F490953

General Info

Members Datasets Scaffolds Average Seq Length
1157 425 2314 106

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_102009464|Ga0097621_1020094642
Length 100
Sequence MNDMAGGFAPQESGDGALAANFRLLQDVDVKLTVEIGSTSLTLRELLALGETSVIELDRQANELLDVLVNGTLIGRGEVVMVGDRFGVRMTELVTPDKRA

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
104 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
122 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
223 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
231 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
232 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
233 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
283 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
284 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
312 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
313 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
314 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
315 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
316 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
317 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
318 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
333 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
334 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
335 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
336 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
337 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
338 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
339 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
340 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
341 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
342 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
343 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
344 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
345 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
346 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
347 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
348 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
349 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
350 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
353 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
354 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
355 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
356 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
357 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
361 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
362 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
373 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
374 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
375 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
376 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
379 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
380 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
381 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
382 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
383 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
384 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
385 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
386 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
387 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
388 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
391 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
392 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
393 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
396 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
397 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
398 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
399 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
400 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
401 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
402 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
403 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
406 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
407 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
408 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
409 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
410 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
411 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
412 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
413 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
414 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
415 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
416 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
417 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
418 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
419 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
420 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
421 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
422 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
423 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
424 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
425 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.17
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 8.9
Nodule 0
Rhizoplane 3.28
Rhizosphere 79.43
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_102009464 3300006237 Bacteria 552
2 SwRhRL2b_contig_200884 2162886007 Unclassified 1129
3 SwRhRL2b_contig_682763 2162886007 Bacteria 1245
4 JGI24034J14986_100946 3300001432 Bacteria 1707
5 JGI24736J21556_1000015 3300001904 Bacteria 28999
6 JGI24736J21556_1000379 3300001904 Bacteria 8429
7 JGI24736J21556_1041369 3300001904 Bacteria 708
8 JGI24741J21665_1000200 3300001915 Bacteria 17725
9 JGI24741J21665_1007687 3300001915 Bacteria 2079
10 JGI24752J21851_1000029 3300001976 Bacteria 16885
11 JGI24752J21851_1000343 3300001976 Bacteria 6470
