F490950

General Info

Members Datasets Scaffolds Average Seq Length
1156 677 2312 203

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885312484|2885317772
Length 226
Sequence KHIEDKPHIEDKPHIEDGPHIEDGPINDRDEERHRAKMAKRKAVQDAEVAAKTVEKGLLIVNTGPGKGKTTAAFGLALRMLGYGKCVGVVQFIKGKWHTGEKDAFAVFGDRVVWHTMGEGFTWETQDLKRDIAAAEAAWAKALELMADPSISLLVLDELNIALRYDYLDLDKVVAALKGRREGLHVVVTGRNAKPALVDAADLVTEMGVTKHHFSAGVKAQQGIEF

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
134 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
222 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
255 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
387 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
390 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
391 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
392 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
393 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
396 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
397 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
398 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
399 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
400 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
401 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
402 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
403 2512875024
404 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
405 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
406 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
407 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
408 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
409 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
410 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
411 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
412 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
413 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
414 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
415 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
416 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
417 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
418 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
419 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
420 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
421 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
422 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
423 2738543024 Aminobacter sp. AP02 Isolate Unclassified
424 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
425 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
426 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
427 2841760612 Bosea sp. Tri-49 Isolate Nodule
428 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
429 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
430 2844104063 Bosea sp. Tri-39 Isolate Nodule
431 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
432 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
433 2851182111 Bosea sp. Tri-44 Isolate Nodule
434 2851246043 Bosea sp. Tri-54 Isolate Nodule
435 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
436 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
437 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
438 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
439 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
440 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
441 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
442 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
443 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
444 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
445 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
446 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
447 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
448 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
449 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
450 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
451 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
452 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
453 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
454 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
455 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
456 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
457 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
458 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
459 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
460 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
461 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
462 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
463 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
464 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
465 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
466 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
467 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
468 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
469 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
470 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
471 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
472 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
473 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
474 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
475 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
476 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
477 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
478 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
479 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
480 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
481 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
482 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
483 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
484 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
485 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
486 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
487 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
488 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
489 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
490 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
491 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
492 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
493 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
494 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
495 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
496 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
497 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
498 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
499 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
500 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
501 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
502 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
503 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
504 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
505 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
506 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
507 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
508 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
509 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
510 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
511 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
512 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
513 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
514 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
515 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
516 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
517 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
518 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
519 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
520 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
521 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
522 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
523 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
524 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
525 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
526 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
527 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
528 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
529 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
530 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
531 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
532 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
533 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
534 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
535 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
536 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
537 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
538 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
539 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
540 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
541 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
542 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
543 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
544 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
545 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
546 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
547 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
548 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
549 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
550 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
551 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
552 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
553 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
554 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
555 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
556 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
557 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
558 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
559 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
560 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
561 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
562 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
563 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
564 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
565 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
566 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
567 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
568 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
569 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
570 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
571 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
572 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
573 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
574 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
575 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
576 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
577 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
578 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
579 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
580 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
581 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
582 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
583 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
584 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
585 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
586 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
587 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
588 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
589 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
590 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
591 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
592 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
593 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
594 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
595 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
596 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
597 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
598 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
599 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
600 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
601 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
602 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
603 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
604 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
605 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
606 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
607 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
608 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
609 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
610 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
611 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
612 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
613 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
614 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
615 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
616 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
617 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
618 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
619 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
