteria | 11434 |
| 38 | Ga0070673_100017217 | 3300005364 | Bacteria | 5132 |
| 39 | Ga0070688_100090372 | 3300005365 | Bacteria | 2000 |
| 40 | Ga0070688_100203639 | 3300005365 | Bacteria | 1386 |
| 41 | Ga0070688_100225450 | 3300005365 | Bacteria | 1323 |
| 42 | Ga0070659_100015263 | 3300005366 | Bacteria | 5750 |
| 43 | Ga0070659_100470197 | 3300005366 | Bacteria | 1069 |
| 44 | Ga0070667_100022104 | 3300005367 | Bacteria | 5276 |
| 45 | Ga0070709_10225004 | 3300005434 | Bacteria | 1340 |
| 46 | Ga0070709_10294912 | 3300005434 | Bacteria | 1183 |
| 47 | Ga0070714_100006761 | 3300005435 | Bacteria | 8889 |
| 48 | Ga0070714_100014915 | 3300005435 | Bacteria | 6247 |
| 49 | Ga0070714_100072142 | 3300005435 | Bacteria | 2988 |
| 50 | Ga0070713_100035633 | 3300005436 | Bacteria | 4008 |
| 51 | Ga0070701_10022341 | 3300005438 | Bacteria | 3031 |
| 52 | Ga0070711_100017659 | 3300005439 | Bacteria | 4545 |
| 53 | Ga0070711_100019153 | 3300005439 | Bacteria | 4386 |
| 54 | Ga0070711_100028014 | 3300005439 | Bacteria | 3703 |
| 55 | Ga0070711_100042386 | 3300005439 | Bacteria | 3076 |
| 56 | Ga0070705_100087853 | 3300005440 | Bacteria | 1928 |
| 57 | Ga0070700_100013506 | 3300005441 | Bacteria | 4587 |
| 58 | Ga0070700_100448341 | 3300005441 | Bacteria | 981 |
| 59 | Ga0070694_100110768 | 3300005444 | Bacteria | 1955 |
| 60 | Ga0070663_100007259 | 3300005455 | Bacteria | 6736 |
| 61 | Ga0070663_101021231 | 3300005455 | Bacteria | 720 |
| 62 | Ga0070678_100076361 | 3300005456 | Bacteria | 2523 |
| 63 | Ga0070678_100251956 | 3300005456 | Bacteria | 1481 |
| 64 | Ga0070662_100030696 | 3300005457 | Bacteria | 3764 |
| 65 | Ga0070681_10019614 | 3300005458 | Bacteria | 6771 |
| 66 | Ga0070681_10283365 | 3300005458 | Bacteria | 1568 |
| 67 | Ga0068867_100022577 | 3300005459 | Bacteria | 4498 |
| 68 | Ga0068867_100380669 | 3300005459 | Bacteria | 1185 |
| 69 | Ga0070685_10328632 | 3300005466 | Bacteria | 1039 |
| 70 | Ga0070699_100008041 | 3300005518 | Bacteria | 9156 |
| 71 | Ga0070699_101033580 | 3300005518 | Bacteria | 753 |
| 72 | Ga0070679_100074479 | 3300005530 | Bacteria | 3386 |
| 73 | Ga0070679_100474764 | 3300005530 | Bacteria | 1195 |
| 74 | Ga0070684_100340907 | 3300005535 | Bacteria | 1378 |
| 75 | Ga0068853_100010872 | 3300005539 | Bacteria | 7374 |
| 76 | Ga0068853_100072716 | 3300005539 | Bacteria | 2997 |
| 77 | Ga0068853_100074585 | 3300005539 | Bacteria | 2960 |
| 78 | Ga0068853_100098013 | 3300005539 | Bacteria | 2589 |
| 79 | Ga0070672_100078555 | 3300005543 | Bacteria | 2640 |
| 80 | Ga0070686_100036914 | 3300005544 | Bacteria | 3028 |
| 81 | Ga0070695_100177699 | 3300005545 | Bacteria | 1506 |
| 82 | Ga0070695_100603673 | 3300005545 | Bacteria | 862 |
| 83 | Ga0070696_100017390 | 3300005546 | Bacteria | 4852 |
| 84 | Ga0070693_100068212 | 3300005547 | Bacteria | 2087 |
| 85 | Ga0070665_100058543 | 3300005548 | Bacteria | 3862 |
| 86 | Ga0070665_100128896 | 3300005548 | Bacteria | 2532 |
| 87 | Ga0070665_100802197 | 3300005548 | Bacteria | 954 |
| 88 | Ga0070704_100414052 | 3300005549 | Bacteria | 1153 |
| 89 | Ga0068855_100430715 | 3300005563 | Bacteria | 1442 |
| 90 | Ga0070664_100228552 | 3300005564 | Bacteria | 1667 |
| 91 | Ga0068857_100039612 | 3300005577 | Bacteria | 4175 |
| 92 | Ga0068857_100050634 | 3300005577 | Bacteria | 3684 |
| 93 | Ga0068857_100294103 | 3300005577 | Bacteria | 1496 |
| 94 | Ga0068854_100024038 | 3300005578 | Bacteria | 4168 |
| 95 | Ga0068856_100169242 | 3300005614 | Bacteria | 2197 |
| 96 | Ga0068856_100323279 | 3300005614 | Bacteria | 1560 |
| 97 | Ga0070702_100017784 | 3300005615 | Bacteria | 3674 |
| 98 | Ga0068852_100006835 | 3300005616 | Bacteria | 8285 |
| 99 | Ga0068852_100232270 | 3300005616 | Bacteria | 1759 |
| 100 | Ga0068852_100509272 | 3300005616 | Bacteria | 1200 |
| 101 | Ga0068859_100022244 | 3300005617 | Bacteria | 6357 |
| 102 | Ga0068864_100132570 | 3300005618 | Bacteria | 2240 |
| 103 | Ga0068864_100146200 | 3300005618 | Bacteria | 2137 |
| 104 | Ga0068864_100984487 | 3300005618 | Bacteria | 836 |
| 105 | Ga0068866_10092731 | 3300005718 | Bacteria | 1648 |
| 106 | Ga0068866_10302516 | 3300005718 | Bacteria | 999 |
| 107 | Ga0068861_100016370 | 3300005719 | Bacteria | 5246 |
| 108 | Ga0068870_10009492 | 3300005840 | Bacteria | 4431 |
| 109 | Ga0068870_10228004 | 3300005840 | Bacteria | 1144 |
| 110 | Ga0068863_100050157 | 3300005841 | Bacteria | 3958 |
| 111 | Ga0068863_100763844 | 3300005841 | Bacteria | 963 |
| 112 | Ga0068858_100020908 | 3300005842 | Bacteria | 6115 |
| 113 | Ga0068858_100243165 | 3300005842 | Bacteria | 1708 |
| 114 | Ga0068858_100298745 | 3300005842 | Bacteria | 1536 |
| 115 | Ga0068860_100025571 | 3300005843 | Bacteria | 5694 |
| 116 | Ga0068862_100054011 | 3300005844 | Bacteria | 3439 |
| 117 | Ga0081455_10001749 | 3300005937 | Bacteria | 26266 |
| 118 | Ga0081455_10011262 | 3300005937 | Bacteria | 9000 |
| 119 | Ga0081455_10186942 | 3300005937 | Bacteria | 1564 |
| 120 | Ga0081538_10062190 | 3300005981 | Bacteria | 2131 |
| 121 | Ga0081540_1006291 | 3300005983 | Bacteria | 8690 |
| 122 | Ga0081540_1049962 | 3300005983 | Bacteria | 2081 |
| 123 | Ga0081539_10001319 | 3300005985 | Bacteria | 43381 |
| 124 | Ga0070717_10025952 | 3300006028 | Bacteria | 4670 |
| 125 | Ga0070717_10465328 | 3300006028 | Bacteria | 1141 |
| 126 | Ga0070717_10517758 | 3300006028 | Bacteria | 1079 |
| 127 | Ga0075365_10001839 | 3300006038 | Bacteria | 9944 |
| 128 | Ga0075365_10024392 | 3300006038 | Bacteria | 3815 |
| 129 | Ga0075365_10056680 | 3300006038 | Bacteria | 2605 |
| 130 | Ga0075365_10069203 | 3300006038 | Bacteria | 2372 |
| 131 | Ga0075365_10077631 | 3300006038 | Bacteria | 2244 |
| 132 | Ga0075365_10271995 | 3300006038 | Bacteria | 1192 |
| 133 | Ga0075368_10030186 | 3300006042 | Bacteria | 2098 |
| 134 | Ga0075368_10081338 | 3300006042 | Bacteria | 1318 |
| 135 | Ga0075363_100246617 | 3300006048 | Bacteria | 1028 |
| 136 | Ga0075364_10131305 | 3300006051 | Bacteria | 1681 |
| 137 | Ga0075364_10446615 | 3300006051 | Bacteria | 883 |
| 138 | Ga0075432_10140533 | 3300006058 | Bacteria | 921 |
| 139 | Ga0070715_10021970 | 3300006163 | Bacteria | 2482 |
| 140 | Ga0070715_10069268 | 3300006163 | Bacteria | 1571 |
| 141 | Ga0070715_10239304 | 3300006163 | Bacteria | 943 |
| 142 | Ga0070716_100054170 | 3300006173 | Bacteria | 2290 |
| 143 | Ga0070716_100127551 | 3300006173 | Bacteria | 1603 |
| 144 | Ga0070716_100612329 | 3300006173 | Bacteria | 821 |
| 145 | Ga0070712_100004818 | 3300006175 | Bacteria | 8341 |
| 146 | Ga0070712_100056217 | 3300006175 | Bacteria | 2759 |
| 147 | Ga0070712_100148098 | 3300006175 | Bacteria | 1799 |
| 148 | Ga0070712_100218163 | 3300006175 | Bacteria | 1508 |
| 149 | Ga0070712_100226120 | 3300006175 | Bacteria | 1484 |
| 150 | Ga0070712_100275352 | 3300006175 | Bacteria | 1354 |
| 151 | Ga0075362_10071418 | 3300006177 | Bacteria | 1586 |
| 152 | Ga0075362_10218982 | 3300006177 | Bacteria | 930 |
| 153 | Ga0075367_10055339 | 3300006178 | Bacteria | 2354 |
| 154 | Ga0075367_10079432 | 3300006178 | Bacteria | 1983 |
| 155 | Ga0075367_10132244 | 3300006178 | Bacteria | 1542 |
| 156 | Ga0075367_10252806 | 3300006178 | Bacteria | 1105 |
| 157 | Ga0075369_10010327 | 3300006186 | Bacteria | 3650 |
| 158 | Ga0097621_100194830 | 3300006237 | Bacteria | 1757 |
| 159 | Ga0075370_10078315 | 3300006353 | Bacteria | 1898 |
| 160 | Ga0075370_10092918 | 3300006353 | Bacteria | 1741 |
| 161 | Ga0075370_10146609 | 3300006353 | Bacteria | 1382 |
| 162 | Ga0068871_100083108 | 3300006358 | Bacteria | 2656 |
| 163 | Ga0068871_100090639 | 3300006358 | Bacteria | 2547 |
| 164 | Ga0075428_100049970 | 3300006844 | Bacteria | 4587 |
| 165 | Ga0075428_100178861 | 3300006844 | Bacteria | 2297 |
| 166 | Ga0075428_100232500 | 3300006844 | Bacteria | 1989 |
| 167 | Ga0075430_100158604 | 3300006846 | Bacteria | 1884 |
| 168 | Ga0075431_100012803 | 3300006847 | Bacteria | 8468 |
| 169 | Ga0075431_101006368 | 3300006847 | Bacteria | 800 |
| 170 | Ga0075433_10561867 | 3300006852 | Bacteria | 1003 |
| 171 | Ga0075434_100035343 | 3300006871 | Bacteria | 4940 |
| 172 | Ga0068865_100259370 | 3300006881 | Bacteria | 1375 |
| 173 | Ga0075436_100110197 | 3300006914 | Bacteria | 1921 |
| 174 | Ga0097620_100022244 | 3300006931 | Bacteria | 6357 |
| 175 | Ga0075435_100045163 | 3300007076 | Bacteria | 3531 |
| 176 | Ga0099794_10004120 | 3300007265 | Bacteria | 5664 |
| 177 | Ga0105240_10134618 | 3300009093 | Bacteria | 2960 |
| 178 | Ga0111539_10051134 | 3300009094 | Bacteria | 4923 |
| 179 | Ga0111539_10663176 | 3300009094 | Bacteria | 1215 |
| 180 | Ga0105245_10020549 | 3300009098 | Bacteria | 5790 |
| 181 | Ga0105245_10370007 | 3300009098 | Bacteria | 1425 |
| 182 | Ga0105245_10536480 | 3300009098 | Bacteria | 1190 |
| 183 | Ga0105247_10014879 | 3300009101 | Bacteria | 4665 |
| 184 | Ga0105247_10414251 | 3300009101 | Bacteria | 963 |
| 185 | Ga0114129_10036121 | 3300009147 | Bacteria | 6979 |
| 186 | Ga0114129_10072223 | 3300009147 | Bacteria | 4811 |
| 187 | Ga0114129_11772670 | 3300009147 | Bacteria | 751 |
| 188 | Ga0105243_10024257 | 3300009148 | Bacteria | 4625 |
| 189 | Ga0105243_10170997 | 3300009148 | Bacteria | 1882 |
| 190 | Ga0105243_10879510 | 3300009148 | Bacteria | 890 |
| 191 | Ga0105241_10027136 | 3300009174 | Bacteria | 4263 |
| 192 | Ga0105241_10074374 | 3300009174 | Bacteria | 2646 |
| 193 | Ga0105241_10354466 | 3300009174 | Bacteria | 1275 |
| 194 | Ga0105242_10034422 | 3300009176 | Bacteria | 4060 |
| 195 | Ga0105242_10065974 | 3300009176 | Bacteria | 2988 |
| 196 | Ga0105248_10044999 | 3300009177 | Bacteria | 4949 |
| 197 | Ga0105248_10053841 | 3300009177 | Bacteria | 4514 |
| 198 | Ga0105248_10510321 | 3300009177 | Bacteria | 1356 |
| 199 | Ga0105248_11126076 | 3300009177 | Bacteria | 887 |
| 200 | Ga0105237_10026169 | 3300009545 | Bacteria | 5962 |
| 201 | Ga0105237_10041723 | 3300009545 | Bacteria | 4627 |
| 202 | Ga0105237_10282080 | 3300009545 | Bacteria | 1664 |
| 203 | Ga0105237_10629232 | 3300009545 | Bacteria | 1080 |
| 204 | Ga0105237_10681252 | 3300009545 | Bacteria | 1035 |
| 205 | Ga0105238_10002854 | 3300009551 | Bacteria | 17259 |
| 206 | Ga0105238_10045315 | 3300009551 | Bacteria | 4443 |
| 207 | Ga0105238_10106658 | 3300009551 | Bacteria | 2783 |
| 208 | Ga0105238_10112864 | 3300009551 | Bacteria | 2697 |
| 209 | Ga0105249_10064133 | 3300009553 | Bacteria | 3377 |
| 210 | Ga0099796_10013297 | 3300010159 | Bacteria | 2347 |
| 211 | Ga0105239_10043981 | 3300010375 | Bacteria | 4897 |
| 212 | Ga0105239_10064538 | 3300010375 | Bacteria | 4019 |
| 213 | Ga0105239_10176966 | 3300010375 | Bacteria | 2386 |
| 214 | Ga0105239_10647177 | 3300010375 | Bacteria | 1207 |
| 215 | Ga0105239_10822845 | 3300010375 | Bacteria | 1064 |
| 216 | Ga0105239_10888456 | 3300010375 | Bacteria | 1023 |
| 217 | Ga0105239_10964561 | 3300010375 | Bacteria | 980 |
| 218 | Ga0105246_10007627 | 3300011119 | Bacteria | 6638 |
| 219 | Ga0105246_10025364 | 3300011119 | Bacteria | 3863 |
| 220 | Ga0157369_10060339 | 3300013105 | Bacteria | 4090 |
| 221 | Ga0157369_10771759 | 3300013105 | Bacteria | 988 |
| 222 | Ga0157374_10015400 | 3300013296 | Bacteria | 6707 |
| 223 | Ga0157374_10095167 | 3300013296 | Bacteria | 2847 |
| 224 | Ga0157378_10424331 | 3300013297 | Bacteria | 1315 |
| 225 | Ga0157378_11206481 | 3300013297 | Bacteria | 796 |
| 226 | Ga0163162_10335844 | 3300013306 | Bacteria | 1643 |
| 227 | Ga0163162_10795342 | 3300013306 | Bacteria | 1063 |
| 228 | Ga0157372_10218214 | 3300013307 | Bacteria | 2211 |
| 229 | Ga0157372_10713687 | 3300013307 | Bacteria | 1167 |
| 230 | Ga0157372_11230711 | 3300013307 | Bacteria | 865 |
| 231 | Ga0157375_10033186 | 3300013308 | Bacteria | 4903 |
| 232 | Ga0157375_10034097 | 3300013308 | Bacteria | 4845 |
| 233 | Ga0157375_10244445 | 3300013308 | Bacteria | 1954 |
| 234 | Ga0157375_10533493 | 3300013308 | Bacteria | 1336 |
| 235 | Ga0157375_10823611 | 3300013308 | Bacteria | 1076 |
| 236 | Ga0163163_10018988 | 3300014325 | Bacteria | 6449 |
| 237 | Ga0163163_10114772 | 3300014325 | Bacteria | 2725 |
| 238 | Ga0163163_10268731 | 3300014325 | Bacteria | 1756 |
| 239 | Ga0157380_10053558 | 3300014326 | Bacteria | 3199 |
| 240 | Ga0182008_10080176 | 3300014497 | Bacteria | 1606 |
| 241 | Ga0182008_10154103 | 3300014497 | Bacteria | 1153 |
| 242 | Ga0157379_10022797 | 3300014968 | Bacteria | 5549 |
| 243 | Ga0157379_10114352 | 3300014968 | Bacteria | 2426 |
| 244 | Ga0157379_10557822 | 3300014968 | Bacteria | 1066 |
| 245 | Ga0157376_10028668 | 3300014969 | Bacteria | 4427 |
| 246 | Ga0157376_10067241 | 3300014969 | Bacteria | 3031 |
| 247 | Ga0182006_1017306 | 3300015261 | Bacteria | 3065 |
| 248 | Ga0163161_10522088 | 3300017792 | Bacteria | 970 |
| 249 | Ga0163161_10734302 | 3300017792 | Bacteria | 825 |
| 250 | Ga0213876_10015925 | 3300021384 | Bacteria | 3978 |
| 251 | Ga0213876_10157131 | 3300021384 | Bacteria | 1210 |
| 252 | Ga0213876_10308927 | 3300021384 | Bacteria | 841 |
| 253 | Ga0213875_10000012 | 3300021388 | Bacteria | 312017 |
| 254 | Ga0213871_10012865 | 3300021441 | Bacteria | 1954 |