12 JGI24752J21851_1033475 3300001976 Bacteria 681
13 JGI24740J21852_10005510 3300001979 Bacteria 5343
14 JGI24740J21852_10021799 3300001979 Bacteria 2215
15 JGI24740J21852_10066980 3300001979 Bacteria 973
16 JGI24740J21852_10070938 3300001979 Bacteria 934
17 JGI24739J22299_10007450 3300001989 Bacteria 4106
18 JGI24739J22299_10013160 3300001989 Bacteria 3027
19 JGI24739J22299_10016802 3300001989 Bacteria 2646
20 JGI24739J22299_10035566 3300001989 Bacteria 1687
21 JGI24739J22299_10062228 3300001989 Bacteria 1177
22 JGI24739J22299_10149173 3300001989 Bacteria 692
23 JGI24737J22298_10000844 3300001990 Bacteria 10918
24 JGI24737J22298_10002091 3300001990 Bacteria 7133
25 JGI24737J22298_10019795 3300001990 Bacteria 2152
26 JGI24737J22298_10046085 3300001990 Bacteria 1331
27 JGI24737J22298_10075128 3300001990 Bacteria 1007
28 JGI24743J22301_10025233 3300001991 Bacteria 1151
29 JGI24735J21928_10000451 3300002067 Bacteria 14425
30 JGI24735J21928_10003995 3300002067 Bacteria 4990
31 JGI24735J21928_10004623 3300002067 Bacteria 4607
32 JGI24735J21928_10038022 3300002067 Bacteria 1409
33 JGI24750J21931_1000259 3300002070 Bacteria 9019
34 JGI24748J21848_1000023 3300002074 Bacteria 106523
35 JGI24748J21848_1023771 3300002074 Bacteria 744
36 JGI24738J21930_10000728 3300002075 Bacteria 9474
37 JGI24738J21930_10000824 3300002075 Bacteria 8877
38 JGI24738J21930_10002030 3300002075 Bacteria 5429
39 JGI24738J21930_10071374 3300002075 Bacteria 720
40 JGI24749J21850_1001696 3300002076 Bacteria 3122
41 JGI24744J21845_10003312 3300002077 Bacteria 3307
42 JGI24035J26624_1002255 3300002126 Bacteria 1802
43 JGI24034J26672_10000010 3300002239 Bacteria 150746
44 JGI24034J26672_10005447 3300002239 Bacteria 1825
45 JGI24034J26672_10008951 3300002239 Bacteria 1471
46 JGI24742J22300_10000537 3300002244 Bacteria 5673
47 JGI24751J29686_10056506 3300002459 Bacteria 809
48 JGI25165J46597_1000124 3300003214 Bacteria 131341
49 rootH1_10081084 3300003316 Bacteria 3221
50 Ga0055542_1001963 3300003762 Bacteria 7991
51 Ga0055542_1028623 3300003762 Bacteria 732
52 Ga0055530_10000485 3300003791 Bacteria 34524
53 Ga0055531_10000524 3300003794 Bacteria 34477
54 Ga0065165_1063338 3300005262 Bacteria 1005
55 Ga0065704_10005679 3300005289 Bacteria 3736
56 Ga0065704_10074420 3300005289 Bacteria 6283
57 Ga0065704_10093669 3300005289 Bacteria 2584
58 Ga0065707_10027121 3300005295 Bacteria 1717
59 Ga0065707_10082699 3300005295 Bacteria 12652
60 Ga0065707_10100815 3300005295 Unclassified 2903
61 Ga0065707_10153765 3300005295 Bacteria 1630
62 Ga0065707_10160566 3300005295 Bacteria 1567
63 Ga0065707_10665677 3300005295 Bacteria 656
64 Ga0070658_10000050 3300005327 Bacteria 119052
65 Ga0070658_10000057 3300005327 Bacteria 113572
66 Ga0070658_10008422 3300005327 Bacteria 8294
67 Ga0070658_10104912 3300005327 Bacteria 2338
68 Ga0070658_10646559 3300005327 Bacteria 917
69 Ga0070658_10704415 3300005327 Bacteria 876
70 Ga0070676_10001112 3300005328 Bacteria 13442
71 Ga0070676_10255743 3300005328 Bacteria 1171
72 Ga0070683_100049964 3300005329 Bacteria 3869
73 Ga0070683_101112413 3300005329 Bacteria 759
74 Ga0070670_100000003 3300005331 Bacteria 529510
75 Ga0070670_100000135 3300005331 Bacteria 69478
76 Ga0070670_100000815 3300005331 Bacteria 24294
77 Ga0070670_100001203 3300005331 Bacteria 20550
78 Ga0070670_100056819 3300005331 Bacteria 3359
79 Ga0070670_100126486 3300005331 Bacteria 2206
80 Ga0070670_101133684 3300005331 Bacteria 714
81 Ga0068869_100000528 3300005334 Bacteria 21287
82 Ga0068869_100432191 3300005334 Bacteria 1088
83 Ga0070666_10000009 3300005335 Bacteria 279209
84 Ga0070666_10000115 3300005335 Bacteria 55609
85 Ga0070666_10004754 3300005335 Bacteria 8296
86 Ga0070666_10027244 3300005335 Bacteria 3741
87 Ga0070682_100143730 3300005337 Bacteria 1629
88 Ga0068868_100000074 3300005338 Bacteria 58620
89 Ga0070660_100002838 3300005339 Bacteria 11930
90 Ga0070660_100004367 3300005339 Bacteria 9762
91 Ga0070660_100008583 3300005339 Bacteria 7155
92 Ga0070660_100013497 3300005339 Bacteria 5861
93 Ga0070660_100056725 3300005339 Bacteria 3031
94 Ga0070660_100058458 3300005339 Bacteria 2988
95 Ga0070660_100957382 3300005339 Bacteria 723
96 Ga0070689_101607124 3300005340 Bacteria 590
97 Ga0070687_100185112 3300005343 Bacteria 1250
98 Ga0070661_100043344 3300005344 Bacteria 3286
99 Ga0070661_100056833 3300005344 Bacteria 2867
100 Ga0070661_100111742 3300005344 Bacteria 2041
101 Ga0070661_100467201 3300005344 Bacteria 1006
102 Ga0070668_100000117 3300005347 Bacteria 48801
103 Ga0070668_100000119 3300005347 Bacteria 48651
104 Ga0070668_100008086 3300005347 Bacteria 7812
105 Ga0070668_100025713 3300005347 Bacteria 4465
106 Ga0070668_100124001 3300005347 Bacteria 2068
107 Ga0070668_100216084 3300005347 Bacteria 1579
108 Ga0070668_100435792 3300005347 Bacteria 1124
109 Ga0070668_102128782 3300005347 Bacteria 518
110 Ga0070669_100000004 3300005353 Bacteria 314707
111 Ga0070669_100000017 3300005353 Bacteria 195995
112 Ga0070669_100000020 3300005353 Bacteria 181297
113 Ga0070669_100021925 3300005353 Bacteria 4568
114 Ga0070669_100048028 3300005353 Bacteria 3115
115 Ga0070669_101973825 3300005353 Bacteria 510
116 Ga0070675_100000482 3300005354 Bacteria 27236
117 Ga0070675_100491535 3300005354 Bacteria 1105
118 Ga0070671_100000004 3300005355 Bacteria 262155
119 Ga0070671_100000426 3300005355 Bacteria 29399
120 Ga0070671_100012098 3300005355 Bacteria 6944
121 Ga0070671_100014451 3300005355 Bacteria 6380
122 Ga0070671_100673147 3300005355 Bacteria 897
123 Ga0070674_100014876 3300005356 Bacteria 4843
124 Ga0070674_100803879 3300005356 Bacteria 812
125 Ga0070674_100963512 3300005356 Bacteria 747
126 Ga0070673_100000008 3300005364 Bacteria 166844
127 Ga0070673_100792423 3300005364 Bacteria 875
128 Ga0070688_100010711 3300005365 Bacteria 5066
129 Ga0070688_100296952 3300005365 Unclassified 1166
130 Ga0070659_100015151 3300005366 Bacteria 5767
131 Ga0070659_100037194 3300005366 Bacteria 3794