620 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
621 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
622 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
623 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
624 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
625 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
626 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
627 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
628 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
629 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
630 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
631 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
632 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
633 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
634 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
635 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
636 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
637 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
638 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
639 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
640 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
641 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
642 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
643 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
644 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
645 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
646 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
647 3004167301 Mesorhizobium loti 582 Isolate Unclassified
648 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
649 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
650 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
651 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
652 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
653 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
654 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
655 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
656 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
657 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
658 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
659 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
660 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
661 641522639 Methylobacterium sp. 4-46 Isolate Nodule
662 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
663 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
664 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
665 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
666 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
667 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
668 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
669 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
670 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
671 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
672 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
673 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
674 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
675 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
676 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
677 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.26
Metatranscriptomes 0.26
Isolates 24.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 21.19
Rhizoplane 7.44
Rhizosphere 60.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10050467 3300001989 Bacteria 1345
2 JGI24750J21931_1000910 3300002070 Bacteria 4007
3 JGI24738J21930_10043045 3300002075 Bacteria 918
4 JGI24742J22300_10017176 3300002244 Bacteria 1223
5 JGI25156J39149_1013582 3300002705 Bacteria 1720
6 JGI25157J39369_1000997 3300002741 Bacteria 13180
7 JGI25406J46586_10139439 3300003203 Bacteria 710
8 JGI25165J46597_1000169 3300003214 Bacteria 103007
9 Ga0055542_1000200 3300003762 Bacteria 73349
10 JGI25405J52794_10002905 3300003911 Bacteria 2983
11 Ga0070676_10196879 3300005328 Bacteria 1319
12 Ga0070670_100008924 3300005331 Bacteria 8561
13 Ga0070670_100026922 3300005331 Bacteria 4946
14 Ga0068869_100020500 3300005334 Bacteria 4533
15 Ga0070680_100033129 3300005336 Bacteria 4162
16 Ga0070680_100339604 3300005336 Bacteria 1276
17 Ga0070682_100017788 3300005337 Bacteria 4146
18 Ga0070682_100039512 3300005337 Bacteria 2900
19 Ga0068868_100020483 3300005338 Bacteria 4971
20 Ga0070660_100055566 3300005339 Bacteria 3060
21 Ga0070660_100112319 3300005339 Bacteria 2169
22 Ga0070660_100112987 3300005339 Bacteria 2162
23 Ga0070689_100009010 3300005340 Bacteria 7065
24 Ga0070689_100164065 3300005340 Bacteria 1797
25 Ga0070691_10070081 3300005341 Bacteria 1700
26 Ga0070687_100023504 3300005343 Bacteria 2930
27 Ga0070661_100152449 3300005344 Bacteria 1748
28 Ga0070692_10272221 3300005345 Bacteria 1023
29 Ga0070668_100022994 3300005347 Bacteria 4712
30 Ga0070669_100028839 3300005353 Bacteria 3997
31 Ga0070675_100038027 3300005354 Bacteria 3921
32 Ga0070671_100005178 3300005355 Bacteria 10386
33 Ga0070671_100115795 3300005355 Bacteria 2254
34 Ga0070671_100475128 3300005355 Bacteria 1074
35 Ga0070674_100134885 3300005356 Bacteria 1845
36 Ga0070674_100524366 3300005356 Bacteria 990
37 Ga0070673_100002387 3300005364 Bacteria 11434
38 Ga0070673_100017217 3300005364 Bacteria 5132
39 Ga0070688_100090372 3300005365 Bacteria 2000
40 Ga0070688_100203639 3300005365 Bacteria 1386
41 Ga0070688_100225450 3300005365 Bacteria 1323
42 Ga0070659_100015263 3300005366 Bacteria 5750
43 Ga0070659_100470197 3300005366 Bacteria 1069
44 Ga0070667_100022104 3300005367 Bacteria 5276
45 Ga0070709_10225004 3300005434 Bacteria 1340
46 Ga0070709_10294912 3300005434 Bacteria 1183
47 Ga0070714_100006761 3300005435 Bacteria 8889
48 Ga0070714_100014915 3300005435 Bacteria 6247
49 Ga0070714_100072142 3300005435 Bacteria 2988
50 Ga0070713_100035633 3300005436 Bacteria 4008
51 Ga0070701_10022341 3300005438 Bacteria 3031
52 Ga0070711_100017659 3300005439 Bacteria 4545
53 Ga0070711_100019153 3300005439 Bacteria 4386
54 Ga0070711_100028014 3300005439 Bacteria 3703
55 Ga0070711_100042386 3300005439 Bacteria 3076
56 Ga0070705_100087853 3300005440 Bacteria 1928
57 Ga0070700_100013506 3300005441 Bacteria 4587
58 Ga0070700_100448341 3300005441 Bacteria 981
59 Ga0070694_100110768 3300005444 Bacteria 1955
60 Ga0070663_100007259 3300005455 Bacteria 6736
61 Ga0070663_101021231 3300005455 Bacteria 720
62 Ga0070678_100076361 3300005456 Bacteria 2523
63 Ga0070678_100251956 3300005456 Bacteria 1481
64 Ga0070662_100030696 3300005457 Bacteria 3764
65 Ga0070681_10019614 3300005458 Bacteria 6771
66 Ga0070681_10283365 3300005458 Bacteria 1568
67 Ga0068867_100022577 3300005459 Bacteria 4498
68 Ga0068867_100380669 3300005459 Bacteria 1185
69 Ga0070685_10328632 3300005466 Bacteria 1039
70 Ga0070699_100008041 3300005518 Bacteria 9156
71 Ga0070699_101033580 3300005518 Bacteria 753
72 Ga0070679_100074479 3300005530 Bacteria 3386
73 Ga0070679_100474764 3300005530 Bacteria 1195
74 Ga0070684_100340907 3300005535 Bacteria 1378
75 Ga0068853_100010872 3300005539 Bacteria 7374
76 Ga0068853_100072716 3300005539 Bacteria 2997
77 Ga0068853_100074585 3300005539 Bacteria 2960
78 Ga0068853_100098013 3300005539 Bacteria 2589
79 Ga0070672_100078555 3300005543 Bacteria 2640
80 Ga0070686_100036914 3300005544 Bacteria 3028
81 Ga0070695_100177699 3300005545 Bacteria 1506
82 Ga0070695_100603673 3300005545 Bacteria 862
83 Ga0070696_100017390 3300005546 Bacteria 4852
84 Ga0070693_100068212 3300005547 Bacteria 2087
85 Ga0070665_100058543 3300005548 Bacteria 3862
86 Ga0070665_100128896 3300005548 Bacteria 2532
87 Ga0070665_100802197 3300005548 Bacteria 954
88 Ga0070704_100414052 3300005549 Bacteria 1153
89 Ga0068855_100430715 3300005563 Bacteria 1442
90 Ga0070664_100228552 3300005564 Bacteria 1667
91 Ga0068857_100039612 3300005577 Bacteria 4175
92 Ga0068857_100050634 3300005577 Bacteria 3684
93 Ga0068857_100294103 3300005577 Bacteria 1496
94 Ga0068854_100024038 3300005578 Bacteria 4168
95 Ga0068856_100169242 3300005614 Bacteria 2197
96 Ga0068856_100323279 3300005614 Bacteria 1560
97 Ga0070702_100017784 3300005615 Bacteria 3674
98 Ga0068852_100006835 3300005616 Bacteria 8285
99 Ga0068852_100232270 3300005616 Bacteria 1759
100 Ga0068852_100509272 3300005616 Bacteria 1200
101 Ga0068859_100022244 3300005617 Bacteria 6357
102 Ga0068864_100132570 3300005618 Bacteria 2240
103 Ga0068864_100146200 3300005618 Bacteria 2137
104 Ga0068864_100984487 3300005618 Bacteria 836
105 Ga0068866_10092731 3300005718 Bacteria 1648
106 Ga0068866_10302516 3300005718 Bacteria 999
107 Ga0068861_100016370 3300005719 Bacteria 5246
108 Ga0068870_10009492 3300005840 Bacteria 4431
109 Ga0068870_10228004 3300005840 Bacteria 1144
110 Ga0068863_100050157 3300005841 Bacteria 3958
111 Ga0068863_100763844 3300005841 Bacteria 963
112 Ga0068858_100020908 3300005842 Bacteria 6115
113 Ga0068858_100243165 3300005842 Bacteria 1708
114 Ga0068858_100298745 3300005842 Bacteria 1536
115 Ga0068860_100025571 3300005843 Bacteria 5694
116 Ga0068862_100054011 3300005844 Bacteria 3439
117 Ga0081455_10001749 3300005937 Bacteria 26266
118 Ga0081455_10011262 3300005937 Bacteria 9000
119 Ga0081455_10186942 3300005937 Bacteria 1564
120 Ga0081538_10062190 3300005981 Bacteria 2131
121 Ga0081540_1006291 3300005983 Bacteria 8690
122 Ga0081540_1049962 3300005983 Bacteria 2081
123 Ga0081539_10001319 3300005985 Bacteria 43381
124 Ga0070717_10025952 3300006028 Bacteria 4670
125 Ga0070717_10465328 3300006028 Bacteria 1141
126 Ga0070717_10517758 3300006028 Bacteria 1079
127 Ga0075365_10001839 3300006038 Bacteria 9944
128 Ga0075365_10024392 3300006038 Bacteria 3815
129 Ga0075365_10056680 3300006038 Bacteria 2605
130 Ga0075365_10069203 3300006038 Bacteria 2372
131 Ga0075365_10077631 3300006038 Bacteria 2244
132 Ga0075365_10271995 3300006038 Bacteria 1192
133 Ga0075368_10030186 3300006042 Bacteria 2098
134 Ga0075368_10081338 3300006042 Bacteria 1318
135 Ga0075363_100246617 3300006048 Bacteria 1028
136 Ga0075364_10131305 3300006051 Bacteria 1681
137 Ga0075364_10446615 3300006051 Bacteria 883
138 Ga0075432_10140533 3300006058 Bacteria 921
139 Ga0070715_10021970 3300006163 Bacteria 2482
140 Ga0070715_10069268 3300006163 Bacteria 1571
141 Ga0070715_10239304 3300006163 Bacteria 943
142 Ga0070716_100054170 3300006173 Bacteria 2290
143 Ga0070716_100127551 3300006173 Bacteria 1603
144 Ga0070716_100612329 3300006173 Bacteria 821
145 Ga0070712_100004818 3300006175 Bacteria 8341
146 Ga0070712_100056217 3300006175 Bacteria 2759
147 Ga0070712_100148098 3300006175 Bacteria 1799
148 Ga0070712_100218163 3300006175 Bacteria 1508
149 Ga0070712_100226120 3300006175 Bacteria 1484
150 Ga0070712_100275352 3300006175 Bacteria 1354
151 Ga0075362_10071418 3300006177 Bacteria 1586
152 Ga0075362_10218982 3300006177 Bacteria 930
153 Ga0075367_10055339 3300006178 Bacteria 2354
154 Ga0075367_10079432 3300006178 Bacteria 1983
155 Ga0075367_10132244 3300006178 Bacteria 1542
156 Ga0075367_10252806 3300006178 Bacteria 1105
157 Ga0075369_10010327 3300006186 Bacteria 3650
158 Ga0097621_100194830 3300006237 Bacteria 1757
159 Ga0075370_10078315 3300006353 Bacteria 1898
160 Ga0075370_10092918 3300006353 Bacteria 1741
161 Ga0075370_10146609 3300006353 Bacteria 1382
162 Ga0068871_100083108 3300006358 Bacteria 2656
163 Ga0068871_100090639 3300006358 Bacteria 2547
164 Ga0075428_100049970 3300006844 Bacteria 4587
165 Ga0075428_100178861 3300006844 Bacteria 2297
166 Ga0075428_100232500 3300006844 Bacteria 1989
167 Ga0075430_100158604 3300006846 Bacteria 1884
168 Ga0075431_100012803 3300006847 Bacteria 8468
169 Ga0075431_101006368 3300006847 Bacteria 800
170 Ga0075433_10561867 3300006852 Bacteria 1003
171 Ga0075434_100035343 3300006871 Bacteria 4940
172 Ga0068865_100259370 3300006881 Bacteria 1375
173 Ga0075436_100110197 3300006914 Bacteria 1921
174 Ga0097620_100022244 3300006931 Bacteria 6357
175 Ga0075435_100045163 3300007076 Bacteria 3531
176 Ga0099794_10004120 3300007265 Bacteria 5664
177 Ga0105240_10134618 3300009093 Bacteria 2960
178 Ga0111539_10051134 3300009094 Bacteria 4923
179 Ga0111539_10663176 3300009094 Bacteria 1215
180 Ga0105245_10020549 3300009098 Bacteria 5790
181 Ga0105245_10370007 3300009098 Bacteria 1425
182 Ga0105245_10536480 3300009098 Bacteria 1190
183 Ga0105247_10014879 3300009101 Bacteria 4665
184 Ga0105247_10414251 3300009101 Bacteria 963
185 Ga0114129_10036121 3300009147 Bacteria 6979
186 Ga0114129_10072223 3300009147 Bacteria 4811
187 Ga0114129_11772670 3300009147 Bacteria 751
188 Ga0105243_10024257 3300009148 Bacteria 4625
189 Ga0105243_10170997 3300009148 Bacteria 1882
190 Ga0105243_10879510 3300009148 Bacteria 890
191 Ga0105241_10027136 3300009174 Bacteria 4263
192 Ga0105241_10074374 3300009174 Bacteria 2646
193 Ga0105241_10354466 3300009174 Bacteria 1275
194 Ga0105242_10034422 3300009176 Bacteria 4060
195 Ga0105242_10065974 3300009176 Bacteria 2988
196 Ga0105248_10044999 3300009177 Bacteria 4949
197 Ga0105248_10053841 3300009177 Bacteria 4514
198 Ga0105248_10510321 3300009177 Bacteria 1356
199 Ga0105248_11126076 3300009177 Bacteria 887
200 Ga0105237_10026169 3300009545 Bacteria 5962
201 Ga0105237_10041723 3300009545 Bacteria 4627
202 Ga0105237_10282080 3300009545 Bacteria 1664
203 Ga0105237_10629232 3300009545 Bacteria 1080
204 Ga0105237_10681252 3300009545 Bacteria 1035
205 Ga0105238_10002854 3300009551 Bacteria 17259
206 Ga0105238_10045315 3300009551 Bacteria 4443
207 Ga0105238_10106658 3300009551 Bacteria 2783
208 Ga0105238_10112864 3300009551 Bacteria 2697
209 Ga0105249_10064133 3300009553 Bacteria 3377
210 Ga0099796_10013297 3300010159 Bacteria 2347
211 Ga0105239_10043981 3300010375 Bacteria 4897
212 Ga0105239_10064538 3300010375 Bacteria 4019
213 Ga0105239_10176966 3300010375 Bacteria 2386