| 255 | Ga0224572_1023175 | 3300024225 | Bacteria | 1193 |
| 256 | Ga0224572_1057975 | 3300024225 | Bacteria | 718 |
| 257 | Ga0228598_1010721 | 3300024227 | Bacteria | 1825 |
| 258 | Ga0209026_1000024 | 3300025250 | Bacteria | 355839 |
| 259 | Ga0209148_1000050 | 3300025254 | Bacteria | 413178 |
| 260 | Ga0209759_1000057 | 3300025256 | Bacteria | 205181 |
| 261 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 262 | Ga0209455_1000147 | 3300025272 | Bacteria | 132054 |
| 263 | Ga0209758_1009276 | 3300025297 | Bacteria | 6153 |
| 264 | Ga0207697_10035008 | 3300025315 | Bacteria | 2055 |
| 265 | Ga0207697_10122578 | 3300025315 | Bacteria | 1119 |
| 266 | Ga0207682_10034780 | 3300025893 | Bacteria | 2033 |
| 267 | Ga0207692_10078289 | 3300025898 | Bacteria | 1761 |
| 268 | Ga0207642_10051184 | 3300025899 | Bacteria | 1867 |
| 269 | Ga0207642_10224843 | 3300025899 | Bacteria | 1051 |
| 270 | Ga0207710_10015213 | 3300025900 | Bacteria | 3250 |
| 271 | Ga0207710_10265138 | 3300025900 | Bacteria | 862 |
| 272 | Ga0207688_10025353 | 3300025901 | Bacteria | 3255 |
| 273 | Ga0207647_10005228 | 3300025904 | Bacteria | 9554 |
| 274 | Ga0207647_10010727 | 3300025904 | Bacteria | 6454 |
| 275 | Ga0207647_10339482 | 3300025904 | Bacteria | 851 |
| 276 | Ga0207685_10013814 | 3300025905 | Bacteria | 2509 |
| 277 | Ga0207685_10060984 | 3300025905 | Bacteria | 1494 |
| 278 | Ga0207685_10074828 | 3300025905 | Bacteria | 1384 |
| 279 | Ga0207685_10078215 | 3300025905 | Bacteria | 1361 |
| 280 | Ga0207685_10256895 | 3300025905 | Bacteria | 847 |
| 281 | Ga0207699_10014392 | 3300025906 | Bacteria | 4077 |
| 282 | Ga0207699_10162535 | 3300025906 | Bacteria | 1488 |
| 283 | Ga0207699_10201597 | 3300025906 | Bacteria | 1348 |
| 284 | Ga0207645_10012885 | 3300025907 | Bacteria | 5659 |
| 285 | Ga0207645_10173531 | 3300025907 | Bacteria | 1414 |
| 286 | Ga0207643_10003096 | 3300025908 | Bacteria | 8941 |
| 287 | Ga0207705_10330446 | 3300025909 | Bacteria | 1172 |
| 288 | Ga0207654_10012383 | 3300025911 | Bacteria | 4372 |
| 289 | Ga0207654_10255213 | 3300025911 | Bacteria | 1177 |
| 290 | Ga0207707_10011468 | 3300025912 | Bacteria | 7718 |
| 291 | Ga0207707_10148445 | 3300025912 | Bacteria | 2050 |
| 292 | Ga0207695_10254777 | 3300025913 | Bacteria | 1654 |
| 293 | Ga0207695_10309941 | 3300025913 | Bacteria | 1469 |
| 294 | Ga0207671_10067599 | 3300025914 | Bacteria | 2662 |
| 295 | Ga0207693_10001484 | 3300025915 | Bacteria | 20734 |
| 296 | Ga0207693_10002742 | 3300025915 | Bacteria | 15254 |
| 297 | Ga0207693_10162406 | 3300025915 | Bacteria | 1758 |
| 298 | Ga0207693_10238849 | 3300025915 | Bacteria | 1426 |
| 299 | Ga0207663_10015883 | 3300025916 | Bacteria | 4164 |
| 300 | Ga0207663_10156431 | 3300025916 | Bacteria | 1604 |
| 301 | Ga0207663_10754050 | 3300025916 | Bacteria | 773 |
| 302 | Ga0207660_10056067 | 3300025917 | Bacteria | 2819 |
| 303 | Ga0207657_10062636 | 3300025919 | Bacteria | 3183 |
| 304 | Ga0207657_10095352 | 3300025919 | Bacteria | 2476 |
| 305 | Ga0207657_10377948 | 3300025919 | Bacteria | 1116 |
| 306 | Ga0207657_10780988 | 3300025919 | Bacteria | 739 |
| 307 | Ga0207649_10115358 | 3300025920 | Bacteria | 1802 |
| 308 | Ga0207649_10276410 | 3300025920 | Bacteria | 1219 |
| 309 | Ga0207681_10187187 | 3300025923 | Bacteria | 1581 |
| 310 | Ga0207694_10010089 | 3300025924 | Bacteria | 7118 |
| 311 | Ga0207694_10199190 | 3300025924 | Bacteria | 1629 |
| 312 | Ga0207694_10288861 | 3300025924 | Bacteria | 1348 |
| 313 | Ga0207650_10002963 | 3300025925 | Bacteria | 11718 |
| 314 | Ga0207650_10009740 | 3300025925 | Bacteria | 6571 |
| 315 | Ga0207650_10153897 | 3300025925 | Bacteria | 1817 |
| 316 | Ga0207659_10009295 | 3300025926 | Bacteria | 6137 |
| 317 | Ga0207659_10468502 | 3300025926 | Bacteria | 1063 |
| 318 | Ga0207687_10026158 | 3300025927 | Bacteria | 3907 |
| 319 | Ga0207687_10357472 | 3300025927 | Bacteria | 1191 |
| 320 | Ga0207687_11047360 | 3300025927 | Bacteria | 700 |
| 321 | Ga0207700_10103615 | 3300025928 | Bacteria | 2275 |
| 322 | Ga0207700_10532069 | 3300025928 | Bacteria | 1042 |
| 323 | Ga0207700_10929169 | 3300025928 | Bacteria | 778 |
| 324 | Ga0207664_10052285 | 3300025929 | Bacteria | 3230 |
| 325 | Ga0207664_10103384 | 3300025929 | Bacteria | 2357 |
| 326 | Ga0207644_10007084 | 3300025931 | Bacteria | 7311 |
| 327 | Ga0207644_10015159 | 3300025931 | Bacteria | 5171 |
| 328 | Ga0207644_10205499 | 3300025931 | Bacteria | 1555 |
| 329 | Ga0207690_10038670 | 3300025932 | Bacteria | 3107 |
| 330 | Ga0207690_10055991 | 3300025932 | Bacteria | 2658 |
| 331 | Ga0207690_10385324 | 3300025932 | Bacteria | 1115 |
| 332 | Ga0207706_10009674 | 3300025933 | Bacteria | 8850 |
| 333 | Ga0207706_10392329 | 3300025933 | Bacteria | 1204 |
| 334 | Ga0207686_10213296 | 3300025934 | Bacteria | 1389 |
| 335 | Ga0207709_10083875 | 3300025935 | Bacteria | 2062 |
| 336 | Ga0207709_10793189 | 3300025935 | Bacteria | 764 |
| 337 | Ga0207670_10006644 | 3300025936 | Bacteria | 6432 |
| 338 | Ga0207670_10008195 | 3300025936 | Bacteria | 5883 |
| 339 | Ga0207670_10036710 | 3300025936 | Bacteria | 3189 |
| 340 | Ga0207669_10013106 | 3300025937 | Bacteria | 4104 |
| 341 | Ga0207704_10043058 | 3300025938 | Bacteria | 2662 |
| 342 | Ga0207665_10354136 | 3300025939 | Bacteria | 1109 |
| 343 | Ga0207665_10356243 | 3300025939 | Bacteria | 1105 |
| 344 | Ga0207691_10003971 | 3300025940 | Bacteria | 14363 |
| 345 | Ga0207711_10025426 | 3300025941 | Bacteria | 4969 |
| 346 | Ga0207711_10083554 | 3300025941 | Bacteria | 2793 |
| 347 | Ga0207711_10473478 | 3300025941 | Bacteria | 1167 |
| 348 | Ga0207689_10001884 | 3300025942 | Bacteria | 19842 |
| 349 | Ga0207689_10214342 | 3300025942 | Bacteria | 1591 |
| 350 | Ga0207661_10259695 | 3300025944 | Bacteria | 1547 |
| 351 | Ga0207679_10063594 | 3300025945 | Bacteria | 2755 |
| 352 | Ga0207679_10083748 | 3300025945 | Bacteria | 2445 |
| 353 | Ga0207679_10222495 | 3300025945 | Bacteria | 1589 |
| 354 | Ga0207667_10164319 | 3300025949 | Bacteria | 2282 |
| 355 | Ga0207667_10374665 | 3300025949 | Bacteria | 1450 |
| 356 | Ga0207651_10003503 | 3300025960 | Bacteria | 7716 |
| 357 | Ga0207651_10005442 | 3300025960 | Bacteria | 6536 |
| 358 | Ga0207712_10122487 | 3300025961 | Bacteria | 1970 |
| 359 | Ga0207668_10033695 | 3300025972 | Bacteria | 3394 |
| 360 | Ga0207668_10310866 | 3300025972 | Bacteria | 1304 |
| 361 | Ga0207668_10438777 | 3300025972 | Bacteria | 1112 |
| 362 | Ga0207640_10047119 | 3300025981 | Bacteria | 2778 |
| 363 | Ga0207640_11048000 | 3300025981 | Bacteria | 719 |
| 364 | Ga0207658_10052929 | 3300025986 | Bacteria | 2997 |
| 365 | Ga0207658_10307058 | 3300025986 | Bacteria | 1369 |
| 366 | Ga0207658_10380210 | 3300025986 | Bacteria | 1237 |
| 367 | Ga0207658_11233913 | 3300025986 | Bacteria | 684 |
| 368 | Ga0207677_10107247 | 3300026023 | Bacteria | 2071 |
| 369 | Ga0207703_10012529 | 3300026035 | Bacteria | 6609 |
| 370 | Ga0207703_10236678 | 3300026035 | Bacteria | 1640 |
| 371 | Ga0207703_10572259 | 3300026035 | Bacteria | 1067 |
| 372 | Ga0207639_10024726 | 3300026041 | Bacteria | 4351 |
| 373 | Ga0207639_10449794 | 3300026041 | Bacteria | 1169 |
| 374 | Ga0207639_10699591 | 3300026041 | Bacteria | 940 |
| 375 | Ga0207678_10000114 | 3300026067 | Bacteria | 66223 |
| 376 | Ga0207678_10088790 | 3300026067 | Bacteria | 2642 |
| 377 | Ga0207708_10028546 | 3300026075 | Bacteria | 4225 |
| 378 | Ga0207708_10368305 | 3300026075 | Bacteria | 1182 |
| 379 | Ga0207702_10226090 | 3300026078 | Bacteria | 1746 |
| 380 | Ga0207702_10250892 | 3300026078 | Bacteria | 1662 |
| 381 | Ga0207641_10037528 | 3300026088 | Bacteria | 4047 |
| 382 | Ga0207641_10696710 | 3300026088 | Bacteria | 1000 |
| 383 | Ga0207648_10003613 | 3300026089 | Bacteria | 16172 |
| 384 | Ga0207648_10168303 | 3300026089 | Bacteria | 1937 |
| 385 | Ga0207676_10037967 | 3300026095 | Bacteria | 3674 |
| 386 | Ga0207676_10187741 | 3300026095 | Bacteria | 1816 |
| 387 | Ga0207676_10269817 | 3300026095 | Bacteria | 1540 |
| 388 | Ga0207674_10017777 | 3300026116 | Bacteria | 7751 |
| 389 | Ga0207674_10087226 | 3300026116 | Bacteria | 3115 |
| 390 | Ga0207674_10120939 | 3300026116 | Bacteria | 2586 |
| 391 | Ga0207675_100014341 | 3300026118 | Bacteria | 7389 |
| 392 | Ga0207675_100917457 | 3300026118 | Bacteria | 892 |
| 393 | Ga0207683_10009784 | 3300026121 | Bacteria | 8173 |
| 394 | Ga0207683_10027474 | 3300026121 | Bacteria | 4917 |
| 395 | Ga0207698_10059041 | 3300026142 | Bacteria | 2976 |
| 396 | Ga0207698_10351662 | 3300026142 | Bacteria | 1392 |
| 397 | Ga0209179_1021607 | 3300027512 | Bacteria | 1257 |
| 398 | Ga0209813_10045297 | 3300027866 | Bacteria | 1355 |
| 399 | Ga0207428_10179758 | 3300027907 | Bacteria | 1599 |
| 400 | Ga0265357_1000569 | 3300028023 | Bacteria | 2241 |
| 401 | Ga0268266_10012797 | 3300028379 | Bacteria | 7248 |
| 402 | Ga0268266_10054805 | 3300028379 | Bacteria | 3427 |
| 403 | Ga0268266_10306317 | 3300028379 | Bacteria | 1483 |
| 404 | Ga0268265_10233343 | 3300028380 | Bacteria | 1618 |
| 405 | Ga0268264_10015832 | 3300028381 | Bacteria | 6175 |
| 406 | Ga0265762_1075661 | 3300030760 | Bacteria | 714 |
| 407 | Ga0265773_1001072 | 3300031018 | Bacteria | 1369 |
| 408 | Ga0265760_10170059 | 3300031090 | Bacteria | 723 |
| 409 | Ga0265332_10000592 | 3300031238 | Bacteria | 23812 |
| 410 | Ga0265329_10008897 | 3300031242 | Bacteria | 3781 |
| 411 | Ga0265340_10007268 | 3300031247 | Bacteria | 6022 |
| 412 | Ga0265339_10001715 | 3300031249 | Bacteria | 16151 |
| 413 | Ga0265331_10009132 | 3300031250 | Bacteria | 5595 |
| 414 | Ga0307513_10048573 | 3300031456 | Bacteria | 4605 |
| 415 | Ga0265313_10069555 | 3300031595 | Bacteria | 1624 |
| 416 | Ga0265342_10000116 | 3300031712 | Bacteria | 87805 |
| 417 | Ga0307405_10327522 | 3300031731 | Bacteria | 1173 |
| 418 | Ga0373930_0003794 | 3300034816 | Bacteria | 2423 |
| 419 | Ga0373938_0061441 | 3300034957 | Bacteria | 880 |
| 420 | Ga0373926_0166397 | 3300035083 | Bacteria | 843 |
| 421 | Ga0373929_0029226 | 3300035085 | Bacteria | 1168 |
| 422 | Ga0373934_0036930 | 3300035086 | Bacteria | 1924 |
| 423 | Ga0373934_0055431 | 3300035086 | Bacteria | 1575 |
| 424 | Ga0373940_0023298 | 3300035088 | Bacteria | 1597 |
| 425 | Ga0373949_0019950 | 3300035090 | Bacteria | 1531 |
| 426 | Ga0373923_0000186 | 3300035111 | Bacteria | 12562 |
| 427 | Ga0373923_0129768 | 3300035111 | Bacteria | 1132 |
| 428 | Ga0373936_0016342 | 3300035113 | Bacteria | 2855 |
| 429 | Ga0373936_0053012 | 3300035113 | Bacteria | 1644 |
| 430 | Ga0373936_0107799 | 3300035113 | Bacteria | 1180 |
| 431 | Ga0373936_0246278 | 3300035113 | Bacteria | 797 |
| 432 | Ga0373939_0018875 | 3300035114 | Bacteria | 1854 |
| 433 | Ga0373945_0137623 | 3300035116 | Bacteria | 983 |
| 434 | Ga0373953_0011844 | 3300035117 | Bacteria | 3073 |
| 435 | Ga0373953_0018792 | 3300035117 | Bacteria | 2562 |
| 436 | Ga0373953_0093923 | 3300035117 | Bacteria | 1257 |
| 437 | Ga0373954_0008300 | 3300035118 | Bacteria | 4557 |
| 438 | Ga0373956_0046593 | 3300035119 | Bacteria | 1938 |
| 439 | Ga0373956_0095422 | 3300035119 | Bacteria | 1375 |
| 440 | Ga0373960_0015866 | 3300035121 | Bacteria | 1929 |
| 441 | Ga0373943_0071731 | 3300035170 | Bacteria | 1755 |
| 442 | Ga0373943_0494382 | 3300035170 | Bacteria | 714 |
| 443 | Ga0373946_0044720 | 3300035171 | Bacteria | 1829 |
| 444 | Ga0373955_0003215 | 3300035172 | Bacteria | 7158 |
| 445 | Ga0373955_0400129 | 3300035172 | Bacteria | 834 |
| 446 | Ga0373955_0417070 | 3300035172 | Bacteria | 816 |
| 447 | Ga0373924_0005086 | 3300035410 | Bacteria | 4635 |
| 448 | Ga0373924_0017966 | 3300035410 | Bacteria | 2720 |
| 449 | Ga0373924_0040202 | 3300035410 | Bacteria | 1913 |
| 450 | Ga0373924_0057140 | 3300035410 | Bacteria | 1627 |
| 451 | Ga0373924_0098036 | 3300035410 | Bacteria | 1259 |
| 452 | Ga0373931_0063588 | 3300035691 | Bacteria | 1995 |
| 453 | Ga0373931_0070201 | 3300035691 | Bacteria | 1910 |
| 454 | Ga0373931_0110931 | 3300035691 | Bacteria | 1556 |
| 455 | Ga0373935_0001959 | 3300035692 | Bacteria | 11590 |
| 456 | Ga0373935_0005867 | 3300035692 | Bacteria | 7275 |
| 457 | Ga0373935_0097259 | 3300035692 | Bacteria | 1936 |
| 458 | Ga0373935_0130725 | 3300035692 | Bacteria | 1687 |
| 459 | Ga0373935_0202041 | 3300035692 | Bacteria | 1373 |
| 460 | Ga0373935_0288881 | 3300035692 | Bacteria | 1156 |
| 461 | Ga0373935_0355931 | 3300035692 | Bacteria | 1044 |
| 462 | Ga0373935_0451083 | 3300035692 | Bacteria | 929 |
| 463 | Ga0373935_0504630 | 3300035692 | Bacteria | 878 |
| 464 | Ga0373927_0015698 | 3300035695 | Bacteria | 5002 |
| 465 | Ga0373927_0023606 | 3300035695 | Bacteria | 4026 |
| 466 | Ga0373927_0063346 | 3300035695 | Bacteria | 2391 |
| 467 | Ga0373927_0118559 | 3300035695 | Bacteria | 1727 |
| 468 | Ga0373927_0162990 | 3300035695 | Bacteria | 1461 |
| 469 | Ga0373933_0002179 | 3300035724 | Bacteria | 11217 |
| 470 | Ga0373933_0002211 | 3300035724 | Bacteria | 11103 |
| 471 | Ga0373933_0031590 | 3300035724 | Bacteria | 3072 |
| 472 | Ga0373933_0101391 | 3300035724 | Bacteria | 1786 |
| 473 | Ga0373947_0002362 | 3300035725 | Bacteria | 11399 |