132 Ga0070659_100065464 3300005366 Bacteria 2878
133 Ga0070659_100221119 3300005366 Bacteria 1563
134 Ga0070659_100435276 3300005366 Bacteria 1110
135 Ga0070659_100478239 3300005366 Bacteria 1060
136 Ga0070667_100000016 3300005367 Bacteria 237028
137 Ga0070667_100000113 3300005367 Bacteria 104015
138 Ga0070667_100000357 3300005367 Bacteria 49937
139 Ga0070667_100000969 3300005367 Bacteria 26391
140 Ga0070667_100002047 3300005367 Bacteria 17855
141 Ga0070667_100014603 3300005367 Bacteria 6489
142 Ga0070667_100373346 3300005367 Bacteria 1294
143 Ga0070667_101141709 3300005367 Bacteria 729
144 Ga0070667_101248868 3300005367 Bacteria 696
145 Ga0070667_101302372 3300005367 Bacteria 681
146 Ga0070705_100058395 3300005440 Bacteria 2280
147 Ga0070708_100213171 3300005445 Bacteria 1810
148 Ga0070663_100008375 3300005455 Bacteria 6355
149 Ga0070663_100175974 3300005455 Bacteria 1657
150 Ga0070663_100184030 3300005455 Bacteria 1622
151 Ga0070663_100206062 3300005455 Bacteria 1537
152 Ga0070663_100297134 3300005455 Bacteria 1291
153 Ga0070678_100003552 3300005456 Bacteria 8698
154 Ga0070678_100302164 3300005456 Bacteria 1360
155 Ga0070662_100009993 3300005457 Bacteria 6213
156 Ga0070662_100038291 3300005457 Bacteria 3406
157 Ga0070662_100054299 3300005457 Bacteria 2903
158 Ga0070662_100256482 3300005457 Bacteria 1407
159 Ga0070662_100263336 3300005457 Bacteria 1389
160 Ga0070662_101539970 3300005457 Bacteria 573
161 Ga0068867_100000003 3300005459 Bacteria 217886
162 Ga0068867_100558914 3300005459 Bacteria 992
163 Ga0070685_10000291 3300005466 Bacteria 31615
164 Ga0070685_10773857 3300005466 Bacteria 705
165 Ga0070707_100950460 3300005468 Bacteria 824
166 Ga0070679_100653556 3300005530 Bacteria 994
167 Ga0070684_100671317 3300005535 Bacteria 965
168 Ga0068853_100000408 3300005539 Bacteria 29530
169 Ga0068853_100049504 3300005539 Bacteria 3611
170 Ga0068853_100129707 3300005539 Bacteria 2256
171 Ga0068853_100155785 3300005539 Bacteria 2059
172 Ga0068853_100220351 3300005539 Bacteria 1732
173 Ga0068853_100381375 3300005539 Bacteria 1316
174 Ga0068853_101232667 3300005539 Bacteria 722
175 Ga0070672_100419806 3300005543 Bacteria 1149
176 Ga0070672_101399494 3300005543 Bacteria 626
177 Ga0070686_100000041 3300005544 Bacteria 104174
178 Ga0070693_100082827 3300005547 Bacteria 1916
179 Ga0070693_100290623 3300005547 Bacteria 1098
180 Ga0070665_100000368 3300005548 Bacteria 67541
181 Ga0070665_100129628 3300005548 Bacteria 2524
182 Ga0070665_100227729 3300005548 Bacteria 1864
183 Ga0070665_100651920 3300005548 Bacteria 1066
184 Ga0068855_100003895 3300005563 Bacteria 18224
185 Ga0068855_100325483 3300005563 Bacteria 1698
186 Ga0068855_100364233 3300005563 Bacteria 1590
187 Ga0068855_100493147 3300005563 Bacteria 1332
188 Ga0068855_100580485 3300005563 Bacteria 1211
189 Ga0068855_100780631 3300005563 Bacteria 1017
190 Ga0068855_100783044 3300005563 Bacteria 1015
191 Ga0068855_101533168 3300005563 Bacteria 683
192 Ga0070664_100041964 3300005564 Bacteria 3862
193 Ga0070664_100054636 3300005564 Bacteria 3389
194 Ga0070664_100185252 3300005564 Bacteria 1852
195 Ga0070664_101974678 3300005564 Bacteria 554
196 Ga0068857_100026906 3300005577 Bacteria 5072
197 Ga0068857_100037444 3300005577 Bacteria 4297
198 Ga0068857_100073026 3300005577 Bacteria 3056
199 Ga0068857_100079335 3300005577 Bacteria 2930
200 Ga0068857_100084504 3300005577 Bacteria 2836
201 Ga0068857_100131683 3300005577 Bacteria 2256
202 Ga0068857_100150957 3300005577 Bacteria 2105
203 Ga0068854_100001318 3300005578 Bacteria 14977
204 Ga0068854_100010079 3300005578 Bacteria 6119
205 Ga0068854_100018727 3300005578 Bacteria 4653
206 Ga0068854_100049284 3300005578 Bacteria 3008
207 Ga0068854_100098886 3300005578 Bacteria 2184
208 Ga0068854_100130300 3300005578 Bacteria 1920
209 Ga0068854_101221017 3300005578 Bacteria 674
210 Ga0068856_100003087 3300005614 Bacteria 17012
211 Ga0068856_100021580 3300005614 Bacteria 6258
212 Ga0068856_100180410 3300005614 Bacteria 2124
213 Ga0068856_100896913 3300005614 Bacteria 905
214 Ga0068856_101454313 3300005614 Bacteria 699
215 Ga0068856_101937912 3300005614 Bacteria 600
216 Ga0068856_101942530 3300005614 Bacteria 599
217 Ga0068852_100002299 3300005616 Bacteria 13144
218 Ga0068852_100031099 3300005616 Bacteria 4401
219 Ga0068852_100132840 3300005616 Bacteria 2294
220 Ga0068852_100193270 3300005616 Bacteria 1922
221 Ga0068852_100342914 3300005616 Bacteria 1457
222 Ga0068852_100615321 3300005616 Bacteria 1091
223 Ga0068852_100780069 3300005616 Bacteria 969
224 Ga0068852_100886793 3300005616 Bacteria 909
225 Ga0068852_101820514 3300005616 Bacteria 631
226 Ga0068859_100000233 3300005617 Bacteria 54852
227 Ga0068859_100003392 3300005617 Bacteria 16213
228 Ga0068859_100035740 3300005617 Bacteria 4986
229 Ga0068859_100055791 3300005617 Bacteria 3975
230 Ga0068859_100162429 3300005617 Bacteria 2313
231 Ga0068859_100433024 3300005617 Bacteria 1412
232 Ga0068859_100936126 3300005617 Bacteria 950
233 Ga0068859_102377425 3300005617 Bacteria 584
234 Ga0068864_100000005 3300005618 Bacteria 400840
235 Ga0068864_100000191 3300005618 Bacteria 55913
236 Ga0068864_100000798 3300005618 Bacteria 26391
237 Ga0068864_100001033 3300005618 Bacteria 23327
238 Ga0068864_100005449 3300005618 Bacteria 10436
239 Ga0068864_100006140 3300005618 Bacteria 9854
240 Ga0068864_100057140 3300005618 Bacteria 3371
241 Ga0068861_100006153 3300005719 Bacteria 8162
242 Ga0068861_100007109 3300005719 Bacteria 7660
243 Ga0068861_100200940 3300005719 Bacteria 1673
244 Ga0068861_101376968 3300005719 Bacteria 688
245 Ga0068851_10005533 3300005834 Bacteria 5725
246 Ga0068851_10058089 3300005834 Bacteria 1976
247 Ga0068851_10109605 3300005834 Bacteria 1473
248 Ga0068870_10138802 3300005840 Bacteria 1420
249 Ga0068863_100000132 3300005841 Bacteria 78811
250 Ga0068863_100000166 3300005841 Bacteria 71068
251 Ga0068863_100005052 3300005841 Bacteria 13009
252 Ga0068863_100014467 3300005841 Bacteria 7598
253 Ga0068863_100026394 3300005841 Bacteria 5542