214 Ga0105239_10647177 3300010375 Bacteria 1207
215 Ga0105239_10822845 3300010375 Bacteria 1064
216 Ga0105239_10888456 3300010375 Bacteria 1023
217 Ga0105239_10964561 3300010375 Bacteria 980
218 Ga0105246_10007627 3300011119 Bacteria 6638
219 Ga0105246_10025364 3300011119 Bacteria 3863
220 Ga0157369_10060339 3300013105 Bacteria 4090
221 Ga0157369_10771759 3300013105 Bacteria 988
222 Ga0157374_10015400 3300013296 Bacteria 6707
223 Ga0157374_10095167 3300013296 Bacteria 2847
224 Ga0157378_10424331 3300013297 Bacteria 1315
225 Ga0157378_11206481 3300013297 Bacteria 796
226 Ga0163162_10335844 3300013306 Bacteria 1643
227 Ga0163162_10795342 3300013306 Bacteria 1063
228 Ga0157372_10218214 3300013307 Bacteria 2211
229 Ga0157372_10713687 3300013307 Bacteria 1167
230 Ga0157372_11230711 3300013307 Bacteria 865
231 Ga0157375_10033186 3300013308 Bacteria 4903
232 Ga0157375_10034097 3300013308 Bacteria 4845
233 Ga0157375_10244445 3300013308 Bacteria 1954
234 Ga0157375_10533493 3300013308 Bacteria 1336
235 Ga0157375_10823611 3300013308 Bacteria 1076
236 Ga0163163_10018988 3300014325 Bacteria 6449
237 Ga0163163_10114772 3300014325 Bacteria 2725
238 Ga0163163_10268731 3300014325 Bacteria 1756
239 Ga0157380_10053558 3300014326 Bacteria 3199
240 Ga0182008_10080176 3300014497 Bacteria 1606
241 Ga0182008_10154103 3300014497 Bacteria 1153
242 Ga0157379_10022797 3300014968 Bacteria 5549
243 Ga0157379_10114352 3300014968 Bacteria 2426
244 Ga0157379_10557822 3300014968 Bacteria 1066
245 Ga0157376_10028668 3300014969 Bacteria 4427
246 Ga0157376_10067241 3300014969 Bacteria 3031
247 Ga0182006_1017306 3300015261 Bacteria 3065
248 Ga0163161_10522088 3300017792 Bacteria 970
249 Ga0163161_10734302 3300017792 Bacteria 825
250 Ga0213876_10015925 3300021384 Bacteria 3978
251 Ga0213876_10157131 3300021384 Bacteria 1210
252 Ga0213876_10308927 3300021384 Bacteria 841
253 Ga0213875_10000012 3300021388 Bacteria 312017
254 Ga0213871_10012865 3300021441 Bacteria 1954
255 Ga0224572_1023175 3300024225 Bacteria 1193
256 Ga0224572_1057975 3300024225 Bacteria 718
257 Ga0228598_1010721 3300024227 Bacteria 1825
258 Ga0209026_1000024 3300025250 Bacteria 355839
259 Ga0209148_1000050 3300025254 Bacteria 413178
260 Ga0209759_1000057 3300025256 Bacteria 205181
261 Ga0209233_1000010 3300025261 Bacteria 1194329
262 Ga0209455_1000147 3300025272 Bacteria 132054
263 Ga0209758_1009276 3300025297 Bacteria 6153
264 Ga0207697_10035008 3300025315 Bacteria 2055
265 Ga0207697_10122578 3300025315 Bacteria 1119
266 Ga0207682_10034780 3300025893 Bacteria 2033
267 Ga0207692_10078289 3300025898 Bacteria 1761
268 Ga0207642_10051184 3300025899 Bacteria 1867
269 Ga0207642_10224843 3300025899 Bacteria 1051
270 Ga0207710_10015213 3300025900 Bacteria 3250
271 Ga0207710_10265138 3300025900 Bacteria 862
272 Ga0207688_10025353 3300025901 Bacteria 3255
273 Ga0207647_10005228 3300025904 Bacteria 9554
274 Ga0207647_10010727 3300025904 Bacteria 6454
275 Ga0207647_10339482 3300025904 Bacteria 851
276 Ga0207685_10013814 3300025905 Bacteria 2509
277 Ga0207685_10060984 3300025905 Bacteria 1494
278 Ga0207685_10074828 3300025905 Bacteria 1384
279 Ga0207685_10078215 3300025905 Bacteria 1361
280 Ga0207685_10256895 3300025905 Bacteria 847
281 Ga0207699_10014392 3300025906 Bacteria 4077
282 Ga0207699_10162535 3300025906 Bacteria 1488
283 Ga0207699_10201597 3300025906 Bacteria 1348
284 Ga0207645_10012885 3300025907 Bacteria 5659
285 Ga0207645_10173531 3300025907 Bacteria 1414
286 Ga0207643_10003096 3300025908 Bacteria 8941
287 Ga0207705_10330446 3300025909 Bacteria 1172
288 Ga0207654_10012383 3300025911 Bacteria 4372
289 Ga0207654_10255213 3300025911 Bacteria 1177
290 Ga0207707_10011468 3300025912 Bacteria 7718
291 Ga0207707_10148445 3300025912 Bacteria 2050
292 Ga0207695_10254777 3300025913 Bacteria 1654
293 Ga0207695_10309941 3300025913 Bacteria 1469
294 Ga0207671_10067599 3300025914 Bacteria 2662
295 Ga0207693_10001484 3300025915 Bacteria 20734
296 Ga0207693_10002742 3300025915 Bacteria 15254
297 Ga0207693_10162406 3300025915 Bacteria 1758
298 Ga0207693_10238849 3300025915 Bacteria 1426
299 Ga0207663_10015883 3300025916 Bacteria 4164
300 Ga0207663_10156431 3300025916 Bacteria 1604
301 Ga0207663_10754050 3300025916 Bacteria 773
302 Ga0207660_10056067 3300025917 Bacteria 2819
303 Ga0207657_10062636 3300025919 Bacteria 3183
304 Ga0207657_10095352 3300025919 Bacteria 2476
305 Ga0207657_10377948 3300025919 Bacteria 1116
306 Ga0207657_10780988 3300025919 Bacteria 739
307 Ga0207649_10115358 3300025920 Bacteria 1802
308 Ga0207649_10276410 3300025920 Bacteria 1219
309 Ga0207681_10187187 3300025923 Bacteria 1581
310 Ga0207694_10010089 3300025924 Bacteria 7118
311 Ga0207694_10199190 3300025924 Bacteria 1629
312 Ga0207694_10288861 3300025924 Bacteria 1348
313 Ga0207650_10002963 3300025925 Bacteria 11718
314 Ga0207650_10009740 3300025925 Bacteria 6571
315 Ga0207650_10153897 3300025925 Bacteria 1817
316 Ga0207659_10009295 3300025926 Bacteria 6137
317 Ga0207659_10468502 3300025926 Bacteria 1063
318 Ga0207687_10026158 3300025927 Bacteria 3907
319 Ga0207687_10357472 3300025927 Bacteria 1191
320 Ga0207687_11047360 3300025927 Bacteria 700
321 Ga0207700_10103615 3300025928 Bacteria 2275
322 Ga0207700_10532069 3300025928 Bacteria 1042
323 Ga0207700_10929169 3300025928 Bacteria 778
324 Ga0207664_10052285 3300025929 Bacteria 3230
325 Ga0207664_10103384 3300025929 Bacteria 2357
326 Ga0207644_10007084 3300025931 Bacteria 7311
327 Ga0207644_10015159 3300025931 Bacteria 5171
328 Ga0207644_10205499 3300025931 Bacteria 1555
329 Ga0207690_10038670 3300025932 Bacteria 3107
330 Ga0207690_10055991 3300025932 Bacteria 2658
331 Ga0207690_10385324 3300025932 Bacteria 1115
332 Ga0207706_10009674 3300025933 Bacteria 8850
333 Ga0207706_10392329 3300025933 Bacteria 1204
334 Ga0207686_10213296 3300025934 Bacteria 1389
335 Ga0207709_10083875 3300025935 Bacteria 2062
336 Ga0207709_10793189 3300025935 Bacteria 764
337 Ga0207670_10006644 3300025936 Bacteria 6432
338 Ga0207670_10008195 3300025936 Bacteria 5883
339 Ga0207670_10036710 3300025936 Bacteria 3189
340 Ga0207669_10013106 3300025937 Bacteria 4104
341 Ga0207704_10043058 3300025938 Bacteria 2662
342 Ga0207665_10354136 3300025939 Bacteria 1109
343 Ga0207665_10356243 3300025939 Bacteria 1105
344 Ga0207691_10003971 3300025940 Bacteria 14363
345 Ga0207711_10025426 3300025941 Bacteria 4969
346 Ga0207711_10083554 3300025941 Bacteria 2793
347 Ga0207711_10473478 3300025941 Bacteria 1167
348 Ga0207689_10001884 3300025942 Bacteria 19842
349 Ga0207689_10214342 3300025942 Bacteria 1591
350 Ga0207661_10259695 3300025944 Bacteria 1547
351 Ga0207679_10063594 3300025945 Bacteria 2755
352 Ga0207679_10083748 3300025945 Bacteria 2445
353 Ga0207679_10222495 3300025945 Bacteria 1589
354 Ga0207667_10164319 3300025949 Bacteria 2282
355 Ga0207667_10374665 3300025949 Bacteria 1450
356 Ga0207651_10003503 3300025960 Bacteria 7716
357 Ga0207651_10005442 3300025960 Bacteria 6536
358 Ga0207712_10122487 3300025961 Bacteria 1970
359 Ga0207668_10033695 3300025972 Bacteria 3394
360 Ga0207668_10310866 3300025972 Bacteria 1304
361 Ga0207668_10438777 3300025972 Bacteria 1112
362 Ga0207640_10047119 3300025981 Bacteria 2778
363 Ga0207640_11048000 3300025981 Bacteria 719
364 Ga0207658_10052929 3300025986 Bacteria 2997
365 Ga0207658_10307058 3300025986 Bacteria 1369
366 Ga0207658_10380210 3300025986 Bacteria 1237
367 Ga0207658_11233913 3300025986 Bacteria 684
368 Ga0207677_10107247 3300026023 Bacteria 2071
369 Ga0207703_10012529 3300026035 Bacteria 6609
370 Ga0207703_10236678 3300026035 Bacteria 1640
371 Ga0207703_10572259 3300026035 Bacteria 1067
372 Ga0207639_10024726 3300026041 Bacteria 4351
373 Ga0207639_10449794 3300026041 Bacteria 1169
374 Ga0207639_10699591 3300026041 Bacteria 940
375 Ga0207678_10000114 3300026067 Bacteria 66223
376 Ga0207678_10088790 3300026067 Bacteria 2642
377 Ga0207708_10028546 3300026075 Bacteria 4225
378 Ga0207708_10368305 3300026075 Bacteria 1182
379 Ga0207702_10226090 3300026078 Bacteria 1746
380 Ga0207702_10250892 3300026078 Bacteria 1662
381 Ga0207641_10037528 3300026088 Bacteria 4047
382 Ga0207641_10696710 3300026088 Bacteria 1000
383 Ga0207648_10003613 3300026089 Bacteria 16172
384 Ga0207648_10168303 3300026089 Bacteria 1937
385 Ga0207676_10037967 3300026095 Bacteria 3674
386 Ga0207676_10187741 3300026095 Bacteria 1816
387 Ga0207676_10269817 3300026095 Bacteria 1540
388 Ga0207674_10017777 3300026116 Bacteria 7751
389 Ga0207674_10087226 3300026116 Bacteria 3115
390 Ga0207674_10120939 3300026116 Bacteria 2586
391 Ga0207675_100014341 3300026118 Bacteria 7389
392 Ga0207675_100917457 3300026118 Bacteria 892
393 Ga0207683_10009784 3300026121 Bacteria 8173
394 Ga0207683_10027474 3300026121 Bacteria 4917
395 Ga0207698_10059041 3300026142 Bacteria 2976
396 Ga0207698_10351662 3300026142 Bacteria 1392
397 Ga0209179_1021607 3300027512 Bacteria 1257
398 Ga0209813_10045297 3300027866 Bacteria 1355
399 Ga0207428_10179758 3300027907 Bacteria 1599
400 Ga0265357_1000569 3300028023 Bacteria 2241
401 Ga0268266_10012797 3300028379 Bacteria 7248
402 Ga0268266_10054805 3300028379 Bacteria 3427
403 Ga0268266_10306317 3300028379 Bacteria 1483
404 Ga0268265_10233343 3300028380 Bacteria 1618
405 Ga0268264_10015832 3300028381 Bacteria 6175
406 Ga0265762_1075661 3300030760 Bacteria 714
407 Ga0265773_1001072 3300031018 Bacteria 1369
408 Ga0265760_10170059 3300031090 Bacteria 723
409 Ga0265332_10000592 3300031238 Bacteria 23812
410 Ga0265329_10008897 3300031242 Bacteria 3781
411 Ga0265340_10007268 3300031247 Bacteria 6022
412 Ga0265339_10001715 3300031249 Bacteria 16151
413 Ga0265331_10009132 3300031250 Bacteria 5595
414 Ga0307513_10048573 3300031456 Bacteria 4605
415 Ga0265313_10069555 3300031595 Bacteria 1624
416 Ga0265342_10000116 3300031712 Bacteria 87805
417 Ga0307405_10327522 3300031731 Bacteria 1173
418 Ga0373930_0003794 3300034816 Bacteria 2423
419 Ga0373938_0061441 3300034957 Bacteria 880
420 Ga0373926_0166397 3300035083 Bacteria 843
421 Ga0373929_0029226 3300035085 Bacteria 1168
422 Ga0373934_0036930 3300035086 Bacteria 1924
423 Ga0373934_0055431 3300035086 Bacteria 1575
424 Ga0373940_0023298 3300035088 Bacteria 1597
425 Ga0373949_0019950 3300035090 Bacteria 1531
426 Ga0373923_0000186 3300035111 Bacteria 12562
427 Ga0373923_0129768 3300035111 Bacteria 1132
428 Ga0373936_0016342 3300035113 Bacteria 2855
429 Ga0373936_0053012 3300035113 Bacteria 1644
430 Ga0373936_0107799 3300035113 Bacteria 1180
431 Ga0373936_0246278 3300035113 Bacteria 797
432 Ga0373939_0018875 3300035114 Bacteria 1854
433 Ga0373945_0137623 3300035116 Bacteria 983
434 Ga0373953_0011844 3300035117 Bacteria 3073
435 Ga0373953_0018792 3300035117 Bacteria 2562
436 Ga0373953_0093923 3300035117 Bacteria 1257
437 Ga0373954_0008300 3300035118 Bacteria 4557
438 Ga0373956_0046593 3300035119 Bacteria 1938
439 Ga0373956_0095422 3300035119 Bacteria 1375
440 Ga0373960_0015866 3300035121 Bacteria 1929
441 Ga0373943_0071731 3300035170 Bacteria 1755
442 Ga0373943_0494382 3300035170 Bacteria 714
443 Ga0373946_0044720 3300035171 Bacteria 1829
444 Ga0373955_0003215 3300035172 Bacteria 7158
445 Ga0373955_0400129 3300035172 Bacteria 834
446 Ga0373955_0417070 3300035172 Bacteria 816
447 Ga0373924_0005086 3300035410 Bacteria 4635
448 Ga0373924_0017966 3300035410 Bacteria 2720
449 Ga0373924_0040202 3300035410 Bacteria 1913
450 Ga0373924_0057140 3300035410 Bacteria 1627
451 Ga0373924_0098036 3300035410 Bacteria 1259
452 Ga0373931_0063588 3300035691 Bacteria 1995
453 Ga0373931_0070201 3300035691 Bacteria 1910
454 Ga0373931_0110931 3300035691 Bacteria 1556
455 Ga0373935_0001959 3300035692 Bacteria 11590
456 Ga0373935_0005867 3300035692 Bacteria 7275
457 Ga0373935_0097259 3300035692 Bacteria 1936
458 Ga0373935_0130725 3300035692 Bacteria 1687
459 Ga0373935_0202041 3300035692 Bacteria 1373
460 Ga0373935_0288881 3300035692 Bacteria 1156
461 Ga0373935_0355931 3300035692 Bacteria 1044
462 Ga0373935_0451083 3300035692 Bacteria 929
463 Ga0373935_0504630 3300035692 Bacteria 878
464 Ga0373927_0015698 3300035695 Bacteria 5002
465 Ga0373927_0023606 3300035695 Bacteria 4026
466 Ga0373927_0063346 3300035695 Bacteria 2391
467 Ga0373927_0118559 3300035695 Bacteria 1727
468 Ga0373927_0162990 3300035695 Bacteria 1461
469 Ga0373933_0002179 3300035724 Bacteria 11217
470 Ga0373933_0002211 3300035724 Bacteria 11103
471 Ga0373933_0031590 3300035724 Bacteria 3072
472 Ga0373933_0101391 3300035724 Bacteria 1786
473 Ga0373947_0002362 3300035725 Bacteria 11399
474 Ga0373947_0027690 3300035725 Bacteria 3318
475 Ga0373947_0051532 3300035725 Bacteria 2476
476 Ga0373947_0055899 3300035725 Bacteria 2385
477 Ga0373947_0167396 3300035725 Bacteria 1424
478 Ga0373947_0612285 3300035725 Bacteria 742
479 Ga0373937_0000041 3300036401 Bacteria 108866
480 Ga0373937_0000765 3300036401 Bacteria 27786
481 Ga0373937_0003840 3300036401 Bacteria 12699
482 Ga0373937_0005787 3300036401 Bacteria 10629
483 Ga0373925_0000793 3300037068 Bacteria 29112
484 Ga0373925_0048603 3300037068 Bacteria 3161
485 Ga0373925_0102482 3300037068 Bacteria 2202
486 Ga0373925_0119993 3300037068 Bacteria 2041
487 Ga0373925_0336041 3300037068 Bacteria 1224
488 Ga0395900_0019120 3300037418 Bacteria 6985
489 Ga0395900_0061732 3300037418 Bacteria 3853
490 Ga0395898_0227185 3300037466 Bacteria 1780
491 Ga0395898_0322217 3300037466 Bacteria 1474
492 Ga0395898_0617648 3300037466 Bacteria 1027
493 Ga0395905_0049568 3300037471 Bacteria 3935
494 Ga0395905_0282703 3300037471 Bacteria 1545
495 Ga0436364_0347683 3300037853 Bacteria 5933
496 Ga0436364_0553890 3300037853 Bacteria 33608
497 Ga0436364_0683938 3300037853 Bacteria 1052
498 Ga0436364_0739297 3300037853 Bacteria 837
499 Ga0436364_1241746 3300037853 Bacteria 1883
500 Ga0436364_1465720 3300037853 Bacteria 1080
501 Ga0436364_1491432 3300037853 Bacteria 1390
502 Ga0395901_0011146 3300038443 Bacteria 9110
503 Ga0395901_0103612 3300038443 Bacteria 2985