| 474 | Ga0373947_0027690 | 3300035725 | Bacteria | 3318 |
| 475 | Ga0373947_0051532 | 3300035725 | Bacteria | 2476 |
| 476 | Ga0373947_0055899 | 3300035725 | Bacteria | 2385 |
| 477 | Ga0373947_0167396 | 3300035725 | Bacteria | 1424 |
| 478 | Ga0373947_0612285 | 3300035725 | Bacteria | 742 |
| 479 | Ga0373937_0000041 | 3300036401 | Bacteria | 108866 |
| 480 | Ga0373937_0000765 | 3300036401 | Bacteria | 27786 |
| 481 | Ga0373937_0003840 | 3300036401 | Bacteria | 12699 |
| 482 | Ga0373937_0005787 | 3300036401 | Bacteria | 10629 |
| 483 | Ga0373925_0000793 | 3300037068 | Bacteria | 29112 |
| 484 | Ga0373925_0048603 | 3300037068 | Bacteria | 3161 |
| 485 | Ga0373925_0102482 | 3300037068 | Bacteria | 2202 |
| 486 | Ga0373925_0119993 | 3300037068 | Bacteria | 2041 |
| 487 | Ga0373925_0336041 | 3300037068 | Bacteria | 1224 |
| 488 | Ga0395900_0019120 | 3300037418 | Bacteria | 6985 |
| 489 | Ga0395900_0061732 | 3300037418 | Bacteria | 3853 |
| 490 | Ga0395898_0227185 | 3300037466 | Bacteria | 1780 |
| 491 | Ga0395898_0322217 | 3300037466 | Bacteria | 1474 |
| 492 | Ga0395898_0617648 | 3300037466 | Bacteria | 1027 |
| 493 | Ga0395905_0049568 | 3300037471 | Bacteria | 3935 |
| 494 | Ga0395905_0282703 | 3300037471 | Bacteria | 1545 |
| 495 | Ga0436364_0347683 | 3300037853 | Bacteria | 5933 |
| 496 | Ga0436364_0553890 | 3300037853 | Bacteria | 33608 |
| 497 | Ga0436364_0683938 | 3300037853 | Bacteria | 1052 |
| 498 | Ga0436364_0739297 | 3300037853 | Bacteria | 837 |
| 499 | Ga0436364_1241746 | 3300037853 | Bacteria | 1883 |
| 500 | Ga0436364_1465720 | 3300037853 | Bacteria | 1080 |
| 501 | Ga0436364_1491432 | 3300037853 | Bacteria | 1390 |
| 502 | Ga0395901_0011146 | 3300038443 | Bacteria | 9110 |
| 503 | Ga0395901_0103612 | 3300038443 | Bacteria | 2985 |
| 504 | Ga0395901_0155826 | 3300038443 | Bacteria | 2399 |
| 505 | Ga0395901_0266605 | 3300038443 | Bacteria | 1782 |
| 506 | Ga0436365_0238303 | 3300039437 | Bacteria | 3484 |
| 507 | Ga0436365_0319814 | 3300039437 | Bacteria | 4320 |
| 508 | Ga0436365_0879496 | 3300039437 | Bacteria | 831 |
| 509 | Ga0436365_0899547 | 3300039437 | Bacteria | 1294 |
| 510 | Ga0436365_1529562 | 3300039437 | Bacteria | 1348 |
| 511 | Ga0436360_1334791 | 3300039438 | Bacteria | 1288 |
| 512 | Ga0436362_0706089 | 3300039453 | Bacteria | 980 |
| 513 | Ga0439455_0058449 | 3300042012 | Bacteria | 1019 |
| 514 | Ga0466972_0022440 | 3300044658 | Bacteria | 3144 |
| 515 | Ga0466960_0037172 | 3300044901 | Bacteria | 2283 |
| 516 | Ga0495592_0003368 | 3300046454 | Bacteria | 11447 |
| 517 | Ga0495592_0008877 | 3300046454 | Bacteria | 7549 |
| 518 | Ga0495592_0046621 | 3300046454 | Bacteria | 3230 |
| 519 | Ga0495592_0104615 | 3300046454 | Bacteria | 2012 |
| 520 | Ga0495592_0132975 | 3300046454 | Bacteria | 1738 |
| 521 | Ga0495592_0444990 | 3300046454 | Bacteria | 813 |
| 522 | Ga0495603_0365604 | 3300046455 | Bacteria | 828 |
| 523 | Ga0495603_0405386 | 3300046455 | Bacteria | 781 |
| 524 | Ga0495590_0091075 | 3300046457 | Bacteria | 1079 |
| 525 | Ga0495629_0006715 | 3300046459 | Bacteria | 8508 |
| 526 | Ga0495629_0011756 | 3300046459 | Bacteria | 6352 |
| 527 | Ga0495629_0018879 | 3300046459 | Bacteria | 4928 |
| 528 | Ga0495629_0298998 | 3300046459 | Bacteria | 1102 |
| 529 | Ga0495638_0009008 | 3300046460 | Bacteria | 7035 |
| 530 | Ga0495638_0113930 | 3300046460 | Bacteria | 1604 |
| 531 | Ga0495641_0032701 | 3300046461 | Bacteria | 2474 |
| 532 | Ga0495651_0008706 | 3300046462 | Bacteria | 7788 |
| 533 | Ga0495651_0009661 | 3300046462 | Bacteria | 7417 |
| 534 | Ga0495651_0012317 | 3300046462 | Bacteria | 6593 |
| 535 | Ga0495651_0093756 | 3300046462 | Bacteria | 2247 |
| 536 | Ga0495653_0000646 | 3300046463 | Bacteria | 26579 |
| 537 | Ga0495653_0000993 | 3300046463 | Bacteria | 21848 |
| 538 | Ga0495653_0017117 | 3300046463 | Bacteria | 5897 |
| 539 | Ga0495653_0169725 | 3300046463 | Bacteria | 1507 |
| 540 | Ga0495653_0313116 | 3300046463 | Bacteria | 1020 |
| 541 | Ga0495653_0422124 | 3300046463 | Bacteria | 844 |
| 542 | Ga0495662_0000711 | 3300046476 | Bacteria | 15829 |
| 543 | Ga0495662_0002469 | 3300046476 | Bacteria | 9309 |
| 544 | Ga0495662_0160845 | 3300046476 | Bacteria | 1106 |
| 545 | Ga0495664_0000008 | 3300046477 | Bacteria | 307158 |
| 546 | Ga0495664_0000887 | 3300046477 | Bacteria | 15386 |
| 547 | Ga0495664_0093110 | 3300046477 | Bacteria | 1813 |
| 548 | Ga0495584_0084484 | 3300046491 | Bacteria | 1599 |
| 549 | Ga0495594_0343858 | 3300046499 | Bacteria | 849 |
| 550 | Ga0495607_0223027 | 3300046501 | Bacteria | 921 |
| 551 | Ga0495608_0000226 | 3300046511 | Bacteria | 40663 |
| 552 | Ga0495608_0000752 | 3300046511 | Bacteria | 22646 |
| 553 | Ga0495608_0133229 | 3300046511 | Bacteria | 1589 |
| 554 | Ga0495618_0000826 | 3300046514 | Bacteria | 21563 |
| 555 | Ga0495618_0003138 | 3300046514 | Bacteria | 10388 |
| 556 | Ga0495618_0042615 | 3300046514 | Bacteria | 2861 |
| 557 | Ga0495618_0404693 | 3300046514 | Bacteria | 834 |
| 558 | Ga0495628_0000802 | 3300046516 | Bacteria | 29022 |
| 559 | Ga0495628_0016982 | 3300046516 | Bacteria | 6065 |
| 560 | Ga0495628_0054502 | 3300046516 | Bacteria | 3152 |
| 561 | Ga0495630_0008988 | 3300046517 | Bacteria | 7175 |
| 562 | Ga0495630_0082128 | 3300046517 | Bacteria | 2432 |
| 563 | Ga0495630_0086103 | 3300046517 | Bacteria | 2373 |
| 564 | Ga0495630_0164829 | 3300046517 | Bacteria | 1687 |
| 565 | Ga0495630_0210305 | 3300046517 | Bacteria | 1485 |
| 566 | Ga0495630_0223728 | 3300046517 | Bacteria | 1437 |
| 567 | Ga0495630_0365337 | 3300046517 | Bacteria | 1105 |
| 568 | Ga0495637_0013652 | 3300046520 | Bacteria | 3851 |
| 569 | Ga0495663_0219220 | 3300046525 | Bacteria | 668 |
| 570 | Ga0495666_0076154 | 3300046526 | Bacteria | 1590 |
| 571 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 572 | Ga0495652_0008781 | 3300046529 | Bacteria | 9199 |
| 573 | Ga0495654_0253131 | 3300046530 | Bacteria | 733 |
| 574 | Ga0495665_0043393 | 3300046531 | Bacteria | 2392 |
| 575 | Ga0495665_0061360 | 3300046531 | Bacteria | 1985 |
| 576 | Ga0495665_0373357 | 3300046531 | Bacteria | 725 |
| 577 | Ga0495640_0000020 | 3300046533 | Bacteria | 116618 |
| 578 | Ga0495640_0005859 | 3300046533 | Bacteria | 9753 |
| 579 | Ga0495640_0042211 | 3300046533 | Bacteria | 3184 |
| 580 | Ga0495640_0282965 | 3300046533 | Bacteria | 1032 |
| 581 | Ga0495586_0008716 | 3300046535 | Bacteria | 5402 |
| 582 | Ga0495587_0000005 | 3300046536 | Bacteria | 358412 |
| 583 | Ga0495587_0008717 | 3300046536 | Bacteria | 6509 |
| 584 | Ga0495587_0293760 | 3300046536 | Bacteria | 909 |
| 585 | Ga0495598_0034691 | 3300046537 | Bacteria | 1440 |
| 586 | Ga0495621_0125722 | 3300046539 | Bacteria | 994 |
| 587 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 588 | Ga0495645_0005621 | 3300046543 | Bacteria | 8626 |
| 589 | Ga0495645_0466340 | 3300046543 | Bacteria | 794 |
| 590 | Ga0495667_0000618 | 3300046559 | Bacteria | 22683 |
| 591 | Ga0495667_0020766 | 3300046559 | Bacteria | 4431 |
| 592 | Ga0495667_0042272 | 3300046559 | Bacteria | 3022 |
| 593 | Ga0495667_0147663 | 3300046559 | Bacteria | 1514 |
| 594 | Ga0495668_0079485 | 3300046616 | Bacteria | 1800 |
| 595 | Ga0495668_0192880 | 3300046616 | Bacteria | 1116 |
| 596 | Ga0495634_0001129 | 3300046642 | Bacteria | 24685 |
| 597 | Ga0495634_0002902 | 3300046642 | Bacteria | 14055 |
| 598 | Ga0495634_0004881 | 3300046642 | Bacteria | 10392 |
| 599 | Ga0495625_0054621 | 3300046660 | Bacteria | 2852 |
| 600 | Ga0495635_0000010 | 3300046663 | Bacteria | 246385 |
| 601 | Ga0495635_0003537 | 3300046663 | Bacteria | 10816 |
| 602 | Ga0495635_0004407 | 3300046663 | Bacteria | 9748 |
| 603 | Ga0495635_0164890 | 3300046663 | Bacteria | 1508 |
| 604 | Ga0495635_0292004 | 3300046663 | Bacteria | 1094 |
| 605 | Ga0495661_0144484 | 3300046665 | Bacteria | 1291 |
| 606 | Ga0495588_0014853 | 3300046674 | Bacteria | 3737 |
| 607 | Ga0495657_0000052 | 3300046675 | Bacteria | 101480 |
| 608 | Ga0495657_0116496 | 3300046675 | Bacteria | 1687 |
| 609 | Ga0495599_0000240 | 3300046678 | Bacteria | 34600 |
| 610 | Ga0495599_0086062 | 3300046678 | Bacteria | 1963 |
| 611 | Ga0495599_0167550 | 3300046678 | Bacteria | 1356 |
| 612 | Ga0495623_0001009 | 3300046679 | Bacteria | 19010 |
| 613 | Ga0495623_0040075 | 3300046679 | Bacteria | 2992 |
| 614 | Ga0495646_0000663 | 3300046680 | Bacteria | 18904 |
| 615 | Ga0495646_0054944 | 3300046680 | Bacteria | 2393 |
| 616 | Ga0495646_0232869 | 3300046680 | Bacteria | 992 |
| 617 | Ga0495647_0019819 | 3300046681 | Bacteria | 2409 |
| 618 | Ga0495647_0071643 | 3300046681 | Bacteria | 1388 |
| 619 | Ga0495658_0023605 | 3300046683 | Bacteria | 3266 |
| 620 | Ga0495613_0010045 | 3300046689 | Bacteria | 7031 |
| 621 | Ga0495613_0031750 | 3300046689 | Bacteria | 3923 |
| 622 | Ga0495613_0538713 | 3300046689 | Bacteria | 782 |
| 623 | Ga0495624_0163530 | 3300046690 | Bacteria | 1359 |
| 624 | Ga0495624_0297992 | 3300046690 | Bacteria | 972 |
| 625 | Ga0495671_0338955 | 3300046692 | Bacteria | 721 |
| 626 | Ga0495649_0209191 | 3300046694 | Bacteria | 1011 |
| 627 | Ga0495589_0202378 | 3300046794 | Bacteria | 937 |
| 628 | Ga0495600_0000016 | 3300046809 | Bacteria | 111762 |
| 629 | Ga0495600_0180299 | 3300046809 | Bacteria | 1361 |
| 630 | Ga0495581_0001818 | 3300047315 | Bacteria | 11939 |
| 631 | Ga0495581_0059483 | 3300047315 | Bacteria | 2208 |
| 632 | Ga0495581_0229004 | 3300047315 | Bacteria | 1087 |
| 633 | Ga0495581_0269454 | 3300047315 | Bacteria | 996 |
| 634 | Ga0495604_0000634 | 3300047317 | Bacteria | 30185 |
| 635 | Ga0495604_0001065 | 3300047317 | Bacteria | 22769 |
| 636 | Ga0495604_0065212 | 3300047317 | Bacteria | 2773 |
| 637 | Ga0495604_0158999 | 3300047317 | Bacteria | 1598 |
| 638 | Ga0495604_0221651 | 3300047317 | Bacteria | 1302 |
| 639 | Ga0495674_0000012 | 3300047319 | Bacteria | 270651 |
| 640 | Ga0495674_0006055 | 3300047319 | Bacteria | 11608 |
| 641 | Ga0495674_0006411 | 3300047319 | Bacteria | 11283 |
| 642 | Ga0495674_0130779 | 3300047319 | Bacteria | 2115 |
| 643 | Ga0495674_0310616 | 3300047319 | Bacteria | 1286 |
| 644 | Ga0495674_0509384 | 3300047319 | Bacteria | 962 |
| 645 | Ga0495676_0119139 | 3300047321 | Bacteria | 1923 |
| 646 | Ga0495680_0001629 | 3300047322 | Bacteria | 23855 |
| 647 | Ga0495680_0009090 | 3300047322 | Bacteria | 8967 |
| 648 | Ga0495680_0045962 | 3300047322 | Bacteria | 3445 |
| 649 | Ga0495675_0002307 | 3300047444 | Bacteria | 11396 |
| 650 | Ga0495675_0007464 | 3300047444 | Bacteria | 6732 |
| 651 | Ga0495684_0001027 | 3300047471 | Bacteria | 22679 |
| 652 | Ga0495684_0002302 | 3300047471 | Bacteria | 15288 |
| 653 | Ga0495684_0016011 | 3300047471 | Bacteria | 5773 |
| 654 | Ga0495684_0079481 | 3300047471 | Bacteria | 2490 |
| 655 | Ga0495684_0352333 | 3300047471 | Bacteria | 1045 |
| 656 | Ga0495684_0470611 | 3300047471 | Bacteria | 869 |
| 657 | Ga0495686_0198233 | 3300047472 | Bacteria | 1154 |
| 658 | Ga0495593_0001783 | 3300047673 | Bacteria | 12753 |
| 659 | Ga0495593_0094449 | 3300047673 | Bacteria | 1538 |
| 660 | Ga0495593_0187771 | 3300047673 | Bacteria | 1040 |
| 661 | Ga0495593_0298058 | 3300047673 | Bacteria | 806 |
| 662 | Ga0495602_0001567 | 3300048088 | Bacteria | 22767 |
| 663 | Ga0495602_0012027 | 3300048088 | Bacteria | 8923 |
| 664 | Ga0495602_0351420 | 3300048088 | Bacteria | 1064 |
| 665 | Ga0495602_0527478 | 3300048088 | Bacteria | 822 |
| 666 | Ga0496100_0007628 | 3300048903 | Bacteria | 5985 |
| 667 | Ga0496100_0099344 | 3300048903 | Bacteria | 2002 |
| 668 | Ga0496100_0187516 | 3300048903 | Bacteria | 1499 |
| 669 | Ga0496100_0262056 | 3300048903 | Bacteria | 1282 |
| 670 | Ga0496100_0367903 | 3300048903 | Bacteria | 1089 |
| 671 | Ga0496100_0848620 | 3300048903 | Bacteria | 716 |
| 672 | Ga0496101_0002917 | 3300048904 | Bacteria | 10515 |
| 673 | Ga0496101_0019876 | 3300048904 | Bacteria | 4592 |
| 674 | Ga0496101_0040185 | 3300048904 | Bacteria | 3331 |
| 675 | Ga0496101_0155419 | 3300048904 | Bacteria | 1752 |
| 676 | Ga0496101_0333014 | 3300048904 | Bacteria | 1192 |
| 677 | Ga0496101_0502176 | 3300048904 | Bacteria | 958 |
| 678 | Ga0496101_0559306 | 3300048904 | Bacteria | 904 |
| 679 | Ga0496101_0661406 | 3300048904 | Bacteria | 825 |
| 680 | Ga0496102_0052231 | 3300048905 | Bacteria | 3723 |
| 681 | Ga0496102_0191607 | 3300048905 | Bacteria | 1927 |
| 682 | Ga0496102_0227289 | 3300048905 | Bacteria | 1759 |
| 683 | Ga0496102_0402564 | 3300048905 | Bacteria | 1287 |
| 684 | Ga0496102_0604478 | 3300048905 | Bacteria | 1020 |
| 685 | Ga0496103_0008526 | 3300048906 | Bacteria | 6090 |
| 686 | Ga0496103_0042248 | 3300048906 | Bacteria | 2804 |
| 687 | Ga0496103_0082896 | 3300048906 | Bacteria | 2018 |
| 688 | Ga0496103_0154006 | 3300048906 | Bacteria | 1473 |
| 689 | Ga0496104_0012127 | 3300048907 | Bacteria | 7740 |
| 690 | Ga0496104_0017672 | 3300048907 | Bacteria | 6500 |
| 691 | Ga0496104_0037881 | 3300048907 | Bacteria | 4509 |
| 692 | Ga0496104_0114326 | 3300048907 | Bacteria | 2588 |
| 693 | Ga0496104_0441268 | 3300048907 | Bacteria | 1213 |
