F490953
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1157 | 425 | 2314 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300006237|Ga0097621_102009464|Ga0097621_1020094642 |
| Length | 100 |
| Sequence | MNDMAGGFAPQESGDGALAANFRLLQDVDVKLTVEIGSTSLTLRELLALGETSVIELDRQANELLDVLVNGTLIGRGEVVMVGDRFGVRMTELVTPDKRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 104 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 122 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 208 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 226 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 227 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 228 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 229 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 230 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 231 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 232 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 233 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 234 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 235 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 236 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 313 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 314 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 315 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 316 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 317 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 318 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 333 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 334 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 335 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 336 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 337 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 342 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 343 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 344 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 345 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 346 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 347 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 348 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 350 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 353 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 354 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 355 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 356 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 357 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 361 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 362 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 363 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 373 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 375 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 376 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 377 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 381 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 382 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 383 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 384 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 385 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 386 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 387 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 389 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 390 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 391 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 392 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 393 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 396 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 397 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 400 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 401 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 403 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 406 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 407 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 408 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 409 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 410 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 411 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 412 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 413 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 414 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 415 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 416 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 417 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 418 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 419 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 420 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 421 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 422 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 423 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 424 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 425 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0.17 |
| Isolates | 1.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0 |
| Endosphere | 8.9 |
| Nodule | 0 |
| Rhizoplane | 3.28 |
| Rhizosphere | 79.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0097621_102009464 | 3300006237 | Bacteria | 552 |
| 2 | SwRhRL2b_contig_200884 | 2162886007 | Unclassified | 1129 |
| 3 | SwRhRL2b_contig_682763 | 2162886007 | Bacteria | 1245 |
| 4 | JGI24034J14986_100946 | 3300001432 | Bacteria | 1707 |
| 5 | JGI24736J21556_1000015 | 3300001904 | Bacteria | 28999 |
| 6 | JGI24736J21556_1000379 | 3300001904 | Bacteria | 8429 |
| 7 | JGI24736J21556_1041369 | 3300001904 | Bacteria | 708 |
| 8 | JGI24741J21665_1000200 | 3300001915 | Bacteria | 17725 |
| 9 | JGI24741J21665_1007687 | 3300001915 | Bacteria | 2079 |
| 10 | JGI24752J21851_1000029 | 3300001976 | Bacteria | 16885 |
| 11 | JGI24752J21851_1000343 | 3300001976 | Bacteria | 6470 |
| 12 | JGI24752J21851_1033475 | 3300001976 | Bacteria | 681 |
| 13 | JGI24740J21852_10005510 | 3300001979 | Bacteria | 5343 |
| 14 | JGI24740J21852_10021799 | 3300001979 | Bacteria | 2215 |
| 15 | JGI24740J21852_10066980 | 3300001979 | Bacteria | 973 |
| 16 | JGI24740J21852_10070938 | 3300001979 | Bacteria | 934 |
| 17 | JGI24739J22299_10007450 | 3300001989 | Bacteria | 4106 |
| 18 | JGI24739J22299_10013160 | 3300001989 | Bacteria | 3027 |
| 19 | JGI24739J22299_10016802 | 3300001989 | Bacteria | 2646 |
| 20 | JGI24739J22299_10035566 | 3300001989 | Bacteria | 1687 |
| 21 | JGI24739J22299_10062228 | 3300001989 | Bacteria | 1177 |
| 22 | JGI24739J22299_10149173 | 3300001989 | Bacteria | 692 |
| 23 | JGI24737J22298_10000844 | 3300001990 | Bacteria | 10918 |
| 24 | JGI24737J22298_10002091 | 3300001990 | Bacteria | 7133 |
| 25 | JGI24737J22298_10019795 | 3300001990 | Bacteria | 2152 |
| 26 | JGI24737J22298_10046085 | 3300001990 | Bacteria | 1331 |
| 27 | JGI24737J22298_10075128 | 3300001990 | Bacteria | 1007 |
| 28 | JGI24743J22301_10025233 | 3300001991 | Bacteria | 1151 |
| 29 | JGI24735J21928_10000451 | 3300002067 | Bacteria | 14425 |
| 30 | JGI24735J21928_10003995 | 3300002067 | Bacteria | 4990 |
| 31 | JGI24735J21928_10004623 | 3300002067 | Bacteria | 4607 |
| 32 | JGI24735J21928_10038022 | 3300002067 | Bacteria | 1409 |
| 33 | JGI24750J21931_1000259 | 3300002070 | Bacteria | 9019 |
| 34 | JGI24748J21848_1000023 | 3300002074 | Bacteria | 106523 |
| 35 | JGI24748J21848_1023771 | 3300002074 | Bacteria | 744 |
| 36 | JGI24738J21930_10000728 | 3300002075 | Bacteria | 9474 |
| 37 | JGI24738J21930_10000824 | 3300002075 | Bacteria | 8877 |
| 38 | JGI24738J21930_10002030 | 3300002075 | Bacteria | 5429 |
| 39 | JGI24738J21930_10071374 | 3300002075 | Bacteria | 720 |
| 40 | JGI24749J21850_1001696 | 3300002076 | Bacteria | 3122 |
| 41 | JGI24744J21845_10003312 | 3300002077 | Bacteria | 3307 |
| 42 | JGI24035J26624_1002255 | 3300002126 | Bacteria | 1802 |
| 43 | JGI24034J26672_10000010 | 3300002239 | Bacteria | 150746 |
| 44 | JGI24034J26672_10005447 | 3300002239 | Bacteria | 1825 |
| 45 | JGI24034J26672_10008951 | 3300002239 | Bacteria | 1471 |
| 46 | JGI24742J22300_10000537 | 3300002244 | Bacteria | 5673 |
| 47 | JGI24751J29686_10056506 | 3300002459 | Bacteria | 809 |
| 48 | JGI25165J46597_1000124 | 3300003214 | Bacteria | 131341 |
| 49 | rootH1_10081084 | 3300003316 | Bacteria | 3221 |
| 50 | Ga0055542_1001963 | 3300003762 | Bacteria | 7991 |
| 51 | Ga0055542_1028623 | 3300003762 | Bacteria | 732 |
| 52 | Ga0055530_10000485 | 3300003791 | Bacteria | 34524 |
| 53 | Ga0055531_10000524 | 3300003794 | Bacteria | 34477 |
| 54 | Ga0065165_1063338 | 3300005262 | Bacteria | 1005 |
| 55 | Ga0065704_10005679 | 3300005289 | Bacteria | 3736 |
| 56 | Ga0065704_10074420 | 3300005289 | Bacteria | 6283 |
| 57 | Ga0065704_10093669 | 3300005289 | Bacteria | 2584 |
| 58 | Ga0065707_10027121 | 3300005295 | Bacteria | 1717 |
| 59 | Ga0065707_10082699 | 3300005295 | Bacteria | 12652 |
| 60 | Ga0065707_10100815 | 3300005295 | Unclassified | 2903 |
| 61 | Ga0065707_10153765 | 3300005295 | Bacteria | 1630 |
| 62 | Ga0065707_10160566 | 3300005295 | Bacteria | 1567 |
| 63 | Ga0065707_10665677 | 3300005295 | Bacteria | 656 |
| 64 | Ga0070658_10000050 | 3300005327 | Bacteria | 119052 |
| 65 | Ga0070658_10000057 | 3300005327 | Bacteria | 113572 |
| 66 | Ga0070658_10008422 | 3300005327 | Bacteria | 8294 |
| 67 | Ga0070658_10104912 | 3300005327 | Bacteria | 2338 |
| 68 | Ga0070658_10646559 | 3300005327 | Bacteria | 917 |
| 69 | Ga0070658_10704415 | 3300005327 | Bacteria | 876 |
| 70 | Ga0070676_10001112 | 3300005328 | Bacteria | 13442 |
| 71 | Ga0070676_10255743 | 3300005328 | Bacteria | 1171 |
| 72 | Ga0070683_100049964 | 3300005329 | Bacteria | 3869 |
| 73 | Ga0070683_101112413 | 3300005329 | Bacteria | 759 |
| 74 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 75 | Ga0070670_100000135 | 3300005331 | Bacteria | 69478 |
| 76 | Ga0070670_100000815 | 3300005331 | Bacteria | 24294 |
| 77 | Ga0070670_100001203 | 3300005331 | Bacteria | 20550 |
| 78 | Ga0070670_100056819 | 3300005331 | Bacteria | 3359 |
| 79 | Ga0070670_100126486 | 3300005331 | Bacteria | 2206 |
| 80 | Ga0070670_101133684 | 3300005331 | Bacteria | 714 |
| 81 | Ga0068869_100000528 | 3300005334 | Bacteria | 21287 |
| 82 | Ga0068869_100432191 | 3300005334 | Bacteria | 1088 |
| 83 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 84 | Ga0070666_10000115 | 3300005335 | Bacteria | 55609 |
| 85 | Ga0070666_10004754 | 3300005335 | Bacteria | 8296 |
| 86 | Ga0070666_10027244 | 3300005335 | Bacteria | 3741 |
| 87 | Ga0070682_100143730 | 3300005337 | Bacteria | 1629 |
| 88 | Ga0068868_100000074 | 3300005338 | Bacteria | 58620 |
| 89 | Ga0070660_100002838 | 3300005339 | Bacteria | 11930 |
| 90 | Ga0070660_100004367 | 3300005339 | Bacteria | 9762 |
| 91 | Ga0070660_100008583 | 3300005339 | Bacteria | 7155 |
| 92 | Ga0070660_100013497 | 3300005339 | Bacteria | 5861 |
| 93 | Ga0070660_100056725 | 3300005339 | Bacteria | 3031 |
| 94 | Ga0070660_100058458 | 3300005339 | Bacteria | 2988 |
| 95 | Ga0070660_100957382 | 3300005339 | Bacteria | 723 |
| 96 | Ga0070689_101607124 | 3300005340 | Bacteria | 590 |
| 97 | Ga0070687_100185112 | 3300005343 | Bacteria | 1250 |
| 98 | Ga0070661_100043344 | 3300005344 | Bacteria | 3286 |
| 99 | Ga0070661_100056833 | 3300005344 | Bacteria | 2867 |
| 100 | Ga0070661_100111742 | 3300005344 | Bacteria | 2041 |
| 101 | Ga0070661_100467201 | 3300005344 | Bacteria | 1006 |
| 102 | Ga0070668_100000117 | 3300005347 | Bacteria | 48801 |
| 103 | Ga0070668_100000119 | 3300005347 | Bacteria | 48651 |
| 104 | Ga0070668_100008086 | 3300005347 | Bacteria | 7812 |
| 105 | Ga0070668_100025713 | 3300005347 | Bacteria | 4465 |
| 106 | Ga0070668_100124001 | 3300005347 | Bacteria | 2068 |
| 107 | Ga0070668_100216084 | 3300005347 | Bacteria | 1579 |
| 108 | Ga0070668_100435792 | 3300005347 | Bacteria | 1124 |
| 109 | Ga0070668_102128782 | 3300005347 | Bacteria | 518 |
| 110 | Ga0070669_100000004 | 3300005353 | Bacteria | 314707 |
| 111 | Ga0070669_100000017 | 3300005353 | Bacteria | 195995 |
| 112 | Ga0070669_100000020 | 3300005353 | Bacteria | 181297 |
| 113 | Ga0070669_100021925 | 3300005353 | Bacteria | 4568 |
| 114 | Ga0070669_100048028 | 3300005353 | Bacteria | 3115 |
| 115 | Ga0070669_101973825 | 3300005353 | Bacteria | 510 |
| 116 | Ga0070675_100000482 | 3300005354 | Bacteria | 27236 |
| 117 | Ga0070675_100491535 | 3300005354 | Bacteria | 1105 |
| 118 | Ga0070671_100000004 | 3300005355 | Bacteria | 262155 |
| 119 | Ga0070671_100000426 | 3300005355 | Bacteria | 29399 |
| 120 | Ga0070671_100012098 | 3300005355 | Bacteria | 6944 |
| 121 | Ga0070671_100014451 | 3300005355 | Bacteria | 6380 |
| 122 | Ga0070671_100673147 | 3300005355 | Bacteria | 897 |
| 123 | Ga0070674_100014876 | 3300005356 | Bacteria | 4843 |
| 124 | Ga0070674_100803879 | 3300005356 | Bacteria | 812 |
| 125 | Ga0070674_100963512 | 3300005356 | Bacteria | 747 |
| 126 | Ga0070673_100000008 | 3300005364 | Bacteria | 166844 |
| 127 | Ga0070673_100792423 | 3300005364 | Bacteria | 875 |
| 128 | Ga0070688_100010711 | 3300005365 | Bacteria | 5066 |
| 129 | Ga0070688_100296952 | 3300005365 | Unclassified | 1166 |
| 130 | Ga0070659_100015151 | 3300005366 | Bacteria | 5767 |
| 131 | Ga0070659_100037194 | 3300005366 | Bacteria | 3794 |
| 132 | Ga0070659_100065464 | 3300005366 | Bacteria | 2878 |
| 133 | Ga0070659_100221119 | 3300005366 | Bacteria | 1563 |
| 134 | Ga0070659_100435276 | 3300005366 | Bacteria | 1110 |
| 135 | Ga0070659_100478239 | 3300005366 | Bacteria | 1060 |
| 136 | Ga0070667_100000016 | 3300005367 | Bacteria | 237028 |
| 137 | Ga0070667_100000113 | 3300005367 | Bacteria | 104015 |
| 138 | Ga0070667_100000357 | 3300005367 | Bacteria | 49937 |
| 139 | Ga0070667_100000969 | 3300005367 | Bacteria | 26391 |
| 140 | Ga0070667_100002047 | 3300005367 | Bacteria | 17855 |
| 141 | Ga0070667_100014603 | 3300005367 | Bacteria | 6489 |
| 142 | Ga0070667_100373346 | 3300005367 | Bacteria | 1294 |
| 143 | Ga0070667_101141709 | 3300005367 | Bacteria | 729 |
| 144 | Ga0070667_101248868 | 3300005367 | Bacteria | 696 |
| 145 | Ga0070667_101302372 | 3300005367 | Bacteria | 681 |
| 146 | Ga0070705_100058395 | 3300005440 | Bacteria | 2280 |
| 147 | Ga0070708_100213171 | 3300005445 | Bacteria | 1810 |
| 148 | Ga0070663_100008375 | 3300005455 | Bacteria | 6355 |
| 149 | Ga0070663_100175974 | 3300005455 | Bacteria | 1657 |