504 Ga0395901_0155826 3300038443 Bacteria 2399
505 Ga0395901_0266605 3300038443 Bacteria 1782
506 Ga0436365_0238303 3300039437 Bacteria 3484
507 Ga0436365_0319814 3300039437 Bacteria 4320
508 Ga0436365_0879496 3300039437 Bacteria 831
509 Ga0436365_0899547 3300039437 Bacteria 1294
510 Ga0436365_1529562 3300039437 Bacteria 1348
511 Ga0436360_1334791 3300039438 Bacteria 1288
512 Ga0436362_0706089 3300039453 Bacteria 980
513 Ga0439455_0058449 3300042012 Bacteria 1019
514 Ga0466972_0022440 3300044658 Bacteria 3144
515 Ga0466960_0037172 3300044901 Bacteria 2283
516 Ga0495592_0003368 3300046454 Bacteria 11447
517 Ga0495592_0008877 3300046454 Bacteria 7549
518 Ga0495592_0046621 3300046454 Bacteria 3230
519 Ga0495592_0104615 3300046454 Bacteria 2012
520 Ga0495592_0132975 3300046454 Bacteria 1738
521 Ga0495592_0444990 3300046454 Bacteria 813
522 Ga0495603_0365604 3300046455 Bacteria 828
523 Ga0495603_0405386 3300046455 Bacteria 781
524 Ga0495590_0091075 3300046457 Bacteria 1079
525 Ga0495629_0006715 3300046459 Bacteria 8508
526 Ga0495629_0011756 3300046459 Bacteria 6352
527 Ga0495629_0018879 3300046459 Bacteria 4928
528 Ga0495629_0298998 3300046459 Bacteria 1102
529 Ga0495638_0009008 3300046460 Bacteria 7035
530 Ga0495638_0113930 3300046460 Bacteria 1604
531 Ga0495641_0032701 3300046461 Bacteria 2474
532 Ga0495651_0008706 3300046462 Bacteria 7788
533 Ga0495651_0009661 3300046462 Bacteria 7417
534 Ga0495651_0012317 3300046462 Bacteria 6593
535 Ga0495651_0093756 3300046462 Bacteria 2247
536 Ga0495653_0000646 3300046463 Bacteria 26579
537 Ga0495653_0000993 3300046463 Bacteria 21848
538 Ga0495653_0017117 3300046463 Bacteria 5897
539 Ga0495653_0169725 3300046463 Bacteria 1507
540 Ga0495653_0313116 3300046463 Bacteria 1020
541 Ga0495653_0422124 3300046463 Bacteria 844
542 Ga0495662_0000711 3300046476 Bacteria 15829
543 Ga0495662_0002469 3300046476 Bacteria 9309
544 Ga0495662_0160845 3300046476 Bacteria 1106
545 Ga0495664_0000008 3300046477 Bacteria 307158
546 Ga0495664_0000887 3300046477 Bacteria 15386
547 Ga0495664_0093110 3300046477 Bacteria 1813
548 Ga0495584_0084484 3300046491 Bacteria 1599
549 Ga0495594_0343858 3300046499 Bacteria 849
550 Ga0495607_0223027 3300046501 Bacteria 921
551 Ga0495608_0000226 3300046511 Bacteria 40663
552 Ga0495608_0000752 3300046511 Bacteria 22646
553 Ga0495608_0133229 3300046511 Bacteria 1589
554 Ga0495618_0000826 3300046514 Bacteria 21563
555 Ga0495618_0003138 3300046514 Bacteria 10388
556 Ga0495618_0042615 3300046514 Bacteria 2861
557 Ga0495618_0404693 3300046514 Bacteria 834
558 Ga0495628_0000802 3300046516 Bacteria 29022
559 Ga0495628_0016982 3300046516 Bacteria 6065
560 Ga0495628_0054502 3300046516 Bacteria 3152
561 Ga0495630_0008988 3300046517 Bacteria 7175
562 Ga0495630_0082128 3300046517 Bacteria 2432
563 Ga0495630_0086103 3300046517 Bacteria 2373
564 Ga0495630_0164829 3300046517 Bacteria 1687
565 Ga0495630_0210305 3300046517 Bacteria 1485
566 Ga0495630_0223728 3300046517 Bacteria 1437
567 Ga0495630_0365337 3300046517 Bacteria 1105
568 Ga0495637_0013652 3300046520 Bacteria 3851
569 Ga0495663_0219220 3300046525 Bacteria 668
570 Ga0495666_0076154 3300046526 Bacteria 1590
571 Ga0495652_0000005 3300046529 Bacteria 524368
572 Ga0495652_0008781 3300046529 Bacteria 9199
573 Ga0495654_0253131 3300046530 Bacteria 733
574 Ga0495665_0043393 3300046531 Bacteria 2392
575 Ga0495665_0061360 3300046531 Bacteria 1985
576 Ga0495665_0373357 3300046531 Bacteria 725
577 Ga0495640_0000020 3300046533 Bacteria 116618
578 Ga0495640_0005859 3300046533 Bacteria 9753
579 Ga0495640_0042211 3300046533 Bacteria 3184
580 Ga0495640_0282965 3300046533 Bacteria 1032
581 Ga0495586_0008716 3300046535 Bacteria 5402
582 Ga0495587_0000005 3300046536 Bacteria 358412
583 Ga0495587_0008717 3300046536 Bacteria 6509
584 Ga0495587_0293760 3300046536 Bacteria 909
585 Ga0495598_0034691 3300046537 Bacteria 1440
586 Ga0495621_0125722 3300046539 Bacteria 994
587 Ga0495645_0000007 3300046543 Bacteria 376299
588 Ga0495645_0005621 3300046543 Bacteria 8626
589 Ga0495645_0466340 3300046543 Bacteria 794
590 Ga0495667_0000618 3300046559 Bacteria 22683
591 Ga0495667_0020766 3300046559 Bacteria 4431
592 Ga0495667_0042272 3300046559 Bacteria 3022
593 Ga0495667_0147663 3300046559 Bacteria 1514
594 Ga0495668_0079485 3300046616 Bacteria 1800
595 Ga0495668_0192880 3300046616 Bacteria 1116
596 Ga0495634_0001129 3300046642 Bacteria 24685
597 Ga0495634_0002902 3300046642 Bacteria 14055
598 Ga0495634_0004881 3300046642 Bacteria 10392
599 Ga0495625_0054621 3300046660 Bacteria 2852
600 Ga0495635_0000010 3300046663 Bacteria 246385
601 Ga0495635_0003537 3300046663 Bacteria 10816
602 Ga0495635_0004407 3300046663 Bacteria 9748
603 Ga0495635_0164890 3300046663 Bacteria 1508
604 Ga0495635_0292004 3300046663 Bacteria 1094
605 Ga0495661_0144484 3300046665 Bacteria 1291
606 Ga0495588_0014853 3300046674 Bacteria 3737
607 Ga0495657_0000052 3300046675 Bacteria 101480
608 Ga0495657_0116496 3300046675 Bacteria 1687
609 Ga0495599_0000240 3300046678 Bacteria 34600
610 Ga0495599_0086062 3300046678 Bacteria 1963
611 Ga0495599_0167550 3300046678 Bacteria 1356
612 Ga0495623_0001009 3300046679 Bacteria 19010
613 Ga0495623_0040075 3300046679 Bacteria 2992
614 Ga0495646_0000663 3300046680 Bacteria 18904
615 Ga0495646_0054944 3300046680 Bacteria 2393
616 Ga0495646_0232869 3300046680 Bacteria 992
617 Ga0495647_0019819 3300046681 Bacteria 2409
618 Ga0495647_0071643 3300046681 Bacteria 1388
619 Ga0495658_0023605 3300046683 Bacteria 3266
620 Ga0495613_0010045 3300046689 Bacteria 7031
621 Ga0495613_0031750 3300046689 Bacteria 3923
622 Ga0495613_0538713 3300046689 Bacteria 782
623 Ga0495624_0163530 3300046690 Bacteria 1359
624 Ga0495624_0297992 3300046690 Bacteria 972
625 Ga0495671_0338955 3300046692 Bacteria 721
626 Ga0495649_0209191 3300046694 Bacteria 1011
627 Ga0495589_0202378 3300046794 Bacteria 937
628 Ga0495600_0000016 3300046809 Bacteria 111762
629 Ga0495600_0180299 3300046809 Bacteria 1361
630 Ga0495581_0001818 3300047315 Bacteria 11939
631 Ga0495581_0059483 3300047315 Bacteria 2208
632 Ga0495581_0229004 3300047315 Bacteria 1087
633 Ga0495581_0269454 3300047315 Bacteria 996
634 Ga0495604_0000634 3300047317 Bacteria 30185
635 Ga0495604_0001065 3300047317 Bacteria 22769
636 Ga0495604_0065212 3300047317 Bacteria 2773
637 Ga0495604_0158999 3300047317 Bacteria 1598
638 Ga0495604_0221651 3300047317 Bacteria 1302
639 Ga0495674_0000012 3300047319 Bacteria 270651
640 Ga0495674_0006055 3300047319 Bacteria 11608
641 Ga0495674_0006411 3300047319 Bacteria 11283
642 Ga0495674_0130779 3300047319 Bacteria 2115
643 Ga0495674_0310616 3300047319 Bacteria 1286
644 Ga0495674_0509384 3300047319 Bacteria 962
645 Ga0495676_0119139 3300047321 Bacteria 1923
646 Ga0495680_0001629 3300047322 Bacteria 23855
647 Ga0495680_0009090 3300047322 Bacteria 8967
648 Ga0495680_0045962 3300047322 Bacteria 3445
649 Ga0495675_0002307 3300047444 Bacteria 11396
650 Ga0495675_0007464 3300047444 Bacteria 6732
651 Ga0495684_0001027 3300047471 Bacteria 22679
652 Ga0495684_0002302 3300047471 Bacteria 15288
653 Ga0495684_0016011 3300047471 Bacteria 5773
654 Ga0495684_0079481 3300047471 Bacteria 2490
655 Ga0495684_0352333 3300047471 Bacteria 1045
656 Ga0495684_0470611 3300047471 Bacteria 869
657 Ga0495686_0198233 3300047472 Bacteria 1154
658 Ga0495593_0001783 3300047673 Bacteria 12753
659 Ga0495593_0094449 3300047673 Bacteria 1538
660 Ga0495593_0187771 3300047673 Bacteria 1040
661 Ga0495593_0298058 3300047673 Bacteria 806
662 Ga0495602_0001567 3300048088 Bacteria 22767
663 Ga0495602_0012027 3300048088 Bacteria 8923
664 Ga0495602_0351420 3300048088 Bacteria 1064
665 Ga0495602_0527478 3300048088 Bacteria 822
666 Ga0496100_0007628 3300048903 Bacteria 5985
667 Ga0496100_0099344 3300048903 Bacteria 2002
668 Ga0496100_0187516 3300048903 Bacteria 1499
669 Ga0496100_0262056 3300048903 Bacteria 1282
670 Ga0496100_0367903 3300048903 Bacteria 1089
671 Ga0496100_0848620 3300048903 Bacteria 716
672 Ga0496101_0002917 3300048904 Bacteria 10515
673 Ga0496101_0019876 3300048904 Bacteria 4592
674 Ga0496101_0040185 3300048904 Bacteria 3331
675 Ga0496101_0155419 3300048904 Bacteria 1752
676 Ga0496101_0333014 3300048904 Bacteria 1192
677 Ga0496101_0502176 3300048904 Bacteria 958
678 Ga0496101_0559306 3300048904 Bacteria 904
679 Ga0496101_0661406 3300048904 Bacteria 825
680 Ga0496102_0052231 3300048905 Bacteria 3723
681 Ga0496102_0191607 3300048905 Bacteria 1927
682 Ga0496102_0227289 3300048905 Bacteria 1759
683 Ga0496102_0402564 3300048905 Bacteria 1287
684 Ga0496102_0604478 3300048905 Bacteria 1020
685 Ga0496103_0008526 3300048906 Bacteria 6090
686 Ga0496103_0042248 3300048906 Bacteria 2804
687 Ga0496103_0082896 3300048906 Bacteria 2018
688 Ga0496103_0154006 3300048906 Bacteria 1473
689 Ga0496104_0012127 3300048907 Bacteria 7740
690 Ga0496104_0017672 3300048907 Bacteria 6500
691 Ga0496104_0037881 3300048907 Bacteria 4509
692 Ga0496104_0114326 3300048907 Bacteria 2588
693 Ga0496104_0441268 3300048907 Bacteria 1213
694 Ga0496104_0762000 3300048907 Bacteria 875
695 Ga0496105_0039220 3300048908 Bacteria 3903
696 Ga0496105_0052851 3300048908 Bacteria 3355
697 Ga0496105_0144491 3300048908 Bacteria 1957
698 Ga0496105_0149309 3300048908 Bacteria 1921
699 Ga0496106_0015557 3300048909 Bacteria 5627
700 Ga0496106_0020585 3300048909 Bacteria 4897
701 Ga0496106_0054205 3300048909 Bacteria 3029
702 Ga0496107_0003486 3300048910 Bacteria 10521
703 Ga0496107_0033283 3300048910 Bacteria 3687
704 Ga0496107_0100544 3300048910 Bacteria 2120
705 Ga0496107_0327686 3300048910 Bacteria 1139
706 Ga0496107_0434188 3300048910 Bacteria 976
707 Ga0496108_0001144 3300048911 Bacteria 20717
708 Ga0496108_0041960 3300048911 Bacteria 3819
709 Ga0496108_0183319 3300048911 Bacteria 1813
710 Ga0496108_0275614 3300048911 Bacteria 1464
711 Ga0496108_0588975 3300048911 Bacteria 969
712 Ga0496109_0039235 3300048912 Bacteria 4285
713 Ga0496109_0040330 3300048912 Bacteria 4228
714 Ga0496109_0092525 3300048912 Bacteria 2797
715 Ga0496109_0216645 3300048912 Bacteria 1800
716 Ga0496110_0158579 3300048913 Bacteria 2051
717 Ga0496110_0208332 3300048913 Bacteria 1777
718 Ga0496110_0295488 3300048913 Bacteria 1475
719 Ga0496110_0625265 3300048913 Bacteria 976
720 Ga0496111_0002536 3300048914 Bacteria 11024
721 Ga0496111_0065884 3300048914 Bacteria 2630
722 Ga0496111_0085197 3300048914 Bacteria 2310
723 Ga0496112_0001224 3300048915 Bacteria 19328
724 Ga0496112_0055827 3300048915 Bacteria 3885
725 Ga0496112_0093758 3300048915 Bacteria 2972
726 Ga0496112_0117175 3300048915 Bacteria 2633
727 Ga0496112_0162763 3300048915 Bacteria 2197
728 Ga0496112_0215010 3300048915 Bacteria 1879
729 Ga0496112_0239586 3300048915 Bacteria 1767
730 Ga0496112_0282322 3300048915 Bacteria 1607
731 Ga0496112_0380811 3300048915 Bacteria 1352
732 Ga0496113_0003020 3300048916 Bacteria 9971
733 Ga0496113_0084544 3300048916 Bacteria 2436
734 Ga0496113_0187071 3300048916 Bacteria 1643
735 Ga0496113_0188868 3300048916 Bacteria 1635
736 Ga0496113_0220905 3300048916 Bacteria 1510
737 Ga0496113_0604244 3300048916 Bacteria 878
738 Ga0496113_0726241 3300048916 Bacteria 792
739 Ga0496114_0022995 3300048917 Bacteria 5081
740 Ga0496114_0077004 3300048917 Bacteria 2811
741 Ga0496114_0273533 3300048917 Bacteria 1488
742 Ga0496114_0411623 3300048917 Bacteria 1197
743 Ga0496115_0001274 3300048918 Bacteria 18022
744 Ga0496115_0002540 3300048918 Bacteria 13126
745 Ga0496115_0014554 3300048918 Bacteria 5954
746 Ga0496115_0066601 3300048918 Bacteria 2911
747 Ga0496115_0081735 3300048918 Bacteria 2631
748 Ga0496115_0111402 3300048918 Bacteria 2248
749 Ga0496115_0382915 3300048918 Bacteria 1144
750 Ga0496115_0609617 3300048918 Bacteria 867
751 Ga0496119_0005212 3300048922 Bacteria 12550
752 Ga0496119_0051069 3300048922 Bacteria 2544
753 Ga0496119_0189002 3300048922 Bacteria 1074
754 Ga0496120_0001261 3300048923 Bacteria 31815
755 Ga0496120_0050705 3300048923 Bacteria 2375
756 Ga0496121_0333629 3300048924 Bacteria 1016
757 Ga0496122_0029170 3300048925 Bacteria 4660
758 Ga0496123_0001703 3300048926 Bacteria 29387
759 Ga0496124_0293031 3300048927 Bacteria 1180
760 Ga0496125_0248807 3300048928 Bacteria 1123
761 Ga0496126_0560649 3300048929 Bacteria 905
762 Ga0501031_0143782 3300049568 Bacteria 1558
763 Ga0501032_0000786 3300049569 Bacteria 25679
764 Ga0501032_0002130 3300049569 Bacteria 15598
765 Ga0501033_0000197 3300049570 Bacteria 57691
766 Ga0501033_0008439 3300049570 Bacteria 7978
767 Ga0501033_0188276 3300049570 Bacteria 1478
768 Ga0501033_0326363 3300049570 Bacteria 1078
769 Ga0501034_0000031 3300049571 Bacteria 244022
770 Ga0501034_0000901 3300049571 Bacteria 43252
771 Ga0501034_0375642 3300049571 Bacteria 1347
772 Ga0501034_0758487 3300049571 Bacteria 865
773 Ga0501036_0001200 3300049572 Bacteria 19770
774 Ga0501036_0133594 3300049572 Bacteria 2094
775 Ga0501037_0000067 3300049573 Bacteria 96388
776 Ga0501037_0004427 3300049573 Bacteria 10202
777 Ga0501038_0000013 3300049574 Bacteria 167219
778 Ga0501038_0079083 3300049574 Bacteria 2774
779 Ga0501039_0000010 3300049575 Bacteria 247832
780 Ga0501039_0000484 3300049575 Bacteria 28767
781 Ga0501039_0117158 3300049575 Bacteria 2086
782 Ga0501040_0067518 3300049576 Bacteria 2465
783 Ga0501040_0159089 3300049576 Bacteria 1596
784 Ga0501042_0080180 3300049578 Bacteria 2339
785 Ga0501043_0000056 3300049579 Bacteria 104302
786 Ga0501043_0196791 3300049579 Bacteria 1565
787 Ga0501046_0009800 3300049580 Bacteria 8259
788 Ga0501046_0010748 3300049580 Bacteria 7851
789 Ga0501046_0105022 3300049580 Bacteria 2164
790 Ga0501046_0110475 3300049580 Bacteria 2101
791 Ga0501047_0000201 3300049581 Bacteria 72425
792 Ga0501047_0002957 3300049581 Bacteria 16104
793 Ga0501047_0060095 3300049581 Bacteria 3669
794 Ga0501047_0192302 3300049581 Bacteria 1903
795 Ga0501047_0552932 3300049581 Bacteria 975
796 Ga0501067_0006710 3300049583 Bacteria 6388