| 694 | Ga0496104_0762000 | 3300048907 | Bacteria | 875 |
| 695 | Ga0496105_0039220 | 3300048908 | Bacteria | 3903 |
| 696 | Ga0496105_0052851 | 3300048908 | Bacteria | 3355 |
| 697 | Ga0496105_0144491 | 3300048908 | Bacteria | 1957 |
| 698 | Ga0496105_0149309 | 3300048908 | Bacteria | 1921 |
| 699 | Ga0496106_0015557 | 3300048909 | Bacteria | 5627 |
| 700 | Ga0496106_0020585 | 3300048909 | Bacteria | 4897 |
| 701 | Ga0496106_0054205 | 3300048909 | Bacteria | 3029 |
| 702 | Ga0496107_0003486 | 3300048910 | Bacteria | 10521 |
| 703 | Ga0496107_0033283 | 3300048910 | Bacteria | 3687 |
| 704 | Ga0496107_0100544 | 3300048910 | Bacteria | 2120 |
| 705 | Ga0496107_0327686 | 3300048910 | Bacteria | 1139 |
| 706 | Ga0496107_0434188 | 3300048910 | Bacteria | 976 |
| 707 | Ga0496108_0001144 | 3300048911 | Bacteria | 20717 |
| 708 | Ga0496108_0041960 | 3300048911 | Bacteria | 3819 |
| 709 | Ga0496108_0183319 | 3300048911 | Bacteria | 1813 |
| 710 | Ga0496108_0275614 | 3300048911 | Bacteria | 1464 |
| 711 | Ga0496108_0588975 | 3300048911 | Bacteria | 969 |
| 712 | Ga0496109_0039235 | 3300048912 | Bacteria | 4285 |
| 713 | Ga0496109_0040330 | 3300048912 | Bacteria | 4228 |
| 714 | Ga0496109_0092525 | 3300048912 | Bacteria | 2797 |
| 715 | Ga0496109_0216645 | 3300048912 | Bacteria | 1800 |
| 716 | Ga0496110_0158579 | 3300048913 | Bacteria | 2051 |
| 717 | Ga0496110_0208332 | 3300048913 | Bacteria | 1777 |
| 718 | Ga0496110_0295488 | 3300048913 | Bacteria | 1475 |
| 719 | Ga0496110_0625265 | 3300048913 | Bacteria | 976 |
| 720 | Ga0496111_0002536 | 3300048914 | Bacteria | 11024 |
| 721 | Ga0496111_0065884 | 3300048914 | Bacteria | 2630 |
| 722 | Ga0496111_0085197 | 3300048914 | Bacteria | 2310 |
| 723 | Ga0496112_0001224 | 3300048915 | Bacteria | 19328 |
| 724 | Ga0496112_0055827 | 3300048915 | Bacteria | 3885 |
| 725 | Ga0496112_0093758 | 3300048915 | Bacteria | 2972 |
| 726 | Ga0496112_0117175 | 3300048915 | Bacteria | 2633 |
| 727 | Ga0496112_0162763 | 3300048915 | Bacteria | 2197 |
| 728 | Ga0496112_0215010 | 3300048915 | Bacteria | 1879 |
| 729 | Ga0496112_0239586 | 3300048915 | Bacteria | 1767 |
| 730 | Ga0496112_0282322 | 3300048915 | Bacteria | 1607 |
| 731 | Ga0496112_0380811 | 3300048915 | Bacteria | 1352 |
| 732 | Ga0496113_0003020 | 3300048916 | Bacteria | 9971 |
| 733 | Ga0496113_0084544 | 3300048916 | Bacteria | 2436 |
| 734 | Ga0496113_0187071 | 3300048916 | Bacteria | 1643 |
| 735 | Ga0496113_0188868 | 3300048916 | Bacteria | 1635 |
| 736 | Ga0496113_0220905 | 3300048916 | Bacteria | 1510 |
| 737 | Ga0496113_0604244 | 3300048916 | Bacteria | 878 |
| 738 | Ga0496113_0726241 | 3300048916 | Bacteria | 792 |
| 739 | Ga0496114_0022995 | 3300048917 | Bacteria | 5081 |
| 740 | Ga0496114_0077004 | 3300048917 | Bacteria | 2811 |
| 741 | Ga0496114_0273533 | 3300048917 | Bacteria | 1488 |
| 742 | Ga0496114_0411623 | 3300048917 | Bacteria | 1197 |
| 743 | Ga0496115_0001274 | 3300048918 | Bacteria | 18022 |
| 744 | Ga0496115_0002540 | 3300048918 | Bacteria | 13126 |
| 745 | Ga0496115_0014554 | 3300048918 | Bacteria | 5954 |
| 746 | Ga0496115_0066601 | 3300048918 | Bacteria | 2911 |
| 747 | Ga0496115_0081735 | 3300048918 | Bacteria | 2631 |
| 748 | Ga0496115_0111402 | 3300048918 | Bacteria | 2248 |
| 749 | Ga0496115_0382915 | 3300048918 | Bacteria | 1144 |
| 750 | Ga0496115_0609617 | 3300048918 | Bacteria | 867 |
| 751 | Ga0496119_0005212 | 3300048922 | Bacteria | 12550 |
| 752 | Ga0496119_0051069 | 3300048922 | Bacteria | 2544 |
| 753 | Ga0496119_0189002 | 3300048922 | Bacteria | 1074 |
| 754 | Ga0496120_0001261 | 3300048923 | Bacteria | 31815 |
| 755 | Ga0496120_0050705 | 3300048923 | Bacteria | 2375 |
| 756 | Ga0496121_0333629 | 3300048924 | Bacteria | 1016 |
| 757 | Ga0496122_0029170 | 3300048925 | Bacteria | 4660 |
| 758 | Ga0496123_0001703 | 3300048926 | Bacteria | 29387 |
| 759 | Ga0496124_0293031 | 3300048927 | Bacteria | 1180 |
| 760 | Ga0496125_0248807 | 3300048928 | Bacteria | 1123 |
| 761 | Ga0496126_0560649 | 3300048929 | Bacteria | 905 |
| 762 | Ga0501031_0143782 | 3300049568 | Bacteria | 1558 |
| 763 | Ga0501032_0000786 | 3300049569 | Bacteria | 25679 |
| 764 | Ga0501032_0002130 | 3300049569 | Bacteria | 15598 |
| 765 | Ga0501033_0000197 | 3300049570 | Bacteria | 57691 |
| 766 | Ga0501033_0008439 | 3300049570 | Bacteria | 7978 |
| 767 | Ga0501033_0188276 | 3300049570 | Bacteria | 1478 |
| 768 | Ga0501033_0326363 | 3300049570 | Bacteria | 1078 |
| 769 | Ga0501034_0000031 | 3300049571 | Bacteria | 244022 |
| 770 | Ga0501034_0000901 | 3300049571 | Bacteria | 43252 |
| 771 | Ga0501034_0375642 | 3300049571 | Bacteria | 1347 |
| 772 | Ga0501034_0758487 | 3300049571 | Bacteria | 865 |
| 773 | Ga0501036_0001200 | 3300049572 | Bacteria | 19770 |
| 774 | Ga0501036_0133594 | 3300049572 | Bacteria | 2094 |
| 775 | Ga0501037_0000067 | 3300049573 | Bacteria | 96388 |
| 776 | Ga0501037_0004427 | 3300049573 | Bacteria | 10202 |
| 777 | Ga0501038_0000013 | 3300049574 | Bacteria | 167219 |
| 778 | Ga0501038_0079083 | 3300049574 | Bacteria | 2774 |
| 779 | Ga0501039_0000010 | 3300049575 | Bacteria | 247832 |
| 780 | Ga0501039_0000484 | 3300049575 | Bacteria | 28767 |
| 781 | Ga0501039_0117158 | 3300049575 | Bacteria | 2086 |
| 782 | Ga0501040_0067518 | 3300049576 | Bacteria | 2465 |
| 783 | Ga0501040_0159089 | 3300049576 | Bacteria | 1596 |
| 784 | Ga0501042_0080180 | 3300049578 | Bacteria | 2339 |
| 785 | Ga0501043_0000056 | 3300049579 | Bacteria | 104302 |
| 786 | Ga0501043_0196791 | 3300049579 | Bacteria | 1565 |
| 787 | Ga0501046_0009800 | 3300049580 | Bacteria | 8259 |
| 788 | Ga0501046_0010748 | 3300049580 | Bacteria | 7851 |
| 789 | Ga0501046_0105022 | 3300049580 | Bacteria | 2164 |
| 790 | Ga0501046_0110475 | 3300049580 | Bacteria | 2101 |
| 791 | Ga0501047_0000201 | 3300049581 | Bacteria | 72425 |
| 792 | Ga0501047_0002957 | 3300049581 | Bacteria | 16104 |
| 793 | Ga0501047_0060095 | 3300049581 | Bacteria | 3669 |
| 794 | Ga0501047_0192302 | 3300049581 | Bacteria | 1903 |
| 795 | Ga0501047_0552932 | 3300049581 | Bacteria | 975 |
| 796 | Ga0501067_0006710 | 3300049583 | Bacteria | 6388 |
| 797 | Ga0501067_0115095 | 3300049583 | Bacteria | 1495 |
| 798 | Ga0501067_0316488 | 3300049583 | Bacteria | 869 |
| 799 | Ga0501070_0103833 | 3300049586 | Bacteria | 2350 |
| 800 | Ga0501072_0227288 | 3300049588 | Bacteria | 1487 |
| 801 | Ga0501073_0029178 | 3300049589 | Bacteria | 3942 |
| 802 | Ga0501076_0497229 | 3300049592 | Bacteria | 1005 |
| 803 | Ga0501079_0334446 | 3300049741 | Bacteria | 1186 |
| 804 | Ga0501080_0010630 | 3300049742 | Bacteria | 8427 |
| 805 | Ga0501081_0195297 | 3300049743 | Bacteria | 1466 |
| 806 | Ga0501035_0000063 | 3300049822 | Bacteria | 131515 |
| 807 | Ga0501035_0000077 | 3300049822 | Bacteria | 121242 |
| 808 | Ga0501035_0076885 | 3300049822 | Bacteria | 2951 |
| 809 | Ga0501044_0000013 | 3300049823 | Bacteria | 248795 |
| 810 | Ga0501044_0014303 | 3300049823 | Bacteria | 8567 |
| 811 | Ga0501045_0120384 | 3300049824 | Bacteria | 1949 |
| 812 | nmdc:mga03683_31654_c1 | 3300050489 | Bacteria | 2123 |
| 813 | nmdc:mga03683_81543_c1 | 3300050489 | Bacteria | 1397 |
| 814 | nmdc:mga03n38_212451_c1 | 3300050490 | Bacteria | 1006 |
| 815 | nmdc:mga00v17_39039_c1 | 3300050491 | Bacteria | 2841 |
| 816 | nmdc:mga0yw44_14764_c1 | 3300050492 | Bacteria | 4159 |
| 817 | nmdc:mga0yw44_15868_c1 | 3300050492 | Bacteria | 4051 |
| 818 | nmdc:mga0yw44_30670_c1 | 3300050492 | Bacteria | 3119 |
| 819 | nmdc:mga0yw44_53547_c1 | 3300050492 | Bacteria | 2451 |
| 820 | nmdc:mga0yw44_53830_c1 | 3300050492 | Bacteria | 2445 |
| 821 | nmdc:mga0yw44_92949_c1 | 3300050492 | Bacteria | 1910 |
| 822 | nmdc:mga06z11_162363_c1 | 3300050494 | Bacteria | 1278 |
| 823 | nmdc:mga06z11_163130_c1 | 3300050494 | Bacteria | 1275 |
| 824 | nmdc:mga06z11_39131_c1 | 3300050494 | Bacteria | 2358 |
| 825 | nmdc:mga04h51_98244_c1 | 3300050495 | Bacteria | 1064 |
| 826 | nmdc:mga07m45_73582_c1 | 3300050496 | Bacteria | 1945 |
| 827 | nmdc:mga05p37_42032_c1 | 3300050507 | Bacteria | 5615 |
| 828 | nmdc:mga05p37_59076_c1 | 3300050507 | Bacteria | 4723 |
| 829 | nmdc:mga0qj67_25436_c1 | 3300050509 | Bacteria | 4574 |
| 830 | nmdc:mga06r32_166724_c1 | 3300050510 | Bacteria | 2186 |
| 831 | nmdc:mga06r32_557138_c1 | 3300050510 | Bacteria | 1120 |
| 832 | nmdc:mga08y16_119655_c1 | 3300050511 | Bacteria | 2741 |
| 833 | nmdc:mga08y16_557856_c1 | 3300050511 | Bacteria | 1158 |
| 834 | nmdc:mga08y16_67679_c1 | 3300050511 | Bacteria | 3725 |
| 835 | nmdc:mga0n895_23021_c1 | 3300050512 | Bacteria | 5849 |
| 836 | nmdc:mga08x19_165141_c1 | 3300050514 | Bacteria | 1505 |
| 837 | nmdc:mga0a205_659103_c1 | 3300050515 | Bacteria | 898 |
| 838 | nmdc:mga0sz30_10245_c1 | 3300050516 | Bacteria | 3589 |
| 839 | Ga0495601_0000011 | 3300053077 | Bacteria | 264937 |
| 840 | Ga0495601_0002132 | 3300053077 | Bacteria | 11132 |
| 841 | Ga0495601_0071245 | 3300053077 | Bacteria | 2219 |
| 842 | Ga0495601_0305345 | 3300053077 | Bacteria | 1036 |
| 843 | Ga0495612_0000006 | 3300053078 | Bacteria | 269278 |
| 844 | Ga0495612_0009288 | 3300053078 | Bacteria | 3990 |
| 845 | Ga0495612_0036146 | 3300053078 | Bacteria | 2004 |
| 846 | Ga0495612_0046505 | 3300053078 | Bacteria | 1777 |
| 847 | Ga0500610_0142622 | 3300053079 | Bacteria | 1208 |
| 848 | Ga0495595_0000147 | 3300053084 | Bacteria | 28631 |
| 849 | Ga0495595_0000308 | 3300053084 | Bacteria | 19036 |
| 850 | Ga0495595_0113146 | 3300053084 | Bacteria | 1317 |
| 851 | Ga0495619_0000013 | 3300053085 | Bacteria | 264865 |
| 852 | Ga0495619_0000583 | 3300053085 | Bacteria | 24288 |
| 853 | Ga0495619_0001822 | 3300053085 | Bacteria | 14165 |
| 854 | Ga0495619_0087591 | 3300053085 | Bacteria | 2105 |
| 855 | Ga0495619_0148031 | 3300053085 | Bacteria | 1619 |
| 856 | Ga0495619_0236644 | 3300053085 | Bacteria | 1265 |
| 857 | Ga0495619_0278816 | 3300053085 | Bacteria | 1158 |
| 858 | Ga0500583_0148677 | 3300053092 | Bacteria | 1166 |
| 859 | Ga0500641_0071673 | 3300053096 | Bacteria | 1459 |
| 860 | Ga0500556_0000046 | 3300053104 | Bacteria | 130408 |
| 861 | Ga0500592_023216 | 3300053116 | Bacteria | 1000 |
| 862 | Ga0500568_0000062 | 3300053139 | Bacteria | 106840 |
| 863 | Ga0500604_0014403 | 3300053151 | Bacteria | 2153 |
| 864 | Ga0500620_000478 | 3300053155 | Bacteria | 7111 |
| 865 | Ga0500620_155026 | 3300053155 | Bacteria | 796 |
| 866 | Ga0500627_0231377 | 3300053158 | Bacteria | 822 |
| 867 | Ga0500657_100452 | 3300053728 | Bacteria | 1196 |
| 868 | Ga0500645_031429 | 3300053730 | Bacteria | 1595 |
| 869 | Ga0501082_0009547 | 3300060353 | Bacteria | 8350 |
| 870 | Ga0501082_0161610 | 3300060353 | Bacteria | 1947 |
| 871 | Ga0501082_0771114 | 3300060353 | Bacteria | 842 |
| 872 | Ga0530510_0020817 | 3300061734 | Bacteria | 4665 |
| 873 | Ga0530510_0041581 | 3300061734 | Bacteria | 3319 |
| 874 | 2885317772 | 2885312484 | Bacteria | 6415165 |
| 875 | 2503201843 | 2503198000 | Bacteria | 6884444 |
| 876 | 2509118807 | 2508501123 | Bacteria | 6283661 |
| 877 | 2509367614 | 2509276018 | Bacteria | 6910194 |
| 878 | 2509396522 | 2509276022 | Bacteria | 6200534 |
| 879 | 2510315291 | 2510065059 | Bacteria | 6847884 |
| 880 | 2512931264 | 2512875016 | Bacteria | 6529530 |
| 881 | 2512959093 | 2512875024 | Bacteria | 7195110 |
| 882 | 2513613179 | 2513237090 | Bacteria | 7096802 |
| 883 | 2514038046 | 2513237164 | Bacteria | 7563725 |
| 884 | 2514420093 | 2513237305 | Bacteria | 7293571 |
| 885 | 2514588521 | 2513237351 | Bacteria | 6968952 |
| 886 | 2545677818 | 2545555834 | Bacteria | 8130841 |
| 887 | 2588517046 | 2588253730 | Bacteria | 6881675 |
| 888 | 2597813531 | 2597489875 | Bacteria | 7010078 |
| 889 | 2599936535 | 2599185301 | Bacteria | 6161860 |
| 890 | 2643773098 | 2643221550 | Bacteria | 4619371 |
| 891 | 2643775914 | 2643221551 | Bacteria | 3750538 |
| 892 | 2643794361 | 2643221555 | Bacteria | 3749717 |
| 893 | 2643839821 | 2643221564 | Bacteria | 4193379 |
| 894 | 2643984605 | 2643221595 | Bacteria | 6565519 |
| 895 | 2644129195 | 2643221623 | Bacteria | 5239945 |
| 896 | 2644158571 | 2643221627 | Bacteria | 6761570 |
| 897 | 2688598657 | 2687453392 | Bacteria | 6880454 |
| 898 | 2694633142 | 2693429783 | Bacteria | 7019804 |
| 899 | 2694635833 | 2693429784 | Bacteria | 7241525 |
| 900 | 2723575608 | 2721755686 | Bacteria | 7343952 |
| 901 | 2739308301 | 2738543024 | Bacteria | 5603683 |
| 902 | 2756675242 | 2756170246 | Bacteria | 7451806 |
| 903 | 2792749466 | 2791355123 | Bacteria | 8049106 |
| 904 | 2841739494 | 2841734538 | Bacteria | 6784580 |
| 905 | 2841764456 | 2841760612 | Bacteria | 6454112 |
| 906 | 2844007203 | 2844002411 | Bacteria | 7168230 |
| 907 | 2844013963 | 2844009547 | Bacteria | 6728125 |
| 908 | 2844108096 | 2844104063 | Bacteria | 6440972 |
| 909 | 2847675809 | 2847670302 | Bacteria | 6165597 |
| 910 | 2847692460 | 2847686936 | Bacteria | 6278406 |
| 911 | 2851188026 | 2851182111 | Bacteria | 6047226 |
| 912 | 2851250202 | 2851246043 | Bacteria | 6439203 |
| 913 | 2856314647 | 2856314179 | Bacteria | 6477897 |
| 914 | 2856325476 | 2856320880 | Bacteria | 7263508 |