| 150 | Ga0070663_100184030 | 3300005455 | Bacteria | 1622 |
| 151 | Ga0070663_100206062 | 3300005455 | Bacteria | 1537 |
| 152 | Ga0070663_100297134 | 3300005455 | Bacteria | 1291 |
| 153 | Ga0070678_100003552 | 3300005456 | Bacteria | 8698 |
| 154 | Ga0070678_100302164 | 3300005456 | Bacteria | 1360 |
| 155 | Ga0070662_100009993 | 3300005457 | Bacteria | 6213 |
| 156 | Ga0070662_100038291 | 3300005457 | Bacteria | 3406 |
| 157 | Ga0070662_100054299 | 3300005457 | Bacteria | 2903 |
| 158 | Ga0070662_100256482 | 3300005457 | Bacteria | 1407 |
| 159 | Ga0070662_100263336 | 3300005457 | Bacteria | 1389 |
| 160 | Ga0070662_101539970 | 3300005457 | Bacteria | 573 |
| 161 | Ga0068867_100000003 | 3300005459 | Bacteria | 217886 |
| 162 | Ga0068867_100558914 | 3300005459 | Bacteria | 992 |
| 163 | Ga0070685_10000291 | 3300005466 | Bacteria | 31615 |
| 164 | Ga0070685_10773857 | 3300005466 | Bacteria | 705 |
| 165 | Ga0070707_100950460 | 3300005468 | Bacteria | 824 |
| 166 | Ga0070679_100653556 | 3300005530 | Bacteria | 994 |
| 167 | Ga0070684_100671317 | 3300005535 | Bacteria | 965 |
| 168 | Ga0068853_100000408 | 3300005539 | Bacteria | 29530 |
| 169 | Ga0068853_100049504 | 3300005539 | Bacteria | 3611 |
| 170 | Ga0068853_100129707 | 3300005539 | Bacteria | 2256 |
| 171 | Ga0068853_100155785 | 3300005539 | Bacteria | 2059 |
| 172 | Ga0068853_100220351 | 3300005539 | Bacteria | 1732 |
| 173 | Ga0068853_100381375 | 3300005539 | Bacteria | 1316 |
| 174 | Ga0068853_101232667 | 3300005539 | Bacteria | 722 |
| 175 | Ga0070672_100419806 | 3300005543 | Bacteria | 1149 |
| 176 | Ga0070672_101399494 | 3300005543 | Bacteria | 626 |
| 177 | Ga0070686_100000041 | 3300005544 | Bacteria | 104174 |
| 178 | Ga0070693_100082827 | 3300005547 | Bacteria | 1916 |
| 179 | Ga0070693_100290623 | 3300005547 | Bacteria | 1098 |
| 180 | Ga0070665_100000368 | 3300005548 | Bacteria | 67541 |
| 181 | Ga0070665_100129628 | 3300005548 | Bacteria | 2524 |
| 182 | Ga0070665_100227729 | 3300005548 | Bacteria | 1864 |
| 183 | Ga0070665_100651920 | 3300005548 | Bacteria | 1066 |
| 184 | Ga0068855_100003895 | 3300005563 | Bacteria | 18224 |
| 185 | Ga0068855_100325483 | 3300005563 | Bacteria | 1698 |
| 186 | Ga0068855_100364233 | 3300005563 | Bacteria | 1590 |
| 187 | Ga0068855_100493147 | 3300005563 | Bacteria | 1332 |
| 188 | Ga0068855_100580485 | 3300005563 | Bacteria | 1211 |
| 189 | Ga0068855_100780631 | 3300005563 | Bacteria | 1017 |
| 190 | Ga0068855_100783044 | 3300005563 | Bacteria | 1015 |
| 191 | Ga0068855_101533168 | 3300005563 | Bacteria | 683 |
| 192 | Ga0070664_100041964 | 3300005564 | Bacteria | 3862 |
| 193 | Ga0070664_100054636 | 3300005564 | Bacteria | 3389 |
| 194 | Ga0070664_100185252 | 3300005564 | Bacteria | 1852 |
| 195 | Ga0070664_101974678 | 3300005564 | Bacteria | 554 |
| 196 | Ga0068857_100026906 | 3300005577 | Bacteria | 5072 |
| 197 | Ga0068857_100037444 | 3300005577 | Bacteria | 4297 |
| 198 | Ga0068857_100073026 | 3300005577 | Bacteria | 3056 |
| 199 | Ga0068857_100079335 | 3300005577 | Bacteria | 2930 |
| 200 | Ga0068857_100084504 | 3300005577 | Bacteria | 2836 |
| 201 | Ga0068857_100131683 | 3300005577 | Bacteria | 2256 |
| 202 | Ga0068857_100150957 | 3300005577 | Bacteria | 2105 |
| 203 | Ga0068854_100001318 | 3300005578 | Bacteria | 14977 |
| 204 | Ga0068854_100010079 | 3300005578 | Bacteria | 6119 |
| 205 | Ga0068854_100018727 | 3300005578 | Bacteria | 4653 |
| 206 | Ga0068854_100049284 | 3300005578 | Bacteria | 3008 |
| 207 | Ga0068854_100098886 | 3300005578 | Bacteria | 2184 |
| 208 | Ga0068854_100130300 | 3300005578 | Bacteria | 1920 |
| 209 | Ga0068854_101221017 | 3300005578 | Bacteria | 674 |
| 210 | Ga0068856_100003087 | 3300005614 | Bacteria | 17012 |
| 211 | Ga0068856_100021580 | 3300005614 | Bacteria | 6258 |
| 212 | Ga0068856_100180410 | 3300005614 | Bacteria | 2124 |
| 213 | Ga0068856_100896913 | 3300005614 | Bacteria | 905 |
| 214 | Ga0068856_101454313 | 3300005614 | Bacteria | 699 |
| 215 | Ga0068856_101937912 | 3300005614 | Bacteria | 600 |
| 216 | Ga0068856_101942530 | 3300005614 | Bacteria | 599 |
| 217 | Ga0068852_100002299 | 3300005616 | Bacteria | 13144 |
| 218 | Ga0068852_100031099 | 3300005616 | Bacteria | 4401 |
| 219 | Ga0068852_100132840 | 3300005616 | Bacteria | 2294 |
| 220 | Ga0068852_100193270 | 3300005616 | Bacteria | 1922 |
| 221 | Ga0068852_100342914 | 3300005616 | Bacteria | 1457 |
| 222 | Ga0068852_100615321 | 3300005616 | Bacteria | 1091 |
| 223 | Ga0068852_100780069 | 3300005616 | Bacteria | 969 |
| 224 | Ga0068852_100886793 | 3300005616 | Bacteria | 909 |
| 225 | Ga0068852_101820514 | 3300005616 | Bacteria | 631 |
| 226 | Ga0068859_100000233 | 3300005617 | Bacteria | 54852 |
| 227 | Ga0068859_100003392 | 3300005617 | Bacteria | 16213 |
| 228 | Ga0068859_100035740 | 3300005617 | Bacteria | 4986 |
| 229 | Ga0068859_100055791 | 3300005617 | Bacteria | 3975 |
| 230 | Ga0068859_100162429 | 3300005617 | Bacteria | 2313 |
| 231 | Ga0068859_100433024 | 3300005617 | Bacteria | 1412 |
| 232 | Ga0068859_100936126 | 3300005617 | Bacteria | 950 |
| 233 | Ga0068859_102377425 | 3300005617 | Bacteria | 584 |
| 234 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 235 | Ga0068864_100000191 | 3300005618 | Bacteria | 55913 |
| 236 | Ga0068864_100000798 | 3300005618 | Bacteria | 26391 |
| 237 | Ga0068864_100001033 | 3300005618 | Bacteria | 23327 |
| 238 | Ga0068864_100005449 | 3300005618 | Bacteria | 10436 |
| 239 | Ga0068864_100006140 | 3300005618 | Bacteria | 9854 |
| 240 | Ga0068864_100057140 | 3300005618 | Bacteria | 3371 |
| 241 | Ga0068861_100006153 | 3300005719 | Bacteria | 8162 |
| 242 | Ga0068861_100007109 | 3300005719 | Bacteria | 7660 |
| 243 | Ga0068861_100200940 | 3300005719 | Bacteria | 1673 |
| 244 | Ga0068861_101376968 | 3300005719 | Bacteria | 688 |
| 245 | Ga0068851_10005533 | 3300005834 | Bacteria | 5725 |
| 246 | Ga0068851_10058089 | 3300005834 | Bacteria | 1976 |
| 247 | Ga0068851_10109605 | 3300005834 | Bacteria | 1473 |
| 248 | Ga0068870_10138802 | 3300005840 | Bacteria | 1420 |
| 249 | Ga0068863_100000132 | 3300005841 | Bacteria | 78811 |
| 250 | Ga0068863_100000166 | 3300005841 | Bacteria | 71068 |
| 251 | Ga0068863_100005052 | 3300005841 | Bacteria | 13009 |
| 252 | Ga0068863_100014467 | 3300005841 | Bacteria | 7598 |
| 253 | Ga0068863_100026394 | 3300005841 | Bacteria | 5542 |
| 254 | Ga0068863_100196458 | 3300005841 | Bacteria | 1939 |
| 255 | Ga0068863_100285874 | 3300005841 | Bacteria | 1598 |
| 256 | Ga0068863_101076647 | 3300005841 | Bacteria | 808 |
| 257 | Ga0068858_100000288 | 3300005842 | Bacteria | 54436 |
| 258 | Ga0068858_100000291 | 3300005842 | Bacteria | 54242 |
| 259 | Ga0068858_100036066 | 3300005842 | Bacteria | 4585 |
| 260 | Ga0068858_100039517 | 3300005842 | Bacteria | 4374 |
| 261 | Ga0068858_100321273 | 3300005842 | Bacteria | 1479 |
| 262 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 263 | Ga0068860_100000215 | 3300005843 | Bacteria | 90561 |
| 264 | Ga0068860_100000256 | 3300005843 | Bacteria | 78477 |
| 265 | Ga0068860_100035312 | 3300005843 | Bacteria | 4795 |
| 266 | Ga0068860_100039119 | 3300005843 | Bacteria | 4537 |
| 267 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 268 | Ga0068862_100000151 | 3300005844 | Bacteria | 78811 |
| 269 | Ga0068862_100000346 | 3300005844 | Bacteria | 50307 |
| 270 | Ga0068862_100000581 | 3300005844 | Bacteria | 38018 |
| 271 | Ga0068862_100000596 | 3300005844 | Bacteria | 37603 |
| 272 | Ga0068862_100202785 | 3300005844 | Bacteria | 1789 |
| 273 | Ga0081455_10000049 | 3300005937 | Bacteria | 126459 |
| 274 | Ga0081455_10301827 | 3300005937 | Bacteria | 1148 |
| 275 | Ga0081539_10022573 | 3300005985 | Bacteria | 4158 |
| 276 | Ga0075368_10000139 | 3300006042 | Bacteria | 19177 |
| 277 | Ga0075363_100002110 | 3300006048 | Bacteria | 7973 |
| 278 | Ga0075364_10245609 | 3300006051 | Bacteria | 1216 |
| 279 | Ga0075367_10017797 | 3300006178 | Bacteria | 3907 |
| 280 | Ga0075366_10105588 | 3300006195 | Bacteria | 1693 |
| 281 | Ga0075366_10899607 | 3300006195 | Bacteria | 551 |
| 282 | Ga0097621_100026787 | 3300006237 | Bacteria | 4527 |
| 283 | Ga0075370_10031127 | 3300006353 | Bacteria | 2978 |
| 284 | Ga0075370_10035043 | 3300006353 | Bacteria | 2815 |
| 285 | Ga0075370_10610688 | 3300006353 | Bacteria | 661 |
| 286 | Ga0068871_100003615 | 3300006358 | Bacteria | 10621 |
| 287 | Ga0068865_100000002 | 3300006881 | Bacteria | 285745 |
| 288 | Ga0068865_100858645 | 3300006881 | Bacteria | 787 |
| 289 | Ga0097620_100000233 | 3300006931 | Bacteria | 54852 |
| 290 | Ga0097620_100003392 | 3300006931 | Bacteria | 16213 |
| 291 | Ga0097620_100035739 | 3300006931 | Bacteria | 4986 |
| 292 | Ga0097620_100055791 | 3300006931 | Bacteria | 3975 |
| 293 | Ga0097620_100162424 | 3300006931 | Bacteria | 2313 |
| 294 | Ga0097620_100433012 | 3300006931 | Bacteria | 1412 |
| 295 | Ga0097620_100936300 | 3300006931 | Bacteria | 950 |
| 296 | Ga0097620_102376612 | 3300006931 | Bacteria | 584 |
| 297 | Ga0105251_10000264 | 3300009011 | Bacteria | 52208 |
| 298 | Ga0105251_10015469 | 3300009011 | Bacteria | 4168 |
| 299 | Ga0105251_10038670 | 3300009011 | Bacteria | 2336 |
| 300 | Ga0105251_10646565 | 3300009011 | Bacteria | 505 |
| 301 | Ga0105240_10056330 | 3300009093 | Bacteria | 4920 |
| 302 | Ga0105240_10091245 | 3300009093 | Bacteria | 3723 |
| 303 | Ga0105240_10113964 | 3300009093 | Bacteria | 3266 |
| 304 | Ga0105240_10439268 | 3300009093 | Bacteria | 1462 |
| 305 | Ga0105240_11321680 | 3300009093 | Bacteria | 760 |
| 306 | Ga0105245_10000184 | 3300009098 | Bacteria | 58946 |
| 307 | Ga0105247_10000989 | 3300009101 | Bacteria | 21433 |
| 308 | Ga0105247_10003404 | 3300009101 | Bacteria | 10393 |
| 309 | Ga0105247_10382478 | 3300009101 | Bacteria | 998 |
| 310 | Ga0105247_10396008 | 3300009101 | Bacteria | 983 |
| 311 | Ga0105247_10406811 | 3300009101 | Bacteria | 971 |
| 312 | Ga0105247_11378572 | 3300009101 | Bacteria | 570 |
| 313 | Ga0114129_10250889 | 3300009147 | Bacteria | 2375 |
| 314 | Ga0105243_10000031 | 3300009148 | Bacteria | 185825 |
| 315 | Ga0105243_10290320 | 3300009148 | Bacteria | 1477 |
| 316 | Ga0105243_10438223 | 3300009148 | Bacteria | 1223 |
| 317 | Ga0105241_10002989 | 3300009174 | Bacteria | 12624 |
| 318 | Ga0105241_10052516 | 3300009174 | Bacteria | 3112 |
| 319 | Ga0105241_11147730 | 3300009174 | Bacteria | 734 |
| 320 | Ga0105242_10000171 | 3300009176 | Bacteria | 49237 |
| 321 | Ga0105248_10000012 | 3300009177 | Bacteria | 333963 |
| 322 | Ga0105248_10000192 | 3300009177 | Bacteria | 70644 |
| 323 | Ga0105248_10003135 | 3300009177 | Bacteria | 18295 |
| 324 | Ga0105248_10028054 | 3300009177 | Bacteria | 6270 |
| 325 | Ga0105248_10217454 | 3300009177 | Bacteria | 2152 |
| 326 | Ga0105248_10324045 | 3300009177 | Bacteria | 1735 |
| 327 | Ga0105248_10352642 | 3300009177 | Bacteria | 1656 |
| 328 | Ga0105248_10467294 | 3300009177 | Bacteria | 1422 |
| 329 | Ga0105248_12712317 | 3300009177 | Bacteria | 565 |
| 330 | Ga0105237_10002820 | 3300009545 | Bacteria | 21127 |
| 331 | Ga0105237_10068927 | 3300009545 | Bacteria | 3532 |
| 332 | Ga0105237_10073893 | 3300009545 | Bacteria | 3401 |
| 333 | Ga0105237_10112662 | 3300009545 | Bacteria | 2713 |
| 334 | Ga0105238_10030882 | 3300009551 | Bacteria | 5452 |
| 335 | Ga0105238_10152857 | 3300009551 | Bacteria | 2283 |
| 336 | Ga0105238_10421315 | 3300009551 | Bacteria | 1330 |
| 337 | Ga0105238_10522637 | 3300009551 | Bacteria | 1189 |
| 338 | Ga0105238_10546884 | 3300009551 | Bacteria | 1162 |
| 339 | Ga0105249_10000014 | 3300009553 | Bacteria | 283274 |
| 340 | Ga0105249_10000099 | 3300009553 | Bacteria | 119885 |
| 341 | Ga0105249_10000699 | 3300009553 | Bacteria | 30440 |
| 342 | Ga0105249_10017636 | 3300009553 | Bacteria | 6339 |
| 343 | Ga0105249_10244793 | 3300009553 | Bacteria | 1775 |
| 344 | Ga0105249_10331263 | 3300009553 | Bacteria | 1536 |
| 345 | Ga0105249_10738720 | 3300009553 | Bacteria | 1046 |
| 346 | Ga0105249_10751522 | 3300009553 | Bacteria | 1037 |
| 347 | Ga0105148_100092 | 3300009978 | Bacteria | 14396 |
| 348 | Ga0105147_101503 | 3300009982 | Bacteria | 1908 |
| 349 | Ga0105239_10000451 | 3300010375 | Bacteria | 59882 |
| 350 | Ga0105239_10028478 | 3300010375 | Bacteria | 6144 |
| 351 | Ga0105239_10149947 | 3300010375 | Bacteria | 2602 |
| 352 | Ga0105239_10361584 | 3300010375 | Bacteria | 1639 |
| 353 | Ga0105239_10516815 | 3300010375 | Bacteria | 1358 |
| 354 | Ga0105239_10600086 | 3300010375 | Bacteria | 1256 |
| 355 | Ga0105246_10000056 | 3300011119 | Bacteria | 45044 |
| 356 | Ga0105246_10283343 | 3300011119 | Bacteria | 1330 |
| 357 | Ga0157326_1000375 | 3300012513 | Bacteria | 5328 |
| 358 | Ga0157373_10008588 | 3300013100 | Bacteria | 7586 |
| 359 | Ga0157373_10051976 | 3300013100 | Bacteria | 2917 |
| 360 | Ga0157373_10074440 | 3300013100 | Bacteria | 2396 |
| 361 | Ga0157373_10151590 | 3300013100 | Bacteria | 1630 |
| 362 | Ga0157373_10171969 | 3300013100 | Bacteria | 1524 |
| 363 | Ga0157373_10509271 | 3300013100 | Bacteria | 870 |
| 364 | Ga0157371_10086710 | 3300013102 | Bacteria | 2217 |
| 365 | Ga0157371_10184773 | 3300013102 | Bacteria | 1492 |
| 366 | Ga0157371_11155234 | 3300013102 | Bacteria | 595 |
| 367 | Ga0157370_10000080 | 3300013104 | Bacteria | 105872 |
| 368 | Ga0157370_10003119 | 3300013104 | Bacteria | 19629 |
| 369 | Ga0157370_10083609 | 3300013104 | Bacteria | 3001 |
| 370 | Ga0157370_10372884 | 3300013104 | Bacteria | 1315 |
| 371 | Ga0157370_10925981 | 3300013104 | Bacteria | 790 |
| 372 | Ga0157369_10042446 | 3300013105 | Bacteria | 4961 |
| 373 | Ga0157369_10055589 | 3300013105 | Bacteria | 4272 |
| 374 | Ga0157369_10068286 | 3300013105 | Bacteria | 3818 |
| 375 | Ga0157369_10167917 | 3300013105 | Bacteria | 2313 |
| 376 | Ga0157369_11065092 | 3300013105 | Bacteria | 827 |
| 377 | Ga0157369_12621612 | 3300013105 | Bacteria | 509 |
| 378 | Ga0157374_10000184 | 3300013296 | Bacteria | 58278 |
| 379 | Ga0157374_10041949 | 3300013296 | Bacteria | 4219 |
| 380 | Ga0157378_10000205 | 3300013297 | Bacteria | 57706 |
| 381 | Ga0163162_10002879 | 3300013306 | Bacteria | 16380 |
| 382 | Ga0163162_10013910 | 3300013306 | Bacteria | 7860 |
| 383 | Ga0163162_10117460 | 3300013306 | Bacteria | 2761 |
| 384 | Ga0163162_10159072 | 3300013306 | Bacteria | 2380 |
| 385 | Ga0163162_10209195 | 3300013306 | Bacteria | 2080 |
| 386 | Ga0163162_10350467 | 3300013306 | Bacteria | 1609 |
| 387 | Ga0163162_10377805 | 3300013306 | Bacteria | 1550 |
| 388 | Ga0163162_11061666 | 3300013306 | Bacteria | 917 |
| 389 | Ga0157372_10064970 | 3300013307 | Bacteria | 4096 |