797 Ga0501067_0115095 3300049583 Bacteria 1495
798 Ga0501067_0316488 3300049583 Bacteria 869
799 Ga0501070_0103833 3300049586 Bacteria 2350
800 Ga0501072_0227288 3300049588 Bacteria 1487
801 Ga0501073_0029178 3300049589 Bacteria 3942
802 Ga0501076_0497229 3300049592 Bacteria 1005
803 Ga0501079_0334446 3300049741 Bacteria 1186
804 Ga0501080_0010630 3300049742 Bacteria 8427
805 Ga0501081_0195297 3300049743 Bacteria 1466
806 Ga0501035_0000063 3300049822 Bacteria 131515
807 Ga0501035_0000077 3300049822 Bacteria 121242
808 Ga0501035_0076885 3300049822 Bacteria 2951
809 Ga0501044_0000013 3300049823 Bacteria 248795
810 Ga0501044_0014303 3300049823 Bacteria 8567
811 Ga0501045_0120384 3300049824 Bacteria 1949
812 nmdc:mga03683_31654_c1 3300050489 Bacteria 2123
813 nmdc:mga03683_81543_c1 3300050489 Bacteria 1397
814 nmdc:mga03n38_212451_c1 3300050490 Bacteria 1006
815 nmdc:mga00v17_39039_c1 3300050491 Bacteria 2841
816 nmdc:mga0yw44_14764_c1 3300050492 Bacteria 4159
817 nmdc:mga0yw44_15868_c1 3300050492 Bacteria 4051
818 nmdc:mga0yw44_30670_c1 3300050492 Bacteria 3119
819 nmdc:mga0yw44_53547_c1 3300050492 Bacteria 2451
820 nmdc:mga0yw44_53830_c1 3300050492 Bacteria 2445
821 nmdc:mga0yw44_92949_c1 3300050492 Bacteria 1910
822 nmdc:mga06z11_162363_c1 3300050494 Bacteria 1278
823 nmdc:mga06z11_163130_c1 3300050494 Bacteria 1275
824 nmdc:mga06z11_39131_c1 3300050494 Bacteria 2358
825 nmdc:mga04h51_98244_c1 3300050495 Bacteria 1064
826 nmdc:mga07m45_73582_c1 3300050496 Bacteria 1945
827 nmdc:mga05p37_42032_c1 3300050507 Bacteria 5615
828 nmdc:mga05p37_59076_c1 3300050507 Bacteria 4723
829 nmdc:mga0qj67_25436_c1 3300050509 Bacteria 4574
830 nmdc:mga06r32_166724_c1 3300050510 Bacteria 2186
831 nmdc:mga06r32_557138_c1 3300050510 Bacteria 1120
832 nmdc:mga08y16_119655_c1 3300050511 Bacteria 2741
833 nmdc:mga08y16_557856_c1 3300050511 Bacteria 1158
834 nmdc:mga08y16_67679_c1 3300050511 Bacteria 3725
835 nmdc:mga0n895_23021_c1 3300050512 Bacteria 5849
836 nmdc:mga08x19_165141_c1 3300050514 Bacteria 1505
837 nmdc:mga0a205_659103_c1 3300050515 Bacteria 898
838 nmdc:mga0sz30_10245_c1 3300050516 Bacteria 3589
839 Ga0495601_0000011 3300053077 Bacteria 264937
840 Ga0495601_0002132 3300053077 Bacteria 11132
841 Ga0495601_0071245 3300053077 Bacteria 2219
842 Ga0495601_0305345 3300053077 Bacteria 1036
843 Ga0495612_0000006 3300053078 Bacteria 269278
844 Ga0495612_0009288 3300053078 Bacteria 3990
845 Ga0495612_0036146 3300053078 Bacteria 2004
846 Ga0495612_0046505 3300053078 Bacteria 1777
847 Ga0500610_0142622 3300053079 Bacteria 1208
848 Ga0495595_0000147 3300053084 Bacteria 28631
849 Ga0495595_0000308 3300053084 Bacteria 19036
850 Ga0495595_0113146 3300053084 Bacteria 1317
851 Ga0495619_0000013 3300053085 Bacteria 264865
852 Ga0495619_0000583 3300053085 Bacteria 24288
853 Ga0495619_0001822 3300053085 Bacteria 14165
854 Ga0495619_0087591 3300053085 Bacteria 2105
855 Ga0495619_0148031 3300053085 Bacteria 1619
856 Ga0495619_0236644 3300053085 Bacteria 1265
857 Ga0495619_0278816 3300053085 Bacteria 1158
858 Ga0500583_0148677 3300053092 Bacteria 1166
859 Ga0500641_0071673 3300053096 Bacteria 1459
860 Ga0500556_0000046 3300053104 Bacteria 130408
861 Ga0500592_023216 3300053116 Bacteria 1000
862 Ga0500568_0000062 3300053139 Bacteria 106840
863 Ga0500604_0014403 3300053151 Bacteria 2153
864 Ga0500620_000478 3300053155 Bacteria 7111
865 Ga0500620_155026 3300053155 Bacteria 796
866 Ga0500627_0231377 3300053158 Bacteria 822
867 Ga0500657_100452 3300053728 Bacteria 1196
868 Ga0500645_031429 3300053730 Bacteria 1595
869 Ga0501082_0009547 3300060353 Bacteria 8350
870 Ga0501082_0161610 3300060353 Bacteria 1947
871 Ga0501082_0771114 3300060353 Bacteria 842
872 Ga0530510_0020817 3300061734 Bacteria 4665
873 Ga0530510_0041581 3300061734 Bacteria 3319
874 2885317772 2885312484 Bacteria 6415165
875 2503201843 2503198000 Bacteria 6884444
876 2509118807 2508501123 Bacteria 6283661
877 2509367614 2509276018 Bacteria 6910194
878 2509396522 2509276022 Bacteria 6200534
879 2510315291 2510065059 Bacteria 6847884
880 2512931264 2512875016 Bacteria 6529530
881 2512959093 2512875024 Bacteria 7195110
882 2513613179 2513237090 Bacteria 7096802
883 2514038046 2513237164 Bacteria 7563725
884 2514420093 2513237305 Bacteria 7293571
885 2514588521 2513237351 Bacteria 6968952
886 2545677818 2545555834 Bacteria 8130841
887 2588517046 2588253730 Bacteria 6881675
888 2597813531 2597489875 Bacteria 7010078
889 2599936535 2599185301 Bacteria 6161860
890 2643773098 2643221550 Bacteria 4619371
891 2643775914 2643221551 Bacteria 3750538
892 2643794361 2643221555 Bacteria 3749717
893 2643839821 2643221564 Bacteria 4193379
894 2643984605 2643221595 Bacteria 6565519
895 2644129195 2643221623 Bacteria 5239945
896 2644158571 2643221627 Bacteria 6761570
897 2688598657 2687453392 Bacteria 6880454
898 2694633142 2693429783 Bacteria 7019804
899 2694635833 2693429784 Bacteria 7241525
900 2723575608 2721755686 Bacteria 7343952
901 2739308301 2738543024 Bacteria 5603683
902 2756675242 2756170246 Bacteria 7451806
903 2792749466 2791355123 Bacteria 8049106
904 2841739494 2841734538 Bacteria 6784580
905 2841764456 2841760612 Bacteria 6454112
906 2844007203 2844002411 Bacteria 7168230
907 2844013963 2844009547 Bacteria 6728125
908 2844108096 2844104063 Bacteria 6440972
909 2847675809 2847670302 Bacteria 6165597
910 2847692460 2847686936 Bacteria 6278406
911 2851188026 2851182111 Bacteria 6047226
912 2851250202 2851246043 Bacteria 6439203
913 2856314647 2856314179 Bacteria 6477897
914 2856325476 2856320880 Bacteria 7263508
915 2856331310 2856328259 Bacteria 6528202
916 2856335248 2856334872 Bacteria 7037011
917 2856347464 2856342000 Bacteria 7176905
918 2856350475 2856349417 Bacteria 6230045
919 2856358259 2856356410 Bacteria 6297484
920 2856370355 2856364286 Bacteria 6939991
921 2857350862 2857349434 Bacteria 7926032
922 2857370969 2857367948 Bacteria 6965560
923 2869166274 2869162929 Bacteria 6399702
924 2869172844 2869169390 Bacteria 6659796
925 2869238481 2869234852 Bacteria 6654993
926 2869242537 2869242130 Bacteria 6609239
927 2869254616 2869249662 Bacteria 6868783
928 2869262046 2869256925 Bacteria 6981691
929 2869271043 2869264136 Bacteria 6880765
930 2869272101 2869271264 Bacteria 6908218
931 2869285166 2869278585 Bacteria 7077053
932 2869291918 2869285874 Bacteria 6901219
933 2871435127 2871429161 Bacteria 6547891
934 2871440025 2871435913 Bacteria 6880295
935 2871449388 2871444079 Bacteria 6423508
936 2871455711 2871451962 Bacteria 7336357
937 2871465689 2871459585 Bacteria 6866887
938 2871472839 2871466892 Bacteria 6923287
939 2871479662 2871474448 Bacteria 6806570
940 2871484538 2871481445 Bacteria 6700002
941 2871494239 2871488783 Bacteria 6929816
942 2871499927 2871495908 Bacteria 6935695
943 2874102789 2874102143 Bacteria 6342645
944 2874112504 2874109183 Bacteria 6517025
945 2874121559 2874116593 Bacteria 6674494
946 2874123822 2874123672 Bacteria 7238285
947 2874138863 2874131515 Bacteria 6820270
948 2874146103 2874139085 Bacteria 7021506
949 2874149519 2874146452 Bacteria 7533118
950 2874157781 2874155637 Bacteria 6724144
951 2874162723 2874162495 Bacteria 6174670
952 2874174581 2874168670 Bacteria 8062617
953 2876369322 2876363079 Bacteria 6544991
954 2876379752 2876377896 Bacteria 6565995
955 2876388276 2876386047 Bacteria 6698674
956 2876394451 2876392853 Bacteria 6660880
957 2876402945 2876399893 Bacteria 6927900
958 2876413674 2876406927 Bacteria 6191900
959 2876415985 2876413966 Bacteria 6831344
960 2876423899 2876420981 Bacteria 6687741
961 2878039881 2878035449 Bacteria 6555736
962 2878732156 2878730984 Bacteria 6380721
963 2878745456 2878738818 Bacteria 7136951
964 2878752262 2878745973 Bacteria 6867388
965 2878759098 2878753008 Bacteria 6922523
966 2878764082 2878760144 Bacteria 6823465
967 2878771121 2878767105 Bacteria 6898628
968 2878780155 2878774303 Bacteria 6108671
969 2878783153 2878781027 Bacteria 6834456
970 2878793723 2878788777 Bacteria 6567085
971 2881151729 2881147464 Bacteria 7779814
972 2881155527 2881155292 Bacteria 6461656
973 2881167751 2881161766 Bacteria 7127907
974 2881852515 2881845957 Bacteria 6611900
975 2881854793 2881853255 Bacteria 6698367
976 2881865288 2881861095 Bacteria 7128710
977 2882636492 2882632389 Bacteria 8154593
978 2882912781 2882912400 Bacteria 6801539
979 2885309645 2885305155 Bacteria 7348390
980 2885320119 2885318864 Bacteria 6729568
981 2885326888 2885326080 Bacteria 7134805
982 2885334267 2885334103 Bacteria 7216818
983 2885350340 2885342637 Bacteria 7011821
984 2885350984 2885350715 Bacteria 6787678
985 2888339654 2888337043 Bacteria 6629336
986 2888347023 2888343758 Bacteria 6611049
987 2888355983 2888350351 Bacteria 7372807
988 2889010916 2889010040 Bacteria 6749192
989 2889017391 2889016732 Bacteria 6700763
990 2889792663 2889790730 Bacteria 5689708
991 2889918943 2889914905 Bacteria 5702301
992 2903451560 2903448605 Bacteria 7357801
993 2903493180 2903492973 Bacteria 13473544
994 2903503661 2903492973 Bacteria 13473544
995 2903515578 2903513507 Bacteria 6344008
996 2903523071 2903521522 Bacteria 6525694
997 2903534469 2903528002 Bacteria 6586099
998 2903544741 2903540706 Bacteria 7062119
999 2904661085 2904659560 Bacteria 6685615
1000 2906314656 2906308376 Bacteria 6841989
1001 2906327824 2906321335 Bacteria 6579571
1002 2906329808 2906328253 Bacteria 6585166
1003 2906360202 2906354277 Bacteria 6991324
1004 2906363958 2906363423 Bacteria 6856682
1005 2906377539 2906370794 Bacteria 6881062
1006 2906381262 2906378014 Bacteria 6911440
1007 2906402736 2906401398 Bacteria 6693206
1008 2906410273 2906408224 Bacteria 6162342
1009 2906414600 2906414383 Bacteria 6580790
1010 2922138489 2922130491 Bacteria 7173936
1011 2922157963 2922151315 Bacteria 6902399
1012 2922163340 2922158528 Bacteria 6573167
1013 2922174586 2922172374 Bacteria 6167644
1014 2922180550 2922178524 Bacteria 6025201
1015 2922190083 2922185730 Bacteria 7113964
1016 2924712406 2924710171 Bacteria 6752351
1017 2924726101 2924718760 Bacteria 6331356
1018 2924727033 2924726620 Bacteria 6271473
1019 2924733383 2924733363 Bacteria 7574837
1020 2924747597 2924741084 Bacteria 6661321
1021 2924750473 2924748358 Bacteria 6154725
1022 2924759098 2924754689 Bacteria 6774424
1023 2924769000 2924762789 Bacteria 6561353
1024 2924783700 2924776078 Bacteria 7492003
1025 2924789303 2924784321 Bacteria 7416538
1026 2937816041 2937813078 Bacteria 7783518
1027 2937824700 2937822353 Bacteria 7290551
1028 2937842417 2937836603 Bacteria 6811263
1029 2937852962 2937848649 Bacteria 6983481
1030 2937867173 2937861824 Bacteria 6660327
1031 2937881895 2937877337 Bacteria 7246526
1032 2937892918 2937891427 Bacteria 6357007
1033 2937978358 2937972304 Bacteria 7532020
1034 2937981523 2937980651 Bacteria 6517427
1035 2937998587 2937994558 Bacteria 7036190
1036 2958040867 2958034702 Bacteria 6989922
1037 2958056949 2958041894 Bacteria 13082850
1038 2958067647 2958064165 Bacteria 7158582
1039 2958077424 2958071322 Bacteria 6815895
1040 2958089015 2958084443 Bacteria 7312792
1041 2958098770 2958092219 Bacteria 6861151
1042 2958102678 2958100919 Bacteria 6800575
1043 2958113769 2958108152 Bacteria 6681128
1044 2958118657 2958115193 Bacteria 6923548
1045 2958125398 2958122699 Bacteria 7280457
1046 2958136316 2958130278 Bacteria 6897202
1047 2958143893 2958137437 Bacteria 6050276
1048 2958150474 2958144490 Bacteria 6677056
1049 2958159916 2958158011 Bacteria 6058449
1050 2958169067 2958165035 Bacteria 6906348
1051 2958173886 2958172287 Bacteria 6716688
1052 2958185784 2958179912 Bacteria 6874908
1053 2961084161 2961077736 Bacteria 7079850
1054 2961116236 2961114664 Bacteria 6680456
1055 2961129331 2961127735 Bacteria 7196641
1056 2961141130 2961136820 Bacteria 6775228
1057 2961167526 2961163497 Bacteria 6901077
1058 2961175730 2961170736 Bacteria 7072258
1059 2961186434 2961183825 Bacteria 6688536
1060 2963647955 2963644680 Bacteria 6530403
1061 2965022349 2965018300 Bacteria 6883036
1062 2965026368 2965025482 Bacteria 6532201
1063 2965033151 2965032056 Bacteria 6887443
1064 2965046622 2965040258 Bacteria 6855979
1065 2965055038 2965047637 Bacteria 6623551
1066 2965068318 2965062239 Bacteria 7412989
1067 2965103479 2965102966 Bacteria 6800987
1068 2965116007 2965110997 Bacteria 6693150
1069 2968001710 2967996073 Bacteria 6787468
1070 2968009346 2968003550 Bacteria 6929263
1071 2968018213 2968016561 Bacteria 7022047
1072 2968085889 2968083720 Bacteria 7351627
1073 2968096472 2968091066 Bacteria 6052692
1074 2968100736 2968097103 Bacteria 6107094
1075 2968112142 2968110612 Bacteria 6814636
1076 2968120907 2968117919 Bacteria 6536078
1077 2968132523 2968128360 Bacteria 6270294
1078 2968144522 2968138860 Bacteria 6605449
1079 2968175933 2968171901 Bacteria 6894245
1080 2970471613 2970469710 Bacteria 6969209
1081 2970495561 2970489779 Bacteria 6517260
1082 2970508395 2970503327 Bacteria 7099517
1083 2970511800 2970510686 Bacteria 7006402
1084 2970530542 2970524798 Bacteria 6840927
1085 2970541203 2970540015 Bacteria 6977556
1086 2970549293 2970547951 Bacteria 6931819
1087 2970558927 2970554993 Bacteria 6814252
1088 2970599779 2970593180 Bacteria 7073582
1089 2970626127 2970619444 Bacteria 6986144
1090 2970632338 2970627176 Bacteria 6680862
1091 2977827638 2977821940 Bacteria 6906439
1092 2977833133 2977828996 Bacteria 7007971
1093 2977846277 2977843712 Bacteria 6753583
1094 2977854931 2977851361 Bacteria 6694324
1095 2977871479 2977864932 Bacteria 7534097
1096 2977876648 2977872689 Bacteria 7270173
1097 2977899001 2977898635 Bacteria 6675551
1098 2977914447 2977907340 Bacteria 6577984
1099 2977921990 2977915119 Bacteria 6829656
1100 2977924457 2977922695 Bacteria 6956781
1101 2977936813 2977935797 Bacteria 6252826
1102 2977947434 2977942078 Bacteria 7570577
1103 2977951851 2977950692 Bacteria 6893264