254 Ga0068863_100196458 3300005841 Bacteria 1939
255 Ga0068863_100285874 3300005841 Bacteria 1598
256 Ga0068863_101076647 3300005841 Bacteria 808
257 Ga0068858_100000288 3300005842 Bacteria 54436
258 Ga0068858_100000291 3300005842 Bacteria 54242
259 Ga0068858_100036066 3300005842 Bacteria 4585
260 Ga0068858_100039517 3300005842 Bacteria 4374
261 Ga0068858_100321273 3300005842 Bacteria 1479
262 Ga0068860_100000022 3300005843 Bacteria 279209
263 Ga0068860_100000215 3300005843 Bacteria 90561
264 Ga0068860_100000256 3300005843 Bacteria 78477
265 Ga0068860_100035312 3300005843 Bacteria 4795
266 Ga0068860_100039119 3300005843 Bacteria 4537
267 Ga0068862_100000001 3300005844 Bacteria 523031
268 Ga0068862_100000151 3300005844 Bacteria 78811
269 Ga0068862_100000346 3300005844 Bacteria 50307
270 Ga0068862_100000581 3300005844 Bacteria 38018
271 Ga0068862_100000596 3300005844 Bacteria 37603
272 Ga0068862_100202785 3300005844 Bacteria 1789
273 Ga0081455_10000049 3300005937 Bacteria 126459
274 Ga0081455_10301827 3300005937 Bacteria 1148
275 Ga0081539_10022573 3300005985 Bacteria 4158
276 Ga0075368_10000139 3300006042 Bacteria 19177
277 Ga0075363_100002110 3300006048 Bacteria 7973
278 Ga0075364_10245609 3300006051 Bacteria 1216
279 Ga0075367_10017797 3300006178 Bacteria 3907
280 Ga0075366_10105588 3300006195 Bacteria 1693
281 Ga0075366_10899607 3300006195 Bacteria 551
282 Ga0097621_100026787 3300006237 Bacteria 4527
283 Ga0075370_10031127 3300006353 Bacteria 2978
284 Ga0075370_10035043 3300006353 Bacteria 2815
285 Ga0075370_10610688 3300006353 Bacteria 661
286 Ga0068871_100003615 3300006358 Bacteria 10621
287 Ga0068865_100000002 3300006881 Bacteria 285745
288 Ga0068865_100858645 3300006881 Bacteria 787
289 Ga0097620_100000233 3300006931 Bacteria 54852
290 Ga0097620_100003392 3300006931 Bacteria 16213
291 Ga0097620_100035739 3300006931 Bacteria 4986
292 Ga0097620_100055791 3300006931 Bacteria 3975
293 Ga0097620_100162424 3300006931 Bacteria 2313
294 Ga0097620_100433012 3300006931 Bacteria 1412
295 Ga0097620_100936300 3300006931 Bacteria 950
296 Ga0097620_102376612 3300006931 Bacteria 584
297 Ga0105251_10000264 3300009011 Bacteria 52208
298 Ga0105251_10015469 3300009011 Bacteria 4168
299 Ga0105251_10038670 3300009011 Bacteria 2336
300 Ga0105251_10646565 3300009011 Bacteria 505
301 Ga0105240_10056330 3300009093 Bacteria 4920
302 Ga0105240_10091245 3300009093 Bacteria 3723
303 Ga0105240_10113964 3300009093 Bacteria 3266
304 Ga0105240_10439268 3300009093 Bacteria 1462
305 Ga0105240_11321680 3300009093 Bacteria 760
306 Ga0105245_10000184 3300009098 Bacteria 58946
307 Ga0105247_10000989 3300009101 Bacteria 21433
308 Ga0105247_10003404 3300009101 Bacteria 10393
309 Ga0105247_10382478 3300009101 Bacteria 998
310 Ga0105247_10396008 3300009101 Bacteria 983
311 Ga0105247_10406811 3300009101 Bacteria 971
312 Ga0105247_11378572 3300009101 Bacteria 570
313 Ga0114129_10250889 3300009147 Bacteria 2375
314 Ga0105243_10000031 3300009148 Bacteria 185825
315 Ga0105243_10290320 3300009148 Bacteria 1477
316 Ga0105243_10438223 3300009148 Bacteria 1223
317 Ga0105241_10002989 3300009174 Bacteria 12624
318 Ga0105241_10052516 3300009174 Bacteria 3112
319 Ga0105241_11147730 3300009174 Bacteria 734
320 Ga0105242_10000171 3300009176 Bacteria 49237
321 Ga0105248_10000012 3300009177 Bacteria 333963
322 Ga0105248_10000192 3300009177 Bacteria 70644
323 Ga0105248_10003135 3300009177 Bacteria 18295
324 Ga0105248_10028054 3300009177 Bacteria 6270
325 Ga0105248_10217454 3300009177 Bacteria 2152
326 Ga0105248_10324045 3300009177 Bacteria 1735
327 Ga0105248_10352642 3300009177 Bacteria 1656
328 Ga0105248_10467294 3300009177 Bacteria 1422
329 Ga0105248_12712317 3300009177 Bacteria 565
330 Ga0105237_10002820 3300009545 Bacteria 21127
331 Ga0105237_10068927 3300009545 Bacteria 3532
332 Ga0105237_10073893 3300009545 Bacteria 3401
333 Ga0105237_10112662 3300009545 Bacteria 2713
334 Ga0105238_10030882 3300009551 Bacteria 5452
335 Ga0105238_10152857 3300009551 Bacteria 2283
336 Ga0105238_10421315 3300009551 Bacteria 1330
337 Ga0105238_10522637 3300009551 Bacteria 1189
338 Ga0105238_10546884 3300009551 Bacteria 1162
339 Ga0105249_10000014 3300009553 Bacteria 283274
340 Ga0105249_10000099 3300009553 Bacteria 119885
341 Ga0105249_10000699 3300009553 Bacteria 30440
342 Ga0105249_10017636 3300009553 Bacteria 6339
343 Ga0105249_10244793 3300009553 Bacteria 1775
344 Ga0105249_10331263 3300009553 Bacteria 1536
345 Ga0105249_10738720 3300009553 Bacteria 1046
346 Ga0105249_10751522 3300009553 Bacteria 1037
347 Ga0105148_100092 3300009978 Bacteria 14396
348 Ga0105147_101503 3300009982 Bacteria 1908
349 Ga0105239_10000451 3300010375 Bacteria 59882
350 Ga0105239_10028478 3300010375 Bacteria 6144
351 Ga0105239_10149947 3300010375 Bacteria 2602
352 Ga0105239_10361584 3300010375 Bacteria 1639
353 Ga0105239_10516815 3300010375 Bacteria 1358
354 Ga0105239_10600086 3300010375 Bacteria 1256
355 Ga0105246_10000056 3300011119 Bacteria 45044
356 Ga0105246_10283343 3300011119 Bacteria 1330
357 Ga0157326_1000375 3300012513 Bacteria 5328
358 Ga0157373_10008588 3300013100 Bacteria 7586
359 Ga0157373_10051976 3300013100 Bacteria 2917
360 Ga0157373_10074440 3300013100 Bacteria 2396
361 Ga0157373_10151590 3300013100 Bacteria 1630
362 Ga0157373_10171969 3300013100 Bacteria 1524
363 Ga0157373_10509271 3300013100 Bacteria 870
364 Ga0157371_10086710 3300013102 Bacteria 2217
365 Ga0157371_10184773 3300013102 Bacteria 1492
366 Ga0157371_11155234 3300013102 Bacteria 595
367 Ga0157370_10000080 3300013104 Bacteria 105872
368 Ga0157370_10003119 3300013104 Bacteria 19629
369 Ga0157370_10083609 3300013104 Bacteria 3001
370 Ga0157370_10372884 3300013104 Bacteria 1315
371 Ga0157370_10925981 3300013104 Bacteria 790
372 Ga0157369_10042446 3300013105 Bacteria 4961
373 Ga0157369_10055589 3300013105 Bacteria 4272
374 Ga0157369_10068286 3300013105 Bacteria 3818
375 Ga0157369_10167917 3300013105 Bacteria 2313
376 Ga0157369_11065092 3300013105 Bacteria 827