| 390 | Ga0157372_10075492 | 3300013307 | Bacteria | 3804 |
| 391 | Ga0157372_10078364 | 3300013307 | Bacteria | 3733 |
| 392 | Ga0157372_10498080 | 3300013307 | Bacteria | 1421 |
| 393 | Ga0157372_11433170 | 3300013307 | Bacteria | 796 |
| 394 | Ga0157372_11765392 | 3300013307 | Bacteria | 712 |
| 395 | Ga0157375_10080217 | 3300013308 | Bacteria | 3301 |
| 396 | Ga0157375_10729144 | 3300013308 | Bacteria | 1143 |
| 397 | Ga0163163_10025413 | 3300014325 | Bacteria | 5645 |
| 398 | Ga0163163_10067038 | 3300014325 | Bacteria | 3567 |
| 399 | Ga0163163_10223664 | 3300014325 | Bacteria | 1931 |
| 400 | Ga0163163_10471431 | 3300014325 | Bacteria | 1316 |
| 401 | Ga0163163_10721878 | 3300014325 | Bacteria | 1060 |
| 402 | Ga0157380_10000107 | 3300014326 | Bacteria | 45379 |
| 403 | Ga0157380_10000350 | 3300014326 | Bacteria | 27615 |
| 404 | Ga0157380_10001483 | 3300014326 | Bacteria | 15349 |
| 405 | Ga0157380_10034350 | 3300014326 | Bacteria | 3911 |
| 406 | Ga0157379_10034748 | 3300014968 | Bacteria | 4496 |
| 407 | Ga0157379_10057086 | 3300014968 | Bacteria | 3489 |
| 408 | Ga0157379_10058471 | 3300014968 | Bacteria | 3447 |
| 409 | Ga0157379_12119996 | 3300014968 | Bacteria | 557 |
| 410 | Ga0157376_10000148 | 3300014969 | Bacteria | 48325 |
| 411 | Ga0157376_12617527 | 3300014969 | Bacteria | 544 |
| 412 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 413 | Ga0183361_10472 | 3300016635 | Bacteria | 1749 |
| 414 | Ga0163161_10000860 | 3300017792 | Bacteria | 23679 |
| 415 | Ga0163161_10030187 | 3300017792 | Bacteria | 3856 |
| 416 | Ga0163161_10030480 | 3300017792 | Bacteria | 3840 |
| 417 | Ga0163161_10300304 | 3300017792 | Bacteria | 1264 |
| 418 | Ga0163161_10603456 | 3300017792 | Bacteria | 905 |
| 419 | Ga0163161_10758566 | 3300017792 | Bacteria | 812 |
| 420 | Ga0207672_1002763 | 3300025223 | Bacteria | 1031 |
| 421 | Ga0209147_101130 | 3300025229 | Bacteria | 10971 |
| 422 | Ga0207427_101618 | 3300025231 | Bacteria | 7641 |
| 423 | Ga0209026_1002559 | 3300025250 | Bacteria | 6711 |
| 424 | Ga0209148_1000112 | 3300025254 | Bacteria | 197101 |
| 425 | Ga0209148_1000974 | 3300025254 | Bacteria | 18589 |
| 426 | Ga0209233_1000189 | 3300025261 | Bacteria | 131465 |
| 427 | Ga0209455_1001147 | 3300025272 | Bacteria | 12788 |
| 428 | Ga0207673_1004543 | 3300025290 | Bacteria | 1663 |
| 429 | Ga0209050_1000832 | 3300025298 | Bacteria | 42754 |
| 430 | Ga0209257_1000929 | 3300025304 | Bacteria | 40568 |
| 431 | Ga0209257_1048009 | 3300025304 | Bacteria | 1224 |
| 432 | Ga0207697_10000101 | 3300025315 | Bacteria | 39230 |
| 433 | Ga0207697_10009818 | 3300025315 | Bacteria | 4115 |
| 434 | Ga0207697_10203779 | 3300025315 | Bacteria | 871 |
| 435 | Ga0207656_10004950 | 3300025321 | Bacteria | 4680 |
| 436 | Ga0207656_10178021 | 3300025321 | Bacteria | 1019 |
| 437 | Ga0207713_1001017 | 3300025735 | Bacteria | 24423 |
| 438 | Ga0207710_10004035 | 3300025900 | Bacteria | 6460 |
| 439 | Ga0207710_10367134 | 3300025900 | Bacteria | 735 |
| 440 | Ga0207710_10372457 | 3300025900 | Bacteria | 730 |
| 441 | Ga0207710_10477319 | 3300025900 | Bacteria | 646 |
| 442 | Ga0207688_10367906 | 3300025901 | Bacteria | 888 |
| 443 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 444 | Ga0207680_10000078 | 3300025903 | Bacteria | 43793 |
| 445 | Ga0207680_10017766 | 3300025903 | Bacteria | 3764 |
| 446 | Ga0207680_10018003 | 3300025903 | Bacteria | 3744 |
| 447 | Ga0207680_10234188 | 3300025903 | Bacteria | 1263 |
| 448 | Ga0207680_11142866 | 3300025903 | Bacteria | 556 |
| 449 | Ga0207647_10000323 | 3300025904 | Bacteria | 39393 |
| 450 | Ga0207647_10004162 | 3300025904 | Bacteria | 10729 |
| 451 | Ga0207647_10010729 | 3300025904 | Bacteria | 6452 |
| 452 | Ga0207647_10318710 | 3300025904 | Bacteria | 883 |
| 453 | Ga0207645_10001019 | 3300025907 | Bacteria | 23155 |
| 454 | Ga0207645_10491252 | 3300025907 | Bacteria | 831 |
| 455 | Ga0207645_10775422 | 3300025907 | Bacteria | 652 |
| 456 | Ga0207705_10000014 | 3300025909 | Bacteria | 434286 |
| 457 | Ga0207705_10000145 | 3300025909 | Bacteria | 76141 |
| 458 | Ga0207705_10193347 | 3300025909 | Bacteria | 1539 |
| 459 | Ga0207705_10327551 | 3300025909 | Bacteria | 1177 |
| 460 | Ga0207654_10000521 | 3300025911 | Bacteria | 22010 |
| 461 | Ga0207654_10025400 | 3300025911 | Bacteria | 3196 |
| 462 | Ga0207695_10004592 | 3300025913 | Bacteria | 18760 |
| 463 | Ga0207695_10015825 | 3300025913 | Bacteria | 8860 |
| 464 | Ga0207695_10075373 | 3300025913 | Bacteria | 3433 |
| 465 | Ga0207695_10821677 | 3300025913 | Bacteria | 809 |
| 466 | Ga0207695_10989976 | 3300025913 | Bacteria | 720 |
| 467 | Ga0207671_10000740 | 3300025914 | Bacteria | 41467 |
| 468 | Ga0207671_10001130 | 3300025914 | Bacteria | 32130 |
| 469 | Ga0207671_10050539 | 3300025914 | Bacteria | 3078 |
| 470 | Ga0207671_10206859 | 3300025914 | Bacteria | 1534 |
| 471 | Ga0207671_10426551 | 3300025914 | Bacteria | 1055 |
| 472 | Ga0207662_10211064 | 3300025918 | Bacteria | 1260 |
| 473 | Ga0207657_10001736 | 3300025919 | Bacteria | 23488 |
| 474 | Ga0207657_10010116 | 3300025919 | Bacteria | 9428 |
| 475 | Ga0207657_10013912 | 3300025919 | Bacteria | 7874 |
| 476 | Ga0207657_10022481 | 3300025919 | Bacteria | 5896 |
| 477 | Ga0207657_10054229 | 3300025919 | Bacteria | 3468 |
| 478 | Ga0207657_10058524 | 3300025919 | Bacteria | 3315 |
| 479 | Ga0207649_10060326 | 3300025920 | Bacteria | 2383 |
| 480 | Ga0207649_10128672 | 3300025920 | Bacteria | 1717 |
| 481 | Ga0207649_10307869 | 3300025920 | Bacteria | 1160 |
| 482 | Ga0207649_10794313 | 3300025920 | Bacteria | 738 |
| 483 | Ga0207652_10893322 | 3300025921 | Bacteria | 785 |
| 484 | Ga0207646_10478627 | 3300025922 | Bacteria | 1123 |
| 485 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 486 | Ga0207681_10000010 | 3300025923 | Bacteria | 403379 |
| 487 | Ga0207681_10000029 | 3300025923 | Bacteria | 177260 |
| 488 | Ga0207681_10007837 | 3300025923 | Bacteria | 6539 |
| 489 | Ga0207681_10009997 | 3300025923 | Bacteria | 5807 |
| 490 | Ga0207681_10162446 | 3300025923 | Bacteria | 1685 |
| 491 | Ga0207681_10401826 | 3300025923 | Bacteria | 1107 |
| 492 | Ga0207694_10002569 | 3300025924 | Bacteria | 14737 |
| 493 | Ga0207694_10021154 | 3300025924 | Bacteria | 4926 |
| 494 | Ga0207694_10044490 | 3300025924 | Bacteria | 3428 |
| 495 | Ga0207694_10123314 | 3300025924 | Bacteria | 2070 |
| 496 | Ga0207694_10151946 | 3300025924 | Bacteria | 1866 |
| 497 | Ga0207694_10448556 | 3300025924 | Bacteria | 1077 |
| 498 | Ga0207694_11145990 | 3300025924 | Bacteria | 658 |
| 499 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 500 | Ga0207650_10000182 | 3300025925 | Bacteria | 73032 |
| 501 | Ga0207650_10006854 | 3300025925 | Bacteria | 7770 |
| 502 | Ga0207650_10079934 | 3300025925 | Bacteria | 2477 |
| 503 | Ga0207650_10137542 | 3300025925 | Bacteria | 1918 |
| 504 | Ga0207650_10143934 | 3300025925 | Bacteria | 1876 |
| 505 | Ga0207650_11343351 | 3300025925 | Bacteria | 608 |
| 506 | Ga0207659_10001548 | 3300025926 | Bacteria | 13651 |
| 507 | Ga0207687_10004300 | 3300025927 | Bacteria | 9508 |
| 508 | Ga0207644_10000007 | 3300025931 | Bacteria | 381778 |
| 509 | Ga0207644_10000112 | 3300025931 | Bacteria | 60600 |
| 510 | Ga0207644_10003240 | 3300025931 | Bacteria | 10491 |
| 511 | Ga0207644_10032789 | 3300025931 | Bacteria | 3627 |
| 512 | Ga0207644_10083105 | 3300025931 | Bacteria | 2370 |
| 513 | Ga0207644_10692959 | 3300025931 | Bacteria | 849 |
| 514 | Ga0207690_10048615 | 3300025932 | Bacteria | 2822 |
| 515 | Ga0207690_10058336 | 3300025932 | Bacteria | 2611 |
| 516 | Ga0207690_10100517 | 3300025932 | Bacteria | 2064 |
| 517 | Ga0207690_10177938 | 3300025932 | Bacteria | 1599 |
| 518 | Ga0207690_10321198 | 3300025932 | Bacteria | 1217 |
| 519 | Ga0207690_10420183 | 3300025932 | Bacteria | 1069 |
| 520 | Ga0207690_10894151 | 3300025932 | Bacteria | 736 |
| 521 | Ga0207706_10002566 | 3300025933 | Bacteria | 17713 |
| 522 | Ga0207706_10008580 | 3300025933 | Bacteria | 9417 |
| 523 | Ga0207706_10045273 | 3300025933 | Bacteria | 3899 |
| 524 | Ga0207706_10057010 | 3300025933 | Bacteria | 3442 |
| 525 | Ga0207706_10059202 | 3300025933 | Bacteria | 3373 |
| 526 | Ga0207706_10064667 | 3300025933 | Bacteria | 3221 |
| 527 | Ga0207706_10081560 | 3300025933 | Bacteria | 2842 |
| 528 | Ga0207686_10000178 | 3300025934 | Bacteria | 48947 |
| 529 | Ga0207709_10000237 | 3300025935 | Bacteria | 69190 |
| 530 | Ga0207709_10365883 | 3300025935 | Bacteria | 1093 |
| 531 | Ga0207709_10459821 | 3300025935 | Bacteria | 985 |
| 532 | Ga0207670_10014687 | 3300025936 | Bacteria | 4657 |
| 533 | Ga0207669_10008300 | 3300025937 | Bacteria | 4866 |
| 534 | Ga0207669_10486132 | 3300025937 | Bacteria | 985 |
| 535 | Ga0207704_10000003 | 3300025938 | Bacteria | 285808 |
| 536 | Ga0207691_10409382 | 3300025940 | Bacteria | 1156 |
| 537 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 538 | Ga0207711_10000075 | 3300025941 | Bacteria | 106870 |
| 539 | Ga0207711_10198744 | 3300025941 | Bacteria | 1829 |
| 540 | Ga0207711_10300786 | 3300025941 | Bacteria | 1480 |
| 541 | Ga0207711_10787656 | 3300025941 | Bacteria | 886 |
| 542 | Ga0207711_10974078 | 3300025941 | Bacteria | 787 |
| 543 | Ga0207711_12029027 | 3300025941 | Bacteria | 518 |
| 544 | Ga0207689_10001512 | 3300025942 | Bacteria | 22142 |
| 545 | Ga0207689_10401777 | 3300025942 | Bacteria | 1142 |
| 546 | Ga0207689_11175008 | 3300025942 | Bacteria | 646 |
| 547 | Ga0207661_10539359 | 3300025944 | Bacteria | 1068 |
| 548 | Ga0207661_10795915 | 3300025944 | Bacteria | 870 |
| 549 | Ga0207679_10503067 | 3300025945 | Bacteria | 1081 |
| 550 | Ga0207679_10609976 | 3300025945 | Bacteria | 984 |
| 551 | Ga0207667_10000007 | 3300025949 | Bacteria | 630590 |
| 552 | Ga0207667_10000825 | 3300025949 | Bacteria | 40050 |
| 553 | Ga0207667_10053298 | 3300025949 | Bacteria | 4257 |
| 554 | Ga0207667_10368324 | 3300025949 | Bacteria | 1465 |
| 555 | Ga0207667_10387507 | 3300025949 | Bacteria | 1423 |
| 556 | Ga0207667_10493180 | 3300025949 | Bacteria | 1243 |
| 557 | Ga0207651_10000003 | 3300025960 | Bacteria | 308050 |
| 558 | Ga0207651_10403117 | 3300025960 | Bacteria | 1164 |
| 559 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 560 | Ga0207712_10000161 | 3300025961 | Bacteria | 69260 |
| 561 | Ga0207712_10008789 | 3300025961 | Bacteria | 6388 |
| 562 | Ga0207712_10155829 | 3300025961 | Bacteria | 1769 |
| 563 | Ga0207712_10239582 | 3300025961 | Bacteria | 1460 |
| 564 | Ga0207712_10390537 | 3300025961 | Bacteria | 1167 |
| 565 | Ga0207668_10000142 | 3300025972 | Bacteria | 48783 |
| 566 | Ga0207668_10000186 | 3300025972 | Bacteria | 42321 |
| 567 | Ga0207668_10000348 | 3300025972 | Bacteria | 30042 |
| 568 | Ga0207668_10024299 | 3300025972 | Bacteria | 3909 |
| 569 | Ga0207668_10058964 | 3300025972 | Bacteria | 2686 |
| 570 | Ga0207668_10165219 | 3300025972 | Bacteria | 1729 |
| 571 | Ga0207640_10000031 | 3300025981 | Bacteria | 120815 |
| 572 | Ga0207640_10018606 | 3300025981 | Bacteria | 4085 |
| 573 | Ga0207640_10026524 | 3300025981 | Bacteria | 3519 |
| 574 | Ga0207640_10028518 | 3300025981 | Bacteria | 3414 |
| 575 | Ga0207640_10058937 | 3300025981 | Bacteria | 2532 |
| 576 | Ga0207640_10154731 | 3300025981 | Bacteria | 1689 |
| 577 | Ga0207640_10313034 | 3300025981 | Bacteria | 1247 |
| 578 | Ga0207658_10000034 | 3300025986 | Bacteria | 155561 |
| 579 | Ga0207658_10000213 | 3300025986 | Bacteria | 60739 |
| 580 | Ga0207658_10000309 | 3300025986 | Bacteria | 49982 |
| 581 | Ga0207658_10000405 | 3300025986 | Bacteria | 41161 |
| 582 | Ga0207658_10000462 | 3300025986 | Bacteria | 38001 |
| 583 | Ga0207658_10005078 | 3300025986 | Bacteria | 9056 |
| 584 | Ga0207658_10013403 | 3300025986 | Bacteria | 5600 |
| 585 | Ga0207658_10335502 | 3300025986 | Bacteria | 1313 |
| 586 | Ga0207677_10000194 | 3300026023 | Bacteria | 48709 |
| 587 | Ga0207703_10000499 | 3300026035 | Bacteria | 40585 |
| 588 | Ga0207703_10000918 | 3300026035 | Bacteria | 28700 |
| 589 | Ga0207703_10003457 | 3300026035 | Bacteria | 13224 |
| 590 | Ga0207703_10005021 | 3300026035 | Bacteria | 10728 |
| 591 | Ga0207703_11043808 | 3300026035 | Bacteria | 785 |
| 592 | Ga0207639_10002175 | 3300026041 | Bacteria | 13196 |
| 593 | Ga0207639_10017740 | 3300026041 | Bacteria | 5047 |
| 594 | Ga0207639_10019235 | 3300026041 | Bacteria | 4867 |
| 595 | Ga0207639_10052900 | 3300026041 | Bacteria | 3096 |
| 596 | Ga0207639_10187889 | 3300026041 | Bacteria | 1763 |
| 597 | Ga0207639_10305834 | 3300026041 | Bacteria | 1407 |
| 598 | Ga0207639_10549495 | 3300026041 | Bacteria | 1060 |
| 599 | Ga0207639_10588591 | 3300026041 | Bacteria | 1025 |
| 600 | Ga0207678_10000095 | 3300026067 | Bacteria | 73553 |
| 601 | Ga0207678_10000608 | 3300026067 | Bacteria | 32746 |
| 602 | Ga0207678_10011244 | 3300026067 | Bacteria | 7858 |
| 603 | Ga0207678_10332873 | 3300026067 | Bacteria | 1307 |
| 604 | Ga0207702_10002411 | 3300026078 | Bacteria | 17783 |
| 605 | Ga0207702_10007703 | 3300026078 | Bacteria | 9147 |
| 606 | Ga0207702_10047819 | 3300026078 | Bacteria | 3606 |
| 607 | Ga0207702_10174651 | 3300026078 | Bacteria | 1973 |
| 608 | Ga0207702_10307887 | 3300026078 | Bacteria | 1505 |
| 609 | Ga0207702_11842699 | 3300026078 | Bacteria | 597 |
| 610 | Ga0207702_12088482 | 3300026078 | Bacteria | 556 |
| 611 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 612 | Ga0207641_10000239 | 3300026088 | Bacteria | 71088 |
| 613 | Ga0207641_10000263 | 3300026088 | Bacteria | 66525 |
| 614 | Ga0207641_10001750 | 3300026088 | Bacteria | 20940 |
| 615 | Ga0207641_10049402 | 3300026088 | Bacteria | 3554 |
| 616 | Ga0207641_10088779 | 3300026088 | Bacteria | 2700 |
| 617 | Ga0207641_10110067 | 3300026088 | Bacteria | 2440 |
| 618 | Ga0207641_10127601 | 3300026088 | Bacteria | 2279 |
| 619 | Ga0207648_10000007 | 3300026089 | Bacteria | 217865 |
| 620 | Ga0207648_11177217 | 3300026089 | Bacteria | 720 |
| 621 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 622 | Ga0207676_10000046 | 3300026095 | Bacteria | 149037 |
| 623 | Ga0207676_10000137 | 3300026095 | Bacteria | 63867 |
| 624 | Ga0207676_10002267 | 3300026095 | Bacteria | 13798 |
| 625 | Ga0207676_10006162 | 3300026095 | Bacteria | 8468 |
| 626 | Ga0207676_10014115 | 3300026095 | Bacteria | 5738 |
| 627 | Ga0207676_10042837 | 3300026095 | Bacteria | 3482 |
| 628 | Ga0207674_10006156 | 3300026116 | Bacteria | 14169 |
| 629 | Ga0207674_10019665 | 3300026116 | Bacteria | 7312 |
| 630 | Ga0207674_10029230 | 3300026116 | Bacteria | 5805 |