1104 2977964401 2977957713 Bacteria 6877875
1105 2977975285 2977971508 Bacteria 7472917
1106 2977990496 2977986579 Bacteria 6581278
1107 2979713796 2979710463 Bacteria 6785254
1108 2979750943 2979742915 Bacteria 7301278
1109 2979771382 2979764755 Bacteria 6610066
1110 2979778468 2979772303 Bacteria 6618277
1111 2979781954 2979779861 Bacteria 6219781
1112 2979795246 2979793036 Bacteria 6808957
1113 2979811956 2979808191 Bacteria 7179355
1114 2987638047 2987636660 Bacteria 8088555
1115 2987650543 2987645492 Bacteria 6117018
1116 2987653573 2987652177 Bacteria 6969023
1117 2987663532 2987659509 Bacteria 6966464
1118 2987669010 2987666974 Bacteria 6509233
1119 2987680276 2987673487 Bacteria 6884027
1120 2996313868 2996310559 Bacteria 6357320
1121 2996340952 2996336353 Bacteria 5511628
1122 2996344042 2996341866 Bacteria 6643098
1123 2996350400 2996348954 Bacteria 7239054
1124 2996391693 2996386984 Bacteria 6978667
1125 3000140365 3000135777 Bacteria 6891109
1126 3004169138 3004167301 Bacteria 8330599
1127 3004192593 3004188549 Bacteria 6952365
1128 3004199588 3004195979 Bacteria 6776956
1129 3004205631 3004203850 Bacteria 7307914
1130 3004216191 3004211236 Bacteria 7417683
1131 3004223941 3004218560 Bacteria 7421728
1132 3004233595 3004232784 Bacteria 6662140
1133 3004246338 3004239961 Bacteria 6892290
1134 3004255696 3004248173 Bacteria 6563236
1135 3004269697 3004268573 Bacteria 7043476
1136 3004277098 3004275668 Bacteria 7114440
1137 3004294003 3004289098 Bacteria 6135450
1138 3004334091 3004334049 Bacteria 8449246
1139 637074367 637000159 Bacteria 7596297
1140 641642652 641522639 Bacteria 7737025
1141 649873174 649633066 Bacteria 6690028
1142 8004304579 8004300914 Bacteria 6132239
1143 8004316238 8004312739 Bacteria 7444653
1144 8004365715 8004361976 Bacteria 6858373
1145 8004380619 8004374579 Bacteria 6898112
1146 8004394356 8004387939 Bacteria 7049250
1147 8004399782 8004395343 Bacteria 6620908
1148 8004450258 8004445564 Bacteria 6322258
1149 8004637243 8004633249 Bacteria 6723080
1150 8004640597 8004640170 Bacteria 6723001
1151 8004697363 8004695233 Bacteria 6731676
1152 8004709559 8004703790 Bacteria 8006957
1153 8004720917 8004714634 Bacteria 6776161
1154 8004734257 8004727605 Bacteria 6643904
1155 8055620987 8055617313 Bacteria 7548464
1156 8057533473 8057529695 Bacteria 6306553
1157 JGI24739J22299_10050467
1158 JGI24750J21931_1000910
1159 JGI24738J21930_10043045
1160 JGI24742J22300_10017176
1161 JGI25156J39149_1013582
1162 JGI25157J39369_1000997
1163 JGI25406J46586_10139439
1164 JGI25165J46597_1000169
1165 Ga0055542_1000200
1166 JGI25405J52794_10002905
1167 Ga0070676_10196879
1168 Ga0070670_100008924
1169 Ga0070670_100026922
1170 Ga0068869_100020500
1171 Ga0070680_100033129
1172 Ga0070680_100339604
1173 Ga0070682_100017788
1174 Ga0070682_100039512
1175 Ga0068868_100020483
1176 Ga0070660_100055566
1177 Ga0070660_100112319
1178 Ga0070660_100112987
1179 Ga0070689_100009010
1180 Ga0070689_100164065
1181 Ga0070691_10070081
1182 Ga0070687_100023504
1183 Ga0070661_100152449
1184 Ga0070692_10272221
1185 Ga0070668_100022994
1186 Ga0070669_100028839
1187 Ga0070675_100038027
1188 Ga0070671_100005178
1189 Ga0070671_100115795
1190 Ga0070671_100475128
1191 Ga0070674_100134885
1192 Ga0070674_100524366
1193 Ga0070673_100002387
1194 Ga0070673_100017217
1195 Ga0070688_100090372
1196 Ga0070688_100203639
1197 Ga0070688_100225450
1198 Ga0070659_100015263
1199 Ga0070659_100470197
1200 Ga0070667_100022104
1201 Ga0070709_10225004
1202 Ga0070709_10294912
1203 Ga0070714_100006761
1204 Ga0070714_100014915
1205 Ga0070714_100072142
1206 Ga0070713_100035633
1207 Ga0070701_10022341
1208 Ga0070711_100017659
1209 Ga0070711_100019153
1210 Ga0070711_100028014
1211 Ga0070711_100042386
1212 Ga0070705_100087853
1213 Ga0070700_100013506
1214 Ga0070700_100448341
1215 Ga0070694_100110768
1216 Ga0070663_100007259
1217 Ga0070663_101021231
1218 Ga0070678_100076361
1219 Ga0070678_100251956
1220 Ga0070662_100030696
1221 Ga0070681_10019614
1222 Ga0070681_10283365
1223 Ga0068867_100022577
1224 Ga0068867_100380669
1225 Ga0070685_10328632
1226 Ga0070699_100008041
1227 Ga0070699_101033580
1228 Ga0070679_100074479
1229 Ga0070679_100474764
1230 Ga0070684_100340907
1231 Ga0068853_100010872
1232 Ga0068853_100072716
1233 Ga0068853_100074585
1234 Ga0068853_100098013
1235 Ga0070672_100078555
1236 Ga0070686_100036914
1237 Ga0070695_100177699
1238 Ga0070695_100603673
1239 Ga0070696_100017390
1240 Ga0070693_100068212
1241 Ga0070665_100058543
1242 Ga0070665_100128896
1243 Ga0070665_100802197
1244 Ga0070704_100414052
1245 Ga0068855_100430715
1246 Ga0070664_100228552
1247 Ga0068857_100039612
1248 Ga0068857_100050634
1249 Ga0068857_100294103
1250 Ga0068854_100024038
1251 Ga0068856_100169242
1252 Ga0068856_100323279
1253 Ga0070702_100017784
1254 Ga0068852_100006835
1255 Ga0068852_100232270
1256 Ga0068852_100509272
1257 Ga0068859_100022244
1258 Ga0068864_100132570
1259 Ga0068864_100146200
1260 Ga0068864_100984487
1261 Ga0068866_10092731
1262 Ga0068866_10302516
1263 Ga0068861_100016370
1264 Ga0068870_10009492
1265 Ga0068870_10228004
1266 Ga0068863_100050157
1267 Ga0068863_100763844
1268 Ga0068858_100020908
1269 Ga0068858_100243165
1270 Ga0068858_100298745
1271 Ga0068860_100025571
1272 Ga0068862_100054011
1273 Ga0081455_10001749
1274 Ga0081455_10011262
1275 Ga0081455_10186942
1276 Ga0081538_10062190
1277 Ga0081540_1006291
1278 Ga0081540_1049962
1279 Ga0081539_10001319
1280 Ga0070717_10025952
1281 Ga0070717_10465328
1282 Ga0070717_10517758
1283 Ga0075365_10001839
1284 Ga0075365_10024392
1285 Ga0075365_10056680
1286 Ga0075365_10069203
1287 Ga0075365_10077631
1288 Ga0075365_10271995
1289 Ga0075368_10030186
1290 Ga0075368_10081338
1291 Ga0075363_100246617
1292 Ga0075364_10131305
1293 Ga0075364_10446615
1294 Ga0075432_10140533
1295 Ga0070715_10021970
1296 Ga0070715_10069268
1297 Ga0070715_10239304
1298 Ga0070716_100054170
1299 Ga0070716_100127551
1300 Ga0070716_100612329
1301 Ga0070712_100004818
1302 Ga0070712_100056217
1303 Ga0070712_100148098
1304 Ga0070712_100218163
1305 Ga0070712_100226120
1306 Ga0070712_100275352
1307 Ga0075362_10071418
1308 Ga0075362_10218982
1309 Ga0075367_10055339
1310 Ga0075367_10079432
1311 Ga0075367_10132244
1312 Ga0075367_10252806
1313 Ga0075369_10010327
1314 Ga0097621_100194830
1315 Ga0075370_10078315
1316 Ga0075370_10092918
1317 Ga0075370_10146609
1318 Ga0068871_100083108
1319 Ga0068871_100090639
1320 Ga0075428_100049970
1321 Ga0075428_100178861
1322 Ga0075428_100232500
1323 Ga0075430_100158604
1324 Ga0075431_100012803
1325 Ga0075431_101006368
1326 Ga0075433_10561867
1327 Ga0075434_100035343
1328 Ga0068865_100259370
1329 Ga0075436_100110197
1330 Ga0097620_100022244
1331 Ga0075435_100045163
1332 Ga0099794_10004120
1333 Ga0105240_10134618
1334 Ga0111539_10051134
1335 Ga0111539_10663176
1336 Ga0105245_10020549
1337 Ga0105245_10370007
1338 Ga0105245_10536480
1339 Ga0105247_10014879
1340 Ga0105247_10414251
1341 Ga0114129_10036121
1342 Ga0114129_10072223
1343 Ga0114129_11772670
1344 Ga0105243_10024257
1345 Ga0105243_10170997
1346 Ga0105243_10879510
1347 Ga0105241_10027136
1348 Ga0105241_10074374
1349 Ga0105241_10354466
1350 Ga0105242_10034422
1351 Ga0105242_10065974
1352 Ga0105248_10044999
1353 Ga0105248_10053841
1354 Ga0105248_10510321
1355 Ga0105248_11126076
1356 Ga0105237_10026169
1357 Ga0105237_10041723
1358 Ga0105237_10282080
1359 Ga0105237_10629232
1360 Ga0105237_10681252
1361 Ga0105238_10002854
1362 Ga0105238_10045315
1363 Ga0105238_10106658
1364 Ga0105238_10112864
1365 Ga0105249_10064133
1366 Ga0099796_10013297
1367 Ga0105239_10043981
1368 Ga0105239_10064538
1369 Ga0105239_10176966
1370 Ga0105239_10647177
1371 Ga0105239_10822845
1372 Ga0105239_10888456
1373 Ga0105239_10964561
1374 Ga0105246_10007627
1375 Ga0105246_10025364
1376 Ga0157369_10060339
1377 Ga0157369_10771759
1378 Ga0157374_10015400
1379 Ga0157374_10095167
1380 Ga0157378_10424331
1381 Ga0157378_11206481
1382 Ga0163162_10335844
1383 Ga0163162_10795342
1384 Ga0157372_10218214
1385 Ga0157372_10713687
1386 Ga0157372_11230711
1387 Ga0157375_10033186
1388 Ga0157375_10034097
1389 Ga0157375_10244445
1390 Ga0157375_10533493
1391 Ga0157375_10823611
1392 Ga0163163_10018988
1393 Ga0163163_10114772
1394 Ga0163163_10268731
1395 Ga0157380_10053558
1396 Ga0182008_10080176
1397 Ga0182008_10154103
1398 Ga0157379_10022797
1399 Ga0157379_10114352
1400 Ga0157379_10557822
1401 Ga0157376_10028668
1402 Ga0157376_10067241
1403 Ga0182006_1017306
1404 Ga0163161_10522088
1405 Ga0163161_10734302
1406 Ga0213876_10015925
1407 Ga0213876_10157131
1408 Ga0213876_10308927
1409 Ga0213875_10000012
1410 Ga0213871_10012865
1411 Ga0224572_1023175
1412 Ga0224572_1057975
1413 Ga0228598_1010721
1414 Ga0209026_1000024
1415 Ga0209148_1000050
1416 Ga0209759_1000057
1417 Ga0209233_1000010
1418 Ga0209455_1000147
1419 Ga0209758_1009276
1420 Ga0207697_10035008
1421 Ga0207697_10122578
1422 Ga0207682_10034780
1423 Ga0207692_10078289
1424 Ga0207642_10051184
1425 Ga0207642_10224843
1426 Ga0207710_10015213
1427 Ga0207710_10265138
1428 Ga0207688_10025353
1429 Ga0207647_10005228
1430 Ga0207647_10010727
1431 Ga0207647_10339482
1432 Ga0207685_10013814
1433 Ga0207685_10060984
1434 Ga0207685_10074828
1435 Ga0207685_10078215
1436 Ga0207685_10256895
1437 Ga0207699_10014392
1438 Ga0207699_10162535
1439 Ga0207699_10201597
1440 Ga0207645_10012885
1441 Ga0207645_10173531
1442 Ga0207643_10003096
1443 Ga0207705_10330446
1444 Ga0207654_10012383
1445 Ga0207654_10255213
1446 Ga0207707_10011468
1447 Ga0207707_10148445
1448 Ga0207695_10254777
1449 Ga0207695_10309941
1450 Ga0207671_10067599
1451 Ga0207693_10001484
1452 Ga0207693_10002742
1453 Ga0207693_10162406
1454 Ga0207693_10238849
1455 Ga0207663_10015883
1456 Ga0207663_10156431
1457 Ga0207663_10754050
1458 Ga0207660_10056067
1459 Ga0207657_10062636
1460 Ga0207657_10095352
1461 Ga0207657_10377948
1462 Ga0207657_10780988
1463 Ga0207649_10115358
1464 Ga0207649_10276410
1465 Ga0207681_10187187
1466 Ga0207694_10010089
1467 Ga0207694_10199190
1468 Ga0207694_10288861
1469 Ga0207650_10002963
1470 Ga0207650_10009740
1471 Ga0207650_10153897
1472 Ga0207659_10009295
1473 Ga0207659_10468502
1474 Ga0207687_10026158
1475 Ga0207687_10357472
1476 Ga0207687_11047360
1477 Ga0207700_10103615
1478 Ga0207700_10532069
1479 Ga0207700_10929169
1480 Ga0207664_10052285
1481 Ga0207664_10103384
1482 Ga0207644_10007084
1483 Ga0207644_10015159
1484 Ga0207644_10205499
1485 Ga0207690_10038670
1486 Ga0207690_10055991
1487 Ga0207690_10385324
1488 Ga0207706_10009674
1489 Ga0207706_10392329
1490 Ga0207686_10213296
1491 Ga0207709_10083875
1492 Ga0207709_10793189
1493 Ga0207670_10006644
1494 Ga0207670_10008195
1495 Ga0207670_10036710
1496 Ga0207669_10013106
1497 Ga0207704_10043058
1498 Ga0207665_10354136
1499 Ga0207665_10356243
1500 Ga0207691_10003971
1501 Ga0207711_10025426
1502 Ga0207711_10083554
1503 Ga0207711_10473478
1504 Ga0207689_10001884
1505 Ga0207689_10214342
1506 Ga0207661_10259695
1507 Ga0207679_10063594
1508 Ga0207679_10083748
1509 Ga0207679_10222495
1510 Ga0207667_10164319
1511 Ga0207667_10374665
1512 Ga0207651_10003503
1513 Ga0207651_10005442
1514 Ga0207712_10122487
1515 Ga0207668_10033695
1516 Ga0207668_10310866
1517 Ga0207668_10438777
1518 Ga0207640_10047119
1519 Ga0207640_11048000
1520 Ga0207658_10052929
1521 Ga0207658_10307058
1522 Ga0207658_10380210
1523 Ga0207658_11233913
1524 Ga0207677_10107247
1525 Ga0207703_10012529
1526 Ga0207703_10236678
1527 Ga0207703_10572259
1528 Ga0207639_10024726
1529 Ga0207639_10449794
1530 Ga0207639_10699591
1531 Ga0207678_10000114
1532 Ga0207678_10088790
1533 Ga0207708_10028546
1534 Ga0207708_10368305
1535 Ga0207702_10226090
1536 Ga0207702_10250892
1537 Ga0207641_10037528
1538 Ga0207641_10696710
1539 Ga0207648_10003613
1540 Ga0207648_10168303
1541 Ga0207676_10037967
1542 Ga0207676_10187741
1543 Ga0207676_10269817
1544 Ga0207674_10017777
1545 Ga0207674_10087226
1546 Ga0207674_10120939
1547 Ga0207675_100014341
1548 Ga0207675_100917457
1549 Ga0207683_10009784
1550 Ga0207683_10027474
1551 Ga0207698_10059041
1552 Ga0207698_10351662
1553 Ga0209179_1021607
1554 Ga0209813_10045297
1555 Ga0207428_10179758
1556 Ga0265357_1000569
1557 Ga0268266_10012797
1558 Ga0268266_10054805
1559 Ga0268266_10306317
1560 Ga0268265_10233343
1561 Ga0268264_10015832
1562 Ga0265762_1075661
1563 Ga0265773_1001072
1564 Ga0265760_10170059
1565 Ga0265332_10000592
1566 Ga0265329_10008897
1567 Ga0265340_10007268
1568 Ga0265339_10001715
1569 Ga0265331_10009132
1570 Ga0307513_10048573
1571 Ga0265313_10069555
1572 Ga0265342_10000116
1573 Ga0307405_10327522
1574 Ga0373930_0003794
1575 Ga0373938_0061441
1576 Ga0373926_0166397
1577 Ga0373929_0029226
1578 Ga0373934_0036930
1579 Ga0373934_0055431
1580 Ga0373940_0023298
1581 Ga0373949_0019950
1582 Ga0373923_0000186
1583 Ga0373923_0129768
1584 Ga0373936_0016342
1585 Ga0373936_0053012
1586 Ga0373936_0107799
1587 Ga0373936_0246278
1588 Ga0373939_0018875
1589 Ga0373945_0137623
1590 Ga0373953_0011844
1591 Ga0373953_0018792
1592 Ga0373953_0093923
1593 Ga0373954_0008300
1594 Ga0373956_0046593
1595 Ga0373956_0095422
1596 Ga0373960_0015866
1597 Ga0373943_0071731
1598 Ga0373943_0494382
1599 Ga0373946_0044720
1600 Ga0373955_0003215
1601 Ga0373955_0400129
1602 Ga0373955_0417070
1603 Ga0373924_0005086
1604 Ga0373924_0017966
1605 Ga0373924_0040202
1606 Ga0373924_0057140
1607 Ga0373924_0098036
1608 Ga0373931_0063588
1609 Ga0373931_0070201
1610 Ga0373931_0110931
1611 Ga0373935_0001959
1612 Ga0373935_0005867
1613 Ga0373935_0097259
1614 Ga0373935_0130725
1615 Ga0373935_0202041
1616 Ga0373935_0288881
1617 Ga0373935_0355931
1618 Ga0373935_0451083
1619 Ga0373935_0504630
1620 Ga0373927_0015698
1621 Ga0373927_0023606
1622 Ga0373927_0063346
1623 Ga0373927_0118559
1624 Ga0373927_0162990
1625 Ga0373933_0002179
1626 Ga0373933_0002211
1627 Ga0373933_0031590
1628 Ga0373933_0101391
1629 Ga0373947_0002362
1630 Ga0373947_0027690
1631 Ga0373947_0051532
1632 Ga0373947_0055899