| 915 | 2856331310 | 2856328259 | Bacteria | 6528202 |
| 916 | 2856335248 | 2856334872 | Bacteria | 7037011 |
| 917 | 2856347464 | 2856342000 | Bacteria | 7176905 |
| 918 | 2856350475 | 2856349417 | Bacteria | 6230045 |
| 919 | 2856358259 | 2856356410 | Bacteria | 6297484 |
| 920 | 2856370355 | 2856364286 | Bacteria | 6939991 |
| 921 | 2857350862 | 2857349434 | Bacteria | 7926032 |
| 922 | 2857370969 | 2857367948 | Bacteria | 6965560 |
| 923 | 2869166274 | 2869162929 | Bacteria | 6399702 |
| 924 | 2869172844 | 2869169390 | Bacteria | 6659796 |
| 925 | 2869238481 | 2869234852 | Bacteria | 6654993 |
| 926 | 2869242537 | 2869242130 | Bacteria | 6609239 |
| 927 | 2869254616 | 2869249662 | Bacteria | 6868783 |
| 928 | 2869262046 | 2869256925 | Bacteria | 6981691 |
| 929 | 2869271043 | 2869264136 | Bacteria | 6880765 |
| 930 | 2869272101 | 2869271264 | Bacteria | 6908218 |
| 931 | 2869285166 | 2869278585 | Bacteria | 7077053 |
| 932 | 2869291918 | 2869285874 | Bacteria | 6901219 |
| 933 | 2871435127 | 2871429161 | Bacteria | 6547891 |
| 934 | 2871440025 | 2871435913 | Bacteria | 6880295 |
| 935 | 2871449388 | 2871444079 | Bacteria | 6423508 |
| 936 | 2871455711 | 2871451962 | Bacteria | 7336357 |
| 937 | 2871465689 | 2871459585 | Bacteria | 6866887 |
| 938 | 2871472839 | 2871466892 | Bacteria | 6923287 |
| 939 | 2871479662 | 2871474448 | Bacteria | 6806570 |
| 940 | 2871484538 | 2871481445 | Bacteria | 6700002 |
| 941 | 2871494239 | 2871488783 | Bacteria | 6929816 |
| 942 | 2871499927 | 2871495908 | Bacteria | 6935695 |
| 943 | 2874102789 | 2874102143 | Bacteria | 6342645 |
| 944 | 2874112504 | 2874109183 | Bacteria | 6517025 |
| 945 | 2874121559 | 2874116593 | Bacteria | 6674494 |
| 946 | 2874123822 | 2874123672 | Bacteria | 7238285 |
| 947 | 2874138863 | 2874131515 | Bacteria | 6820270 |
| 948 | 2874146103 | 2874139085 | Bacteria | 7021506 |
| 949 | 2874149519 | 2874146452 | Bacteria | 7533118 |
| 950 | 2874157781 | 2874155637 | Bacteria | 6724144 |
| 951 | 2874162723 | 2874162495 | Bacteria | 6174670 |
| 952 | 2874174581 | 2874168670 | Bacteria | 8062617 |
| 953 | 2876369322 | 2876363079 | Bacteria | 6544991 |
| 954 | 2876379752 | 2876377896 | Bacteria | 6565995 |
| 955 | 2876388276 | 2876386047 | Bacteria | 6698674 |
| 956 | 2876394451 | 2876392853 | Bacteria | 6660880 |
| 957 | 2876402945 | 2876399893 | Bacteria | 6927900 |
| 958 | 2876413674 | 2876406927 | Bacteria | 6191900 |
| 959 | 2876415985 | 2876413966 | Bacteria | 6831344 |
| 960 | 2876423899 | 2876420981 | Bacteria | 6687741 |
| 961 | 2878039881 | 2878035449 | Bacteria | 6555736 |
| 962 | 2878732156 | 2878730984 | Bacteria | 6380721 |
| 963 | 2878745456 | 2878738818 | Bacteria | 7136951 |
| 964 | 2878752262 | 2878745973 | Bacteria | 6867388 |
| 965 | 2878759098 | 2878753008 | Bacteria | 6922523 |
| 966 | 2878764082 | 2878760144 | Bacteria | 6823465 |
| 967 | 2878771121 | 2878767105 | Bacteria | 6898628 |
| 968 | 2878780155 | 2878774303 | Bacteria | 6108671 |
| 969 | 2878783153 | 2878781027 | Bacteria | 6834456 |
| 970 | 2878793723 | 2878788777 | Bacteria | 6567085 |
| 971 | 2881151729 | 2881147464 | Bacteria | 7779814 |
| 972 | 2881155527 | 2881155292 | Bacteria | 6461656 |
| 973 | 2881167751 | 2881161766 | Bacteria | 7127907 |
| 974 | 2881852515 | 2881845957 | Bacteria | 6611900 |
| 975 | 2881854793 | 2881853255 | Bacteria | 6698367 |
| 976 | 2881865288 | 2881861095 | Bacteria | 7128710 |
| 977 | 2882636492 | 2882632389 | Bacteria | 8154593 |
| 978 | 2882912781 | 2882912400 | Bacteria | 6801539 |
| 979 | 2885309645 | 2885305155 | Bacteria | 7348390 |
| 980 | 2885320119 | 2885318864 | Bacteria | 6729568 |
| 981 | 2885326888 | 2885326080 | Bacteria | 7134805 |
| 982 | 2885334267 | 2885334103 | Bacteria | 7216818 |
| 983 | 2885350340 | 2885342637 | Bacteria | 7011821 |
| 984 | 2885350984 | 2885350715 | Bacteria | 6787678 |
| 985 | 2888339654 | 2888337043 | Bacteria | 6629336 |
| 986 | 2888347023 | 2888343758 | Bacteria | 6611049 |
| 987 | 2888355983 | 2888350351 | Bacteria | 7372807 |
| 988 | 2889010916 | 2889010040 | Bacteria | 6749192 |
| 989 | 2889017391 | 2889016732 | Bacteria | 6700763 |
| 990 | 2889792663 | 2889790730 | Bacteria | 5689708 |
| 991 | 2889918943 | 2889914905 | Bacteria | 5702301 |
| 992 | 2903451560 | 2903448605 | Bacteria | 7357801 |
| 993 | 2903493180 | 2903492973 | Bacteria | 13473544 |
| 994 | 2903503661 | 2903492973 | Bacteria | 13473544 |
| 995 | 2903515578 | 2903513507 | Bacteria | 6344008 |
| 996 | 2903523071 | 2903521522 | Bacteria | 6525694 |
| 997 | 2903534469 | 2903528002 | Bacteria | 6586099 |
| 998 | 2903544741 | 2903540706 | Bacteria | 7062119 |
| 999 | 2904661085 | 2904659560 | Bacteria | 6685615 |
| 1000 | 2906314656 | 2906308376 | Bacteria | 6841989 |
| 1001 | 2906327824 | 2906321335 | Bacteria | 6579571 |
| 1002 | 2906329808 | 2906328253 | Bacteria | 6585166 |
| 1003 | 2906360202 | 2906354277 | Bacteria | 6991324 |
| 1004 | 2906363958 | 2906363423 | Bacteria | 6856682 |
| 1005 | 2906377539 | 2906370794 | Bacteria | 6881062 |
| 1006 | 2906381262 | 2906378014 | Bacteria | 6911440 |
| 1007 | 2906402736 | 2906401398 | Bacteria | 6693206 |
| 1008 | 2906410273 | 2906408224 | Bacteria | 6162342 |
| 1009 | 2906414600 | 2906414383 | Bacteria | 6580790 |
| 1010 | 2922138489 | 2922130491 | Bacteria | 7173936 |
| 1011 | 2922157963 | 2922151315 | Bacteria | 6902399 |
| 1012 | 2922163340 | 2922158528 | Bacteria | 6573167 |
| 1013 | 2922174586 | 2922172374 | Bacteria | 6167644 |
| 1014 | 2922180550 | 2922178524 | Bacteria | 6025201 |
| 1015 | 2922190083 | 2922185730 | Bacteria | 7113964 |
| 1016 | 2924712406 | 2924710171 | Bacteria | 6752351 |
| 1017 | 2924726101 | 2924718760 | Bacteria | 6331356 |
| 1018 | 2924727033 | 2924726620 | Bacteria | 6271473 |
| 1019 | 2924733383 | 2924733363 | Bacteria | 7574837 |
| 1020 | 2924747597 | 2924741084 | Bacteria | 6661321 |
| 1021 | 2924750473 | 2924748358 | Bacteria | 6154725 |
| 1022 | 2924759098 | 2924754689 | Bacteria | 6774424 |
| 1023 | 2924769000 | 2924762789 | Bacteria | 6561353 |
| 1024 | 2924783700 | 2924776078 | Bacteria | 7492003 |
| 1025 | 2924789303 | 2924784321 | Bacteria | 7416538 |
| 1026 | 2937816041 | 2937813078 | Bacteria | 7783518 |
| 1027 | 2937824700 | 2937822353 | Bacteria | 7290551 |
| 1028 | 2937842417 | 2937836603 | Bacteria | 6811263 |
| 1029 | 2937852962 | 2937848649 | Bacteria | 6983481 |
| 1030 | 2937867173 | 2937861824 | Bacteria | 6660327 |
| 1031 | 2937881895 | 2937877337 | Bacteria | 7246526 |
| 1032 | 2937892918 | 2937891427 | Bacteria | 6357007 |
| 1033 | 2937978358 | 2937972304 | Bacteria | 7532020 |
| 1034 | 2937981523 | 2937980651 | Bacteria | 6517427 |
| 1035 | 2937998587 | 2937994558 | Bacteria | 7036190 |
| 1036 | 2958040867 | 2958034702 | Bacteria | 6989922 |
| 1037 | 2958056949 | 2958041894 | Bacteria | 13082850 |
| 1038 | 2958067647 | 2958064165 | Bacteria | 7158582 |
| 1039 | 2958077424 | 2958071322 | Bacteria | 6815895 |
| 1040 | 2958089015 | 2958084443 | Bacteria | 7312792 |
| 1041 | 2958098770 | 2958092219 | Bacteria | 6861151 |
| 1042 | 2958102678 | 2958100919 | Bacteria | 6800575 |
| 1043 | 2958113769 | 2958108152 | Bacteria | 6681128 |
| 1044 | 2958118657 | 2958115193 | Bacteria | 6923548 |
| 1045 | 2958125398 | 2958122699 | Bacteria | 7280457 |
| 1046 | 2958136316 | 2958130278 | Bacteria | 6897202 |
| 1047 | 2958143893 | 2958137437 | Bacteria | 6050276 |
| 1048 | 2958150474 | 2958144490 | Bacteria | 6677056 |
| 1049 | 2958159916 | 2958158011 | Bacteria | 6058449 |
| 1050 | 2958169067 | 2958165035 | Bacteria | 6906348 |
| 1051 | 2958173886 | 2958172287 | Bacteria | 6716688 |
| 1052 | 2958185784 | 2958179912 | Bacteria | 6874908 |
| 1053 | 2961084161 | 2961077736 | Bacteria | 7079850 |
| 1054 | 2961116236 | 2961114664 | Bacteria | 6680456 |
| 1055 | 2961129331 | 2961127735 | Bacteria | 7196641 |
| 1056 | 2961141130 | 2961136820 | Bacteria | 6775228 |
| 1057 | 2961167526 | 2961163497 | Bacteria | 6901077 |
| 1058 | 2961175730 | 2961170736 | Bacteria | 7072258 |
| 1059 | 2961186434 | 2961183825 | Bacteria | 6688536 |
| 1060 | 2963647955 | 2963644680 | Bacteria | 6530403 |
| 1061 | 2965022349 | 2965018300 | Bacteria | 6883036 |
| 1062 | 2965026368 | 2965025482 | Bacteria | 6532201 |
| 1063 | 2965033151 | 2965032056 | Bacteria | 6887443 |
| 1064 | 2965046622 | 2965040258 | Bacteria | 6855979 |
| 1065 | 2965055038 | 2965047637 | Bacteria | 6623551 |
| 1066 | 2965068318 | 2965062239 | Bacteria | 7412989 |
| 1067 | 2965103479 | 2965102966 | Bacteria | 6800987 |
| 1068 | 2965116007 | 2965110997 | Bacteria | 6693150 |
| 1069 | 2968001710 | 2967996073 | Bacteria | 6787468 |
| 1070 | 2968009346 | 2968003550 | Bacteria | 6929263 |
| 1071 | 2968018213 | 2968016561 | Bacteria | 7022047 |
| 1072 | 2968085889 | 2968083720 | Bacteria | 7351627 |
| 1073 | 2968096472 | 2968091066 | Bacteria | 6052692 |
| 1074 | 2968100736 | 2968097103 | Bacteria | 6107094 |
| 1075 | 2968112142 | 2968110612 | Bacteria | 6814636 |
| 1076 | 2968120907 | 2968117919 | Bacteria | 6536078 |
| 1077 | 2968132523 | 2968128360 | Bacteria | 6270294 |
| 1078 | 2968144522 | 2968138860 | Bacteria | 6605449 |
| 1079 | 2968175933 | 2968171901 | Bacteria | 6894245 |
| 1080 | 2970471613 | 2970469710 | Bacteria | 6969209 |
| 1081 | 2970495561 | 2970489779 | Bacteria | 6517260 |
| 1082 | 2970508395 | 2970503327 | Bacteria | 7099517 |
| 1083 | 2970511800 | 2970510686 | Bacteria | 7006402 |
| 1084 | 2970530542 | 2970524798 | Bacteria | 6840927 |
| 1085 | 2970541203 | 2970540015 | Bacteria | 6977556 |
| 1086 | 2970549293 | 2970547951 | Bacteria | 6931819 |
| 1087 | 2970558927 | 2970554993 | Bacteria | 6814252 |
| 1088 | 2970599779 | 2970593180 | Bacteria | 7073582 |
| 1089 | 2970626127 | 2970619444 | Bacteria | 6986144 |
| 1090 | 2970632338 | 2970627176 | Bacteria | 6680862 |
| 1091 | 2977827638 | 2977821940 | Bacteria | 6906439 |
| 1092 | 2977833133 | 2977828996 | Bacteria | 7007971 |
| 1093 | 2977846277 | 2977843712 | Bacteria | 6753583 |
| 1094 | 2977854931 | 2977851361 | Bacteria | 6694324 |
| 1095 | 2977871479 | 2977864932 | Bacteria | 7534097 |
| 1096 | 2977876648 | 2977872689 | Bacteria | 7270173 |
| 1097 | 2977899001 | 2977898635 | Bacteria | 6675551 |
| 1098 | 2977914447 | 2977907340 | Bacteria | 6577984 |
| 1099 | 2977921990 | 2977915119 | Bacteria | 6829656 |
| 1100 | 2977924457 | 2977922695 | Bacteria | 6956781 |
| 1101 | 2977936813 | 2977935797 | Bacteria | 6252826 |
| 1102 | 2977947434 | 2977942078 | Bacteria | 7570577 |
| 1103 | 2977951851 | 2977950692 | Bacteria | 6893264 |
| 1104 | 2977964401 | 2977957713 | Bacteria | 6877875 |
| 1105 | 2977975285 | 2977971508 | Bacteria | 7472917 |
| 1106 | 2977990496 | 2977986579 | Bacteria | 6581278 |
| 1107 | 2979713796 | 2979710463 | Bacteria | 6785254 |
| 1108 | 2979750943 | 2979742915 | Bacteria | 7301278 |
| 1109 | 2979771382 | 2979764755 | Bacteria | 6610066 |
| 1110 | 2979778468 | 2979772303 | Bacteria | 6618277 |
| 1111 | 2979781954 | 2979779861 | Bacteria | 6219781 |
| 1112 | 2979795246 | 2979793036 | Bacteria | 6808957 |
| 1113 | 2979811956 | 2979808191 | Bacteria | 7179355 |
| 1114 | 2987638047 | 2987636660 | Bacteria | 8088555 |
| 1115 | 2987650543 | 2987645492 | Bacteria | 6117018 |
| 1116 | 2987653573 | 2987652177 | Bacteria | 6969023 |
| 1117 | 2987663532 | 2987659509 | Bacteria | 6966464 |
| 1118 | 2987669010 | 2987666974 | Bacteria | 6509233 |
| 1119 | 2987680276 | 2987673487 | Bacteria | 6884027 |
| 1120 | 2996313868 | 2996310559 | Bacteria | 6357320 |
| 1121 | 2996340952 | 2996336353 | Bacteria | 5511628 |
| 1122 | 2996344042 | 2996341866 | Bacteria | 6643098 |
| 1123 | 2996350400 | 2996348954 | Bacteria | 7239054 |
| 1124 | 2996391693 | 2996386984 | Bacteria | 6978667 |
| 1125 | 3000140365 | 3000135777 | Bacteria | 6891109 |
| 1126 | 3004169138 | 3004167301 | Bacteria | 8330599 |
| 1127 | 3004192593 | 3004188549 | Bacteria | 6952365 |
| 1128 | 3004199588 | 3004195979 | Bacteria | 6776956 |
| 1129 | 3004205631 | 3004203850 | Bacteria | 7307914 |
| 1130 | 3004216191 | 3004211236 | Bacteria | 7417683 |
| 1131 | 3004223941 | 3004218560 | Bacteria | 7421728 |
| 1132 | 3004233595 | 3004232784 | Bacteria | 6662140 |
| 1133 | 3004246338 | 3004239961 | Bacteria | 6892290 |
| 1134 | 3004255696 | 3004248173 | Bacteria | 6563236 |
| 1135 | 3004269697 | 3004268573 | Bacteria | 7043476 |
| 1136 | 3004277098 | 3004275668 | Bacteria | 7114440 |
| 1137 | 3004294003 | 3004289098 | Bacteria | 6135450 |
| 1138 | 3004334091 | 3004334049 | Bacteria | 8449246 |
| 1139 | 637074367 | 637000159 | Bacteria | 7596297 |
| 1140 | 641642652 | 641522639 | Bacteria | 7737025 |
| 1141 | 649873174 | 649633066 | Bacteria | 6690028 |
| 1142 | 8004304579 | 8004300914 | Bacteria | 6132239 |
| 1143 | 8004316238 | 8004312739 | Bacteria | 7444653 |
| 1144 | 8004365715 | 8004361976 | Bacteria | 6858373 |
| 1145 | 8004380619 | 8004374579 | Bacteria | 6898112 |
| 1146 | 8004394356 | 8004387939 | Bacteria | 7049250 |
| 1147 | 8004399782 | 8004395343 | Bacteria | 6620908 |
| 1148 | 8004450258 | 8004445564 | Bacteria | 6322258 |
| 1149 | 8004637243 | 8004633249 | Bacteria | 6723080 |