| 631 | Ga0207674_10077073 | 3300026116 | Bacteria | 3340 |
| 632 | Ga0207674_10170099 | 3300026116 | Bacteria | 2133 |
| 633 | Ga0207674_10880340 | 3300026116 | Bacteria | 863 |
| 634 | Ga0207675_100000131 | 3300026118 | Bacteria | 62791 |
| 635 | Ga0207675_100000418 | 3300026118 | Bacteria | 41021 |
| 636 | Ga0207675_100001453 | 3300026118 | Bacteria | 23738 |
| 637 | Ga0207675_100675975 | 3300026118 | Bacteria | 1040 |
| 638 | Ga0207675_101390528 | 3300026118 | Bacteria | 722 |
| 639 | Ga0207683_10003569 | 3300026121 | Bacteria | 13566 |
| 640 | Ga0207683_10161557 | 3300026121 | Bacteria | 2025 |
| 641 | Ga0207698_10000182 | 3300026142 | Bacteria | 38622 |
| 642 | Ga0207698_10013572 | 3300026142 | Bacteria | 5383 |
| 643 | Ga0207698_10039816 | 3300026142 | Bacteria | 3485 |
| 644 | Ga0207698_10228613 | 3300026142 | Bacteria | 1687 |
| 645 | Ga0207698_10359308 | 3300026142 | Bacteria | 1379 |
| 646 | Ga0207698_10541139 | 3300026142 | Bacteria | 1140 |
| 647 | Ga0207698_10607782 | 3300026142 | Bacteria | 1079 |
| 648 | Ga0207698_11709090 | 3300026142 | Bacteria | 645 |
| 649 | Ga0209813_10000015 | 3300027866 | Bacteria | 83882 |
| 650 | Ga0209974_10125950 | 3300027876 | Bacteria | 911 |
| 651 | Ga0268266_10000117 | 3300028379 | Bacteria | 163515 |
| 652 | Ga0268266_10133476 | 3300028379 | Bacteria | 2222 |
| 653 | Ga0268266_10222069 | 3300028379 | Bacteria | 1737 |
| 654 | Ga0268266_10421260 | 3300028379 | Bacteria | 1265 |
| 655 | Ga0268266_11263725 | 3300028379 | Bacteria | 713 |
| 656 | Ga0268266_11292241 | 3300028379 | Bacteria | 705 |
| 657 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 658 | Ga0268265_10000026 | 3300028380 | Bacteria | 246653 |
| 659 | Ga0268265_10000266 | 3300028380 | Bacteria | 59618 |
| 660 | Ga0268265_10000918 | 3300028380 | Bacteria | 27252 |
| 661 | Ga0268265_10005225 | 3300028380 | Bacteria | 8890 |
| 662 | Ga0268265_10189552 | 3300028380 | Bacteria | 1774 |
| 663 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 664 | Ga0268264_10000075 | 3300028381 | Bacteria | 256011 |
| 665 | Ga0268264_10000087 | 3300028381 | Bacteria | 236696 |
| 666 | Ga0268264_10000106 | 3300028381 | Bacteria | 210031 |
| 667 | Ga0268264_10028912 | 3300028381 | Bacteria | 4538 |
| 668 | Ga0268264_11986481 | 3300028381 | Bacteria | 591 |
| 669 | Ga0307517_10216975 | 3300028786 | Bacteria | 1168 |
| 670 | Ga0307517_10511980 | 3300028786 | Bacteria | 608 |
| 671 | Ga0307515_10489616 | 3300028794 | Bacteria | 841 |
| 672 | Ga0307513_10040972 | 3300031456 | Bacteria | 5116 |
| 673 | Ga0307513_10041326 | 3300031456 | Bacteria | 5090 |
| 674 | Ga0307408_100036775 | 3300031548 | Bacteria | 3443 |
| 675 | Ga0307408_100103486 | 3300031548 | Bacteria | 2173 |
| 676 | Ga0307408_100373938 | 3300031548 | Bacteria | 1216 |
| 677 | Ga0307408_100692248 | 3300031548 | Bacteria | 915 |
| 678 | Ga0307405_10037630 | 3300031731 | Bacteria | 2909 |
| 679 | Ga0307405_10122314 | 3300031731 | Bacteria | 1783 |
| 680 | Ga0307405_10172309 | 3300031731 | Bacteria | 1545 |
| 681 | Ga0307405_10182095 | 3300031731 | Bacteria | 1509 |
| 682 | Ga0307405_10271163 | 3300031731 | Bacteria | 1272 |
| 683 | Ga0307405_10305129 | 3300031731 | Bacteria | 1209 |
| 684 | Ga0307405_10648899 | 3300031731 | Bacteria | 868 |
| 685 | Ga0307413_10221462 | 3300031824 | Bacteria | 1382 |
| 686 | Ga0307413_11749120 | 3300031824 | Bacteria | 555 |
| 687 | Ga0307410_10156769 | 3300031852 | Bacteria | 1701 |
| 688 | Ga0307410_10232303 | 3300031852 | Bacteria | 1425 |
| 689 | Ga0307410_10285118 | 3300031852 | Bacteria | 1297 |
| 690 | Ga0307410_11048892 | 3300031852 | Bacteria | 705 |
| 691 | Ga0307410_11534445 | 3300031852 | Bacteria | 587 |
| 692 | Ga0307406_10002984 | 3300031901 | Bacteria | 9222 |
| 693 | Ga0307406_10276960 | 3300031901 | Bacteria | 1277 |
| 694 | Ga0307406_10818011 | 3300031901 | Bacteria | 787 |
| 695 | Ga0307407_10210081 | 3300031903 | Bacteria | 1310 |
| 696 | Ga0307407_10502609 | 3300031903 | Bacteria | 889 |
| 697 | Ga0307412_10000933 | 3300031911 | Bacteria | 16724 |
| 698 | Ga0307412_10025608 | 3300031911 | Bacteria | 3655 |
| 699 | Ga0307412_10069292 | 3300031911 | Bacteria | 2400 |
| 700 | Ga0307412_10089335 | 3300031911 | Bacteria | 2151 |
| 701 | Ga0307412_10134859 | 3300031911 | Bacteria | 1799 |
| 702 | Ga0307412_10150498 | 3300031911 | Bacteria | 1716 |
| 703 | Ga0307412_10696873 | 3300031911 | Bacteria | 871 |
| 704 | Ga0307412_11485099 | 3300031911 | Bacteria | 616 |
| 705 | Ga0307409_100045924 | 3300031995 | Bacteria | 3302 |
| 706 | Ga0307409_101131920 | 3300031995 | Bacteria | 805 |
| 707 | Ga0307409_101240750 | 3300031995 | Bacteria | 769 |
| 708 | Ga0307416_100146446 | 3300032002 | Bacteria | 2157 |
| 709 | Ga0307416_100174915 | 3300032002 | Bacteria | 2004 |
| 710 | Ga0307416_100737875 | 3300032002 | Bacteria | 1076 |
| 711 | Ga0307416_101126857 | 3300032002 | Bacteria | 889 |
| 712 | Ga0307414_10001776 | 3300032004 | Bacteria | 11167 |
| 713 | Ga0307414_10013540 | 3300032004 | Bacteria | 4860 |
| 714 | Ga0307414_10061999 | 3300032004 | Bacteria | 2651 |
| 715 | Ga0307414_10214026 | 3300032004 | Bacteria | 1577 |
| 716 | Ga0307414_10574121 | 3300032004 | Unclassified | 1008 |
| 717 | Ga0307414_10816200 | 3300032004 | Bacteria | 851 |
| 718 | Ga0307414_10905217 | 3300032004 | Bacteria | 809 |
| 719 | Ga0307414_11381540 | 3300032004 | Bacteria | 654 |
| 720 | Ga0307414_11627641 | 3300032004 | Bacteria | 602 |
| 721 | Ga0307411_10034229 | 3300032005 | Bacteria | 3159 |
| 722 | Ga0307411_10164427 | 3300032005 | Bacteria | 1666 |
| 723 | Ga0307411_10343397 | 3300032005 | Bacteria | 1214 |
| 724 | Ga0307411_10346620 | 3300032005 | Bacteria | 1209 |
| 725 | Ga0307411_10381127 | 3300032005 | Bacteria | 1160 |
| 726 | Ga0307411_10990954 | 3300032005 | Bacteria | 752 |
| 727 | Ga0307415_102121679 | 3300032126 | Bacteria | 549 |
| 728 | Ga0307510_10002511 | 3300033180 | Bacteria | 20892 |
| 729 | Ga0307510_10145093 | 3300033180 | Bacteria | 2008 |
| 730 | Ga0307510_10414759 | 3300033180 | Bacteria | 789 |
| 731 | Ga0373930_0189371 | 3300034816 | Bacteria | 531 |
| 732 | Ga0373946_0275961 | 3300035171 | Bacteria | 826 |
| 733 | Ga0373931_1087989 | 3300035691 | Bacteria | 544 |
| 734 | Ga0373927_0216911 | 3300035695 | Bacteria | 1257 |
| 735 | Ga0373947_0195877 | 3300035725 | Bacteria | 1320 |
| 736 | Ga0373925_0403645 | 3300037068 | Bacteria | 1115 |
| 737 | Ga0395899_0004019 | 3300037312 | Bacteria | 11593 |
| 738 | Ga0395900_0034599 | 3300037418 | Bacteria | 5204 |
| 739 | Ga0395900_0184335 | 3300037418 | Bacteria | 2119 |
| 740 | Ga0395898_0144521 | 3300037466 | Bacteria | 2277 |
| 741 | Ga0395905_0114237 | 3300037471 | Bacteria | 2537 |
| 742 | Ga0395901_0069561 | 3300038443 | Bacteria | 3666 |
| 743 | Ga0395901_0201382 | 3300038443 | Bacteria | 2087 |
| 744 | Ga0436363_1192622 | 3300039450 | Bacteria | 926 |
| 745 | Ga0436362_1167794 | 3300039453 | Bacteria | 780 |
| 746 | Ga0451789_0732163 | 3300041443 | Bacteria | 944 |
| 747 | Ga0451789_0744125 | 3300041443 | Bacteria | 605 |
| 748 | Ga0451789_1233599 | 3300041443 | Bacteria | 943 |
| 749 | Ga0451791_0600836 | 3300041451 | Bacteria | 579 |
| 750 | Ga0451795_1238003 | 3300041456 | Bacteria | 997 |
| 751 | Ga0451800_0373317 | 3300041459 | Bacteria | 612 |
| 752 | Ga0451833_0700584 | 3300041491 | Bacteria | 727 |
| 753 | Ga0451839_1504574 | 3300041496 | Bacteria | 1052 |
| 754 | Ga0451851_1298683 | 3300041507 | Bacteria | 753 |
| 755 | Ga0451853_3049099 | 3300041512 | Bacteria | 593 |
| 756 | Ga0439448_0036066 | 3300042005 | Bacteria | 1585 |
| 757 | Ga0439448_0203920 | 3300042005 | Bacteria | 693 |
| 758 | Ga0439450_055929 | 3300042008 | Bacteria | 946 |
| 759 | Ga0439455_0003092 | 3300042012 | Bacteria | 3130 |
| 760 | Ga0439455_0007290 | 3300042012 | Bacteria | 2334 |
| 761 | Ga0450890_026896 | 3300042127 | Bacteria | 803 |
| 762 | Ga0439458_0000183 | 3300042157 | Bacteria | 14213 |
| 763 | Ga0439458_0038983 | 3300042157 | Bacteria | 1149 |
| 764 | Ga0439458_0056306 | 3300042157 | Bacteria | 976 |
| 765 | Ga0466969_0044024 | 3300044656 | Bacteria | 2223 |
| 766 | Ga0466972_0006177 | 3300044658 | Bacteria | 6020 |
| 767 | Ga0466973_0276660 | 3300044659 | Bacteria | 1152 |
| 768 | Ga0466965_0140424 | 3300044683 | Bacteria | 1257 |
| 769 | Ga0466966_0016992 | 3300044684 | Bacteria | 4809 |
| 770 | Ga0466961_0102193 | 3300044693 | Bacteria | 1805 |
| 771 | Ga0466961_0188117 | 3300044693 | Bacteria | 1280 |
| 772 | Ga0466963_0002342 | 3300044694 | Bacteria | 10570 |
| 773 | Ga0466964_0029999 | 3300044706 | Bacteria | 2150 |
| 774 | Ga0466971_0086613 | 3300044719 | Bacteria | 1432 |
| 775 | Ga0466971_0086774 | 3300044719 | Bacteria | 1430 |
| 776 | Ga0466968_0021345 | 3300044735 | Bacteria | 2621 |
| 777 | Ga0466968_0050375 | 3300044735 | Bacteria | 1777 |
| 778 | Ga0466968_0686042 | 3300044735 | Bacteria | 522 |
| 779 | Ga0466970_0076227 | 3300044765 | Bacteria | 1806 |
| 780 | Ga0466970_0731958 | 3300044765 | Bacteria | 578 |
| 781 | Ga0466957_0224891 | 3300044842 | Bacteria | 1240 |
| 782 | Ga0466957_0695571 | 3300044842 | Bacteria | 717 |
| 783 | Ga0466960_0011429 | 3300044901 | Bacteria | 3714 |
| 784 | Ga0466959_0013984 | 3300045049 | Bacteria | 5826 |
| 785 | Ga0466959_0133290 | 3300045049 | Bacteria | 1760 |
| 786 | Ga0466958_0002202 | 3300045836 | Bacteria | 9708 |
| 787 | Ga0466958_0014687 | 3300045836 | Bacteria | 4472 |
| 788 | Ga0466958_0682025 | 3300045836 | Bacteria | 669 |
| 789 | Ga0466967_0007995 | 3300045976 | Bacteria | 7701 |
| 790 | Ga0466967_0450090 | 3300045976 | Bacteria | 1258 |
| 791 | Ga0495617_201093 | 3300046452 | Bacteria | 623 |
| 792 | Ga0495627_000216 | 3300046453 | Bacteria | 62618 |
| 793 | Ga0495627_000273 | 3300046453 | Bacteria | 52157 |
| 794 | Ga0495627_173357 | 3300046453 | Unclassified | 598 |
| 795 | Ga0495590_0089598 | 3300046457 | Bacteria | 1088 |
| 796 | Ga0495638_0000051 | 3300046460 | Bacteria | 206003 |
| 797 | Ga0495638_0000253 | 3300046460 | Bacteria | 72446 |
| 798 | Ga0495650_0000861 | 3300046471 | Bacteria | 36461 |
| 799 | Ga0495584_0119083 | 3300046491 | Bacteria | 1337 |
| 800 | Ga0495583_0000422 | 3300046506 | Bacteria | 64011 |
| 801 | Ga0495583_0009923 | 3300046506 | Bacteria | 5629 |
| 802 | Ga0495583_0282605 | 3300046506 | Bacteria | 661 |
| 803 | Ga0495606_0152475 | 3300046507 | Bacteria | 1355 |
| 804 | Ga0495610_0000311 | 3300046512 | Bacteria | 51569 |
| 805 | Ga0495616_0000013 | 3300046513 | Bacteria | 202334 |
| 806 | Ga0495632_0000357 | 3300046519 | Bacteria | 43422 |
| 807 | Ga0495632_0000359 | 3300046519 | Bacteria | 43288 |
| 808 | Ga0495637_0006811 | 3300046520 | Bacteria | 5717 |
| 809 | Ga0495637_0012784 | 3300046520 | Bacteria | 4006 |
| 810 | Ga0495637_0024023 | 3300046520 | Bacteria | 2759 |
| 811 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 812 | Ga0495643_0037629 | 3300046522 | Bacteria | 2653 |
| 813 | Ga0495643_0100799 | 3300046522 | Bacteria | 1480 |
| 814 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 815 | Ga0495648_0001780 | 3300046524 | Bacteria | 20723 |
| 816 | Ga0495648_0025654 | 3300046524 | Bacteria | 3986 |
| 817 | Ga0495648_0031355 | 3300046524 | Bacteria | 3501 |
| 818 | Ga0495648_0310992 | 3300046524 | Bacteria | 734 |
| 819 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 820 | Ga0495663_0007553 | 3300046525 | Bacteria | 3008 |
| 821 | Ga0495663_0008640 | 3300046525 | Bacteria | 2825 |
| 822 | Ga0495654_0003985 | 3300046530 | Bacteria | 8885 |
| 823 | Ga0495654_0019995 | 3300046530 | Bacteria | 3496 |
| 824 | Ga0495654_0064205 | 3300046530 | Bacteria | 1756 |
| 825 | Ga0495609_0275550 | 3300046538 | Bacteria | 689 |
| 826 | Ga0495597_0191305 | 3300046542 | Bacteria | 823 |
| 827 | Ga0495597_0209958 | 3300046542 | Bacteria | 777 |
| 828 | Ga0495622_0011529 | 3300046557 | Bacteria | 4085 |
| 829 | Ga0495633_0000102 | 3300046558 | Bacteria | 115655 |
| 830 | Ga0495633_0000786 | 3300046558 | Bacteria | 28391 |
| 831 | Ga0495633_0025418 | 3300046558 | Bacteria | 2917 |
| 832 | Ga0495633_0073717 | 3300046558 | Bacteria | 1591 |
| 833 | Ga0495633_0076967 | 3300046558 | Bacteria | 1553 |
| 834 | Ga0495633_0088784 | 3300046558 | Bacteria | 1437 |
| 835 | Ga0495633_0289882 | 3300046558 | Bacteria | 744 |
| 836 | Ga0495668_0007526 | 3300046616 | Bacteria | 6950 |
| 837 | Ga0495668_0017694 | 3300046616 | Bacteria | 4128 |
| 838 | Ga0495668_0023881 | 3300046616 | Bacteria | 3481 |
| 839 | Ga0495668_0062584 | 3300046616 | Bacteria | 2050 |
| 840 | Ga0495668_0073328 | 3300046616 | Bacteria | 1880 |
| 841 | Ga0495668_0121622 | 3300046616 | Bacteria | 1428 |
| 842 | Ga0495611_0107889 | 3300046648 | Bacteria | 1295 |
| 843 | Ga0495625_0000031 | 3300046660 | Bacteria | 238193 |
| 844 | Ga0495625_0006969 | 3300046660 | Bacteria | 9966 |
| 845 | Ga0495625_0008935 | 3300046660 | Bacteria | 8468 |
| 846 | Ga0495625_0111092 | 3300046660 | Bacteria | 1873 |
| 847 | Ga0495625_0148371 | 3300046660 | Bacteria | 1578 |
| 848 | Ga0495625_0373816 | 3300046660 | Bacteria | 896 |
| 849 | Ga0495625_0433432 | 3300046660 | Unclassified | 815 |
| 850 | Ga0495669_0095356 | 3300046684 | Bacteria | 1378 |
| 851 | Ga0495670_0008493 | 3300046691 | Bacteria | 5054 |
| 852 | Ga0495670_0491773 | 3300046691 | Bacteria | 666 |
| 853 | Ga0495670_0572265 | 3300046691 | Bacteria | 615 |
| 854 | Ga0495670_0823298 | 3300046691 | Bacteria | 507 |
| 855 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 856 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 857 | Ga0495671_0001468 | 3300046692 | Bacteria | 15811 |
| 858 | Ga0495649_0167227 | 3300046694 | Bacteria | 1152 |
| 859 | Ga0495589_0027870 | 3300046794 | Bacteria | 2855 |
| 860 | Ga0495672_0060682 | 3300047320 | Bacteria | 2183 |
| 861 | Ga0495676_0532786 | 3300047321 | Bacteria | 769 |
| 862 | Ga0495683_0463540 | 3300047323 | Bacteria | 518 |
| 863 | Ga0495677_0014583 | 3300047445 | Bacteria | 2859 |
| 864 | Ga0495677_0139659 | 3300047445 | Bacteria | 930 |
| 865 | Ga0495685_181100 | 3300047447 | Bacteria | 679 |
| 866 | Ga0495673_0000076 | 3300047469 | Bacteria | 205985 |
| 867 | Ga0495673_0068055 | 3300047469 | Bacteria | 1506 |
| 868 | Ga0495681_0000059 | 3300047470 | Bacteria | 102400 |
| 869 | Ga0495681_0000202 | 3300047470 | Bacteria | 49721 |
| 870 | Ga0495686_0000141 | 3300047472 | Bacteria | 144510 |
| 871 | Ga0495686_0000238 | 3300047472 | Bacteria | 99919 |
| 872 | Ga0495686_0002243 | 3300047472 | Bacteria | 18638 |
| 873 | Ga0495686_0018319 | 3300047472 | Bacteria | 4702 |
| 874 | Ga0495686_0026212 | 3300047472 | Bacteria | 3815 |