377 Ga0157369_12621612 3300013105 Bacteria 509
378 Ga0157374_10000184 3300013296 Bacteria 58278
379 Ga0157374_10041949 3300013296 Bacteria 4219
380 Ga0157378_10000205 3300013297 Bacteria 57706
381 Ga0163162_10002879 3300013306 Bacteria 16380
382 Ga0163162_10013910 3300013306 Bacteria 7860
383 Ga0163162_10117460 3300013306 Bacteria 2761
384 Ga0163162_10159072 3300013306 Bacteria 2380
385 Ga0163162_10209195 3300013306 Bacteria 2080
386 Ga0163162_10350467 3300013306 Bacteria 1609
387 Ga0163162_10377805 3300013306 Bacteria 1550
388 Ga0163162_11061666 3300013306 Bacteria 917
389 Ga0157372_10064970 3300013307 Bacteria 4096
390 Ga0157372_10075492 3300013307 Bacteria 3804
391 Ga0157372_10078364 3300013307 Bacteria 3733
392 Ga0157372_10498080 3300013307 Bacteria 1421
393 Ga0157372_11433170 3300013307 Bacteria 796
394 Ga0157372_11765392 3300013307 Bacteria 712
395 Ga0157375_10080217 3300013308 Bacteria 3301
396 Ga0157375_10729144 3300013308 Bacteria 1143
397 Ga0163163_10025413 3300014325 Bacteria 5645
398 Ga0163163_10067038 3300014325 Bacteria 3567
399 Ga0163163_10223664 3300014325 Bacteria 1931
400 Ga0163163_10471431 3300014325 Bacteria 1316
401 Ga0163163_10721878 3300014325 Bacteria 1060
402 Ga0157380_10000107 3300014326 Bacteria 45379
403 Ga0157380_10000350 3300014326 Bacteria 27615
404 Ga0157380_10001483 3300014326 Bacteria 15349
405 Ga0157380_10034350 3300014326 Bacteria 3911
406 Ga0157379_10034748 3300014968 Bacteria 4496
407 Ga0157379_10057086 3300014968 Bacteria 3489
408 Ga0157379_10058471 3300014968 Bacteria 3447
409 Ga0157379_12119996 3300014968 Bacteria 557
410 Ga0157376_10000148 3300014969 Bacteria 48325
411 Ga0157376_12617527 3300014969 Bacteria 544
412 Ga0183363_1007 3300015690 Bacteria 315687
413 Ga0183361_10472 3300016635 Bacteria 1749
414 Ga0163161_10000860 3300017792 Bacteria 23679
415 Ga0163161_10030187 3300017792 Bacteria 3856
416 Ga0163161_10030480 3300017792 Bacteria 3840
417 Ga0163161_10300304 3300017792 Bacteria 1264
418 Ga0163161_10603456 3300017792 Bacteria 905
419 Ga0163161_10758566 3300017792 Bacteria 812
420 Ga0207672_1002763 3300025223 Bacteria 1031
421 Ga0209147_101130 3300025229 Bacteria 10971
422 Ga0207427_101618 3300025231 Bacteria 7641
423 Ga0209026_1002559 3300025250 Bacteria 6711
424 Ga0209148_1000112 3300025254 Bacteria 197101
425 Ga0209148_1000974 3300025254 Bacteria 18589
426 Ga0209233_1000189 3300025261 Bacteria 131465
427 Ga0209455_1001147 3300025272 Bacteria 12788
428 Ga0207673_1004543 3300025290 Bacteria 1663
429 Ga0209050_1000832 3300025298 Bacteria 42754
430 Ga0209257_1000929 3300025304 Bacteria 40568
431 Ga0209257_1048009 3300025304 Bacteria 1224
432 Ga0207697_10000101 3300025315 Bacteria 39230
433 Ga0207697_10009818 3300025315 Bacteria 4115
434 Ga0207697_10203779 3300025315 Bacteria 871
435 Ga0207656_10004950 3300025321 Bacteria 4680
436 Ga0207656_10178021 3300025321 Bacteria 1019
437 Ga0207713_1001017 3300025735 Bacteria 24423
438 Ga0207710_10004035 3300025900 Bacteria 6460
439 Ga0207710_10367134 3300025900 Bacteria 735
440 Ga0207710_10372457 3300025900 Bacteria 730
441 Ga0207710_10477319 3300025900 Bacteria 646
442 Ga0207688_10367906 3300025901 Bacteria 888
443 Ga0207680_10000007 3300025903 Bacteria 623574
444 Ga0207680_10000078 3300025903 Bacteria 43793
445 Ga0207680_10017766 3300025903 Bacteria 3764
446 Ga0207680_10018003 3300025903 Bacteria 3744
447 Ga0207680_10234188 3300025903 Bacteria 1263
448 Ga0207680_11142866 3300025903 Bacteria 556
449 Ga0207647_10000323 3300025904 Bacteria 39393
450 Ga0207647_10004162 3300025904 Bacteria 10729
451 Ga0207647_10010729 3300025904 Bacteria 6452
452 Ga0207647_10318710 3300025904 Bacteria 883
453 Ga0207645_10001019 3300025907 Bacteria 23155
454 Ga0207645_10491252 3300025907 Bacteria 831
455 Ga0207645_10775422 3300025907 Bacteria 652
456 Ga0207705_10000014 3300025909 Bacteria 434286
457 Ga0207705_10000145 3300025909 Bacteria 76141
458 Ga0207705_10193347 3300025909 Bacteria 1539
459 Ga0207705_10327551 3300025909 Bacteria 1177
460 Ga0207654_10000521 3300025911 Bacteria 22010
461 Ga0207654_10025400 3300025911 Bacteria 3196
462 Ga0207695_10004592 3300025913 Bacteria 18760
463 Ga0207695_10015825 3300025913 Bacteria 8860
464 Ga0207695_10075373 3300025913 Bacteria 3433
465 Ga0207695_10821677 3300025913 Bacteria 809
466 Ga0207695_10989976 3300025913 Bacteria 720
467 Ga0207671_10000740 3300025914 Bacteria 41467
468 Ga0207671_10001130 3300025914 Bacteria 32130
469 Ga0207671_10050539 3300025914 Bacteria 3078
470 Ga0207671_10206859 3300025914 Bacteria 1534
471 Ga0207671_10426551 3300025914 Bacteria 1055
472 Ga0207662_10211064 3300025918 Bacteria 1260
473 Ga0207657_10001736 3300025919 Bacteria 23488
474 Ga0207657_10010116 3300025919 Bacteria 9428
475 Ga0207657_10013912 3300025919 Bacteria 7874
476 Ga0207657_10022481 3300025919 Bacteria 5896
477 Ga0207657_10054229 3300025919 Bacteria 3468
478 Ga0207657_10058524 3300025919 Bacteria 3315
479 Ga0207649_10060326 3300025920 Bacteria 2383
480 Ga0207649_10128672 3300025920 Bacteria 1717
481 Ga0207649_10307869 3300025920 Bacteria 1160
482 Ga0207649_10794313 3300025920 Bacteria 738
483 Ga0207652_10893322 3300025921 Bacteria 785
484 Ga0207646_10478627 3300025922 Bacteria 1123
485 Ga0207681_10000005 3300025923 Bacteria 555724
486 Ga0207681_10000010 3300025923 Bacteria 403379
487 Ga0207681_10000029 3300025923 Bacteria 177260
488 Ga0207681_10007837 3300025923 Bacteria 6539
489 Ga0207681_10009997 3300025923 Bacteria 5807
490 Ga0207681_10162446 3300025923 Bacteria 1685
491 Ga0207681_10401826 3300025923 Bacteria 1107
492 Ga0207694_10002569 3300025924 Bacteria 14737
493 Ga0207694_10021154 3300025924 Bacteria 4926
494 Ga0207694_10044490 3300025924 Bacteria 3428
495 Ga0207694_10123314 3300025924 Bacteria 2070
496 Ga0207694_10151946 3300025924 Bacteria 1866
497 Ga0207694_10448556 3300025924 Bacteria 1077
498 Ga0207694_11145990 3300025924 Bacteria 658
499 Ga0207650_10000004 3300025925 Bacteria 743372
500 Ga0207650_10000182 3300025925 Bacteria 73032