| 1150 | 8004640597 | 8004640170 | Bacteria | 6723001 |
| 1151 | 8004697363 | 8004695233 | Bacteria | 6731676 |
| 1152 | 8004709559 | 8004703790 | Bacteria | 8006957 |
| 1153 | 8004720917 | 8004714634 | Bacteria | 6776161 |
| 1154 | 8004734257 | 8004727605 | Bacteria | 6643904 |
| 1155 | 8055620987 | 8055617313 | Bacteria | 7548464 |
| 1156 | 8057533473 | 8057529695 | Bacteria | 6306553 |
| 1157 | JGI24739J22299_10050467 | |||
| 1158 | JGI24750J21931_1000910 | |||
| 1159 | JGI24738J21930_10043045 | |||
| 1160 | JGI24742J22300_10017176 | |||
| 1161 | JGI25156J39149_1013582 | |||
| 1162 | JGI25157J39369_1000997 | |||
| 1163 | JGI25406J46586_10139439 | |||
| 1164 | JGI25165J46597_1000169 | |||
| 1165 | Ga0055542_1000200 | |||
| 1166 | JGI25405J52794_10002905 | |||
| 1167 | Ga0070676_10196879 | |||
| 1168 | Ga0070670_100008924 | |||
| 1169 | Ga0070670_100026922 | |||
| 1170 | Ga0068869_100020500 | |||
| 1171 | Ga0070680_100033129 | |||
| 1172 | Ga0070680_100339604 | |||
| 1173 | Ga0070682_100017788 | |||
| 1174 | Ga0070682_100039512 | |||
| 1175 | Ga0068868_100020483 | |||
| 1176 | Ga0070660_100055566 | |||
| 1177 | Ga0070660_100112319 | |||
| 1178 | Ga0070660_100112987 | |||
| 1179 | Ga0070689_100009010 | |||
| 1180 | Ga0070689_100164065 | |||
| 1181 | Ga0070691_10070081 | |||
| 1182 | Ga0070687_100023504 | |||
| 1183 | Ga0070661_100152449 | |||
| 1184 | Ga0070692_10272221 | |||
| 1185 | Ga0070668_100022994 | |||
| 1186 | Ga0070669_100028839 | |||
| 1187 | Ga0070675_100038027 | |||
| 1188 | Ga0070671_100005178 | |||
| 1189 | Ga0070671_100115795 | |||
| 1190 | Ga0070671_100475128 | |||
| 1191 | Ga0070674_100134885 | |||
| 1192 | Ga0070674_100524366 | |||
| 1193 | Ga0070673_100002387 | |||
| 1194 | Ga0070673_100017217 | |||
| 1195 | Ga0070688_100090372 | |||
| 1196 | Ga0070688_100203639 | |||
| 1197 | Ga0070688_100225450 | |||
| 1198 | Ga0070659_100015263 | |||
| 1199 | Ga0070659_100470197 | |||
| 1200 | Ga0070667_100022104 | |||
| 1201 | Ga0070709_10225004 | |||
| 1202 | Ga0070709_10294912 | |||
| 1203 | Ga0070714_100006761 | |||
| 1204 | Ga0070714_100014915 | |||
| 1205 | Ga0070714_100072142 | |||
| 1206 | Ga0070713_100035633 | |||
| 1207 | Ga0070701_10022341 | |||
| 1208 | Ga0070711_100017659 | |||
| 1209 | Ga0070711_100019153 | |||
| 1210 | Ga0070711_100028014 | |||
| 1211 | Ga0070711_100042386 | |||
| 1212 | Ga0070705_100087853 | |||
| 1213 | Ga0070700_100013506 | |||
| 1214 | Ga0070700_100448341 | |||
| 1215 | Ga0070694_100110768 | |||
| 1216 | Ga0070663_100007259 | |||
| 1217 | Ga0070663_101021231 | |||
| 1218 | Ga0070678_100076361 | |||
| 1219 | Ga0070678_100251956 | |||
| 1220 | Ga0070662_100030696 | |||
| 1221 | Ga0070681_10019614 | |||
| 1222 | Ga0070681_10283365 | |||
| 1223 | Ga0068867_100022577 | |||
| 1224 | Ga0068867_100380669 | |||
| 1225 | Ga0070685_10328632 | |||
| 1226 | Ga0070699_100008041 | |||
| 1227 | Ga0070699_101033580 | |||
| 1228 | Ga0070679_100074479 | |||
| 1229 | Ga0070679_100474764 | |||
| 1230 | Ga0070684_100340907 | |||
| 1231 | Ga0068853_100010872 | |||
| 1232 | Ga0068853_100072716 | |||
| 1233 | Ga0068853_100074585 | |||
| 1234 | Ga0068853_100098013 | |||
| 1235 | Ga0070672_100078555 | |||
| 1236 | Ga0070686_100036914 | |||
| 1237 | Ga0070695_100177699 | |||
| 1238 | Ga0070695_100603673 | |||
| 1239 | Ga0070696_100017390 | |||
| 1240 | Ga0070693_100068212 | |||
| 1241 | Ga0070665_100058543 | |||
| 1242 | Ga0070665_100128896 | |||
| 1243 | Ga0070665_100802197 | |||
| 1244 | Ga0070704_100414052 | |||
| 1245 | Ga0068855_100430715 | |||
| 1246 | Ga0070664_100228552 | |||
| 1247 | Ga0068857_100039612 | |||
| 1248 | Ga0068857_100050634 | |||
| 1249 | Ga0068857_100294103 | |||
| 1250 | Ga0068854_100024038 | |||
| 1251 | Ga0068856_100169242 | |||
| 1252 | Ga0068856_100323279 | |||
| 1253 | Ga0070702_100017784 | |||
| 1254 | Ga0068852_100006835 | |||
| 1255 | Ga0068852_100232270 | |||
| 1256 | Ga0068852_100509272 | |||
| 1257 | Ga0068859_100022244 | |||
| 1258 | Ga0068864_100132570 | |||
| 1259 | Ga0068864_100146200 | |||
| 1260 | Ga0068864_100984487 | |||
| 1261 | Ga0068866_10092731 | |||
| 1262 | Ga0068866_10302516 | |||
| 1263 | Ga0068861_100016370 | |||
| 1264 | Ga0068870_10009492 | |||
| 1265 | Ga0068870_10228004 | |||
| 1266 | Ga0068863_100050157 | |||
| 1267 | Ga0068863_100763844 | |||
| 1268 | Ga0068858_100020908 | |||
| 1269 | Ga0068858_100243165 | |||
| 1270 | Ga0068858_100298745 | |||
| 1271 | Ga0068860_100025571 | |||
| 1272 | Ga0068862_100054011 | |||
| 1273 | Ga0081455_10001749 | |||
| 1274 | Ga0081455_10011262 | |||
| 1275 | Ga0081455_10186942 | |||
| 1276 | Ga0081538_10062190 | |||
| 1277 | Ga0081540_1006291 | |||
| 1278 | Ga0081540_1049962 | |||
| 1279 | Ga0081539_10001319 | |||
| 1280 | Ga0070717_10025952 | |||
| 1281 | Ga0070717_10465328 | |||
| 1282 | Ga0070717_10517758 | |||
| 1283 | Ga0075365_10001839 | |||
| 1284 | Ga0075365_10024392 | |||
| 1285 | Ga0075365_10056680 | |||
| 1286 | Ga0075365_10069203 | |||
| 1287 | Ga0075365_10077631 | |||
| 1288 | Ga0075365_10271995 | |||
| 1289 | Ga0075368_10030186 | |||
| 1290 | Ga0075368_10081338 | |||
| 1291 | Ga0075363_100246617 | |||
| 1292 | Ga0075364_10131305 | |||
| 1293 | Ga0075364_10446615 | |||
| 1294 | Ga0075432_10140533 | |||
| 1295 | Ga0070715_10021970 | |||
| 1296 | Ga0070715_10069268 | |||
| 1297 | Ga0070715_10239304 | |||
| 1298 | Ga0070716_100054170 | |||
| 1299 | Ga0070716_100127551 | |||
| 1300 | Ga0070716_100612329 | |||
| 1301 | Ga0070712_100004818 | |||
| 1302 | Ga0070712_100056217 | |||
| 1303 | Ga0070712_100148098 | |||
| 1304 | Ga0070712_100218163 | |||
| 1305 | Ga0070712_100226120 | |||
| 1306 | Ga0070712_100275352 | |||
| 1307 | Ga0075362_10071418 | |||
| 1308 | Ga0075362_10218982 | |||
| 1309 | Ga0075367_10055339 | |||
| 1310 | Ga0075367_10079432 | |||
| 1311 | Ga0075367_10132244 | |||
| 1312 | Ga0075367_10252806 | |||
| 1313 | Ga0075369_10010327 | |||
| 1314 | Ga0097621_100194830 | |||
| 1315 | Ga0075370_10078315 | |||
| 1316 | Ga0075370_10092918 | |||
| 1317 | Ga0075370_10146609 | |||
| 1318 | Ga0068871_100083108 | |||
| 1319 | Ga0068871_100090639 | |||
| 1320 | Ga0075428_100049970 | |||
| 1321 | Ga0075428_100178861 | |||
| 1322 | Ga0075428_100232500 | |||
| 1323 | Ga0075430_100158604 | |||
| 1324 | Ga0075431_100012803 | |||
| 1325 | Ga0075431_101006368 | |||
| 1326 | Ga0075433_10561867 | |||
| 1327 | Ga0075434_100035343 | |||
| 1328 | Ga0068865_100259370 | |||
| 1329 | Ga0075436_100110197 | |||
| 1330 | Ga0097620_100022244 | |||
| 1331 | Ga0075435_100045163 | |||
| 1332 | Ga0099794_10004120 | |||
| 1333 | Ga0105240_10134618 | |||
| 1334 | Ga0111539_10051134 | |||
| 1335 | Ga0111539_10663176 | |||
| 1336 | Ga0105245_10020549 | |||
| 1337 | Ga0105245_10370007 | |||
| 1338 | Ga0105245_10536480 | |||
| 1339 | Ga0105247_10014879 | |||
| 1340 | Ga0105247_10414251 | |||
| 1341 | Ga0114129_10036121 | |||
| 1342 | Ga0114129_10072223 | |||
| 1343 | Ga0114129_11772670 | |||
| 1344 | Ga0105243_10024257 | |||
| 1345 | Ga0105243_10170997 | |||
| 1346 | Ga0105243_10879510 | |||
| 1347 | Ga0105241_10027136 | |||
| 1348 | Ga0105241_10074374 | |||
| 1349 | Ga0105241_10354466 | |||
| 1350 | Ga0105242_10034422 | |||
| 1351 | Ga0105242_10065974 | |||
| 1352 | Ga0105248_10044999 | |||
| 1353 | Ga0105248_10053841 | |||
| 1354 | Ga0105248_10510321 | |||
| 1355 | Ga0105248_11126076 | |||
| 1356 | Ga0105237_10026169 | |||
| 1357 | Ga0105237_10041723 | |||
| 1358 | Ga0105237_10282080 | |||
| 1359 | Ga0105237_10629232 | |||
| 1360 | Ga0105237_10681252 | |||
| 1361 | Ga0105238_10002854 | |||
| 1362 | Ga0105238_10045315 | |||
| 1363 | Ga0105238_10106658 | |||
| 1364 | Ga0105238_10112864 | |||
| 1365 | Ga0105249_10064133 | |||
| 1366 | Ga0099796_10013297 | |||
| 1367 | Ga0105239_10043981 | |||
| 1368 | Ga0105239_10064538 | |||
| 1369 | Ga0105239_10176966 | |||
| 1370 | Ga0105239_10647177 | |||
| 1371 | Ga0105239_10822845 | |||
| 1372 | Ga0105239_10888456 | |||
| 1373 | Ga0105239_10964561 | |||
| 1374 | Ga0105246_10007627 | |||
| 1375 | Ga0105246_10025364 | |||
| 1376 | Ga0157369_10060339 | |||
| 1377 | Ga0157369_10771759 | |||
| 1378 | Ga0157374_10015400 | |||
| 1379 | Ga0157374_10095167 | |||
| 1380 | Ga0157378_10424331 | |||
| 1381 | Ga0157378_11206481 | |||
| 1382 | Ga0163162_10335844 | |||
| 1383 | Ga0163162_10795342 | |||
| 1384 | Ga0157372_10218214 | |||
| 1385 | Ga0157372_10713687 | |||
| 1386 | Ga0157372_11230711 | |||
| 1387 | Ga0157375_10033186 | |||
| 1388 | Ga0157375_10034097 | |||
| 1389 | Ga0157375_10244445 | |||
| 1390 | Ga0157375_10533493 | |||
| 1391 | Ga0157375_10823611 | |||
| 1392 | Ga0163163_10018988 | |||
| 1393 | Ga0163163_10114772 | |||
| 1394 | Ga0163163_10268731 | |||
| 1395 | Ga0157380_10053558 | |||
| 1396 | Ga0182008_10080176 | |||
| 1397 | Ga0182008_10154103 | |||
| 1398 | Ga0157379_10022797 | |||
| 1399 | Ga0157379_10114352 | |||
| 1400 | Ga0157379_10557822 | |||
| 1401 | Ga0157376_10028668 | |||
| 1402 | Ga0157376_10067241 | |||
| 1403 | Ga0182006_1017306 | |||
| 1404 | Ga0163161_10522088 | |||
| 1405 | Ga0163161_10734302 | |||
| 1406 | Ga0213876_10015925 | |||
| 1407 | Ga0213876_10157131 | |||
| 1408 | Ga0213876_10308927 | |||
| 1409 | Ga0213875_10000012 | |||
| 1410 | Ga0213871_10012865 | |||
| 1411 | Ga0224572_1023175 | |||
| 1412 | Ga0224572_1057975 | |||
| 1413 | Ga0228598_1010721 | |||
| 1414 | Ga0209026_1000024 | |||
| 1415 | Ga0209148_1000050 | |||
| 1416 | Ga0209759_1000057 | |||
| 1417 | Ga0209233_1000010 | |||
| 1418 | Ga0209455_1000147 | |||
| 1419 | Ga0209758_1009276 | |||
| 1420 | Ga0207697_10035008 | |||
| 1421 | Ga0207697_10122578 | |||
| 1422 | Ga0207682_10034780 | |||
| 1423 | Ga0207692_10078289 | |||
| 1424 | Ga0207642_10051184 | |||
| 1425 | Ga0207642_10224843 | |||
| 1426 | Ga0207710_10015213 | |||
| 1427 | Ga0207710_10265138 | |||
| 1428 | Ga0207688_10025353 | |||
| 1429 | Ga0207647_10005228 | |||
| 1430 | Ga0207647_10010727 | |||
| 1431 | Ga0207647_10339482 | |||
| 1432 | Ga0207685_10013814 | |||
| 1433 | Ga0207685_10060984 | |||
| 1434 | Ga0207685_10074828 | |||
| 1435 | Ga0207685_10078215 | |||
| 1436 | Ga0207685_10256895 | |||
| 1437 | Ga0207699_10014392 | |||
| 1438 | Ga0207699_10162535 | |||
| 1439 | Ga0207699_10201597 | |||
| 1440 | Ga0207645_10012885 | |||
| 1441 | Ga0207645_10173531 | |||
| 1442 | Ga0207643_10003096 | |||
| 1443 | Ga0207705_10330446 | |||
| 1444 | Ga0207654_10012383 | |||
| 1445 | Ga0207654_10255213 | |||
| 1446 | Ga0207707_10011468 | |||
| 1447 | Ga0207707_10148445 | |||
| 1448 | Ga0207695_10254777 | |||
| 1449 | Ga0207695_10309941 | |||
| 1450 | Ga0207671_10067599 | |||
| 1451 | Ga0207693_10001484 | |||
| 1452 | Ga0207693_10002742 | |||
| 1453 | Ga0207693_10162406 | |||
| 1454 | Ga0207693_10238849 | |||
| 1455 | Ga0207663_10015883 | |||
| 1456 | Ga0207663_10156431 | |||
| 1457 | Ga0207663_10754050 | |||
| 1458 | Ga0207660_10056067 | |||
| 1459 | Ga0207657_10062636 | |||
| 1460 | Ga0207657_10095352 | |||
| 1461 | Ga0207657_10377948 | |||
| 1462 | Ga0207657_10780988 | |||
| 1463 | Ga0207649_10115358 | |||
| 1464 | Ga0207649_10276410 | |||
| 1465 | Ga0207681_10187187 | |||
| 1466 | Ga0207694_10010089 | |||
| 1467 | Ga0207694_10199190 | |||
| 1468 | Ga0207694_10288861 | |||
| 1469 | Ga0207650_10002963 | |||
| 1470 | Ga0207650_10009740 | |||
| 1471 | Ga0207650_10153897 | |||
| 1472 | Ga0207659_10009295 | |||
| 1473 | Ga0207659_10468502 | |||
| 1474 | Ga0207687_10026158 | |||
| 1475 | Ga0207687_10357472 | |||
| 1476 | Ga0207687_11047360 | |||
| 1477 | Ga0207700_10103615 | |||
| 1478 | Ga0207700_10532069 | |||
| 1479 | Ga0207700_10929169 | |||
| 1480 | Ga0207664_10052285 | |||
| 1481 | Ga0207664_10103384 | |||
| 1482 | Ga0207644_10007084 | |||
| 1483 | Ga0207644_10015159 | |||
| 1484 | Ga0207644_10205499 | |||
| 1485 | Ga0207690_10038670 | |||
| 1486 | Ga0207690_10055991 | |||
| 1487 | Ga0207690_10385324 | |||
| 1488 | Ga0207706_10009674 | |||
| 1489 | Ga0207706_10392329 | |||
| 1490 | Ga0207686_10213296 | |||
| 1491 | Ga0207709_10083875 | |||
| 1492 | Ga0207709_10793189 | |||
| 1493 | Ga0207670_10006644 | |||
| 1494 | Ga0207670_10008195 | |||
| 1495 | Ga0207670_10036710 | |||
| 1496 | Ga0207669_10013106 | |||
| 1497 | Ga0207704_10043058 | |||
| 1498 | Ga0207665_10354136 | |||
| 1499 | Ga0207665_10356243 | |||
| 1500 | Ga0207691_10003971 | |||
| 1501 | Ga0207711_10025426 | |||
| 1502 | Ga0207711_10083554 | |||
| 1503 | Ga0207711_10473478 | |||
| 1504 | Ga0207689_10001884 | |||
| 1505 | Ga0207689_10214342 | |||
| 1506 | Ga0207661_10259695 | |||
| 1507 | Ga0207679_10063594 | |||
| 1508 | Ga0207679_10083748 | |||
| 1509 | Ga0207679_10222495 | |||
| 1510 | Ga0207667_10164319 | |||
| 1511 | Ga0207667_10374665 | |||
| 1512 | Ga0207651_10003503 | |||
| 1513 | Ga0207651_10005442 | |||
| 1514 | Ga0207712_10122487 | |||
| 1515 | Ga0207668_10033695 | |||
| 1516 | Ga0207668_10310866 | |||
| 1517 | Ga0207668_10438777 | |||
| 1518 | Ga0207640_10047119 | |||
| 1519 | Ga0207640_11048000 | |||
| 1520 | Ga0207658_10052929 | |||
| 1521 | Ga0207658_10307058 | |||
| 1522 | Ga0207658_10380210 | |||
| 1523 | Ga0207658_11233913 | |||