| 875 | Ga0495686_0320197 | 3300047472 | Bacteria | 850 |
| 876 | Ga0495686_0350529 | 3300047472 | Bacteria | 802 |
| 877 | Ga0496100_0196852 | 3300048903 | Bacteria | 1466 |
| 878 | Ga0496101_0016231 | 3300048904 | Bacteria | 5026 |
| 879 | Ga0496102_0000036 | 3300048905 | Bacteria | 201896 |
| 880 | Ga0496102_0009074 | 3300048905 | Bacteria | 8532 |
| 881 | Ga0496102_0407214 | 3300048905 | Bacteria | 1278 |
| 882 | Ga0496102_0857482 | 3300048905 | Bacteria | 830 |
| 883 | Ga0496102_1300882 | 3300048905 | Bacteria | 646 |
| 884 | Ga0496103_0000074 | 3300048906 | Bacteria | 116385 |
| 885 | Ga0496103_0007440 | 3300048906 | Bacteria | 6528 |
| 886 | Ga0496103_0023715 | 3300048906 | Bacteria | 3700 |
| 887 | Ga0496103_0079884 | 3300048906 | Bacteria | 2056 |
| 888 | Ga0496103_0185776 | 3300048906 | Bacteria | 1336 |
| 889 | Ga0496103_0240120 | 3300048906 | Bacteria | 1166 |
| 890 | Ga0496104_0753832 | 3300048907 | Bacteria | 880 |
| 891 | Ga0496105_0185147 | 3300048908 | Bacteria | 1704 |
| 892 | Ga0496105_0213790 | 3300048908 | Bacteria | 1571 |
| 893 | Ga0496106_0190164 | 3300048909 | Bacteria | 1632 |
| 894 | Ga0496107_0037068 | 3300048910 | Bacteria | 3499 |
| 895 | Ga0496107_0137154 | 3300048910 | Bacteria | 1808 |
| 896 | Ga0496108_0003856 | 3300048911 | Bacteria | 12037 |
| 897 | Ga0496108_0221697 | 3300048911 | Bacteria | 1643 |
| 898 | Ga0496109_0003822 | 3300048912 | Bacteria | 12579 |
| 899 | Ga0496110_0010100 | 3300048913 | Bacteria | 7665 |
| 900 | Ga0496110_0049723 | 3300048913 | Bacteria | 3679 |
| 901 | Ga0496110_0243283 | 3300048913 | Bacteria | 1637 |
| 902 | Ga0496111_0039257 | 3300048914 | Bacteria | 3394 |
| 903 | Ga0496111_0304629 | 3300048914 | Bacteria | 1181 |
| 904 | Ga0496111_0406956 | 3300048914 | Bacteria | 1005 |
| 905 | Ga0496111_1045172 | 3300048914 | Bacteria | 584 |
| 906 | Ga0496113_0074937 | 3300048916 | Bacteria | 2581 |
| 907 | Ga0496114_0714791 | 3300048917 | Unclassified | 878 |
| 908 | Ga0496114_1377034 | 3300048917 | Bacteria | 593 |
| 909 | Ga0496116_0022703 | 3300048919 | Bacteria | 4695 |
| 910 | Ga0496116_0024263 | 3300048919 | Bacteria | 4491 |
| 911 | Ga0496116_0112777 | 3300048919 | Bacteria | 1592 |
| 912 | Ga0496116_0174234 | 3300048919 | Bacteria | 1161 |
| 913 | Ga0496117_0000093 | 3300048920 | Bacteria | 201862 |
| 914 | Ga0496117_0005266 | 3300048920 | Bacteria | 13717 |
| 915 | Ga0496117_0022206 | 3300048920 | Bacteria | 5094 |
| 916 | Ga0496117_0032491 | 3300048920 | Bacteria | 3964 |
| 917 | Ga0496117_0033745 | 3300048920 | Bacteria | 3865 |
| 918 | Ga0496117_0064004 | 3300048920 | Bacteria | 2510 |
| 919 | Ga0496117_0247277 | 3300048920 | Bacteria | 975 |
| 920 | Ga0496118_0000070 | 3300048921 | Bacteria | 201866 |
| 921 | Ga0496118_0000416 | 3300048921 | Bacteria | 70809 |
| 922 | Ga0496118_0008773 | 3300048921 | Bacteria | 10365 |
| 923 | Ga0496118_0035449 | 3300048921 | Bacteria | 4050 |
| 924 | Ga0496118_0039758 | 3300048921 | Bacteria | 3749 |
| 925 | Ga0496118_0153844 | 3300048921 | Bacteria | 1434 |
| 926 | Ga0496118_0220803 | 3300048921 | Bacteria | 1103 |
| 927 | Ga0496118_0259246 | 3300048921 | Bacteria | 982 |
| 928 | Ga0496118_0274897 | 3300048921 | Bacteria | 941 |
| 929 | Ga0496118_0579343 | 3300048921 | Bacteria | 541 |
| 930 | Ga0496119_0036352 | 3300048922 | Bacteria | 3216 |
| 931 | Ga0496119_0049559 | 3300048922 | Bacteria | 2595 |
| 932 | Ga0496119_0049636 | 3300048922 | Bacteria | 2593 |
| 933 | Ga0496119_0096446 | 3300048922 | Bacteria | 1668 |
| 934 | Ga0496120_0055188 | 3300048923 | Bacteria | 2247 |
| 935 | Ga0496120_0221952 | 3300048923 | Bacteria | 902 |
| 936 | Ga0496121_0000163 | 3300048924 | Bacteria | 145648 |
| 937 | Ga0496121_0000880 | 3300048924 | Bacteria | 54384 |
| 938 | Ga0496121_0001214 | 3300048924 | Bacteria | 44944 |
| 939 | Ga0496121_0001608 | 3300048924 | Bacteria | 37482 |
| 940 | Ga0496121_0047653 | 3300048924 | Bacteria | 3654 |
| 941 | Ga0496121_0097100 | 3300048924 | Bacteria | 2284 |
| 942 | Ga0496121_0097880 | 3300048924 | Bacteria | 2272 |
| 943 | Ga0496121_0108596 | 3300048924 | Bacteria | 2122 |
| 944 | Ga0496121_0139313 | 3300048924 | Bacteria | 1802 |
| 945 | Ga0496121_0174019 | 3300048924 | Bacteria | 1561 |
| 946 | Ga0496121_0296182 | 3300048924 | Bacteria | 1100 |
| 947 | Ga0496122_0000176 | 3300048925 | Bacteria | 152190 |
| 948 | Ga0496122_0010742 | 3300048925 | Bacteria | 9392 |
| 949 | Ga0496122_0021362 | 3300048925 | Bacteria | 5798 |
| 950 | Ga0496122_0436774 | 3300048925 | Bacteria | 653 |
| 951 | Ga0496123_0000220 | 3300048926 | Bacteria | 115824 |
| 952 | Ga0496123_0029884 | 3300048926 | Bacteria | 4000 |
| 953 | Ga0496123_0115289 | 3300048926 | Bacteria | 1525 |
| 954 | Ga0496123_0185645 | 3300048926 | Bacteria | 1081 |
| 955 | Ga0496123_0228841 | 3300048926 | Bacteria | 932 |
| 956 | Ga0496123_0295524 | 3300048926 | Bacteria | 776 |
| 957 | Ga0496124_0000225 | 3300048927 | Bacteria | 110516 |
| 958 | Ga0496124_0003343 | 3300048927 | Bacteria | 19739 |
| 959 | Ga0496124_0012464 | 3300048927 | Bacteria | 8390 |
| 960 | Ga0496124_0128992 | 3300048927 | Bacteria | 2011 |
| 961 | Ga0496124_0256786 | 3300048927 | Bacteria | 1289 |
| 962 | Ga0496124_0310133 | 3300048927 | Bacteria | 1135 |
| 963 | Ga0496124_0419095 | 3300048927 | Bacteria | 923 |
| 964 | Ga0496125_0008573 | 3300048928 | Bacteria | 10677 |
| 965 | Ga0496125_0025087 | 3300048928 | Bacteria | 5468 |
| 966 | Ga0496125_0042722 | 3300048928 | Bacteria | 3856 |
| 967 | Ga0496125_0059858 | 3300048928 | Bacteria | 3065 |
| 968 | Ga0496125_0149597 | 3300048928 | Bacteria | 1606 |
| 969 | Ga0496125_0212925 | 3300048928 | Bacteria | 1253 |
| 970 | Ga0496125_0251347 | 3300048928 | Bacteria | 1115 |
| 971 | Ga0496125_0342385 | 3300048928 | Bacteria | 897 |
| 972 | Ga0496125_0576544 | 3300048928 | Bacteria | 619 |
| 973 | Ga0496126_0010605 | 3300048929 | Bacteria | 9635 |
| 974 | Ga0496126_0011101 | 3300048929 | Bacteria | 9357 |
| 975 | Ga0496126_0059986 | 3300048929 | Bacteria | 3424 |
| 976 | Ga0496126_0252653 | 3300048929 | Bacteria | 1469 |
| 977 | Ga0496126_0345432 | 3300048929 | Bacteria | 1218 |
| 978 | Ga0496126_0806095 | 3300048929 | Bacteria | 720 |
| 979 | Ga0495682_0370095 | 3300049460 | Bacteria | 505 |
| 980 | Ga0501290_000401 | 3300049513 | Bacteria | 6887 |
| 981 | Ga0501290_006423 | 3300049513 | Bacteria | 1473 |
| 982 | Ga0501292_000049 | 3300049515 | Bacteria | 24987 |
| 983 | Ga0501293_040770 | 3300049516 | Bacteria | 526 |
| 984 | Ga0501294_000131 | 3300049517 | Bacteria | 8738 |
| 985 | Ga0501299_060454 | 3300049522 | Bacteria | 802 |
| 986 | Ga0501300_000260 | 3300049523 | Bacteria | 8045 |
| 987 | Ga0501300_000689 | 3300049523 | Bacteria | 5061 |
| 988 | Ga0501314_010069 | 3300049530 | Bacteria | 877 |
| 989 | Ga0501335_007702 | 3300049551 | Bacteria | 1000 |
| 990 | Ga0501032_0482230 | 3300049569 | Bacteria | 793 |
| 991 | Ga0501033_0592962 | 3300049570 | Bacteria | 760 |
| 992 | Ga0501033_0790175 | 3300049570 | Bacteria | 642 |
| 993 | Ga0501034_0004038 | 3300049571 | Bacteria | 16469 |
| 994 | Ga0501034_0037966 | 3300049571 | Bacteria | 4878 |
| 995 | Ga0501034_0241441 | 3300049571 | Bacteria | 1753 |
| 996 | Ga0501036_0231880 | 3300049572 | Bacteria | 1549 |
| 997 | Ga0501037_0700054 | 3300049573 | Bacteria | 674 |
| 998 | Ga0501038_0199248 | 3300049574 | Bacteria | 1608 |
| 999 | Ga0501039_0270408 | 3300049575 | Bacteria | 1336 |
| 1000 | Ga0501043_0070645 | 3300049579 | Bacteria | 2743 |
| 1001 | Ga0501043_0124196 | 3300049579 | Bacteria | 2024 |
| 1002 | Ga0501043_1323847 | 3300049579 | Bacteria | 502 |
| 1003 | Ga0501047_0002660 | 3300049581 | Bacteria | 16998 |
| 1004 | Ga0501047_0303094 | 3300049581 | Bacteria | 1440 |
| 1005 | Ga0501047_0363946 | 3300049581 | Bacteria | 1282 |
| 1006 | Ga0501048_0067221 | 3300049582 | Bacteria | 2534 |
| 1007 | Ga0501069_0001144 | 3300049585 | Bacteria | 12827 |
| 1008 | Ga0501071_0237548 | 3300049587 | Bacteria | 1374 |
| 1009 | Ga0501198_003618 | 3300049649 | Bacteria | 2119 |
| 1010 | Ga0501202_017144 | 3300049652 | Bacteria | 1412 |
| 1011 | Ga0501207_022073 | 3300049654 | Bacteria | 1026 |
| 1012 | Ga0501211_037350 | 3300049658 | Bacteria | 568 |
| 1013 | Ga0501222_000186 | 3300049662 | Bacteria | 11204 |
| 1014 | Ga0501223_000026 | 3300049663 | Bacteria | 58071 |
| 1015 | Ga0501223_000155 | 3300049663 | Bacteria | 18141 |
| 1016 | Ga0501223_000502 | 3300049663 | Bacteria | 9508 |
| 1017 | Ga0501223_007293 | 3300049663 | Bacteria | 2265 |
| 1018 | Ga0501223_013730 | 3300049663 | Bacteria | 1611 |
| 1019 | Ga0501224_000006 | 3300049664 | Bacteria | 149611 |
| 1020 | Ga0501224_000243 | 3300049664 | Bacteria | 6202 |
| 1021 | Ga0501224_028771 | 3300049664 | Bacteria | 832 |
| 1022 | Ga0501227_009170 | 3300049665 | Bacteria | 2127 |
| 1023 | Ga0501233_000373 | 3300049668 | Bacteria | 7074 |
| 1024 | Ga0501233_079369 | 3300049668 | Bacteria | 843 |
| 1025 | Ga0501235_004175 | 3300049669 | Bacteria | 3130 |
| 1026 | Ga0501235_005975 | 3300049669 | Bacteria | 2650 |
| 1027 | Ga0501246_012043 | 3300049676 | Bacteria | 807 |
| 1028 | Ga0501249_061921 | 3300049679 | Bacteria | 867 |
| 1029 | Ga0501257_000014 | 3300049686 | Bacteria | 50280 |
| 1030 | Ga0501259_003276 | 3300049688 | Bacteria | 2587 |
| 1031 | Ga0501261_000013 | 3300049690 | Bacteria | 45622 |
| 1032 | Ga0501221_002894 | 3300049704 | Bacteria | 2829 |
| 1033 | Ga0501225_0000129 | 3300049705 | Bacteria | 23106 |
| 1034 | Ga0501225_0000164 | 3300049705 | Bacteria | 20019 |
| 1035 | Ga0501225_0012404 | 3300049705 | Bacteria | 2394 |
| 1036 | Ga0501229_012275 | 3300049706 | Bacteria | 1093 |
| 1037 | Ga0501245_002452 | 3300049708 | Bacteria | 2477 |
| 1038 | Ga0501245_005990 | 3300049708 | Bacteria | 1693 |
| 1039 | Ga0501080_0534872 | 3300049742 | Bacteria | 1045 |
| 1040 | Ga0501241_009319 | 3300049758 | Bacteria | 1787 |
| 1041 | Ga0501278_010491 | 3300049774 | Bacteria | 740 |
| 1042 | Ga0501279_000017 | 3300049775 | Bacteria | 62448 |
| 1043 | Ga0501280_000015 | 3300049776 | Bacteria | 55614 |
| 1044 | Ga0501280_001970 | 3300049776 | Bacteria | 3575 |
| 1045 | Ga0501281_00053 | 3300049777 | Bacteria | 13557 |
| 1046 | Ga0501282_000557 | 3300049778 | Bacteria | 4362 |
| 1047 | Ga0501035_0898978 | 3300049822 | Bacteria | 701 |
| 1048 | Ga0501035_1276269 | 3300049822 | Bacteria | 567 |
| 1049 | Ga0501044_0003361 | 3300049823 | Bacteria | 18041 |
| 1050 | Ga0501044_0234100 | 3300049823 | Bacteria | 1783 |
| 1051 | Ga0501204_074564 | 3300049850 | Bacteria | 565 |
| 1052 | Ga0501212_101646 | 3300049851 | Bacteria | 540 |
| 1053 | Ga0501226_000041 | 3300049853 | Bacteria | 59344 |
| 1054 | Ga0501226_020454 | 3300049853 | Bacteria | 732 |
| 1055 | nmdc:mga03n38_2083_c1 | 3300050490 | Bacteria | 6055 |
| 1056 | nmdc:mga00v17_363493_c1 | 3300050491 | Bacteria | 941 |
| 1057 | nmdc:mga06z11_69_c1 | 3300050494 | Bacteria | 42587 |
| 1058 | nmdc:mga04h51_116_c1 | 3300050495 | Bacteria | 23330 |
| 1059 | nmdc:mga07m45_119069_c1 | 3300050496 | Bacteria | 1524 |
| 1060 | nmdc:mga07m45_33591_c1 | 3300050496 | Bacteria | 2849 |
| 1061 | nmdc:mga07m45_559499_c1 | 3300050496 | Bacteria | 661 |
| 1062 | nmdc:mga0sz30_184575_c1 | 3300050516 | Bacteria | 926 |
| 1063 | Ga0495601_0891215 | 3300053077 | Bacteria | 562 |
| 1064 | Ga0500635_0270068 | 3300053080 | Bacteria | 669 |
| 1065 | Ga0495619_0871968 | 3300053085 | Bacteria | 606 |
| 1066 | Ga0500643_000151 | 3300053087 | Bacteria | 70674 |
| 1067 | Ga0500643_000242 | 3300053087 | Bacteria | 50505 |
| 1068 | Ga0500643_000348 | 3300053087 | Bacteria | 36744 |
| 1069 | Ga0500643_000471 | 3300053087 | Bacteria | 29518 |
| 1070 | Ga0500643_000628 | 3300053087 | Bacteria | 23797 |
| 1071 | Ga0500643_002009 | 3300053087 | Bacteria | 10953 |
| 1072 | Ga0500643_097267 | 3300053087 | Bacteria | 800 |
| 1073 | Ga0500643_180149 | 3300053087 | Bacteria | 567 |
| 1074 | Ga0500644_0096104 | 3300053088 | Bacteria | 1118 |
| 1075 | Ga0500644_0276246 | 3300053088 | Bacteria | 714 |
| 1076 | Ga0500646_0374147 | 3300053090 | Bacteria | 523 |
| 1077 | Ga0500647_0110793 | 3300053091 | Bacteria | 1305 |
| 1078 | Ga0500647_0302306 | 3300053091 | Bacteria | 683 |
| 1079 | Ga0500651_0001723 | 3300053093 | Bacteria | 11200 |
| 1080 | Ga0500566_0119319 | 3300053094 | Bacteria | 1424 |
| 1081 | Ga0500641_0440304 | 3300053096 | Bacteria | 504 |
| 1082 | Ga0500556_0000025 | 3300053104 | Bacteria | 167307 |
| 1083 | Ga0500562_037090 | 3300053108 | Bacteria | 1293 |
| 1084 | Ga0500592_000037 | 3300053116 | Bacteria | 42549 |
| 1085 | Ga0500592_002732 | 3300053116 | Bacteria | 2842 |
| 1086 | Ga0500592_002889 | 3300053116 | Bacteria | 2761 |
| 1087 | Ga0500593_154804 | 3300053117 | Bacteria | 884 |
| 1088 | Ga0500594_0006394 | 3300053118 | Bacteria | 2645 |
| 1089 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 1090 | Ga0500642_0002903 | 3300053130 | Bacteria | 5096 |
| 1091 | Ga0500652_202890 | 3300053131 | Bacteria | 804 |
| 1092 | Ga0500655_011783 | 3300053133 | Bacteria | 1586 |
| 1093 | Ga0500658_0002052 | 3300053134 | Bacteria | 7853 |
| 1094 | Ga0500658_0156648 | 3300053134 | Bacteria | 1029 |
| 1095 | Ga0500559_0011994 | 3300053136 | Bacteria | 3693 |
| 1096 | Ga0500559_0021863 | 3300053136 | Bacteria | 2713 |
| 1097 | Ga0500559_0029654 | 3300053136 | Bacteria | 2344 |
| 1098 | Ga0500559_0113736 | 3300053136 | Bacteria | 1255 |
| 1099 | Ga0500568_0045317 | 3300053139 | Bacteria | 1751 |
| 1100 | Ga0500568_0182185 | 3300053139 | Bacteria | 772 |
| 1101 | Ga0500573_0000010 | 3300053140 | Bacteria | 210704 |
| 1102 | Ga0500573_0296822 | 3300053140 | Bacteria | 810 |
| 1103 | Ga0500573_0508188 | 3300053140 | Bacteria | 543 |
| 1104 | Ga0500577_0045158 | 3300053142 | Bacteria | 1627 |
| 1105 | Ga0500590_053507 | 3300053148 | Bacteria | 2046 |
| 1106 | Ga0500604_0002377 | 3300053151 | Bacteria | 5146 |
| 1107 | Ga0500604_0005821 | 3300053151 | Bacteria | 3259 |
| 1108 | Ga0500604_0032864 | 3300053151 | Bacteria | 1531 |
| 1109 | Ga0500604_0096251 | 3300053151 | Bacteria | 972 |
| 1110 | Ga0500604_0096993 | 3300053151 | Bacteria | 968 |
| 1111 | Ga0500616_0007814 | 3300053153 | Bacteria | 6737 |
| 1112 | Ga0500616_0091162 | 3300053153 | Bacteria | 1509 |
| 1113 | Ga0500616_0259593 | 3300053153 | Bacteria | 738 |
| 1114 | Ga0500622_0017836 | 3300053156 | Bacteria | 3776 |
| 1115 | Ga0500622_0237033 | 3300053156 | Bacteria | 808 |
| 1116 | Ga0500622_0422613 | 3300053156 | Bacteria | 536 |
| 1117 | Ga0500624_000026 | 3300053157 | Bacteria | 109681 |
| 1118 | Ga0500624_000058 | 3300053157 | Bacteria | 70829 |