1633 Ga0373947_0167396
1634 Ga0373947_0612285
1635 Ga0373937_0000041
1636 Ga0373937_0000765
1637 Ga0373937_0003840
1638 Ga0373937_0005787
1639 Ga0373925_0000793
1640 Ga0373925_0048603
1641 Ga0373925_0102482
1642 Ga0373925_0119993
1643 Ga0373925_0336041
1644 Ga0395900_0019120
1645 Ga0395900_0061732
1646 Ga0395898_0227185
1647 Ga0395898_0322217
1648 Ga0395898_0617648
1649 Ga0395905_0049568
1650 Ga0395905_0282703
1651 Ga0436364_0347683
1652 Ga0436364_0553890
1653 Ga0436364_0683938
1654 Ga0436364_0739297
1655 Ga0436364_1241746
1656 Ga0436364_1465720
1657 Ga0436364_1491432
1658 Ga0395901_0011146
1659 Ga0395901_0103612
1660 Ga0395901_0155826
1661 Ga0395901_0266605
1662 Ga0436365_0238303
1663 Ga0436365_0319814
1664 Ga0436365_0879496
1665 Ga0436365_0899547
1666 Ga0436365_1529562
1667 Ga0436360_1334791
1668 Ga0436362_0706089
1669 Ga0439455_0058449
1670 Ga0466972_0022440
1671 Ga0466960_0037172
1672 Ga0495592_0003368
1673 Ga0495592_0008877
1674 Ga0495592_0046621
1675 Ga0495592_0104615
1676 Ga0495592_0132975
1677 Ga0495592_0444990
1678 Ga0495603_0365604
1679 Ga0495603_0405386
1680 Ga0495590_0091075
1681 Ga0495629_0006715
1682 Ga0495629_0011756
1683 Ga0495629_0018879
1684 Ga0495629_0298998
1685 Ga0495638_0009008
1686 Ga0495638_0113930
1687 Ga0495641_0032701
1688 Ga0495651_0008706
1689 Ga0495651_0009661
1690 Ga0495651_0012317
1691 Ga0495651_0093756
1692 Ga0495653_0000646
1693 Ga0495653_0000993
1694 Ga0495653_0017117
1695 Ga0495653_0169725
1696 Ga0495653_0313116
1697 Ga0495653_0422124
1698 Ga0495662_0000711
1699 Ga0495662_0002469
1700 Ga0495662_0160845
1701 Ga0495664_0000008
1702 Ga0495664_0000887
1703 Ga0495664_0093110
1704 Ga0495584_0084484
1705 Ga0495594_0343858
1706 Ga0495607_0223027
1707 Ga0495608_0000226
1708 Ga0495608_0000752
1709 Ga0495608_0133229
1710 Ga0495618_0000826
1711 Ga0495618_0003138
1712 Ga0495618_0042615
1713 Ga0495618_0404693
1714 Ga0495628_0000802
1715 Ga0495628_0016982
1716 Ga0495628_0054502
1717 Ga0495630_0008988
1718 Ga0495630_0082128
1719 Ga0495630_0086103
1720 Ga0495630_0164829
1721 Ga0495630_0210305
1722 Ga0495630_0223728
1723 Ga0495630_0365337
1724 Ga0495637_0013652
1725 Ga0495663_0219220
1726 Ga0495666_0076154
1727 Ga0495652_0000005
1728 Ga0495652_0008781
1729 Ga0495654_0253131
1730 Ga0495665_0043393
1731 Ga0495665_0061360
1732 Ga0495665_0373357
1733 Ga0495640_0000020
1734 Ga0495640_0005859
1735 Ga0495640_0042211
1736 Ga0495640_0282965
1737 Ga0495586_0008716
1738 Ga0495587_0000005
1739 Ga0495587_0008717
1740 Ga0495587_0293760
1741 Ga0495598_0034691
1742 Ga0495621_0125722
1743 Ga0495645_0000007
1744 Ga0495645_0005621
1745 Ga0495645_0466340
1746 Ga0495667_0000618
1747 Ga0495667_0020766
1748 Ga0495667_0042272
1749 Ga0495667_0147663
1750 Ga0495668_0079485
1751 Ga0495668_0192880
1752 Ga0495634_0001129
1753 Ga0495634_0002902
1754 Ga0495634_0004881
1755 Ga0495625_0054621
1756 Ga0495635_0000010
1757 Ga0495635_0003537
1758 Ga0495635_0004407
1759 Ga0495635_0164890
1760 Ga0495635_0292004
1761 Ga0495661_0144484
1762 Ga0495588_0014853
1763 Ga0495657_0000052
1764 Ga0495657_0116496
1765 Ga0495599_0000240
1766 Ga0495599_0086062
1767 Ga0495599_0167550
1768 Ga0495623_0001009
1769 Ga0495623_0040075
1770 Ga0495646_0000663
1771 Ga0495646_0054944
1772 Ga0495646_0232869
1773 Ga0495647_0019819
1774 Ga0495647_0071643
1775 Ga0495658_0023605
1776 Ga0495613_0010045
1777 Ga0495613_0031750
1778 Ga0495613_0538713
1779 Ga0495624_0163530
1780 Ga0495624_0297992
1781 Ga0495671_0338955
1782 Ga0495649_0209191
1783 Ga0495589_0202378
1784 Ga0495600_0000016
1785 Ga0495600_0180299
1786 Ga0495581_0001818
1787 Ga0495581_0059483
1788 Ga0495581_0229004
1789 Ga0495581_0269454
1790 Ga0495604_0000634
1791 Ga0495604_0001065
1792 Ga0495604_0065212
1793 Ga0495604_0158999
1794 Ga0495604_0221651
1795 Ga0495674_0000012
1796 Ga0495674_0006055
1797 Ga0495674_0006411
1798 Ga0495674_0130779
1799 Ga0495674_0310616
1800 Ga0495674_0509384
1801 Ga0495676_0119139
1802 Ga0495680_0001629
1803 Ga0495680_0009090
1804 Ga0495680_0045962
1805 Ga0495675_0002307
1806 Ga0495675_0007464
1807 Ga0495684_0001027
1808 Ga0495684_0002302
1809 Ga0495684_0016011
1810 Ga0495684_0079481
1811 Ga0495684_0352333
1812 Ga0495684_0470611
1813 Ga0495686_0198233
1814 Ga0495593_0001783
1815 Ga0495593_0094449
1816 Ga0495593_0187771
1817 Ga0495593_0298058
1818 Ga0495602_0001567
1819 Ga0495602_0012027
1820 Ga0495602_0351420
1821 Ga0495602_0527478
1822 Ga0496100_0007628
1823 Ga0496100_0099344
1824 Ga0496100_0187516
1825 Ga0496100_0262056
1826 Ga0496100_0367903
1827 Ga0496100_0848620
1828 Ga0496101_0002917
1829 Ga0496101_0019876
1830 Ga0496101_0040185
1831 Ga0496101_0155419
1832 Ga0496101_0333014
1833 Ga0496101_0502176
1834 Ga0496101_0559306
1835 Ga0496101_0661406
1836 Ga0496102_0052231
1837 Ga0496102_0191607
1838 Ga0496102_0227289
1839 Ga0496102_0402564
1840 Ga0496102_0604478
1841 Ga0496103_0008526
1842 Ga0496103_0042248
1843 Ga0496103_0082896
1844 Ga0496103_0154006
1845 Ga0496104_0012127
1846 Ga0496104_0017672
1847 Ga0496104_0037881
1848 Ga0496104_0114326
1849 Ga0496104_0441268
1850 Ga0496104_0762000
1851 Ga0496105_0039220
1852 Ga0496105_0052851
1853 Ga0496105_0144491
1854 Ga0496105_0149309
1855 Ga0496106_0015557
1856 Ga0496106_0020585
1857 Ga0496106_0054205
1858 Ga0496107_0003486
1859 Ga0496107_0033283
1860 Ga0496107_0100544
1861 Ga0496107_0327686
1862 Ga0496107_0434188
1863 Ga0496108_0001144
1864 Ga0496108_0041960
1865 Ga0496108_0183319
1866 Ga0496108_0275614
1867 Ga0496108_0588975
1868 Ga0496109_0039235
1869 Ga0496109_0040330
1870 Ga0496109_0092525
1871 Ga0496109_0216645
1872 Ga0496110_0158579
1873 Ga0496110_0208332
1874 Ga0496110_0295488
1875 Ga0496110_0625265
1876 Ga0496111_0002536
1877 Ga0496111_0065884
1878 Ga0496111_0085197
1879 Ga0496112_0001224
1880 Ga0496112_0055827
1881 Ga0496112_0093758
1882 Ga0496112_0117175
1883 Ga0496112_0162763
1884 Ga0496112_0215010
1885 Ga0496112_0239586
1886 Ga0496112_0282322
1887 Ga0496112_0380811
1888 Ga0496113_0003020
1889 Ga0496113_0084544
1890 Ga0496113_0187071
1891 Ga0496113_0188868
1892 Ga0496113_0220905
1893 Ga0496113_0604244
1894 Ga0496113_0726241
1895 Ga0496114_0022995
1896 Ga0496114_0077004
1897 Ga0496114_0273533
1898 Ga0496114_0411623
1899 Ga0496115_0001274
1900 Ga0496115_0002540
1901 Ga0496115_0014554
1902 Ga0496115_0066601
1903 Ga0496115_0081735
1904 Ga0496115_0111402
1905 Ga0496115_0382915
1906 Ga0496115_0609617
1907 Ga0496119_0005212
1908 Ga0496119_0051069
1909 Ga0496119_0189002
1910 Ga0496120_0001261
1911 Ga0496120_0050705
1912 Ga0496121_0333629
1913 Ga0496122_0029170
1914 Ga0496123_0001703
1915 Ga0496124_0293031
1916 Ga0496125_0248807
1917 Ga0496126_0560649
1918 Ga0501031_0143782
1919 Ga0501032_0000786
1920 Ga0501032_0002130
1921 Ga0501033_0000197
1922 Ga0501033_0008439
1923 Ga0501033_0188276
1924 Ga0501033_0326363
1925 Ga0501034_0000031
1926 Ga0501034_0000901
1927 Ga0501034_0375642
1928 Ga0501034_0758487
1929 Ga0501036_0001200
1930 Ga0501036_0133594
1931 Ga0501037_0000067
1932 Ga0501037_0004427
1933 Ga0501038_0000013
1934 Ga0501038_0079083
1935 Ga0501039_0000010
1936 Ga0501039_0000484
1937 Ga0501039_0117158
1938 Ga0501040_0067518
1939 Ga0501040_0159089
1940 Ga0501042_0080180
1941 Ga0501043_0000056
1942 Ga0501043_0196791
1943 Ga0501046_0009800
1944 Ga0501046_0010748
1945 Ga0501046_0105022
1946 Ga0501046_0110475
1947 Ga0501047_0000201
1948 Ga0501047_0002957
1949 Ga0501047_0060095
1950 Ga0501047_0192302
1951 Ga0501047_0552932
1952 Ga0501067_0006710
1953 Ga0501067_0115095
1954 Ga0501067_0316488
1955 Ga0501070_0103833
1956 Ga0501072_0227288
1957 Ga0501073_0029178
1958 Ga0501076_0497229
1959 Ga0501079_0334446
1960 Ga0501080_0010630
1961 Ga0501081_0195297
1962 Ga0501035_0000063
1963 Ga0501035_0000077
1964 Ga0501035_0076885
1965 Ga0501044_0000013
1966 Ga0501044_0014303
1967 Ga0501045_0120384
1968 nmdc:mga03683_31654_c1
1969 nmdc:mga03683_81543_c1
1970 nmdc:mga03n38_212451_c1
1971 nmdc:mga00v17_39039_c1
1972 nmdc:mga0yw44_14764_c1
1973 nmdc:mga0yw44_15868_c1
1974 nmdc:mga0yw44_30670_c1
1975 nmdc:mga0yw44_53547_c1
1976 nmdc:mga0yw44_53830_c1
1977 nmdc:mga0yw44_92949_c1
1978 nmdc:mga06z11_162363_c1
1979 nmdc:mga06z11_163130_c1
1980 nmdc:mga06z11_39131_c1
1981 nmdc:mga04h51_98244_c1
1982 nmdc:mga07m45_73582_c1
1983 nmdc:mga05p37_42032_c1
1984 nmdc:mga05p37_59076_c1
1985 nmdc:mga0qj67_25436_c1
1986 nmdc:mga06r32_166724_c1
1987 nmdc:mga06r32_557138_c1
1988 nmdc:mga08y16_119655_c1
1989 nmdc:mga08y16_557856_c1
1990 nmdc:mga08y16_67679_c1
1991 nmdc:mga0n895_23021_c1
1992 nmdc:mga08x19_165141_c1
1993 nmdc:mga0a205_659103_c1
1994 nmdc:mga0sz30_10245_c1
1995 Ga0495601_0000011
1996 Ga0495601_0002132
1997 Ga0495601_0071245
1998 Ga0495601_0305345
1999 Ga0495612_0000006
2000 Ga0495612_0009288
2001 Ga0495612_0036146
2002 Ga0495612_0046505
2003 Ga0500610_0142622
2004 Ga0495595_0000147
2005 Ga0495595_0000308
2006 Ga0495595_0113146
2007 Ga0495619_0000013
2008 Ga0495619_0000583
2009 Ga0495619_0001822
2010 Ga0495619_0087591
2011 Ga0495619_0148031
2012 Ga0495619_0236644
2013 Ga0495619_0278816
2014 Ga0500583_0148677
2015 Ga0500641_0071673
2016 Ga0500556_0000046
2017 Ga0500592_023216
2018 Ga0500568_0000062
2019 Ga0500604_0014403
2020 Ga0500620_000478
2021 Ga0500620_155026
2022 Ga0500627_0231377
2023 Ga0500657_100452
2024 Ga0500645_031429
2025 Ga0501082_0009547
2026 Ga0501082_0161610
2027 Ga0501082_0771114
2028 Ga0530510_0020817
2029 Ga0530510_0041581
2030 2885317772
2031 2503201843
2032 2509118807
2033 2509367614
2034 2509396522
2035 2510315291
2036 2512931264
2037 2512959093
2038 2513613179
2039 2514038046
2040 2514420093
2041 2514588521
2042 2545677818
2043 2588517046
2044 2597813531
2045 2599936535
2046 2643773098
2047 2643775914
2048 2643794361
2049 2643839821
2050 2643984605
2051 2644129195
2052 2644158571
2053 2688598657
2054 2694633142
2055 2694635833
2056 2723575608
2057 2739308301
2058 2756675242
2059 2792749466
2060 2841739494
2061 2841764456
2062 2844007203
2063 2844013963
2064 2844108096
2065 2847675809
2066 2847692460
2067 2851188026
2068 2851250202
2069 2856314647
2070 2856325476
2071 2856331310
2072 2856335248
2073 2856347464
2074 2856350475
2075 2856358259
2076 2856370355
2077 2857350862
2078 2857370969
2079 2869166274
2080 2869172844
2081 2869238481
2082 2869242537
2083 2869254616
2084 2869262046
2085 2869271043
2086 2869272101
2087 2869285166
2088 2869291918
2089 2871435127
2090 2871440025
2091 2871449388
2092 2871455711
2093 2871465689
2094 2871472839
2095 2871479662
2096 2871484538
2097 2871494239
2098 2871499927
2099 2874102789
2100 2874112504
2101 2874121559
2102 2874123822
2103 2874138863
2104 2874146103
2105 2874149519
2106 2874157781
2107 2874162723
2108 2874174581
2109 2876369322
2110 2876379752
2111 2876388276
2112 2876394451
2113 2876402945
2114 2876413674
2115 2876415985
2116 2876423899
2117 2878039881
2118 2878732156
2119 2878745456
2120 2878752262
2121 2878759098
2122 2878764082
2123 2878771121
2124 2878780155
2125 2878783153
2126 2878793723
2127 2881151729
2128 2881155527
2129 2881167751
2130 2881852515
2131 2881854793
2132 2881865288
2133 2882636492
2134 2882912781
2135 2885309645
2136 2885320119
2137 2885326888
2138 2885334267
2139 2885350340
2140 2885350984
2141 2888339654
2142 2888347023
2143 2888355983
2144 2889010916
2145 2889017391
2146 2889792663
2147 2889918943
2148 2903451560
2149 2903493180
2150 2903503661
2151 2903515578
2152 2903523071
2153 2903534469
2154 2903544741
2155 2904661085
2156 2906314656
2157 2906327824
2158 2906329808
2159 2906360202
2160 2906363958
2161 2906377539
2162 2906381262
2163 2906402736
2164 2906410273
2165 2906414600
2166 2922138489
2167 2922157963
2168 2922163340
2169 2922174586
2170 2922180550
2171 2922190083
2172 2924712406
2173 2924726101
2174 2924727033
2175 2924733383
2176 2924747597
2177 2924750473
2178 2924759098
2179 2924769000
2180 2924783700
2181 2924789303
2182 2937816041
2183 2937824700
2184 2937842417
2185 2937852962
2186 2937867173
2187 2937881895
2188 2937892918
2189 2937978358
2190 2937981523
2191 2937998587
2192 2958040867
2193 2958056949
2194 2958067647
2195 2958077424
2196 2958089015
2197 2958098770
2198 2958102678
2199 2958113769
2200 2958118657
2201 2958125398
2202 2958136316
2203 2958143893
2204 2958150474
2205 2958159916
2206 2958169067
2207 2958173886
2208 2958185784
2209 2961084161
2210 2961116236
2211 2961129331
2212 2961141130
2213 2961167526
2214 2961175730
2215 2961186434
2216 2963647955
2217 2965022349
2218 2965026368
2219 2965033151
2220 2965046622
2221 2965055038
2222 2965068318
2223 2965103479
2224 2965116007
2225 2968001710
2226 2968009346
2227 2968018213
2228 2968085889
2229 2968096472
2230 2968100736
2231 2968112142
2232 2968120907
2233 2968132523
2234 2968144522
2235 2968175933
2236 2970471613
2237 2970495561
2238 2970508395
2239 2970511800
2240 2970530542
2241 2970541203
2242 2970549293
2243 2970558927
2244 2970599779
2245 2970626127
2246 2970632338
2247 2977827638
2248 2977833133
2249 2977846277
2250 2977854931
2251 2977871479
2252 2977876648
2253 2977899001
2254 2977914447
2255 2977921990
2256 2977924457
2257 2977936813
2258 2977947434
2259 2977951851
2260 2977964401
2261 2977975285
2262 2977990496
2263 2979713796
2264 2979750943
2265 2979771382
2266 2979778468
2267 2979781954
2268 2979795246
2269 2979811956
2270 2987638047
2271 2987650543
2272 2987653573
2273 2987663532
2274 2987669010
2275 2987680276
2276 2996313868
2277 2996340952
2278 2996344042
2279 2996350400
2280 2996391693
2281 3000140365
2282 3004169138
2283 3004192593
2284 3004199588
2285 3004205631
2286 3004216191
2287 3004223941
2288 3004233595
2289 3004246338
2290 3004255696
2291 3004269697
2292 3004277098
2293 3004294003
2294 3004334091
2295 637074367
2296 641642652
2297 649873174
2298 8004304579
2299 8004316238
2300 8004365715
2301 8004380619
2302 8004394356
2303 8004399782
2304 8004450258
2305 8004637243
2306 8004640597
2307 8004697363
2308 8004709559
2309 8004720917
2310 8004734257
2311 8055620987
2312 8057533473