501 Ga0207650_10006854 3300025925 Bacteria 7770
502 Ga0207650_10079934 3300025925 Bacteria 2477
503 Ga0207650_10137542 3300025925 Bacteria 1918
504 Ga0207650_10143934 3300025925 Bacteria 1876
505 Ga0207650_11343351 3300025925 Bacteria 608
506 Ga0207659_10001548 3300025926 Bacteria 13651
507 Ga0207687_10004300 3300025927 Bacteria 9508
508 Ga0207644_10000007 3300025931 Bacteria 381778
509 Ga0207644_10000112 3300025931 Bacteria 60600
510 Ga0207644_10003240 3300025931 Bacteria 10491
511 Ga0207644_10032789 3300025931 Bacteria 3627
512 Ga0207644_10083105 3300025931 Bacteria 2370
513 Ga0207644_10692959 3300025931 Bacteria 849
514 Ga0207690_10048615 3300025932 Bacteria 2822
515 Ga0207690_10058336 3300025932 Bacteria 2611
516 Ga0207690_10100517 3300025932 Bacteria 2064
517 Ga0207690_10177938 3300025932 Bacteria 1599
518 Ga0207690_10321198 3300025932 Bacteria 1217
519 Ga0207690_10420183 3300025932 Bacteria 1069
520 Ga0207690_10894151 3300025932 Bacteria 736
521 Ga0207706_10002566 3300025933 Bacteria 17713
522 Ga0207706_10008580 3300025933 Bacteria 9417
523 Ga0207706_10045273 3300025933 Bacteria 3899
524 Ga0207706_10057010 3300025933 Bacteria 3442
525 Ga0207706_10059202 3300025933 Bacteria 3373
526 Ga0207706_10064667 3300025933 Bacteria 3221
527 Ga0207706_10081560 3300025933 Bacteria 2842
528 Ga0207686_10000178 3300025934 Bacteria 48947
529 Ga0207709_10000237 3300025935 Bacteria 69190
530 Ga0207709_10365883 3300025935 Bacteria 1093
531 Ga0207709_10459821 3300025935 Bacteria 985
532 Ga0207670_10014687 3300025936 Bacteria 4657
533 Ga0207669_10008300 3300025937 Bacteria 4866
534 Ga0207669_10486132 3300025937 Bacteria 985
535 Ga0207704_10000003 3300025938 Bacteria 285808
536 Ga0207691_10409382 3300025940 Bacteria 1156
537 Ga0207711_10000004 3300025941 Bacteria 870636
538 Ga0207711_10000075 3300025941 Bacteria 106870
539 Ga0207711_10198744 3300025941 Bacteria 1829
540 Ga0207711_10300786 3300025941 Bacteria 1480
541 Ga0207711_10787656 3300025941 Bacteria 886
542 Ga0207711_10974078 3300025941 Bacteria 787
543 Ga0207711_12029027 3300025941 Bacteria 518
544 Ga0207689_10001512 3300025942 Bacteria 22142
545 Ga0207689_10401777 3300025942 Bacteria 1142
546 Ga0207689_11175008 3300025942 Bacteria 646
547 Ga0207661_10539359 3300025944 Bacteria 1068
548 Ga0207661_10795915 3300025944 Bacteria 870
549 Ga0207679_10503067 3300025945 Bacteria 1081
550 Ga0207679_10609976 3300025945 Bacteria 984
551 Ga0207667_10000007 3300025949 Bacteria 630590
552 Ga0207667_10000825 3300025949 Bacteria 40050
553 Ga0207667_10053298 3300025949 Bacteria 4257
554 Ga0207667_10368324 3300025949 Bacteria 1465
555 Ga0207667_10387507 3300025949 Bacteria 1423
556 Ga0207667_10493180 3300025949 Bacteria 1243
557 Ga0207651_10000003 3300025960 Bacteria 308050
558 Ga0207651_10403117 3300025960 Bacteria 1164
559 Ga0207712_10000004 3300025961 Bacteria 614655
560 Ga0207712_10000161 3300025961 Bacteria 69260
561 Ga0207712_10008789 3300025961 Bacteria 6388
562 Ga0207712_10155829 3300025961 Bacteria 1769
563 Ga0207712_10239582 3300025961 Bacteria 1460
564 Ga0207712_10390537 3300025961 Bacteria 1167
565 Ga0207668_10000142 3300025972 Bacteria 48783
566 Ga0207668_10000186 3300025972 Bacteria 42321
567 Ga0207668_10000348 3300025972 Bacteria 30042
568 Ga0207668_10024299 3300025972 Bacteria 3909
569 Ga0207668_10058964 3300025972 Bacteria 2686
570 Ga0207668_10165219 3300025972 Bacteria 1729
571 Ga0207640_10000031 3300025981 Bacteria 120815
572 Ga0207640_10018606 3300025981 Bacteria 4085
573 Ga0207640_10026524 3300025981 Bacteria 3519
574 Ga0207640_10028518 3300025981 Bacteria 3414
575 Ga0207640_10058937 3300025981 Bacteria 2532
576 Ga0207640_10154731 3300025981 Bacteria 1689
577 Ga0207640_10313034 3300025981 Bacteria 1247
578 Ga0207658_10000034 3300025986 Bacteria 155561
579 Ga0207658_10000213 3300025986 Bacteria 60739
580 Ga0207658_10000309 3300025986 Bacteria 49982
581 Ga0207658_10000405 3300025986 Bacteria 41161
582 Ga0207658_10000462 3300025986 Bacteria 38001
583 Ga0207658_10005078 3300025986 Bacteria 9056
584 Ga0207658_10013403 3300025986 Bacteria 5600
585 Ga0207658_10335502 3300025986 Bacteria 1313
586 Ga0207677_10000194 3300026023 Bacteria 48709
587 Ga0207703_10000499 3300026035 Bacteria 40585
588 Ga0207703_10000918 3300026035 Bacteria 28700
589 Ga0207703_10003457 3300026035 Bacteria 13224
590 Ga0207703_10005021 3300026035 Bacteria 10728
591 Ga0207703_11043808 3300026035 Bacteria 785
592 Ga0207639_10002175 3300026041 Bacteria 13196
593 Ga0207639_10017740 3300026041 Bacteria 5047
594 Ga0207639_10019235 3300026041 Bacteria 4867
595 Ga0207639_10052900 3300026041 Bacteria 3096
596 Ga0207639_10187889 3300026041 Bacteria 1763
597 Ga0207639_10305834 3300026041 Bacteria 1407
598 Ga0207639_10549495 3300026041 Bacteria 1060
599 Ga0207639_10588591 3300026041 Bacteria 1025
600 Ga0207678_10000095 3300026067 Bacteria 73553
601 Ga0207678_10000608 3300026067 Bacteria 32746
602 Ga0207678_10011244 3300026067 Bacteria 7858
603 Ga0207678_10332873 3300026067 Bacteria 1307
604 Ga0207702_10002411 3300026078 Bacteria 17783
605 Ga0207702_10007703 3300026078 Bacteria 9147
606 Ga0207702_10047819 3300026078 Bacteria 3606
607 Ga0207702_10174651 3300026078 Bacteria 1973
608 Ga0207702_10307887 3300026078 Bacteria 1505
609 Ga0207702_11842699 3300026078 Bacteria 597
610 Ga0207702_12088482 3300026078 Bacteria 556
611 Ga0207641_10000010 3300026088 Bacteria 402193
612 Ga0207641_10000239 3300026088 Bacteria 71088
613 Ga0207641_10000263 3300026088 Bacteria 66525
614 Ga0207641_10001750 3300026088 Bacteria 20940
615 Ga0207641_10049402 3300026088 Bacteria 3554
616 Ga0207641_10088779 3300026088 Bacteria 2700
617 Ga0207641_10110067 3300026088 Bacteria 2440
618 Ga0207641_10127601 3300026088 Bacteria 2279
619 Ga0207648_10000007 3300026089 Bacteria 217865
620 Ga0207648_11177217 3300026089 Bacteria 720
621 Ga0207676_10000006 3300026095 Bacteria 681936
622 Ga0207676_10000046 3300026095 Bacteria 149037
623 Ga0207676_10000137 3300026095 Bacteria 63867