| 1119 | Ga0500627_0000411 | 3300053158 | Bacteria | 11566 |
| 1120 | Ga0500627_0000731 | 3300053158 | Bacteria | 8741 |
| 1121 | Ga0500627_0003404 | 3300053158 | Bacteria | 4909 |
| 1122 | Ga0500627_0102669 | 3300053158 | Bacteria | 1284 |
| 1123 | Ga0500627_0239955 | 3300053158 | Bacteria | 804 |
| 1124 | Ga0500627_0466807 | 3300053158 | Bacteria | 529 |
| 1125 | Ga0500636_0000920 | 3300053177 | Bacteria | 15845 |
| 1126 | Ga0500636_0084556 | 3300053177 | Bacteria | 1824 |
| 1127 | Ga0500636_0121211 | 3300053177 | Bacteria | 1467 |
| 1128 | Ga0500570_022799 | 3300053724 | Bacteria | 3470 |
| 1129 | Ga0500611_013745 | 3300053727 | Bacteria | 1396 |
| 1130 | Ga0500645_000355 | 3300053730 | Bacteria | 32606 |
| 1131 | Ga0500645_046727 | 3300053730 | Bacteria | 1270 |
| 1132 | Ga0500645_089855 | 3300053730 | Bacteria | 871 |
| 1133 | Ga0500596_008569 | 3300053735 | Bacteria | 1627 |
| 1134 | Ga0500661_000136 | 3300055283 | Bacteria | 12432 |
| 1135 | Ga0501082_0874047 | 3300060353 | Bacteria | 786 |
| 1136 | Ga0466962_0016119 | 3300061719 | Bacteria | 3604 |
| 1137 | Ga0466962_0183745 | 3300061719 | Bacteria | 1020 |
| 1138 | 2512645549 | 2512564014 | Bacteria | 4639632 |
| 1139 | 2585260411 | 2582581305 | Bacteria | 4895574 |
| 1140 | 2643729127 | 2643221541 | Bacteria | 5498788 |
| 1141 | 2644038611 | 2643221605 | Bacteria | 4772303 |
| 1142 | 2644045140 | 2643221606 | Bacteria | 5588032 |
| 1143 | 2644391312 | 2643221671 | Bacteria | 5496681 |
| 1144 | 2778126231 | 2775507255 | Bacteria | 3945731 |
| 1145 | 2809063216 | 2808606401 | Bacteria | 4586670 |
| 1146 | 2809079349 | 2808606404 | Bacteria | 4652788 |
| 1147 | 2809083278 | 2808606405 | Bacteria | 4586632 |
| 1148 | 2830075926 | 2830075706 | Bacteria | 3855215 |
| 1149 | 2880520485 | 2880518877 | Bacteria | 5012590 |
| 1150 | 2885432081 | 2885429604 | Bacteria | 3642894 |
| 1151 | 2919710726 | 2919709256 | Bacteria | 4318106 |
| 1152 | 2928028841 | 2928027323 | Bacteria | 4382488 |
| 1153 | 2984556397 | 2984555340 | Bacteria | 4247089 |
| 1154 | 2984565414 | 2984564862 | Bacteria | 4339992 |
| 1155 | 2990268949 | 2990265787 | Bacteria | 3943888 |
| 1156 | 2993356506 | 2993356040 | Bacteria | 4247105 |
| 1157 | 2993697239 | 2993693658 | Bacteria | 4040749 |
| 1158 | Ga0097621_102009464 | |||
| 1159 | SwRhRL2b_contig_200884 | |||
| 1160 | SwRhRL2b_contig_682763 | |||
| 1161 | JGI24034J14986_100946 | |||
| 1162 | JGI24736J21556_1000015 | |||
| 1163 | JGI24736J21556_1000379 | |||
| 1164 | JGI24736J21556_1041369 | |||
| 1165 | JGI24741J21665_1000200 | |||
| 1166 | JGI24741J21665_1007687 | |||
| 1167 | JGI24752J21851_1000029 | |||
| 1168 | JGI24752J21851_1000343 | |||
| 1169 | JGI24752J21851_1033475 | |||
| 1170 | JGI24740J21852_10005510 | |||
| 1171 | JGI24740J21852_10021799 | |||
| 1172 | JGI24740J21852_10066980 | |||
| 1173 | JGI24740J21852_10070938 | |||
| 1174 | JGI24739J22299_10007450 | |||
| 1175 | JGI24739J22299_10013160 | |||
| 1176 | JGI24739J22299_10016802 | |||
| 1177 | JGI24739J22299_10035566 | |||
| 1178 | JGI24739J22299_10062228 | |||
| 1179 | JGI24739J22299_10149173 | |||
| 1180 | JGI24737J22298_10000844 | |||
| 1181 | JGI24737J22298_10002091 | |||
| 1182 | JGI24737J22298_10019795 | |||
| 1183 | JGI24737J22298_10046085 | |||
| 1184 | JGI24737J22298_10075128 | |||
| 1185 | JGI24743J22301_10025233 | |||
| 1186 | JGI24735J21928_10000451 | |||
| 1187 | JGI24735J21928_10003995 | |||
| 1188 | JGI24735J21928_10004623 | |||
| 1189 | JGI24735J21928_10038022 | |||
| 1190 | JGI24750J21931_1000259 | |||
| 1191 | JGI24748J21848_1000023 | |||
| 1192 | JGI24748J21848_1023771 | |||
| 1193 | JGI24738J21930_10000728 | |||
| 1194 | JGI24738J21930_10000824 | |||
| 1195 | JGI24738J21930_10002030 | |||
| 1196 | JGI24738J21930_10071374 | |||
| 1197 | JGI24749J21850_1001696 | |||
| 1198 | JGI24744J21845_10003312 | |||
| 1199 | JGI24035J26624_1002255 | |||
| 1200 | JGI24034J26672_10000010 | |||
| 1201 | JGI24034J26672_10005447 | |||
| 1202 | JGI24034J26672_10008951 | |||
| 1203 | JGI24742J22300_10000537 | |||
| 1204 | JGI24751J29686_10056506 | |||
| 1205 | JGI25165J46597_1000124 | |||
| 1206 | rootH1_10081084 | |||
| 1207 | Ga0055542_1001963 | |||
| 1208 | Ga0055542_1028623 | |||
| 1209 | Ga0055530_10000485 | |||
| 1210 | Ga0055531_10000524 | |||
| 1211 | Ga0065165_1063338 | |||
| 1212 | Ga0065704_10005679 | |||
| 1213 | Ga0065704_10074420 | |||
| 1214 | Ga0065704_10093669 | |||
| 1215 | Ga0065707_10027121 | |||
| 1216 | Ga0065707_10082699 | |||
| 1217 | Ga0065707_10100815 | |||
| 1218 | Ga0065707_10153765 | |||
| 1219 | Ga0065707_10160566 | |||
| 1220 | Ga0065707_10665677 | |||
| 1221 | Ga0070658_10000050 | |||
| 1222 | Ga0070658_10000057 | |||
| 1223 | Ga0070658_10008422 | |||
| 1224 | Ga0070658_10104912 | |||
| 1225 | Ga0070658_10646559 | |||
| 1226 | Ga0070658_10704415 | |||
| 1227 | Ga0070676_10001112 | |||
| 1228 | Ga0070676_10255743 | |||
| 1229 | Ga0070683_100049964 | |||
| 1230 | Ga0070683_101112413 | |||
| 1231 | Ga0070670_100000003 | |||
| 1232 | Ga0070670_100000135 | |||
| 1233 | Ga0070670_100000815 | |||
| 1234 | Ga0070670_100001203 | |||
| 1235 | Ga0070670_100056819 | |||
| 1236 | Ga0070670_100126486 | |||
| 1237 | Ga0070670_101133684 | |||
| 1238 | Ga0068869_100000528 | |||
| 1239 | Ga0068869_100432191 | |||
| 1240 | Ga0070666_10000009 | |||
| 1241 | Ga0070666_10000115 | |||
| 1242 | Ga0070666_10004754 | |||
| 1243 | Ga0070666_10027244 | |||
| 1244 | Ga0070682_100143730 | |||
| 1245 | Ga0068868_100000074 | |||
| 1246 | Ga0070660_100002838 | |||
| 1247 | Ga0070660_100004367 | |||
| 1248 | Ga0070660_100008583 | |||
| 1249 | Ga0070660_100013497 | |||
| 1250 | Ga0070660_100056725 | |||
| 1251 | Ga0070660_100058458 | |||
| 1252 | Ga0070660_100957382 | |||
| 1253 | Ga0070689_101607124 | |||
| 1254 | Ga0070687_100185112 | |||
| 1255 | Ga0070661_100043344 | |||
| 1256 | Ga0070661_100056833 | |||
| 1257 | Ga0070661_100111742 | |||
| 1258 | Ga0070661_100467201 | |||
| 1259 | Ga0070668_100000117 | |||
| 1260 | Ga0070668_100000119 | |||
| 1261 | Ga0070668_100008086 | |||
| 1262 | Ga0070668_100025713 | |||
| 1263 | Ga0070668_100124001 | |||
| 1264 | Ga0070668_100216084 | |||
| 1265 | Ga0070668_100435792 | |||
| 1266 | Ga0070668_102128782 | |||
| 1267 | Ga0070669_100000004 | |||
| 1268 | Ga0070669_100000017 | |||
| 1269 | Ga0070669_100000020 | |||
| 1270 | Ga0070669_100021925 | |||
| 1271 | Ga0070669_100048028 | |||
| 1272 | Ga0070669_101973825 | |||
| 1273 | Ga0070675_100000482 | |||
| 1274 | Ga0070675_100491535 | |||
| 1275 | Ga0070671_100000004 | |||
| 1276 | Ga0070671_100000426 | |||
| 1277 | Ga0070671_100012098 | |||
| 1278 | Ga0070671_100014451 | |||
| 1279 | Ga0070671_100673147 | |||
| 1280 | Ga0070674_100014876 | |||
| 1281 | Ga0070674_100803879 | |||
| 1282 | Ga0070674_100963512 | |||
| 1283 | Ga0070673_100000008 | |||
| 1284 | Ga0070673_100792423 | |||
| 1285 | Ga0070688_100010711 | |||
| 1286 | Ga0070688_100296952 | |||
| 1287 | Ga0070659_100015151 | |||
| 1288 | Ga0070659_100037194 | |||
| 1289 | Ga0070659_100065464 | |||
| 1290 | Ga0070659_100221119 | |||
| 1291 | Ga0070659_100435276 | |||
| 1292 | Ga0070659_100478239 | |||
| 1293 | Ga0070667_100000016 | |||
| 1294 | Ga0070667_100000113 | |||
| 1295 | Ga0070667_100000357 | |||
| 1296 | Ga0070667_100000969 | |||
| 1297 | Ga0070667_100002047 | |||
| 1298 | Ga0070667_100014603 | |||
| 1299 | Ga0070667_100373346 | |||
| 1300 | Ga0070667_101141709 | |||
| 1301 | Ga0070667_101248868 | |||
| 1302 | Ga0070667_101302372 | |||
| 1303 | Ga0070705_100058395 | |||
| 1304 | Ga0070708_100213171 | |||
| 1305 | Ga0070663_100008375 | |||
| 1306 | Ga0070663_100175974 | |||
| 1307 | Ga0070663_100184030 | |||
| 1308 | Ga0070663_100206062 | |||
| 1309 | Ga0070663_100297134 | |||
| 1310 | Ga0070678_100003552 | |||
| 1311 | Ga0070678_100302164 | |||
| 1312 | Ga0070662_100009993 | |||
| 1313 | Ga0070662_100038291 | |||
| 1314 | Ga0070662_100054299 | |||
| 1315 | Ga0070662_100256482 | |||
| 1316 | Ga0070662_100263336 | |||
| 1317 | Ga0070662_101539970 | |||
| 1318 | Ga0068867_100000003 | |||
| 1319 | Ga0068867_100558914 | |||
| 1320 | Ga0070685_10000291 | |||
| 1321 | Ga0070685_10773857 | |||
| 1322 | Ga0070707_100950460 | |||
| 1323 | Ga0070679_100653556 | |||
| 1324 | Ga0070684_100671317 | |||
| 1325 | Ga0068853_100000408 | |||
| 1326 | Ga0068853_100049504 | |||
| 1327 | Ga0068853_100129707 | |||
| 1328 | Ga0068853_100155785 | |||
| 1329 | Ga0068853_100220351 | |||
| 1330 | Ga0068853_100381375 | |||
| 1331 | Ga0068853_101232667 | |||
| 1332 | Ga0070672_100419806 | |||
| 1333 | Ga0070672_101399494 | |||
| 1334 | Ga0070686_100000041 | |||
| 1335 | Ga0070693_100082827 | |||
| 1336 | Ga0070693_100290623 | |||
| 1337 | Ga0070665_100000368 | |||
| 1338 | Ga0070665_100129628 | |||
| 1339 | Ga0070665_100227729 | |||
| 1340 | Ga0070665_100651920 | |||
| 1341 | Ga0068855_100003895 | |||
| 1342 | Ga0068855_100325483 | |||
| 1343 | Ga0068855_100364233 | |||
| 1344 | Ga0068855_100493147 | |||
| 1345 | Ga0068855_100580485 | |||
| 1346 | Ga0068855_100780631 | |||
| 1347 | Ga0068855_100783044 | |||
| 1348 | Ga0068855_101533168 | |||
| 1349 | Ga0070664_100041964 | |||
| 1350 | Ga0070664_100054636 | |||
| 1351 | Ga0070664_100185252 | |||
| 1352 | Ga0070664_101974678 | |||
| 1353 | Ga0068857_100026906 | |||
| 1354 | Ga0068857_100037444 | |||
| 1355 | Ga0068857_100073026 | |||
| 1356 | Ga0068857_100079335 | |||
| 1357 | Ga0068857_100084504 | |||
| 1358 | Ga0068857_100131683 | |||
| 1359 | Ga0068857_100150957 | |||
| 1360 | Ga0068854_100001318 | |||
| 1361 | Ga0068854_100010079 | |||
| 1362 | Ga0068854_100018727 | |||
| 1363 | Ga0068854_100049284 | |||
| 1364 | Ga0068854_100098886 | |||
| 1365 | Ga0068854_100130300 | |||
| 1366 | Ga0068854_101221017 | |||
| 1367 | Ga0068856_100003087 | |||
| 1368 | Ga0068856_100021580 | |||
| 1369 | Ga0068856_100180410 | |||
| 1370 | Ga0068856_100896913 | |||
| 1371 | Ga0068856_101454313 | |||
| 1372 | Ga0068856_101937912 | |||
| 1373 | Ga0068856_101942530 | |||
| 1374 | Ga0068852_100002299 | |||
| 1375 | Ga0068852_100031099 | |||
| 1376 | Ga0068852_100132840 | |||
| 1377 | Ga0068852_100193270 | |||
| 1378 | Ga0068852_100342914 | |||
| 1379 | Ga0068852_100615321 | |||
| 1380 | Ga0068852_100780069 | |||
| 1381 | Ga0068852_100886793 | |||
| 1382 | Ga0068852_101820514 | |||
| 1383 | Ga0068859_100000233 | |||
| 1384 | Ga0068859_100003392 | |||
| 1385 | Ga0068859_100035740 | |||
| 1386 | Ga0068859_100055791 | |||
| 1387 | Ga0068859_100162429 | |||
| 1388 | Ga0068859_100433024 | |||
| 1389 | Ga0068859_100936126 | |||
| 1390 | Ga0068859_102377425 | |||
| 1391 | Ga0068864_100000005 | |||
| 1392 | Ga0068864_100000191 | |||
| 1393 | Ga0068864_100000798 | |||
| 1394 | Ga0068864_100001033 | |||
| 1395 | Ga0068864_100005449 | |||
| 1396 | Ga0068864_100006140 | |||
| 1397 | Ga0068864_100057140 | |||
| 1398 | Ga0068861_100006153 | |||
| 1399 | Ga0068861_100007109 | |||
| 1400 | Ga0068861_100200940 | |||
| 1401 | Ga0068861_101376968 | |||
| 1402 | Ga0068851_10005533 | |||
| 1403 | Ga0068851_10058089 | |||
| 1404 | Ga0068851_10109605 | |||
| 1405 | Ga0068870_10138802 | |||
| 1406 | Ga0068863_100000132 | |||
| 1407 | Ga0068863_100000166 | |||
| 1408 | Ga0068863_100005052 | |||
| 1409 | Ga0068863_100014467 | |||
| 1410 | Ga0068863_100026394 | |||
| 1411 | Ga0068863_100196458 | |||
| 1412 | Ga0068863_100285874 | |||
| 1413 | Ga0068863_101076647 | |||
| 1414 | Ga0068858_100000288 | |||
| 1415 | Ga0068858_100000291 | |||
| 1416 | Ga0068858_100036066 | |||
| 1417 | Ga0068858_100039517 | |||
| 1418 | Ga0068858_100321273 | |||
| 1419 | Ga0068860_100000022 | |||
| 1420 | Ga0068860_100000215 | |||
| 1421 | Ga0068860_100000256 | |||
| 1422 | Ga0068860_100035312 | |||
| 1423 | Ga0068860_100039119 | |||
| 1424 | Ga0068862_100000001 | |||
| 1425 | Ga0068862_100000151 | |||
| 1426 | Ga0068862_100000346 | |||
| 1427 | Ga0068862_100000581 | |||
| 1428 | Ga0068862_100000596 | |||
| 1429 | Ga0068862_100202785 | |||
| 1430 | Ga0081455_10000049 | |||
| 1431 | Ga0081455_10301827 | |||
| 1432 | Ga0081539_10022573 | |||
| 1433 | Ga0075368_10000139 | |||
| 1434 | Ga0075363_100002110 | |||
| 1435 | Ga0075364_10245609 | |||
| 1436 | Ga0075367_10017797 | |||
| 1437 | Ga0075366_10105588 | |||
| 1438 | Ga0075366_10899607 | |||
| 1439 | Ga0097621_100026787 | |||
| 1440 | Ga0075370_10031127 | |||
| 1441 | Ga0075370_10035043 | |||
| 1442 | Ga0075370_10610688 | |||
| 1443 | Ga0068871_100003615 | |||
| 1444 | Ga0068865_100000002 | |||
| 1445 | Ga0068865_100858645 | |||
| 1446 | Ga0097620_100000233 | |||
| 1447 | Ga0097620_100003392 | |||
| 1448 | Ga0097620_100035739 | |||
| 1449 | Ga0097620_100055791 | |||
| 1450 | Ga0097620_100162424 | |||
| 1451 | Ga0097620_100433012 | |||
| 1452 | Ga0097620_100936300 | |||
| 1453 | Ga0097620_102376612 | |||
| 1454 | Ga0105251_10000264 | |||
| 1455 | Ga0105251_10015469 | |||
| 1456 | Ga0105251_10038670 | |||
| 1457 | Ga0105251_10646565 | |||
| 1458 | Ga0105240_10056330 | |||
| 1459 | Ga0105240_10091245 | |||
| 1460 | Ga0105240_10113964 | |||
| 1461 | Ga0105240_10439268 | |||
| 1462 | Ga0105240_11321680 | |||
| 1463 | Ga0105245_10000184 | |||
| 1464 | Ga0105247_10000989 | |||
| 1465 | Ga0105247_10003404 | |||
| 1466 | Ga0105247_10382478 | |||
| 1467 | Ga0105247_10396008 | |||
| 1468 | Ga0105247_10406811 | |||
| 1469 | Ga0105247_11378572 | |||
| 1470 | Ga0114129_10250889 | |||
| 1471 | Ga0105243_10000031 | |||
| 1472 | Ga0105243_10290320 | |||
| 1473 | Ga0105243_10438223 | |||
| 1474 | Ga0105241_10002989 | |||
| 1475 | Ga0105241_10052516 | |||
| 1476 | Ga0105241_11147730 | |||
| 1477 | Ga0105242_10000171 | |||
| 1478 | Ga0105248_10000012 | |||
| 1479 | Ga0105248_10000192 | |||
| 1480 | Ga0105248_10003135 | |||
| 1481 | Ga0105248_10028054 | |||
| 1482 | Ga0105248_10217454 | |||
| 1483 | Ga0105248_10324045 | |||
| 1484 | Ga0105248_10352642 | |||
| 1485 | Ga0105248_10467294 | |||
| 1486 | Ga0105248_12712317 | |||
| 1487 | Ga0105237_10002820 | |||
| 1488 | Ga0105237_10068927 | |||
| 1489 | Ga0105237_10073893 | |||
| 1490 | Ga0105237_10112662 | |||
| 1491 | Ga0105238_10030882 | |||
| 1492 | Ga0105238_10152857 | |||
| 1493 | Ga0105238_10421315 | |||
| 1494 | Ga0105238_10522637 | |||
| 1495 | Ga0105238_10546884 | |||
| 1496 | Ga0105249_10000014 | |||
| 1497 | Ga0105249_10000099 | |||
| 1498 | Ga0105249_10000699 | |||
| 1499 | Ga0105249_10017636 | |||
| 1500 | Ga0105249_10244793 | |||
| 1501 | Ga0105249_10331263 | |||
| 1502 | Ga0105249_10738720 | |||
| 1503 | Ga0105249_10751522 | |||
| 1504 | Ga0105148_100092 | |||
| 1505 | Ga0105147_101503 | |||