| 1524 | Ga0207677_10107247 | |||
| 1525 | Ga0207703_10012529 | |||
| 1526 | Ga0207703_10236678 | |||
| 1527 | Ga0207703_10572259 | |||
| 1528 | Ga0207639_10024726 | |||
| 1529 | Ga0207639_10449794 | |||
| 1530 | Ga0207639_10699591 | |||
| 1531 | Ga0207678_10000114 | |||
| 1532 | Ga0207678_10088790 | |||
| 1533 | Ga0207708_10028546 | |||
| 1534 | Ga0207708_10368305 | |||
| 1535 | Ga0207702_10226090 | |||
| 1536 | Ga0207702_10250892 | |||
| 1537 | Ga0207641_10037528 | |||
| 1538 | Ga0207641_10696710 | |||
| 1539 | Ga0207648_10003613 | |||
| 1540 | Ga0207648_10168303 | |||
| 1541 | Ga0207676_10037967 | |||
| 1542 | Ga0207676_10187741 | |||
| 1543 | Ga0207676_10269817 | |||
| 1544 | Ga0207674_10017777 | |||
| 1545 | Ga0207674_10087226 | |||
| 1546 | Ga0207674_10120939 | |||
| 1547 | Ga0207675_100014341 | |||
| 1548 | Ga0207675_100917457 | |||
| 1549 | Ga0207683_10009784 | |||
| 1550 | Ga0207683_10027474 | |||
| 1551 | Ga0207698_10059041 | |||
| 1552 | Ga0207698_10351662 | |||
| 1553 | Ga0209179_1021607 | |||
| 1554 | Ga0209813_10045297 | |||
| 1555 | Ga0207428_10179758 | |||
| 1556 | Ga0265357_1000569 | |||
| 1557 | Ga0268266_10012797 | |||
| 1558 | Ga0268266_10054805 | |||
| 1559 | Ga0268266_10306317 | |||
| 1560 | Ga0268265_10233343 | |||
| 1561 | Ga0268264_10015832 | |||
| 1562 | Ga0265762_1075661 | |||
| 1563 | Ga0265773_1001072 | |||
| 1564 | Ga0265760_10170059 | |||
| 1565 | Ga0265332_10000592 | |||
| 1566 | Ga0265329_10008897 | |||
| 1567 | Ga0265340_10007268 | |||
| 1568 | Ga0265339_10001715 | |||
| 1569 | Ga0265331_10009132 | |||
| 1570 | Ga0307513_10048573 | |||
| 1571 | Ga0265313_10069555 | |||
| 1572 | Ga0265342_10000116 | |||
| 1573 | Ga0307405_10327522 | |||
| 1574 | Ga0373930_0003794 | |||
| 1575 | Ga0373938_0061441 | |||
| 1576 | Ga0373926_0166397 | |||
| 1577 | Ga0373929_0029226 | |||
| 1578 | Ga0373934_0036930 | |||
| 1579 | Ga0373934_0055431 | |||
| 1580 | Ga0373940_0023298 | |||
| 1581 | Ga0373949_0019950 | |||
| 1582 | Ga0373923_0000186 | |||
| 1583 | Ga0373923_0129768 | |||
| 1584 | Ga0373936_0016342 | |||
| 1585 | Ga0373936_0053012 | |||
| 1586 | Ga0373936_0107799 | |||
| 1587 | Ga0373936_0246278 | |||
| 1588 | Ga0373939_0018875 | |||
| 1589 | Ga0373945_0137623 | |||
| 1590 | Ga0373953_0011844 | |||
| 1591 | Ga0373953_0018792 | |||
| 1592 | Ga0373953_0093923 | |||
| 1593 | Ga0373954_0008300 | |||
| 1594 | Ga0373956_0046593 | |||
| 1595 | Ga0373956_0095422 | |||
| 1596 | Ga0373960_0015866 | |||
| 1597 | Ga0373943_0071731 | |||
| 1598 | Ga0373943_0494382 | |||
| 1599 | Ga0373946_0044720 | |||
| 1600 | Ga0373955_0003215 | |||
| 1601 | Ga0373955_0400129 | |||
| 1602 | Ga0373955_0417070 | |||
| 1603 | Ga0373924_0005086 | |||
| 1604 | Ga0373924_0017966 | |||
| 1605 | Ga0373924_0040202 | |||
| 1606 | Ga0373924_0057140 | |||
| 1607 | Ga0373924_0098036 | |||
| 1608 | Ga0373931_0063588 | |||
| 1609 | Ga0373931_0070201 | |||
| 1610 | Ga0373931_0110931 | |||
| 1611 | Ga0373935_0001959 | |||
| 1612 | Ga0373935_0005867 | |||
| 1613 | Ga0373935_0097259 | |||
| 1614 | Ga0373935_0130725 | |||
| 1615 | Ga0373935_0202041 | |||
| 1616 | Ga0373935_0288881 | |||
| 1617 | Ga0373935_0355931 | |||
| 1618 | Ga0373935_0451083 | |||
| 1619 | Ga0373935_0504630 | |||
| 1620 | Ga0373927_0015698 | |||
| 1621 | Ga0373927_0023606 | |||
| 1622 | Ga0373927_0063346 | |||
| 1623 | Ga0373927_0118559 | |||
| 1624 | Ga0373927_0162990 | |||
| 1625 | Ga0373933_0002179 | |||
| 1626 | Ga0373933_0002211 | |||
| 1627 | Ga0373933_0031590 | |||
| 1628 | Ga0373933_0101391 | |||
| 1629 | Ga0373947_0002362 | |||
| 1630 | Ga0373947_0027690 | |||
| 1631 | Ga0373947_0051532 | |||
| 1632 | Ga0373947_0055899 | |||
| 1633 | Ga0373947_0167396 | |||
| 1634 | Ga0373947_0612285 | |||
| 1635 | Ga0373937_0000041 | |||
| 1636 | Ga0373937_0000765 | |||
| 1637 | Ga0373937_0003840 | |||
| 1638 | Ga0373937_0005787 | |||
| 1639 | Ga0373925_0000793 | |||
| 1640 | Ga0373925_0048603 | |||
| 1641 | Ga0373925_0102482 | |||
| 1642 | Ga0373925_0119993 | |||
| 1643 | Ga0373925_0336041 | |||
| 1644 | Ga0395900_0019120 | |||
| 1645 | Ga0395900_0061732 | |||
| 1646 | Ga0395898_0227185 | |||
| 1647 | Ga0395898_0322217 | |||
| 1648 | Ga0395898_0617648 | |||
| 1649 | Ga0395905_0049568 | |||
| 1650 | Ga0395905_0282703 | |||
| 1651 | Ga0436364_0347683 | |||
| 1652 | Ga0436364_0553890 | |||
| 1653 | Ga0436364_0683938 | |||
| 1654 | Ga0436364_0739297 | |||
| 1655 | Ga0436364_1241746 | |||
| 1656 | Ga0436364_1465720 | |||
| 1657 | Ga0436364_1491432 | |||
| 1658 | Ga0395901_0011146 | |||
| 1659 | Ga0395901_0103612 | |||
| 1660 | Ga0395901_0155826 | |||
| 1661 | Ga0395901_0266605 | |||
| 1662 | Ga0436365_0238303 | |||
| 1663 | Ga0436365_0319814 | |||
| 1664 | Ga0436365_0879496 | |||
| 1665 | Ga0436365_0899547 | |||
| 1666 | Ga0436365_1529562 | |||
| 1667 | Ga0436360_1334791 | |||
| 1668 | Ga0436362_0706089 | |||
| 1669 | Ga0439455_0058449 | |||
| 1670 | Ga0466972_0022440 | |||
| 1671 | Ga0466960_0037172 | |||
| 1672 | Ga0495592_0003368 | |||
| 1673 | Ga0495592_0008877 | |||
| 1674 | Ga0495592_0046621 | |||
| 1675 | Ga0495592_0104615 | |||
| 1676 | Ga0495592_0132975 | |||
| 1677 | Ga0495592_0444990 | |||
| 1678 | Ga0495603_0365604 | |||
| 1679 | Ga0495603_0405386 | |||
| 1680 | Ga0495590_0091075 | |||
| 1681 | Ga0495629_0006715 | |||
| 1682 | Ga0495629_0011756 | |||
| 1683 | Ga0495629_0018879 | |||
| 1684 | Ga0495629_0298998 | |||
| 1685 | Ga0495638_0009008 | |||
| 1686 | Ga0495638_0113930 | |||
| 1687 | Ga0495641_0032701 | |||
| 1688 | Ga0495651_0008706 | |||
| 1689 | Ga0495651_0009661 | |||
| 1690 | Ga0495651_0012317 | |||
| 1691 | Ga0495651_0093756 | |||
| 1692 | Ga0495653_0000646 | |||
| 1693 | Ga0495653_0000993 | |||
| 1694 | Ga0495653_0017117 | |||
| 1695 | Ga0495653_0169725 | |||
| 1696 | Ga0495653_0313116 | |||
| 1697 | Ga0495653_0422124 | |||
| 1698 | Ga0495662_0000711 | |||
| 1699 | Ga0495662_0002469 | |||
| 1700 | Ga0495662_0160845 | |||
| 1701 | Ga0495664_0000008 | |||
| 1702 | Ga0495664_0000887 | |||
| 1703 | Ga0495664_0093110 | |||
| 1704 | Ga0495584_0084484 | |||
| 1705 | Ga0495594_0343858 | |||
| 1706 | Ga0495607_0223027 | |||
| 1707 | Ga0495608_0000226 | |||
| 1708 | Ga0495608_0000752 | |||
| 1709 | Ga0495608_0133229 | |||
| 1710 | Ga0495618_0000826 | |||
| 1711 | Ga0495618_0003138 | |||
| 1712 | Ga0495618_0042615 | |||
| 1713 | Ga0495618_0404693 | |||
| 1714 | Ga0495628_0000802 | |||
| 1715 | Ga0495628_0016982 | |||
| 1716 | Ga0495628_0054502 | |||
| 1717 | Ga0495630_0008988 | |||
| 1718 | Ga0495630_0082128 | |||
| 1719 | Ga0495630_0086103 | |||
| 1720 | Ga0495630_0164829 | |||
| 1721 | Ga0495630_0210305 | |||
| 1722 | Ga0495630_0223728 | |||
| 1723 | Ga0495630_0365337 | |||
| 1724 | Ga0495637_0013652 | |||
| 1725 | Ga0495663_0219220 | |||
| 1726 | Ga0495666_0076154 | |||
| 1727 | Ga0495652_0000005 | |||
| 1728 | Ga0495652_0008781 | |||
| 1729 | Ga0495654_0253131 | |||
| 1730 | Ga0495665_0043393 | |||
| 1731 | Ga0495665_0061360 | |||
| 1732 | Ga0495665_0373357 | |||
| 1733 | Ga0495640_0000020 | |||
| 1734 | Ga0495640_0005859 | |||
| 1735 | Ga0495640_0042211 | |||
| 1736 | Ga0495640_0282965 | |||
| 1737 | Ga0495586_0008716 | |||
| 1738 | Ga0495587_0000005 | |||
| 1739 | Ga0495587_0008717 | |||
| 1740 | Ga0495587_0293760 | |||
| 1741 | Ga0495598_0034691 | |||
| 1742 | Ga0495621_0125722 | |||
| 1743 | Ga0495645_0000007 | |||
| 1744 | Ga0495645_0005621 | |||
| 1745 | Ga0495645_0466340 | |||
| 1746 | Ga0495667_0000618 | |||
| 1747 | Ga0495667_0020766 | |||
| 1748 | Ga0495667_0042272 | |||
| 1749 | Ga0495667_0147663 | |||
| 1750 | Ga0495668_0079485 | |||
| 1751 | Ga0495668_0192880 | |||
| 1752 | Ga0495634_0001129 | |||
| 1753 | Ga0495634_0002902 | |||
| 1754 | Ga0495634_0004881 | |||
| 1755 | Ga0495625_0054621 | |||
| 1756 | Ga0495635_0000010 | |||
| 1757 | Ga0495635_0003537 | |||
| 1758 | Ga0495635_0004407 | |||
| 1759 | Ga0495635_0164890 | |||
| 1760 | Ga0495635_0292004 | |||
| 1761 | Ga0495661_0144484 | |||
| 1762 | Ga0495588_0014853 | |||
| 1763 | Ga0495657_0000052 | |||
| 1764 | Ga0495657_0116496 | |||
| 1765 | Ga0495599_0000240 | |||
| 1766 | Ga0495599_0086062 | |||
| 1767 | Ga0495599_0167550 | |||
| 1768 | Ga0495623_0001009 | |||
| 1769 | Ga0495623_0040075 | |||
| 1770 | Ga0495646_0000663 | |||
| 1771 | Ga0495646_0054944 | |||
| 1772 | Ga0495646_0232869 | |||
| 1773 | Ga0495647_0019819 | |||
| 1774 | Ga0495647_0071643 | |||
| 1775 | Ga0495658_0023605 | |||
| 1776 | Ga0495613_0010045 | |||
| 1777 | Ga0495613_0031750 | |||
| 1778 | Ga0495613_0538713 | |||
| 1779 | Ga0495624_0163530 | |||
| 1780 | Ga0495624_0297992 | |||
| 1781 | Ga0495671_0338955 | |||
| 1782 | Ga0495649_0209191 | |||
| 1783 | Ga0495589_0202378 | |||
| 1784 | Ga0495600_0000016 | |||
| 1785 | Ga0495600_0180299 | |||
| 1786 | Ga0495581_0001818 | |||
| 1787 | Ga0495581_0059483 | |||
| 1788 | Ga0495581_0229004 | |||
| 1789 | Ga0495581_0269454 | |||
| 1790 | Ga0495604_0000634 | |||
| 1791 | Ga0495604_0001065 | |||
| 1792 | Ga0495604_0065212 | |||
| 1793 | Ga0495604_0158999 | |||
| 1794 | Ga0495604_0221651 | |||
| 1795 | Ga0495674_0000012 | |||
| 1796 | Ga0495674_0006055 | |||
| 1797 | Ga0495674_0006411 | |||
| 1798 | Ga0495674_0130779 | |||
| 1799 | Ga0495674_0310616 | |||
| 1800 | Ga0495674_0509384 | |||
| 1801 | Ga0495676_0119139 | |||
| 1802 | Ga0495680_0001629 | |||
| 1803 | Ga0495680_0009090 | |||
| 1804 | Ga0495680_0045962 | |||
| 1805 | Ga0495675_0002307 | |||
| 1806 | Ga0495675_0007464 | |||
| 1807 | Ga0495684_0001027 | |||
| 1808 | Ga0495684_0002302 | |||
| 1809 | Ga0495684_0016011 | |||
| 1810 | Ga0495684_0079481 | |||
| 1811 | Ga0495684_0352333 | |||
| 1812 | Ga0495684_0470611 | |||
| 1813 | Ga0495686_0198233 | |||
| 1814 | Ga0495593_0001783 | |||
| 1815 | Ga0495593_0094449 | |||
| 1816 | Ga0495593_0187771 | |||
| 1817 | Ga0495593_0298058 | |||
| 1818 | Ga0495602_0001567 | |||
| 1819 | Ga0495602_0012027 | |||
| 1820 | Ga0495602_0351420 | |||
| 1821 | Ga0495602_0527478 | |||
| 1822 | Ga0496100_0007628 | |||
| 1823 | Ga0496100_0099344 | |||
| 1824 | Ga0496100_0187516 | |||
| 1825 | Ga0496100_0262056 | |||
| 1826 | Ga0496100_0367903 | |||
| 1827 | Ga0496100_0848620 | |||
| 1828 | Ga0496101_0002917 | |||
| 1829 | Ga0496101_0019876 | |||
| 1830 | Ga0496101_0040185 | |||
| 1831 | Ga0496101_0155419 | |||
| 1832 | Ga0496101_0333014 | |||
| 1833 | Ga0496101_0502176 | |||
| 1834 | Ga0496101_0559306 | |||
| 1835 | Ga0496101_0661406 | |||
| 1836 | Ga0496102_0052231 | |||
| 1837 | Ga0496102_0191607 | |||
| 1838 | Ga0496102_0227289 | |||
| 1839 | Ga0496102_0402564 | |||
| 1840 | Ga0496102_0604478 | |||
| 1841 | Ga0496103_0008526 | |||
| 1842 | Ga0496103_0042248 | |||
| 1843 | Ga0496103_0082896 | |||
| 1844 | Ga0496103_0154006 | |||
| 1845 | Ga0496104_0012127 | |||
| 1846 | Ga0496104_0017672 | |||
| 1847 | Ga0496104_0037881 | |||
| 1848 | Ga0496104_0114326 | |||
| 1849 | Ga0496104_0441268 | |||
| 1850 | Ga0496104_0762000 | |||
| 1851 | Ga0496105_0039220 | |||
| 1852 | Ga0496105_0052851 | |||
| 1853 | Ga0496105_0144491 | |||
| 1854 | Ga0496105_0149309 | |||
| 1855 | Ga0496106_0015557 | |||
| 1856 | Ga0496106_0020585 | |||
| 1857 | Ga0496106_0054205 | |||
| 1858 | Ga0496107_0003486 | |||
| 1859 | Ga0496107_0033283 | |||
| 1860 | Ga0496107_0100544 | |||
| 1861 | Ga0496107_0327686 | |||
| 1862 | Ga0496107_0434188 | |||
| 1863 | Ga0496108_0001144 | |||
| 1864 | Ga0496108_0041960 | |||
| 1865 | Ga0496108_0183319 | |||
| 1866 | Ga0496108_0275614 | |||
| 1867 | Ga0496108_0588975 | |||
| 1868 | Ga0496109_0039235 | |||
| 1869 | Ga0496109_0040330 | |||
| 1870 | Ga0496109_0092525 | |||
| 1871 | Ga0496109_0216645 | |||
| 1872 | Ga0496110_0158579 | |||
| 1873 | Ga0496110_0208332 | |||
| 1874 | Ga0496110_0295488 | |||
| 1875 | Ga0496110_0625265 | |||
| 1876 | Ga0496111_0002536 | |||
| 1877 | Ga0496111_0065884 | |||
| 1878 | Ga0496111_0085197 | |||
| 1879 | Ga0496112_0001224 | |||
| 1880 | Ga0496112_0055827 | |||
| 1881 | Ga0496112_0093758 | |||
| 1882 | Ga0496112_0117175 | |||
| 1883 | Ga0496112_0162763 | |||
| 1884 | Ga0496112_0215010 | |||
| 1885 | Ga0496112_0239586 | |||
| 1886 | Ga0496112_0282322 | |||
| 1887 | Ga0496112_0380811 | |||
| 1888 | Ga0496113_0003020 | |||
| 1889 | Ga0496113_0084544 | |||
| 1890 | Ga0496113_0187071 | |||
| 1891 | Ga0496113_0188868 | |||
| 1892 | Ga0496113_0220905 | |||
| 1893 | Ga0496113_0604244 | |||
| 1894 | Ga0496113_0726241 | |||
| 1895 | Ga0496114_0022995 | |||
| 1896 | Ga0496114_0077004 | |||
| 1897 | Ga0496114_0273533 | |||
| 1898 | Ga0496114_0411623 | |||
| 1899 | Ga0496115_0001274 | |||
| 1900 | Ga0496115_0002540 | |||
| 1901 | Ga0496115_0014554 | |||
| 1902 | Ga0496115_0066601 | |||
| 1903 | Ga0496115_0081735 | |||
| 1904 | Ga0496115_0111402 | |||
| 1905 | Ga0496115_0382915 | |||
| 1906 | Ga0496115_0609617 | |||
| 1907 | Ga0496119_0005212 | |||
| 1908 | Ga0496119_0051069 | |||
| 1909 | Ga0496119_0189002 | |||
| 1910 | Ga0496120_0001261 | |||
| 1911 | Ga0496120_0050705 | |||
| 1912 | Ga0496121_0333629 | |||
| 1913 | Ga0496122_0029170 | |||
| 1914 | Ga0496123_0001703 | |||
| 1915 | Ga0496124_0293031 | |||
| 1916 | Ga0496125_0248807 | |||
| 1917 | Ga0496126_0560649 | |||