624 Ga0207676_10002267 3300026095 Bacteria 13798
625 Ga0207676_10006162 3300026095 Bacteria 8468
626 Ga0207676_10014115 3300026095 Bacteria 5738
627 Ga0207676_10042837 3300026095 Bacteria 3482
628 Ga0207674_10006156 3300026116 Bacteria 14169
629 Ga0207674_10019665 3300026116 Bacteria 7312
630 Ga0207674_10029230 3300026116 Bacteria 5805
631 Ga0207674_10077073 3300026116 Bacteria 3340
632 Ga0207674_10170099 3300026116 Bacteria 2133
633 Ga0207674_10880340 3300026116 Bacteria 863
634 Ga0207675_100000131 3300026118 Bacteria 62791
635 Ga0207675_100000418 3300026118 Bacteria 41021
636 Ga0207675_100001453 3300026118 Bacteria 23738
637 Ga0207675_100675975 3300026118 Bacteria 1040
638 Ga0207675_101390528 3300026118 Bacteria 722
639 Ga0207683_10003569 3300026121 Bacteria 13566
640 Ga0207683_10161557 3300026121 Bacteria 2025
641 Ga0207698_10000182 3300026142 Bacteria 38622
642 Ga0207698_10013572 3300026142 Bacteria 5383
643 Ga0207698_10039816 3300026142 Bacteria 3485
644 Ga0207698_10228613 3300026142 Bacteria 1687
645 Ga0207698_10359308 3300026142 Bacteria 1379
646 Ga0207698_10541139 3300026142 Bacteria 1140
647 Ga0207698_10607782 3300026142 Bacteria 1079
648 Ga0207698_11709090 3300026142 Bacteria 645
649 Ga0209813_10000015 3300027866 Bacteria 83882
650 Ga0209974_10125950 3300027876 Bacteria 911
651 Ga0268266_10000117 3300028379 Bacteria 163515
652 Ga0268266_10133476 3300028379 Bacteria 2222
653 Ga0268266_10222069 3300028379 Bacteria 1737
654 Ga0268266_10421260 3300028379 Bacteria 1265
655 Ga0268266_11263725 3300028379 Bacteria 713
656 Ga0268266_11292241 3300028379 Bacteria 705
657 Ga0268265_10000001 3300028380 Bacteria 1230727
658 Ga0268265_10000026 3300028380 Bacteria 246653
659 Ga0268265_10000266 3300028380 Bacteria 59618
660 Ga0268265_10000918 3300028380 Bacteria 27252
661 Ga0268265_10005225 3300028380 Bacteria 8890
662 Ga0268265_10189552 3300028380 Bacteria 1774
663 Ga0268264_10000003 3300028381 Bacteria 1141976
664 Ga0268264_10000075 3300028381 Bacteria 256011
665 Ga0268264_10000087 3300028381 Bacteria 236696
666 Ga0268264_10000106 3300028381 Bacteria 210031
667 Ga0268264_10028912 3300028381 Bacteria 4538
668 Ga0268264_11986481 3300028381 Bacteria 591
669 Ga0307517_10216975 3300028786 Bacteria 1168
670 Ga0307517_10511980 3300028786 Bacteria 608
671 Ga0307515_10489616 3300028794 Bacteria 841
672 Ga0307513_10040972 3300031456 Bacteria 5116
673 Ga0307513_10041326 3300031456 Bacteria 5090
674 Ga0307408_100036775 3300031548 Bacteria 3443
675 Ga0307408_100103486 3300031548 Bacteria 2173
676 Ga0307408_100373938 3300031548 Bacteria 1216
677 Ga0307408_100692248 3300031548 Bacteria 915
678 Ga0307405_10037630 3300031731 Bacteria 2909
679 Ga0307405_10122314 3300031731 Bacteria 1783
680 Ga0307405_10172309 3300031731 Bacteria 1545
681 Ga0307405_10182095 3300031731 Bacteria 1509
682 Ga0307405_10271163 3300031731 Bacteria 1272
683 Ga0307405_10305129 3300031731 Bacteria 1209
684 Ga0307405_10648899 3300031731 Bacteria 868
685 Ga0307413_10221462 3300031824 Bacteria 1382
686 Ga0307413_11749120 3300031824 Bacteria 555
687 Ga0307410_10156769 3300031852 Bacteria 1701
688 Ga0307410_10232303 3300031852 Bacteria 1425
689 Ga0307410_10285118 3300031852 Bacteria 1297
690 Ga0307410_11048892 3300031852 Bacteria 705
691 Ga0307410_11534445 3300031852 Bacteria 587
692 Ga0307406_10002984 3300031901 Bacteria 9222
693 Ga0307406_10276960 3300031901 Bacteria 1277
694 Ga0307406_10818011 3300031901 Bacteria 787
695 Ga0307407_10210081 3300031903 Bacteria 1310
696 Ga0307407_10502609 3300031903 Bacteria 889
697 Ga0307412_10000933 3300031911 Bacteria 16724
698 Ga0307412_10025608 3300031911 Bacteria 3655
699 Ga0307412_10069292 3300031911 Bacteria 2400
700 Ga0307412_10089335 3300031911 Bacteria 2151
701 Ga0307412_10134859 3300031911 Bacteria 1799
702 Ga0307412_10150498 3300031911 Bacteria 1716
703 Ga0307412_10696873 3300031911 Bacteria 871
704 Ga0307412_11485099 3300031911 Bacteria 616
705 Ga0307409_100045924 3300031995 Bacteria 3302
706 Ga0307409_101131920 3300031995 Bacteria 805
707 Ga0307409_101240750 3300031995 Bacteria 769
708 Ga0307416_100146446 3300032002 Bacteria 2157
709 Ga0307416_100174915 3300032002 Bacteria 2004
710 Ga0307416_100737875 3300032002 Bacteria 1076
711 Ga0307416_101126857 3300032002 Bacteria 889
712 Ga0307414_10001776 3300032004 Bacteria 11167
713 Ga0307414_10013540 3300032004 Bacteria 4860
714 Ga0307414_10061999 3300032004 Bacteria 2651
715 Ga0307414_10214026 3300032004 Bacteria 1577
716 Ga0307414_10574121 3300032004 Unclassified 1008
717 Ga0307414_10816200 3300032004 Bacteria 851
718 Ga0307414_10905217 3300032004 Bacteria 809
719 Ga0307414_11381540 3300032004 Bacteria 654
720 Ga0307414_11627641 3300032004 Bacteria 602
721 Ga0307411_10034229 3300032005 Bacteria 3159
722 Ga0307411_10164427 3300032005 Bacteria 1666
723 Ga0307411_10343397 3300032005 Bacteria 1214
724 Ga0307411_10346620 3300032005 Bacteria 1209
725 Ga0307411_10381127 3300032005 Bacteria 1160
726 Ga0307411_10990954 3300032005 Bacteria 752
727 Ga0307415_102121679 3300032126 Bacteria 549
728 Ga0307510_10002511 3300033180 Bacteria 20892
729 Ga0307510_10145093 3300033180 Bacteria 2008
730 Ga0307510_10414759 3300033180 Bacteria 789
731 Ga0373930_0189371 3300034816 Bacteria 531
732 Ga0373946_0275961 3300035171 Bacteria 826
733 Ga0373931_1087989 3300035691 Bacteria 544
734 Ga0373927_0216911 3300035695 Bacteria 1257
735 Ga0373947_0195877 3300035725 Bacteria 1320
736 Ga0373925_0403645 3300037068 Bacteria 1115
737 Ga0395899_0004019 3300037312 Bacteria 11593
738 Ga0395900_0034599 3300037418 Bacteria 5204
739 Ga0395900_0184335 3300037418 Bacteria 2119
740 Ga0395898_0144521 3300037466 Bacteria 2277
741 Ga0395905_0114237 3300037471 Bacteria 2537
742 Ga0395901_0069561 3300038443 Bacteria 3666
743 Ga0395901_0201382 3300038443 Bacteria 2087
744 Ga0436363_1192622 3300039450 Bacteria 926
745 Ga0436362_1167794 3300039453 Bacteria 780
746 Ga0451789_0732163 3300041443 Bacteria 944
747 Ga0451789_0744125 3300041443 Bacteria 605
748 Ga0451789_1233599 3300041443 Bacteria 943