| 1506 | Ga0105239_10000451 | |||
| 1507 | Ga0105239_10028478 | |||
| 1508 | Ga0105239_10149947 | |||
| 1509 | Ga0105239_10361584 | |||
| 1510 | Ga0105239_10516815 | |||
| 1511 | Ga0105239_10600086 | |||
| 1512 | Ga0105246_10000056 | |||
| 1513 | Ga0105246_10283343 | |||
| 1514 | Ga0157326_1000375 | |||
| 1515 | Ga0157373_10008588 | |||
| 1516 | Ga0157373_10051976 | |||
| 1517 | Ga0157373_10074440 | |||
| 1518 | Ga0157373_10151590 | |||
| 1519 | Ga0157373_10171969 | |||
| 1520 | Ga0157373_10509271 | |||
| 1521 | Ga0157371_10086710 | |||
| 1522 | Ga0157371_10184773 | |||
| 1523 | Ga0157371_11155234 | |||
| 1524 | Ga0157370_10000080 | |||
| 1525 | Ga0157370_10003119 | |||
| 1526 | Ga0157370_10083609 | |||
| 1527 | Ga0157370_10372884 | |||
| 1528 | Ga0157370_10925981 | |||
| 1529 | Ga0157369_10042446 | |||
| 1530 | Ga0157369_10055589 | |||
| 1531 | Ga0157369_10068286 | |||
| 1532 | Ga0157369_10167917 | |||
| 1533 | Ga0157369_11065092 | |||
| 1534 | Ga0157369_12621612 | |||
| 1535 | Ga0157374_10000184 | |||
| 1536 | Ga0157374_10041949 | |||
| 1537 | Ga0157378_10000205 | |||
| 1538 | Ga0163162_10002879 | |||
| 1539 | Ga0163162_10013910 | |||
| 1540 | Ga0163162_10117460 | |||
| 1541 | Ga0163162_10159072 | |||
| 1542 | Ga0163162_10209195 | |||
| 1543 | Ga0163162_10350467 | |||
| 1544 | Ga0163162_10377805 | |||
| 1545 | Ga0163162_11061666 | |||
| 1546 | Ga0157372_10064970 | |||
| 1547 | Ga0157372_10075492 | |||
| 1548 | Ga0157372_10078364 | |||
| 1549 | Ga0157372_10498080 | |||
| 1550 | Ga0157372_11433170 | |||
| 1551 | Ga0157372_11765392 | |||
| 1552 | Ga0157375_10080217 | |||
| 1553 | Ga0157375_10729144 | |||
| 1554 | Ga0163163_10025413 | |||
| 1555 | Ga0163163_10067038 | |||
| 1556 | Ga0163163_10223664 | |||
| 1557 | Ga0163163_10471431 | |||
| 1558 | Ga0163163_10721878 | |||
| 1559 | Ga0157380_10000107 | |||
| 1560 | Ga0157380_10000350 | |||
| 1561 | Ga0157380_10001483 | |||
| 1562 | Ga0157380_10034350 | |||
| 1563 | Ga0157379_10034748 | |||
| 1564 | Ga0157379_10057086 | |||
| 1565 | Ga0157379_10058471 | |||
| 1566 | Ga0157379_12119996 | |||
| 1567 | Ga0157376_10000148 | |||
| 1568 | Ga0157376_12617527 | |||
| 1569 | Ga0183363_1007 | |||
| 1570 | Ga0183361_10472 | |||
| 1571 | Ga0163161_10000860 | |||
| 1572 | Ga0163161_10030187 | |||
| 1573 | Ga0163161_10030480 | |||
| 1574 | Ga0163161_10300304 | |||
| 1575 | Ga0163161_10603456 | |||
| 1576 | Ga0163161_10758566 | |||
| 1577 | Ga0207672_1002763 | |||
| 1578 | Ga0209147_101130 | |||
| 1579 | Ga0207427_101618 | |||
| 1580 | Ga0209026_1002559 | |||
| 1581 | Ga0209148_1000112 | |||
| 1582 | Ga0209148_1000974 | |||
| 1583 | Ga0209233_1000189 | |||
| 1584 | Ga0209455_1001147 | |||
| 1585 | Ga0207673_1004543 | |||
| 1586 | Ga0209050_1000832 | |||
| 1587 | Ga0209257_1000929 | |||
| 1588 | Ga0209257_1048009 | |||
| 1589 | Ga0207697_10000101 | |||
| 1590 | Ga0207697_10009818 | |||
| 1591 | Ga0207697_10203779 | |||
| 1592 | Ga0207656_10004950 | |||
| 1593 | Ga0207656_10178021 | |||
| 1594 | Ga0207713_1001017 | |||
| 1595 | Ga0207710_10004035 | |||
| 1596 | Ga0207710_10367134 | |||
| 1597 | Ga0207710_10372457 | |||
| 1598 | Ga0207710_10477319 | |||
| 1599 | Ga0207688_10367906 | |||
| 1600 | Ga0207680_10000007 | |||
| 1601 | Ga0207680_10000078 | |||
| 1602 | Ga0207680_10017766 | |||
| 1603 | Ga0207680_10018003 | |||
| 1604 | Ga0207680_10234188 | |||
| 1605 | Ga0207680_11142866 | |||
| 1606 | Ga0207647_10000323 | |||
| 1607 | Ga0207647_10004162 | |||
| 1608 | Ga0207647_10010729 | |||
| 1609 | Ga0207647_10318710 | |||
| 1610 | Ga0207645_10001019 | |||
| 1611 | Ga0207645_10491252 | |||
| 1612 | Ga0207645_10775422 | |||
| 1613 | Ga0207705_10000014 | |||
| 1614 | Ga0207705_10000145 | |||
| 1615 | Ga0207705_10193347 | |||
| 1616 | Ga0207705_10327551 | |||
| 1617 | Ga0207654_10000521 | |||
| 1618 | Ga0207654_10025400 | |||
| 1619 | Ga0207695_10004592 | |||
| 1620 | Ga0207695_10015825 | |||
| 1621 | Ga0207695_10075373 | |||
| 1622 | Ga0207695_10821677 | |||
| 1623 | Ga0207695_10989976 | |||
| 1624 | Ga0207671_10000740 | |||
| 1625 | Ga0207671_10001130 | |||
| 1626 | Ga0207671_10050539 | |||
| 1627 | Ga0207671_10206859 | |||
| 1628 | Ga0207671_10426551 | |||
| 1629 | Ga0207662_10211064 | |||
| 1630 | Ga0207657_10001736 | |||
| 1631 | Ga0207657_10010116 | |||
| 1632 | Ga0207657_10013912 | |||
| 1633 | Ga0207657_10022481 | |||
| 1634 | Ga0207657_10054229 | |||
| 1635 | Ga0207657_10058524 | |||
| 1636 | Ga0207649_10060326 | |||
| 1637 | Ga0207649_10128672 | |||
| 1638 | Ga0207649_10307869 | |||
| 1639 | Ga0207649_10794313 | |||
| 1640 | Ga0207652_10893322 | |||
| 1641 | Ga0207646_10478627 | |||
| 1642 | Ga0207681_10000005 | |||
| 1643 | Ga0207681_10000010 | |||
| 1644 | Ga0207681_10000029 | |||
| 1645 | Ga0207681_10007837 | |||
| 1646 | Ga0207681_10009997 | |||
| 1647 | Ga0207681_10162446 | |||
| 1648 | Ga0207681_10401826 | |||
| 1649 | Ga0207694_10002569 | |||
| 1650 | Ga0207694_10021154 | |||
| 1651 | Ga0207694_10044490 | |||
| 1652 | Ga0207694_10123314 | |||
| 1653 | Ga0207694_10151946 | |||
| 1654 | Ga0207694_10448556 | |||
| 1655 | Ga0207694_11145990 | |||
| 1656 | Ga0207650_10000004 | |||
| 1657 | Ga0207650_10000182 | |||
| 1658 | Ga0207650_10006854 | |||
| 1659 | Ga0207650_10079934 | |||
| 1660 | Ga0207650_10137542 | |||
| 1661 | Ga0207650_10143934 | |||
| 1662 | Ga0207650_11343351 | |||
| 1663 | Ga0207659_10001548 | |||
| 1664 | Ga0207687_10004300 | |||
| 1665 | Ga0207644_10000007 | |||
| 1666 | Ga0207644_10000112 | |||
| 1667 | Ga0207644_10003240 | |||
| 1668 | Ga0207644_10032789 | |||
| 1669 | Ga0207644_10083105 | |||
| 1670 | Ga0207644_10692959 | |||
| 1671 | Ga0207690_10048615 | |||
| 1672 | Ga0207690_10058336 | |||
| 1673 | Ga0207690_10100517 | |||
| 1674 | Ga0207690_10177938 | |||
| 1675 | Ga0207690_10321198 | |||
| 1676 | Ga0207690_10420183 | |||
| 1677 | Ga0207690_10894151 | |||
| 1678 | Ga0207706_10002566 | |||
| 1679 | Ga0207706_10008580 | |||
| 1680 | Ga0207706_10045273 | |||
| 1681 | Ga0207706_10057010 | |||
| 1682 | Ga0207706_10059202 | |||
| 1683 | Ga0207706_10064667 | |||
| 1684 | Ga0207706_10081560 | |||
| 1685 | Ga0207686_10000178 | |||
| 1686 | Ga0207709_10000237 | |||
| 1687 | Ga0207709_10365883 | |||
| 1688 | Ga0207709_10459821 | |||
| 1689 | Ga0207670_10014687 | |||
| 1690 | Ga0207669_10008300 | |||
| 1691 | Ga0207669_10486132 | |||
| 1692 | Ga0207704_10000003 | |||
| 1693 | Ga0207691_10409382 | |||
| 1694 | Ga0207711_10000004 | |||
| 1695 | Ga0207711_10000075 | |||
| 1696 | Ga0207711_10198744 | |||
| 1697 | Ga0207711_10300786 | |||
| 1698 | Ga0207711_10787656 | |||
| 1699 | Ga0207711_10974078 | |||
| 1700 | Ga0207711_12029027 | |||
| 1701 | Ga0207689_10001512 | |||
| 1702 | Ga0207689_10401777 | |||
| 1703 | Ga0207689_11175008 | |||
| 1704 | Ga0207661_10539359 | |||
| 1705 | Ga0207661_10795915 | |||
| 1706 | Ga0207679_10503067 | |||
| 1707 | Ga0207679_10609976 | |||
| 1708 | Ga0207667_10000007 | |||
| 1709 | Ga0207667_10000825 | |||
| 1710 | Ga0207667_10053298 | |||
| 1711 | Ga0207667_10368324 | |||
| 1712 | Ga0207667_10387507 | |||
| 1713 | Ga0207667_10493180 | |||
| 1714 | Ga0207651_10000003 | |||
| 1715 | Ga0207651_10403117 | |||
| 1716 | Ga0207712_10000004 | |||
| 1717 | Ga0207712_10000161 | |||
| 1718 | Ga0207712_10008789 | |||
| 1719 | Ga0207712_10155829 | |||
| 1720 | Ga0207712_10239582 | |||
| 1721 | Ga0207712_10390537 | |||
| 1722 | Ga0207668_10000142 | |||
| 1723 | Ga0207668_10000186 | |||
| 1724 | Ga0207668_10000348 | |||
| 1725 | Ga0207668_10024299 | |||
| 1726 | Ga0207668_10058964 | |||
| 1727 | Ga0207668_10165219 | |||
| 1728 | Ga0207640_10000031 | |||
| 1729 | Ga0207640_10018606 | |||
| 1730 | Ga0207640_10026524 | |||
| 1731 | Ga0207640_10028518 | |||
| 1732 | Ga0207640_10058937 | |||
| 1733 | Ga0207640_10154731 | |||
| 1734 | Ga0207640_10313034 | |||
| 1735 | Ga0207658_10000034 | |||
| 1736 | Ga0207658_10000213 | |||
| 1737 | Ga0207658_10000309 | |||
| 1738 | Ga0207658_10000405 | |||
| 1739 | Ga0207658_10000462 | |||
| 1740 | Ga0207658_10005078 | |||
| 1741 | Ga0207658_10013403 | |||
| 1742 | Ga0207658_10335502 | |||
| 1743 | Ga0207677_10000194 | |||
| 1744 | Ga0207703_10000499 | |||
| 1745 | Ga0207703_10000918 | |||
| 1746 | Ga0207703_10003457 | |||
| 1747 | Ga0207703_10005021 | |||
| 1748 | Ga0207703_11043808 | |||
| 1749 | Ga0207639_10002175 | |||
| 1750 | Ga0207639_10017740 | |||
| 1751 | Ga0207639_10019235 | |||
| 1752 | Ga0207639_10052900 | |||
| 1753 | Ga0207639_10187889 | |||
| 1754 | Ga0207639_10305834 | |||
| 1755 | Ga0207639_10549495 | |||
| 1756 | Ga0207639_10588591 | |||
| 1757 | Ga0207678_10000095 | |||
| 1758 | Ga0207678_10000608 | |||
| 1759 | Ga0207678_10011244 | |||
| 1760 | Ga0207678_10332873 | |||
| 1761 | Ga0207702_10002411 | |||
| 1762 | Ga0207702_10007703 | |||
| 1763 | Ga0207702_10047819 | |||
| 1764 | Ga0207702_10174651 | |||
| 1765 | Ga0207702_10307887 | |||
| 1766 | Ga0207702_11842699 | |||
| 1767 | Ga0207702_12088482 | |||
| 1768 | Ga0207641_10000010 | |||
| 1769 | Ga0207641_10000239 | |||
| 1770 | Ga0207641_10000263 | |||
| 1771 | Ga0207641_10001750 | |||
| 1772 | Ga0207641_10049402 | |||
| 1773 | Ga0207641_10088779 | |||
| 1774 | Ga0207641_10110067 | |||
| 1775 | Ga0207641_10127601 | |||
| 1776 | Ga0207648_10000007 | |||
| 1777 | Ga0207648_11177217 | |||
| 1778 | Ga0207676_10000006 | |||
| 1779 | Ga0207676_10000046 | |||
| 1780 | Ga0207676_10000137 | |||
| 1781 | Ga0207676_10002267 | |||
| 1782 | Ga0207676_10006162 | |||
| 1783 | Ga0207676_10014115 | |||
| 1784 | Ga0207676_10042837 | |||
| 1785 | Ga0207674_10006156 | |||
| 1786 | Ga0207674_10019665 | |||
| 1787 | Ga0207674_10029230 | |||
| 1788 | Ga0207674_10077073 | |||
| 1789 | Ga0207674_10170099 | |||
| 1790 | Ga0207674_10880340 | |||
| 1791 | Ga0207675_100000131 | |||
| 1792 | Ga0207675_100000418 | |||
| 1793 | Ga0207675_100001453 | |||
| 1794 | Ga0207675_100675975 | |||
| 1795 | Ga0207675_101390528 | |||
| 1796 | Ga0207683_10003569 | |||
| 1797 | Ga0207683_10161557 | |||
| 1798 | Ga0207698_10000182 | |||
| 1799 | Ga0207698_10013572 | |||
| 1800 | Ga0207698_10039816 | |||
| 1801 | Ga0207698_10228613 | |||
| 1802 | Ga0207698_10359308 | |||
| 1803 | Ga0207698_10541139 | |||
| 1804 | Ga0207698_10607782 | |||
| 1805 | Ga0207698_11709090 | |||
| 1806 | Ga0209813_10000015 | |||
| 1807 | Ga0209974_10125950 | |||
| 1808 | Ga0268266_10000117 | |||
| 1809 | Ga0268266_10133476 | |||
| 1810 | Ga0268266_10222069 | |||
| 1811 | Ga0268266_10421260 | |||
| 1812 | Ga0268266_11263725 | |||
| 1813 | Ga0268266_11292241 | |||
| 1814 | Ga0268265_10000001 | |||
| 1815 | Ga0268265_10000026 | |||
| 1816 | Ga0268265_10000266 | |||
| 1817 | Ga0268265_10000918 | |||
| 1818 | Ga0268265_10005225 | |||
| 1819 | Ga0268265_10189552 | |||
| 1820 | Ga0268264_10000003 | |||
| 1821 | Ga0268264_10000075 | |||
| 1822 | Ga0268264_10000087 | |||
| 1823 | Ga0268264_10000106 | |||
| 1824 | Ga0268264_10028912 | |||
| 1825 | Ga0268264_11986481 | |||
| 1826 | Ga0307517_10216975 | |||
| 1827 | Ga0307517_10511980 | |||
| 1828 | Ga0307515_10489616 | |||
| 1829 | Ga0307513_10040972 | |||
| 1830 | Ga0307513_10041326 | |||
| 1831 | Ga0307408_100036775 | |||
| 1832 | Ga0307408_100103486 | |||
| 1833 | Ga0307408_100373938 | |||
| 1834 | Ga0307408_100692248 | |||
| 1835 | Ga0307405_10037630 | |||
| 1836 | Ga0307405_10122314 | |||
| 1837 | Ga0307405_10172309 | |||
| 1838 | Ga0307405_10182095 | |||
| 1839 | Ga0307405_10271163 | |||
| 1840 | Ga0307405_10305129 | |||
| 1841 | Ga0307405_10648899 | |||
| 1842 | Ga0307413_10221462 | |||
| 1843 | Ga0307413_11749120 | |||
| 1844 | Ga0307410_10156769 | |||
| 1845 | Ga0307410_10232303 | |||
| 1846 | Ga0307410_10285118 | |||
| 1847 | Ga0307410_11048892 | |||
| 1848 | Ga0307410_11534445 | |||
| 1849 | Ga0307406_10002984 | |||
| 1850 | Ga0307406_10276960 | |||
| 1851 | Ga0307406_10818011 | |||
| 1852 | Ga0307407_10210081 | |||
| 1853 | Ga0307407_10502609 | |||
| 1854 | Ga0307412_10000933 | |||
| 1855 | Ga0307412_10025608 | |||
| 1856 | Ga0307412_10069292 | |||
| 1857 | Ga0307412_10089335 | |||
| 1858 | Ga0307412_10134859 | |||
| 1859 | Ga0307412_10150498 | |||
| 1860 | Ga0307412_10696873 | |||
| 1861 | Ga0307412_11485099 | |||
| 1862 | Ga0307409_100045924 | |||
| 1863 | Ga0307409_101131920 | |||
| 1864 | Ga0307409_101240750 | |||
| 1865 | Ga0307416_100146446 | |||
| 1866 | Ga0307416_100174915 | |||
| 1867 | Ga0307416_100737875 | |||
| 1868 | Ga0307416_101126857 | |||
| 1869 | Ga0307414_10001776 | |||
| 1870 | Ga0307414_10013540 | |||
| 1871 | Ga0307414_10061999 | |||
| 1872 | Ga0307414_10214026 | |||
| 1873 | Ga0307414_10574121 | |||
| 1874 | Ga0307414_10816200 | |||
| 1875 | Ga0307414_10905217 | |||
| 1876 | Ga0307414_11381540 | |||
| 1877 | Ga0307414_11627641 | |||
| 1878 | Ga0307411_10034229 | |||
| 1879 | Ga0307411_10164427 | |||
| 1880 | Ga0307411_10343397 | |||
| 1881 | Ga0307411_10346620 | |||
| 1882 | Ga0307411_10381127 | |||
| 1883 | Ga0307411_10990954 | |||
| 1884 | Ga0307415_102121679 | |||
| 1885 | Ga0307510_10002511 | |||
| 1886 | Ga0307510_10145093 | |||
| 1887 | Ga0307510_10414759 | |||
| 1888 | Ga0373930_0189371 | |||
| 1889 | Ga0373946_0275961 | |||
| 1890 | Ga0373931_1087989 | |||
| 1891 | Ga0373927_0216911 | |||
| 1892 | Ga0373947_0195877 | |||
| 1893 | Ga0373925_0403645 | |||
| 1894 | Ga0395899_0004019 | |||
| 1895 | Ga0395900_0034599 | |||
| 1896 | Ga0395900_0184335 | |||
| 1897 | Ga0395898_0144521 | |||
| 1898 | Ga0395905_0114237 | |||
| 1899 | Ga0395901_0069561 | |||
| 1900 | Ga0395901_0201382 | |||
| 1901 | Ga0436363_1192622 | |||
| 1902 | Ga0436362_1167794 | |||
| 1903 | Ga0451789_0732163 | |||
| 1904 | Ga0451789_0744125 | |||
| 1905 | Ga0451789_1233599 | |||
| 1906 | Ga0451791_0600836 | |||
| 1907 | Ga0451795_1238003 | |||
| 1908 | Ga0451800_0373317 | |||
| 1909 | Ga0451833_0700584 | |||
| 1910 | Ga0451839_1504574 | |||
| 1911 | Ga0451851_1298683 | |||
| 1912 | Ga0451853_3049099 | |||
| 1913 | Ga0439448_0036066 | |||
| 1914 | Ga0439448_0203920 | |||
| 1915 | Ga0439450_055929 | |||
| 1916 | Ga0439455_0003092 | |||
| 1917 | Ga0439455_0007290 | |||
| 1918 | Ga0450890_026896 | |||
| 1919 | Ga0439458_0000183 | |||
| 1920 | Ga0439458_0038983 | |||
| 1921 | Ga0439458_0056306 | |||
| 1922 | Ga0466969_0044024 | |||
| 1923 | Ga0466972_0006177 | |||
| 1924 | Ga0466973_0276660 | |||
| 1925 | Ga0466965_0140424 | |||
| 1926 | Ga0466966_0016992 | |||
| 1927 | Ga0466961_0102193 | |||
| 1928 | Ga0466961_0188117 | |||
| 1929 | Ga0466963_0002342 | |||
| 1930 | Ga0466964_0029999 | |||
| 1931 | Ga0466971_0086613 | |||
| 1932 | Ga0466971_0086774 | |||
| 1933 | Ga0466968_0021345 | |||