| 1918 | Ga0501031_0143782 | |||
| 1919 | Ga0501032_0000786 | |||
| 1920 | Ga0501032_0002130 | |||
| 1921 | Ga0501033_0000197 | |||
| 1922 | Ga0501033_0008439 | |||
| 1923 | Ga0501033_0188276 | |||
| 1924 | Ga0501033_0326363 | |||
| 1925 | Ga0501034_0000031 | |||
| 1926 | Ga0501034_0000901 | |||
| 1927 | Ga0501034_0375642 | |||
| 1928 | Ga0501034_0758487 | |||
| 1929 | Ga0501036_0001200 | |||
| 1930 | Ga0501036_0133594 | |||
| 1931 | Ga0501037_0000067 | |||
| 1932 | Ga0501037_0004427 | |||
| 1933 | Ga0501038_0000013 | |||
| 1934 | Ga0501038_0079083 | |||
| 1935 | Ga0501039_0000010 | |||
| 1936 | Ga0501039_0000484 | |||
| 1937 | Ga0501039_0117158 | |||
| 1938 | Ga0501040_0067518 | |||
| 1939 | Ga0501040_0159089 | |||
| 1940 | Ga0501042_0080180 | |||
| 1941 | Ga0501043_0000056 | |||
| 1942 | Ga0501043_0196791 | |||
| 1943 | Ga0501046_0009800 | |||
| 1944 | Ga0501046_0010748 | |||
| 1945 | Ga0501046_0105022 | |||
| 1946 | Ga0501046_0110475 | |||
| 1947 | Ga0501047_0000201 | |||
| 1948 | Ga0501047_0002957 | |||
| 1949 | Ga0501047_0060095 | |||
| 1950 | Ga0501047_0192302 | |||
| 1951 | Ga0501047_0552932 | |||
| 1952 | Ga0501067_0006710 | |||
| 1953 | Ga0501067_0115095 | |||
| 1954 | Ga0501067_0316488 | |||
| 1955 | Ga0501070_0103833 | |||
| 1956 | Ga0501072_0227288 | |||
| 1957 | Ga0501073_0029178 | |||
| 1958 | Ga0501076_0497229 | |||
| 1959 | Ga0501079_0334446 | |||
| 1960 | Ga0501080_0010630 | |||
| 1961 | Ga0501081_0195297 | |||
| 1962 | Ga0501035_0000063 | |||
| 1963 | Ga0501035_0000077 | |||
| 1964 | Ga0501035_0076885 | |||
| 1965 | Ga0501044_0000013 | |||
| 1966 | Ga0501044_0014303 | |||
| 1967 | Ga0501045_0120384 | |||
| 1968 | nmdc:mga03683_31654_c1 | |||
| 1969 | nmdc:mga03683_81543_c1 | |||
| 1970 | nmdc:mga03n38_212451_c1 | |||
| 1971 | nmdc:mga00v17_39039_c1 | |||
| 1972 | nmdc:mga0yw44_14764_c1 | |||
| 1973 | nmdc:mga0yw44_15868_c1 | |||
| 1974 | nmdc:mga0yw44_30670_c1 | |||
| 1975 | nmdc:mga0yw44_53547_c1 | |||
| 1976 | nmdc:mga0yw44_53830_c1 | |||
| 1977 | nmdc:mga0yw44_92949_c1 | |||
| 1978 | nmdc:mga06z11_162363_c1 | |||
| 1979 | nmdc:mga06z11_163130_c1 | |||
| 1980 | nmdc:mga06z11_39131_c1 | |||
| 1981 | nmdc:mga04h51_98244_c1 | |||
| 1982 | nmdc:mga07m45_73582_c1 | |||
| 1983 | nmdc:mga05p37_42032_c1 | |||
| 1984 | nmdc:mga05p37_59076_c1 | |||
| 1985 | nmdc:mga0qj67_25436_c1 | |||
| 1986 | nmdc:mga06r32_166724_c1 | |||
| 1987 | nmdc:mga06r32_557138_c1 | |||
| 1988 | nmdc:mga08y16_119655_c1 | |||
| 1989 | nmdc:mga08y16_557856_c1 | |||
| 1990 | nmdc:mga08y16_67679_c1 | |||
| 1991 | nmdc:mga0n895_23021_c1 | |||
| 1992 | nmdc:mga08x19_165141_c1 | |||
| 1993 | nmdc:mga0a205_659103_c1 | |||
| 1994 | nmdc:mga0sz30_10245_c1 | |||
| 1995 | Ga0495601_0000011 | |||
| 1996 | Ga0495601_0002132 | |||
| 1997 | Ga0495601_0071245 | |||
| 1998 | Ga0495601_0305345 | |||
| 1999 | Ga0495612_0000006 | |||
| 2000 | Ga0495612_0009288 | |||
| 2001 | Ga0495612_0036146 | |||
| 2002 | Ga0495612_0046505 | |||
| 2003 | Ga0500610_0142622 | |||
| 2004 | Ga0495595_0000147 | |||
| 2005 | Ga0495595_0000308 | |||
| 2006 | Ga0495595_0113146 | |||
| 2007 | Ga0495619_0000013 | |||
| 2008 | Ga0495619_0000583 | |||
| 2009 | Ga0495619_0001822 | |||
| 2010 | Ga0495619_0087591 | |||
| 2011 | Ga0495619_0148031 | |||
| 2012 | Ga0495619_0236644 | |||
| 2013 | Ga0495619_0278816 | |||
| 2014 | Ga0500583_0148677 | |||
| 2015 | Ga0500641_0071673 | |||
| 2016 | Ga0500556_0000046 | |||
| 2017 | Ga0500592_023216 | |||
| 2018 | Ga0500568_0000062 | |||
| 2019 | Ga0500604_0014403 | |||
| 2020 | Ga0500620_000478 | |||
| 2021 | Ga0500620_155026 | |||
| 2022 | Ga0500627_0231377 | |||
| 2023 | Ga0500657_100452 | |||
| 2024 | Ga0500645_031429 | |||
| 2025 | Ga0501082_0009547 | |||
| 2026 | Ga0501082_0161610 | |||
| 2027 | Ga0501082_0771114 | |||
| 2028 | Ga0530510_0020817 | |||
| 2029 | Ga0530510_0041581 | |||
| 2030 | 2885317772 | |||
| 2031 | 2503201843 | |||
| 2032 | 2509118807 | |||
| 2033 | 2509367614 | |||
| 2034 | 2509396522 | |||
| 2035 | 2510315291 | |||
| 2036 | 2512931264 | |||
| 2037 | 2512959093 | |||
| 2038 | 2513613179 | |||
| 2039 | 2514038046 | |||
| 2040 | 2514420093 | |||
| 2041 | 2514588521 | |||
| 2042 | 2545677818 | |||
| 2043 | 2588517046 | |||
| 2044 | 2597813531 | |||
| 2045 | 2599936535 | |||
| 2046 | 2643773098 | |||
| 2047 | 2643775914 | |||
| 2048 | 2643794361 | |||
| 2049 | 2643839821 | |||
| 2050 | 2643984605 | |||
| 2051 | 2644129195 | |||
| 2052 | 2644158571 | |||
| 2053 | 2688598657 | |||
| 2054 | 2694633142 | |||
| 2055 | 2694635833 | |||
| 2056 | 2723575608 | |||
| 2057 | 2739308301 | |||
| 2058 | 2756675242 | |||
| 2059 | 2792749466 | |||
| 2060 | 2841739494 | |||
| 2061 | 2841764456 | |||
| 2062 | 2844007203 | |||
| 2063 | 2844013963 | |||
| 2064 | 2844108096 | |||
| 2065 | 2847675809 | |||
| 2066 | 2847692460 | |||
| 2067 | 2851188026 | |||
| 2068 | 2851250202 | |||
| 2069 | 2856314647 | |||
| 2070 | 2856325476 | |||
| 2071 | 2856331310 | |||
| 2072 | 2856335248 | |||
| 2073 | 2856347464 | |||
| 2074 | 2856350475 | |||
| 2075 | 2856358259 | |||
| 2076 | 2856370355 | |||
| 2077 | 2857350862 | |||
| 2078 | 2857370969 | |||
| 2079 | 2869166274 | |||
| 2080 | 2869172844 | |||
| 2081 | 2869238481 | |||
| 2082 | 2869242537 | |||
| 2083 | 2869254616 | |||
| 2084 | 2869262046 | |||
| 2085 | 2869271043 | |||
| 2086 | 2869272101 | |||
| 2087 | 2869285166 | |||
| 2088 | 2869291918 | |||
| 2089 | 2871435127 | |||
| 2090 | 2871440025 | |||
| 2091 | 2871449388 | |||
| 2092 | 2871455711 | |||
| 2093 | 2871465689 | |||
| 2094 | 2871472839 | |||
| 2095 | 2871479662 | |||
| 2096 | 2871484538 | |||
| 2097 | 2871494239 | |||
| 2098 | 2871499927 | |||
| 2099 | 2874102789 | |||
| 2100 | 2874112504 | |||
| 2101 | 2874121559 | |||
| 2102 | 2874123822 | |||
| 2103 | 2874138863 | |||
| 2104 | 2874146103 | |||
| 2105 | 2874149519 | |||
| 2106 | 2874157781 | |||
| 2107 | 2874162723 | |||
| 2108 | 2874174581 | |||
| 2109 | 2876369322 | |||
| 2110 | 2876379752 | |||
| 2111 | 2876388276 | |||
| 2112 | 2876394451 | |||
| 2113 | 2876402945 | |||
| 2114 | 2876413674 | |||
| 2115 | 2876415985 | |||
| 2116 | 2876423899 | |||
| 2117 | 2878039881 | |||
| 2118 | 2878732156 | |||
| 2119 | 2878745456 | |||
| 2120 | 2878752262 | |||
| 2121 | 2878759098 | |||
| 2122 | 2878764082 | |||
| 2123 | 2878771121 | |||
| 2124 | 2878780155 | |||
| 2125 | 2878783153 | |||
| 2126 | 2878793723 | |||
| 2127 | 2881151729 | |||
| 2128 | 2881155527 | |||
| 2129 | 2881167751 | |||
| 2130 | 2881852515 | |||
| 2131 | 2881854793 | |||
| 2132 | 2881865288 | |||
| 2133 | 2882636492 | |||
| 2134 | 2882912781 | |||
| 2135 | 2885309645 | |||
| 2136 | 2885320119 | |||
| 2137 | 2885326888 | |||
| 2138 | 2885334267 | |||
| 2139 | 2885350340 | |||
| 2140 | 2885350984 | |||
| 2141 | 2888339654 | |||
| 2142 | 2888347023 | |||
| 2143 | 2888355983 | |||
| 2144 | 2889010916 | |||
| 2145 | 2889017391 | |||
| 2146 | 2889792663 | |||
| 2147 | 2889918943 | |||
| 2148 | 2903451560 | |||
| 2149 | 2903493180 | |||
| 2150 | 2903503661 | |||
| 2151 | 2903515578 | |||
| 2152 | 2903523071 | |||
| 2153 | 2903534469 | |||
| 2154 | 2903544741 | |||
| 2155 | 2904661085 | |||
| 2156 | 2906314656 | |||
| 2157 | 2906327824 | |||
| 2158 | 2906329808 | |||
| 2159 | 2906360202 | |||
| 2160 | 2906363958 | |||
| 2161 | 2906377539 | |||
| 2162 | 2906381262 | |||
| 2163 | 2906402736 | |||
| 2164 | 2906410273 | |||
| 2165 | 2906414600 | |||
| 2166 | 2922138489 | |||
| 2167 | 2922157963 | |||
| 2168 | 2922163340 | |||
| 2169 | 2922174586 | |||
| 2170 | 2922180550 | |||
| 2171 | 2922190083 | |||
| 2172 | 2924712406 | |||
| 2173 | 2924726101 | |||
| 2174 | 2924727033 | |||
| 2175 | 2924733383 | |||
| 2176 | 2924747597 | |||
| 2177 | 2924750473 | |||
| 2178 | 2924759098 | |||
| 2179 | 2924769000 | |||
| 2180 | 2924783700 | |||
| 2181 | 2924789303 | |||
| 2182 | 2937816041 | |||
| 2183 | 2937824700 | |||
| 2184 | 2937842417 | |||
| 2185 | 2937852962 | |||
| 2186 | 2937867173 | |||
| 2187 | 2937881895 | |||
| 2188 | 2937892918 | |||
| 2189 | 2937978358 | |||
| 2190 | 2937981523 | |||
| 2191 | 2937998587 | |||
| 2192 | 2958040867 | |||
| 2193 | 2958056949 | |||
| 2194 | 2958067647 | |||
| 2195 | 2958077424 | |||
| 2196 | 2958089015 | |||
| 2197 | 2958098770 | |||
| 2198 | 2958102678 | |||
| 2199 | 2958113769 | |||
| 2200 | 2958118657 | |||
| 2201 | 2958125398 | |||
| 2202 | 2958136316 | |||
| 2203 | 2958143893 | |||
| 2204 | 2958150474 | |||
| 2205 | 2958159916 | |||
| 2206 | 2958169067 | |||
| 2207 | 2958173886 | |||
| 2208 | 2958185784 | |||
| 2209 | 2961084161 | |||
| 2210 | 2961116236 | |||
| 2211 | 2961129331 | |||
| 2212 | 2961141130 | |||
| 2213 | 2961167526 | |||
| 2214 | 2961175730 | |||
| 2215 | 2961186434 | |||
| 2216 | 2963647955 | |||
| 2217 | 2965022349 | |||
| 2218 | 2965026368 | |||
| 2219 | 2965033151 | |||
| 2220 | 2965046622 | |||
| 2221 | 2965055038 | |||
| 2222 | 2965068318 | |||
| 2223 | 2965103479 | |||
| 2224 | 2965116007 | |||
| 2225 | 2968001710 | |||
| 2226 | 2968009346 | |||
| 2227 | 2968018213 | |||
| 2228 | 2968085889 | |||
| 2229 | 2968096472 | |||
| 2230 | 2968100736 | |||
| 2231 | 2968112142 | |||
| 2232 | 2968120907 | |||
| 2233 | 2968132523 | |||
| 2234 | 2968144522 | |||
| 2235 | 2968175933 | |||
| 2236 | 2970471613 | |||
| 2237 | 2970495561 | |||
| 2238 | 2970508395 | |||
| 2239 | 2970511800 | |||
| 2240 | 2970530542 | |||
| 2241 | 2970541203 | |||
| 2242 | 2970549293 | |||
| 2243 | 2970558927 | |||
| 2244 | 2970599779 | |||
| 2245 | 2970626127 | |||
| 2246 | 2970632338 | |||
| 2247 | 2977827638 | |||
| 2248 | 2977833133 | |||
| 2249 | 2977846277 | |||
| 2250 | 2977854931 | |||
| 2251 | 2977871479 | |||
| 2252 | 2977876648 | |||
| 2253 | 2977899001 | |||
| 2254 | 2977914447 | |||
| 2255 | 2977921990 | |||
| 2256 | 2977924457 | |||
| 2257 | 2977936813 | |||
| 2258 | 2977947434 | |||
| 2259 | 2977951851 | |||
| 2260 | 2977964401 | |||
| 2261 | 2977975285 | |||
| 2262 | 2977990496 | |||
| 2263 | 2979713796 | |||
| 2264 | 2979750943 | |||
| 2265 | 2979771382 | |||
| 2266 | 2979778468 | |||
| 2267 | 2979781954 | |||
| 2268 | 2979795246 | |||
| 2269 | 2979811956 | |||
| 2270 | 2987638047 | |||
| 2271 | 2987650543 | |||
| 2272 | 2987653573 | |||
| 2273 | 2987663532 | |||
| 2274 | 2987669010 | |||
| 2275 | 2987680276 | |||
| 2276 | 2996313868 | |||
| 2277 | 2996340952 | |||
| 2278 | 2996344042 | |||
| 2279 | 2996350400 | |||
| 2280 | 2996391693 | |||
| 2281 | 3000140365 | |||
| 2282 | 3004169138 | |||
| 2283 | 3004192593 | |||
| 2284 | 3004199588 | |||
| 2285 | 3004205631 | |||
| 2286 | 3004216191 | |||
| 2287 | 3004223941 | |||
| 2288 | 3004233595 | |||
| 2289 | 3004246338 | |||
| 2290 | 3004255696 | |||
| 2291 | 3004269697 | |||
| 2292 | 3004277098 | |||
| 2293 | 3004294003 | |||
| 2294 | 3004334091 | |||
| 2295 | 637074367 | |||
| 2296 | 641642652 | |||
| 2297 | 649873174 | |||
| 2298 | 8004304579 | |||
| 2299 | 8004316238 | |||
| 2300 | 8004365715 | |||
| 2301 | 8004380619 | |||
| 2302 | 8004394356 | |||
| 2303 | 8004399782 | |||
| 2304 | 8004450258 | |||
| 2305 | 8004637243 | |||
| 2306 | 8004640597 | |||
| 2307 | 8004697363 | |||
| 2308 | 8004709559 | |||
| 2309 | 8004720917 | |||
| 2310 | 8004734257 | |||
| 2311 | 8055620987 | |||
| 2312 | 8057533473 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1g5r-assembly1.cif.gz_A | the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form | 0.9136 | 31 | 188 |
| 1g5r-assembly1.cif.gz_A | the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form | 0.9025 | 31 | 188 |
| 4hut-assembly1.cif.gz_B | structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp | 0.8481 | 33 | 202 |
| 4hut-assembly1.cif.gz_B | structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp | 0.8384 | 33 | 202 |
| 1g64-assembly1.cif.gz_B | the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex | 0.7968 | 14 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1g5rA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9077 | 31 | 188 | 3.40.50.300 |
| 1g5rA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8965 | 31 | 188 | 3.40.50.300 |
| 1g64A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8437 | 33 | 202 | 3.40.50.300 |
| 1g64A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8342 | 33 | 202 | 3.40.50.300 |
| af_I6Y1V6_9_207_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8003 | 33 | 202 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V9PFW6-F1-model_v4 | corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9472 | 47 | 179 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A382M5X8-F1-model_v4 | Cob(I)yrinic acid a,c-diamide adenosyltransferase | 0.9435 | 29 | 183 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-T1ALC8-F1-model_v4 | Cob(I)alamin adenosyltransferase (EC 2.5.1.17) | 0.9415 | 31 | 179 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A3D1XR81-F1-model_v4 | Cob(I)yrinic acid a,c-diamide adenosyltransferase | 0.9371 | 31 | 158 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A528N548-F1-model_v4 | corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9326 | 53 | 149 |
GO:0005524
GO:0008817 GO:0009236 |