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02572

CobA_CobO_BtuR

ATP:corrinoid adenosyltransferase BtuR/CobO/CobP

55

226

0.99

PF12557

Co_AT_N

Cob(I)alamin adenosyltransferase N terminal

22

49

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.9136 31 188
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.9025 31 188
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8481 33 202
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8384 33 202
1g64-assembly1.cif.gz_B the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex 0.7968 14 202
ID Description Score Start End Superfamily
1g5rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9077 31 188 3.40.50.300
1g5rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8965 31 188 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8437 33 202 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8342 33 202 3.40.50.300
af_I6Y1V6_9_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8003 33 202 3.40.50.300
ID Description Score Start End GO Terms
AF-V9PFW6-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9472 47 179 GO:0005524
GO:0008817
GO:0009236
AF-A0A382M5X8-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase 0.9435 29 183 GO:0005524
GO:0008817
GO:0009236
AF-T1ALC8-F1-model_v4 Cob(I)alamin adenosyltransferase (EC 2.5.1.17) 0.9415 31 179 GO:0005524
GO:0008817
GO:0009236
AF-A0A3D1XR81-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase 0.9371 31 158 GO:0005524
GO:0008817
GO:0009236
AF-A0A528N548-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9326 53 149 GO:0005524
GO:0008817
GO:0009236

Map