| 1934 | Ga0466968_0050375 | |||
| 1935 | Ga0466968_0686042 | |||
| 1936 | Ga0466970_0076227 | |||
| 1937 | Ga0466970_0731958 | |||
| 1938 | Ga0466957_0224891 | |||
| 1939 | Ga0466957_0695571 | |||
| 1940 | Ga0466960_0011429 | |||
| 1941 | Ga0466959_0013984 | |||
| 1942 | Ga0466959_0133290 | |||
| 1943 | Ga0466958_0002202 | |||
| 1944 | Ga0466958_0014687 | |||
| 1945 | Ga0466958_0682025 | |||
| 1946 | Ga0466967_0007995 | |||
| 1947 | Ga0466967_0450090 | |||
| 1948 | Ga0495617_201093 | |||
| 1949 | Ga0495627_000216 | |||
| 1950 | Ga0495627_000273 | |||
| 1951 | Ga0495627_173357 | |||
| 1952 | Ga0495590_0089598 | |||
| 1953 | Ga0495638_0000051 | |||
| 1954 | Ga0495638_0000253 | |||
| 1955 | Ga0495650_0000861 | |||
| 1956 | Ga0495584_0119083 | |||
| 1957 | Ga0495583_0000422 | |||
| 1958 | Ga0495583_0009923 | |||
| 1959 | Ga0495583_0282605 | |||
| 1960 | Ga0495606_0152475 | |||
| 1961 | Ga0495610_0000311 | |||
| 1962 | Ga0495616_0000013 | |||
| 1963 | Ga0495632_0000357 | |||
| 1964 | Ga0495632_0000359 | |||
| 1965 | Ga0495637_0006811 | |||
| 1966 | Ga0495637_0012784 | |||
| 1967 | Ga0495637_0024023 | |||
| 1968 | Ga0495643_0000009 | |||
| 1969 | Ga0495643_0037629 | |||
| 1970 | Ga0495643_0100799 | |||
| 1971 | Ga0495648_0000032 | |||
| 1972 | Ga0495648_0001780 | |||
| 1973 | Ga0495648_0025654 | |||
| 1974 | Ga0495648_0031355 | |||
| 1975 | Ga0495648_0310992 | |||
| 1976 | Ga0495663_0000003 | |||
| 1977 | Ga0495663_0007553 | |||
| 1978 | Ga0495663_0008640 | |||
| 1979 | Ga0495654_0003985 | |||
| 1980 | Ga0495654_0019995 | |||
| 1981 | Ga0495654_0064205 | |||
| 1982 | Ga0495609_0275550 | |||
| 1983 | Ga0495597_0191305 | |||
| 1984 | Ga0495597_0209958 | |||
| 1985 | Ga0495622_0011529 | |||
| 1986 | Ga0495633_0000102 | |||
| 1987 | Ga0495633_0000786 | |||
| 1988 | Ga0495633_0025418 | |||
| 1989 | Ga0495633_0073717 | |||
| 1990 | Ga0495633_0076967 | |||
| 1991 | Ga0495633_0088784 | |||
| 1992 | Ga0495633_0289882 | |||
| 1993 | Ga0495668_0007526 | |||
| 1994 | Ga0495668_0017694 | |||
| 1995 | Ga0495668_0023881 | |||
| 1996 | Ga0495668_0062584 | |||
| 1997 | Ga0495668_0073328 | |||
| 1998 | Ga0495668_0121622 | |||
| 1999 | Ga0495611_0107889 | |||
| 2000 | Ga0495625_0000031 | |||
| 2001 | Ga0495625_0006969 | |||
| 2002 | Ga0495625_0008935 | |||
| 2003 | Ga0495625_0111092 | |||
| 2004 | Ga0495625_0148371 | |||
| 2005 | Ga0495625_0373816 | |||
| 2006 | Ga0495625_0433432 | |||
| 2007 | Ga0495669_0095356 | |||
| 2008 | Ga0495670_0008493 | |||
| 2009 | Ga0495670_0491773 | |||
| 2010 | Ga0495670_0572265 | |||
| 2011 | Ga0495670_0823298 | |||
| 2012 | Ga0495671_0000013 | |||
| 2013 | Ga0495671_0000020 | |||
| 2014 | Ga0495671_0001468 | |||
| 2015 | Ga0495649_0167227 | |||
| 2016 | Ga0495589_0027870 | |||
| 2017 | Ga0495672_0060682 | |||
| 2018 | Ga0495676_0532786 | |||
| 2019 | Ga0495683_0463540 | |||
| 2020 | Ga0495677_0014583 | |||
| 2021 | Ga0495677_0139659 | |||
| 2022 | Ga0495685_181100 | |||
| 2023 | Ga0495673_0000076 | |||
| 2024 | Ga0495673_0068055 | |||
| 2025 | Ga0495681_0000059 | |||
| 2026 | Ga0495681_0000202 | |||
| 2027 | Ga0495686_0000141 | |||
| 2028 | Ga0495686_0000238 | |||
| 2029 | Ga0495686_0002243 | |||
| 2030 | Ga0495686_0018319 | |||
| 2031 | Ga0495686_0026212 | |||
| 2032 | Ga0495686_0320197 | |||
| 2033 | Ga0495686_0350529 | |||
| 2034 | Ga0496100_0196852 | |||
| 2035 | Ga0496101_0016231 | |||
| 2036 | Ga0496102_0000036 | |||
| 2037 | Ga0496102_0009074 | |||
| 2038 | Ga0496102_0407214 | |||
| 2039 | Ga0496102_0857482 | |||
| 2040 | Ga0496102_1300882 | |||
| 2041 | Ga0496103_0000074 | |||
| 2042 | Ga0496103_0007440 | |||
| 2043 | Ga0496103_0023715 | |||
| 2044 | Ga0496103_0079884 | |||
| 2045 | Ga0496103_0185776 | |||
| 2046 | Ga0496103_0240120 | |||
| 2047 | Ga0496104_0753832 | |||
| 2048 | Ga0496105_0185147 | |||
| 2049 | Ga0496105_0213790 | |||
| 2050 | Ga0496106_0190164 | |||
| 2051 | Ga0496107_0037068 | |||
| 2052 | Ga0496107_0137154 | |||
| 2053 | Ga0496108_0003856 | |||
| 2054 | Ga0496108_0221697 | |||
| 2055 | Ga0496109_0003822 | |||
| 2056 | Ga0496110_0010100 | |||
| 2057 | Ga0496110_0049723 | |||
| 2058 | Ga0496110_0243283 | |||
| 2059 | Ga0496111_0039257 | |||
| 2060 | Ga0496111_0304629 | |||
| 2061 | Ga0496111_0406956 | |||
| 2062 | Ga0496111_1045172 | |||
| 2063 | Ga0496113_0074937 | |||
| 2064 | Ga0496114_0714791 | |||
| 2065 | Ga0496114_1377034 | |||
| 2066 | Ga0496116_0022703 | |||
| 2067 | Ga0496116_0024263 | |||
| 2068 | Ga0496116_0112777 | |||
| 2069 | Ga0496116_0174234 | |||
| 2070 | Ga0496117_0000093 | |||
| 2071 | Ga0496117_0005266 | |||
| 2072 | Ga0496117_0022206 | |||
| 2073 | Ga0496117_0032491 | |||
| 2074 | Ga0496117_0033745 | |||
| 2075 | Ga0496117_0064004 | |||
| 2076 | Ga0496117_0247277 | |||
| 2077 | Ga0496118_0000070 | |||
| 2078 | Ga0496118_0000416 | |||
| 2079 | Ga0496118_0008773 | |||
| 2080 | Ga0496118_0035449 | |||
| 2081 | Ga0496118_0039758 | |||
| 2082 | Ga0496118_0153844 | |||
| 2083 | Ga0496118_0220803 | |||
| 2084 | Ga0496118_0259246 | |||
| 2085 | Ga0496118_0274897 | |||
| 2086 | Ga0496118_0579343 | |||
| 2087 | Ga0496119_0036352 | |||
| 2088 | Ga0496119_0049559 | |||
| 2089 | Ga0496119_0049636 | |||
| 2090 | Ga0496119_0096446 | |||
| 2091 | Ga0496120_0055188 | |||
| 2092 | Ga0496120_0221952 | |||
| 2093 | Ga0496121_0000163 | |||
| 2094 | Ga0496121_0000880 | |||
| 2095 | Ga0496121_0001214 | |||
| 2096 | Ga0496121_0001608 | |||
| 2097 | Ga0496121_0047653 | |||
| 2098 | Ga0496121_0097100 | |||
| 2099 | Ga0496121_0097880 | |||
| 2100 | Ga0496121_0108596 | |||
| 2101 | Ga0496121_0139313 | |||
| 2102 | Ga0496121_0174019 | |||
| 2103 | Ga0496121_0296182 | |||
| 2104 | Ga0496122_0000176 | |||
| 2105 | Ga0496122_0010742 | |||
| 2106 | Ga0496122_0021362 | |||
| 2107 | Ga0496122_0436774 | |||
| 2108 | Ga0496123_0000220 | |||
| 2109 | Ga0496123_0029884 | |||
| 2110 | Ga0496123_0115289 | |||
| 2111 | Ga0496123_0185645 | |||
| 2112 | Ga0496123_0228841 | |||
| 2113 | Ga0496123_0295524 | |||
| 2114 | Ga0496124_0000225 | |||
| 2115 | Ga0496124_0003343 | |||
| 2116 | Ga0496124_0012464 | |||
| 2117 | Ga0496124_0128992 | |||
| 2118 | Ga0496124_0256786 | |||
| 2119 | Ga0496124_0310133 | |||
| 2120 | Ga0496124_0419095 | |||
| 2121 | Ga0496125_0008573 | |||
| 2122 | Ga0496125_0025087 | |||
| 2123 | Ga0496125_0042722 | |||
| 2124 | Ga0496125_0059858 | |||
| 2125 | Ga0496125_0149597 | |||
| 2126 | Ga0496125_0212925 | |||
| 2127 | Ga0496125_0251347 | |||
| 2128 | Ga0496125_0342385 | |||
| 2129 | Ga0496125_0576544 | |||
| 2130 | Ga0496126_0010605 | |||
| 2131 | Ga0496126_0011101 | |||
| 2132 | Ga0496126_0059986 | |||
| 2133 | Ga0496126_0252653 | |||
| 2134 | Ga0496126_0345432 | |||
| 2135 | Ga0496126_0806095 | |||
| 2136 | Ga0495682_0370095 | |||
| 2137 | Ga0501290_000401 | |||
| 2138 | Ga0501290_006423 | |||
| 2139 | Ga0501292_000049 | |||
| 2140 | Ga0501293_040770 | |||
| 2141 | Ga0501294_000131 | |||
| 2142 | Ga0501299_060454 | |||
| 2143 | Ga0501300_000260 | |||
| 2144 | Ga0501300_000689 | |||
| 2145 | Ga0501314_010069 | |||
| 2146 | Ga0501335_007702 | |||
| 2147 | Ga0501032_0482230 | |||
| 2148 | Ga0501033_0592962 | |||
| 2149 | Ga0501033_0790175 | |||
| 2150 | Ga0501034_0004038 | |||
| 2151 | Ga0501034_0037966 | |||
| 2152 | Ga0501034_0241441 | |||
| 2153 | Ga0501036_0231880 | |||
| 2154 | Ga0501037_0700054 | |||
| 2155 | Ga0501038_0199248 | |||
| 2156 | Ga0501039_0270408 | |||
| 2157 | Ga0501043_0070645 | |||
| 2158 | Ga0501043_0124196 | |||
| 2159 | Ga0501043_1323847 | |||
| 2160 | Ga0501047_0002660 | |||
| 2161 | Ga0501047_0303094 | |||
| 2162 | Ga0501047_0363946 | |||
| 2163 | Ga0501048_0067221 | |||
| 2164 | Ga0501069_0001144 | |||
| 2165 | Ga0501071_0237548 | |||
| 2166 | Ga0501198_003618 | |||
| 2167 | Ga0501202_017144 | |||
| 2168 | Ga0501207_022073 | |||
| 2169 | Ga0501211_037350 | |||
| 2170 | Ga0501222_000186 | |||
| 2171 | Ga0501223_000026 | |||
| 2172 | Ga0501223_000155 | |||
| 2173 | Ga0501223_000502 | |||
| 2174 | Ga0501223_007293 | |||
| 2175 | Ga0501223_013730 | |||
| 2176 | Ga0501224_000006 | |||
| 2177 | Ga0501224_000243 | |||
| 2178 | Ga0501224_028771 | |||
| 2179 | Ga0501227_009170 | |||
| 2180 | Ga0501233_000373 | |||
| 2181 | Ga0501233_079369 | |||
| 2182 | Ga0501235_004175 | |||
| 2183 | Ga0501235_005975 | |||
| 2184 | Ga0501246_012043 | |||
| 2185 | Ga0501249_061921 | |||
| 2186 | Ga0501257_000014 | |||
| 2187 | Ga0501259_003276 | |||
| 2188 | Ga0501261_000013 | |||
| 2189 | Ga0501221_002894 | |||
| 2190 | Ga0501225_0000129 | |||
| 2191 | Ga0501225_0000164 | |||
| 2192 | Ga0501225_0012404 | |||
| 2193 | Ga0501229_012275 | |||
| 2194 | Ga0501245_002452 | |||
| 2195 | Ga0501245_005990 | |||
| 2196 | Ga0501080_0534872 | |||
| 2197 | Ga0501241_009319 | |||
| 2198 | Ga0501278_010491 | |||
| 2199 | Ga0501279_000017 | |||
| 2200 | Ga0501280_000015 | |||
| 2201 | Ga0501280_001970 | |||
| 2202 | Ga0501281_00053 | |||
| 2203 | Ga0501282_000557 | |||
| 2204 | Ga0501035_0898978 | |||
| 2205 | Ga0501035_1276269 | |||
| 2206 | Ga0501044_0003361 | |||
| 2207 | Ga0501044_0234100 | |||
| 2208 | Ga0501204_074564 | |||
| 2209 | Ga0501212_101646 | |||
| 2210 | Ga0501226_000041 | |||
| 2211 | Ga0501226_020454 | |||
| 2212 | nmdc:mga03n38_2083_c1 | |||
| 2213 | nmdc:mga00v17_363493_c1 | |||
| 2214 | nmdc:mga06z11_69_c1 | |||
| 2215 | nmdc:mga04h51_116_c1 | |||
| 2216 | nmdc:mga07m45_119069_c1 | |||
| 2217 | nmdc:mga07m45_33591_c1 | |||
| 2218 | nmdc:mga07m45_559499_c1 | |||
| 2219 | nmdc:mga0sz30_184575_c1 | |||
| 2220 | Ga0495601_0891215 | |||
| 2221 | Ga0500635_0270068 | |||
| 2222 | Ga0495619_0871968 | |||
| 2223 | Ga0500643_000151 | |||
| 2224 | Ga0500643_000242 | |||
| 2225 | Ga0500643_000348 | |||
| 2226 | Ga0500643_000471 | |||
| 2227 | Ga0500643_000628 | |||
| 2228 | Ga0500643_002009 | |||
| 2229 | Ga0500643_097267 | |||
| 2230 | Ga0500643_180149 | |||
| 2231 | Ga0500644_0096104 | |||
| 2232 | Ga0500644_0276246 | |||
| 2233 | Ga0500646_0374147 | |||
| 2234 | Ga0500647_0110793 | |||
| 2235 | Ga0500647_0302306 | |||
| 2236 | Ga0500651_0001723 | |||
| 2237 | Ga0500566_0119319 | |||
| 2238 | Ga0500641_0440304 | |||
| 2239 | Ga0500556_0000025 | |||
| 2240 | Ga0500562_037090 | |||
| 2241 | Ga0500592_000037 | |||
| 2242 | Ga0500592_002732 | |||
| 2243 | Ga0500592_002889 | |||
| 2244 | Ga0500593_154804 | |||
| 2245 | Ga0500594_0006394 | |||
| 2246 | Ga0500642_0000001 | |||
| 2247 | Ga0500642_0002903 | |||
| 2248 | Ga0500652_202890 | |||
| 2249 | Ga0500655_011783 | |||
| 2250 | Ga0500658_0002052 | |||
| 2251 | Ga0500658_0156648 | |||
| 2252 | Ga0500559_0011994 | |||
| 2253 | Ga0500559_0021863 | |||
| 2254 | Ga0500559_0029654 | |||
| 2255 | Ga0500559_0113736 | |||
| 2256 | Ga0500568_0045317 | |||
| 2257 | Ga0500568_0182185 | |||
| 2258 | Ga0500573_0000010 | |||
| 2259 | Ga0500573_0296822 | |||
| 2260 | Ga0500573_0508188 | |||
| 2261 | Ga0500577_0045158 | |||
| 2262 | Ga0500590_053507 | |||
| 2263 | Ga0500604_0002377 | |||
| 2264 | Ga0500604_0005821 | |||
| 2265 | Ga0500604_0032864 | |||
| 2266 | Ga0500604_0096251 | |||
| 2267 | Ga0500604_0096993 | |||
| 2268 | Ga0500616_0007814 | |||
| 2269 | Ga0500616_0091162 | |||
| 2270 | Ga0500616_0259593 | |||
| 2271 | Ga0500622_0017836 | |||
| 2272 | Ga0500622_0237033 | |||
| 2273 | Ga0500622_0422613 | |||
| 2274 | Ga0500624_000026 | |||
| 2275 | Ga0500624_000058 | |||
| 2276 | Ga0500627_0000411 | |||
| 2277 | Ga0500627_0000731 | |||
| 2278 | Ga0500627_0003404 | |||
| 2279 | Ga0500627_0102669 | |||
| 2280 | Ga0500627_0239955 | |||
| 2281 | Ga0500627_0466807 | |||
| 2282 | Ga0500636_0000920 | |||
| 2283 | Ga0500636_0084556 | |||
| 2284 | Ga0500636_0121211 | |||
| 2285 | Ga0500570_022799 | |||
| 2286 | Ga0500611_013745 | |||
| 2287 | Ga0500645_000355 | |||
| 2288 | Ga0500645_046727 | |||
| 2289 | Ga0500645_089855 | |||
| 2290 | Ga0500596_008569 | |||
| 2291 | Ga0500661_000136 | |||
| 2292 | Ga0501082_0874047 | |||
| 2293 | Ga0466962_0016119 | |||
| 2294 | Ga0466962_0183745 | |||
| 2295 | 2512645549 | |||
| 2296 | 2585260411 | |||
| 2297 | 2643729127 | |||
| 2298 | 2644038611 | |||
| 2299 | 2644045140 | |||
| 2300 | 2644391312 | |||
| 2301 | 2778126231 | |||
| 2302 | 2809063216 | |||
| 2303 | 2809079349 | |||
| 2304 | 2809083278 | |||
| 2305 | 2830075926 | |||
| 2306 | 2880520485 | |||
| 2307 | 2885432081 | |||
| 2308 | 2919710726 | |||
| 2309 | 2928028841 | |||
| 2310 | 2984556397 | |||
| 2311 | 2984565414 | |||
| 2312 | 2990268949 | |||
| 2313 | 2993356506 | |||
| 2314 | 2993697239 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tt9-assembly2.cif.gz_C | structure of the c-terminal spoa domain of shigella flexneri spa33 | 0.5869 | 46 | 94 |
| 7uq3-assembly1.cif.gz_A | jmjc domain-containing protein 5 (jmjd5) in complex with mn and (s)-2-(1-hydroxy-2,5-dioxopyrrolidin-3-yl)acetic acid | 0.5776 | 17 | 64 |
| 3uep-assembly1.cif.gz_B | crystal structure of yscq-c from yersinia pseudotuberculosis | 0.5726 | 24 | 94 |
| 3m7u-assembly1.cif.gz_A | crystal structure of alpha-lytic protease sb1+2 r64a/e182q mutant | 0.5608 | 29 | 95 |
| 1o9y-assembly1.cif.gz_B | crystal structure of the c-terminal domain of the hrcqb protein from pseudomonas syringae pv. phaseolicola | 0.5495 | 24 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ff6D02 | Mainly Beta;Beta Barrel;ClpP/crotonase fold;Biotin dependent carboxylase carboxyltransferase | 0.8254 | 73 | 96 | 2.40.460.10 |
| 2x24A02 | Mainly Beta;Beta Barrel;ClpP/crotonase fold;Biotin dependent carboxylase carboxyltransferase | 0.7879 | 74 | 94 | 2.40.460.10 |
| af_Q7G9P4_276_397_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.7557 | 23 | 49 | 3.30.465.10 |
| af_P81312_3_70_2.40.10.230 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Probable tRNA pseudouridine synthase domain | 0.588 | 48 | 93 | 2.40.10.230 |
| 3uepB00 | Mainly Beta;Roll;Surface presentation of antigens (SPOA);SpoA-like | 0.5726 | 24 | 94 | 2.30.330.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A496RS26-F1-model_v4 | Flagellar motor switch protein FliN-like C-terminal domain-containing protein | 0.8069 | 10 | 94 |
GO:0005886
GO:0006935 GO:0097588 |
| AF-A0A2N9MWJ5-F1-model_v4 | Flagellar motor switch protein FliN | 0.7503 | 1 | 99 |
|
| AF-A0A2N9MWJ5-F1-model_v4 | Flagellar motor switch protein FliN | 0.6996 | 1 | 99 |
|
| AF-A0A3L7V3X4-F1-model_v4 | FliM/FliN family flagellar motor switch protein | 0.6753 | 3 | 98 |
GO:0005886
GO:0006935 GO:0097588 |
| AF-A0A2V9N341-F1-model_v4 | Flagellar motor switch protein FliM | 0.6751 | 2 | 98 |
GO:0000160
GO:0003677 GO:0003774 GO:0005886 GO:0006355 GO:0009425 GO:0050918 GO:0071978 |