749 Ga0451791_0600836 3300041451 Bacteria 579
750 Ga0451795_1238003 3300041456 Bacteria 997
751 Ga0451800_0373317 3300041459 Bacteria 612
752 Ga0451833_0700584 3300041491 Bacteria 727
753 Ga0451839_1504574 3300041496 Bacteria 1052
754 Ga0451851_1298683 3300041507 Bacteria 753
755 Ga0451853_3049099 3300041512 Bacteria 593
756 Ga0439448_0036066 3300042005 Bacteria 1585
757 Ga0439448_0203920 3300042005 Bacteria 693
758 Ga0439450_055929 3300042008 Bacteria 946
759 Ga0439455_0003092 3300042012 Bacteria 3130
760 Ga0439455_0007290 3300042012 Bacteria 2334
761 Ga0450890_026896 3300042127 Bacteria 803
762 Ga0439458_0000183 3300042157 Bacteria 14213
763 Ga0439458_0038983 3300042157 Bacteria 1149
764 Ga0439458_0056306 3300042157 Bacteria 976
765 Ga0466969_0044024 3300044656 Bacteria 2223
766 Ga0466972_0006177 3300044658 Bacteria 6020
767 Ga0466973_0276660 3300044659 Bacteria 1152
768 Ga0466965_0140424 3300044683 Bacteria 1257
769 Ga0466966_0016992 3300044684 Bacteria 4809
770 Ga0466961_0102193 3300044693 Bacteria 1805
771 Ga0466961_0188117 3300044693 Bacteria 1280
772 Ga0466963_0002342 3300044694 Bacteria 10570
773 Ga0466964_0029999 3300044706 Bacteria 2150
774 Ga0466971_0086613 3300044719 Bacteria 1432
775 Ga0466971_0086774 3300044719 Bacteria 1430
776 Ga0466968_0021345 3300044735 Bacteria 2621
777 Ga0466968_0050375 3300044735 Bacteria 1777
778 Ga0466968_0686042 3300044735 Bacteria 522
779 Ga0466970_0076227 3300044765 Bacteria 1806
780 Ga0466970_0731958 3300044765 Bacteria 578
781 Ga0466957_0224891 3300044842 Bacteria 1240
782 Ga0466957_0695571 3300044842 Bacteria 717
783 Ga0466960_0011429 3300044901 Bacteria 3714
784 Ga0466959_0013984 3300045049 Bacteria 5826
785 Ga0466959_0133290 3300045049 Bacteria 1760
786 Ga0466958_0002202 3300045836 Bacteria 9708
787 Ga0466958_0014687 3300045836 Bacteria 4472
788 Ga0466958_0682025 3300045836 Bacteria 669
789 Ga0466967_0007995 3300045976 Bacteria 7701
790 Ga0466967_0450090 3300045976 Bacteria 1258
791 Ga0495617_201093 3300046452 Bacteria 623
792 Ga0495627_000216 3300046453 Bacteria 62618
793 Ga0495627_000273 3300046453 Bacteria 52157
794 Ga0495627_173357 3300046453 Unclassified 598
795 Ga0495590_0089598 3300046457 Bacteria 1088
796 Ga0495638_0000051 3300046460 Bacteria 206003
797 Ga0495638_0000253 3300046460 Bacteria 72446
798 Ga0495650_0000861 3300046471 Bacteria 36461
799 Ga0495584_0119083 3300046491 Bacteria 1337
800 Ga0495583_0000422 3300046506 Bacteria 64011
801 Ga0495583_0009923 3300046506 Bacteria 5629
802 Ga0495583_0282605 3300046506 Bacteria 661
803 Ga0495606_0152475 3300046507 Bacteria 1355
804 Ga0495610_0000311 3300046512 Bacteria 51569
805 Ga0495616_0000013 3300046513 Bacteria 202334
806 Ga0495632_0000357 3300046519 Bacteria 43422
807 Ga0495632_0000359 3300046519 Bacteria 43288
808 Ga0495637_0006811 3300046520 Bacteria 5717
809 Ga0495637_0012784 3300046520 Bacteria 4006
810 Ga0495637_0024023 3300046520 Bacteria 2759
811 Ga0495643_0000009 3300046522 Bacteria 344767
812 Ga0495643_0037629 3300046522 Bacteria 2653
813 Ga0495643_0100799 3300046522 Bacteria 1480
814 Ga0495648_0000032 3300046524 Bacteria 205970
815 Ga0495648_0001780 3300046524 Bacteria 20723
816 Ga0495648_0025654 3300046524 Bacteria 3986
817 Ga0495648_0031355 3300046524 Bacteria 3501
818 Ga0495648_0310992 3300046524 Bacteria 734
819 Ga0495663_0000003 3300046525 Bacteria 362694
820 Ga0495663_0007553 3300046525 Bacteria 3008
821 Ga0495663_0008640 3300046525 Bacteria 2825
822 Ga0495654_0003985 3300046530 Bacteria 8885
823 Ga0495654_0019995 3300046530 Bacteria 3496
824 Ga0495654_0064205 3300046530 Bacteria 1756
825 Ga0495609_0275550 3300046538 Bacteria 689
826 Ga0495597_0191305 3300046542 Bacteria 823
827 Ga0495597_0209958 3300046542 Bacteria 777
828 Ga0495622_0011529 3300046557 Bacteria 4085
829 Ga0495633_0000102 3300046558 Bacteria 115655
830 Ga0495633_0000786 3300046558 Bacteria 28391
831 Ga0495633_0025418 3300046558 Bacteria 2917
832 Ga0495633_0073717 3300046558 Bacteria 1591
833 Ga0495633_0076967 3300046558 Bacteria 1553
834 Ga0495633_0088784 3300046558 Bacteria 1437
835 Ga0495633_0289882 3300046558 Bacteria 744
836 Ga0495668_0007526 3300046616 Bacteria 6950
837 Ga0495668_0017694 3300046616 Bacteria 4128
838 Ga0495668_0023881 3300046616 Bacteria 3481
839 Ga0495668_0062584 3300046616 Bacteria 2050
840 Ga0495668_0073328 3300046616 Bacteria 1880
841 Ga0495668_0121622 3300046616 Bacteria 1428
842 Ga0495611_0107889 3300046648 Bacteria 1295
843 Ga0495625_0000031 3300046660 Bacteria 238193
844 Ga0495625_0006969 3300046660 Bacteria 9966
845 Ga0495625_0008935 3300046660 Bacteria 8468
846 Ga0495625_0111092 3300046660 Bacteria 1873
847 Ga0495625_0148371 3300046660 Bacteria 1578
848 Ga0495625_0373816 3300046660 Bacteria 896
849 Ga0495625_0433432 3300046660 Unclassified 815
850 Ga0495669_0095356 3300046684 Bacteria 1378
851 Ga0495670_0008493 3300046691 Bacteria 5054
852 Ga0495670_0491773 3300046691 Bacteria 666
853 Ga0495670_0572265 3300046691 Bacteria 615
854 Ga0495670_0823298 3300046691 Bacteria 507
855 Ga0495671_0000013 3300046692 Bacteria 344767
856 Ga0495671_0000020 3300046692 Bacteria 268306
857 Ga0495671_0001468 3300046692 Bacteria 15811
858 Ga0495649_0167227 3300046694 Bacteria 1152
859 Ga0495589_0027870 3300046794 Bacteria 2855
860 Ga0495672_0060682 3300047320 Bacteria 2183
861 Ga0495676_0532786 3300047321 Bacteria 769
862 Ga0495683_0463540 3300047323 Bacteria 518
863 Ga0495677_0014583 3300047445 Bacteria 2859
864 Ga0495677_0139659 3300047445 Bacteria 930
865 Ga0495685_181100 3300047447 Bacteria 679
866 Ga0495673_0000076 3300047469 Bacteria 205985
867 Ga0495673_0068055 3300047469 Bacteria 1506
868 Ga0495681_0000059 3300047470 Bacteria 102400
869 Ga0495681_0000202 3300047470 Bacteria 49721
870 Ga0495686_0000141 3300047472 Bacteria 144510
871 Ga0495686_0000238 3300047472 Bacteria 99919
872 Ga0495686_0002243 3300047472 Bacteria 18638
873 Ga0495686_0018319 3300047472 Bacteria 4702
874 Ga0495686_0026212 3300047472 Bacteria 3815
875 Ga0495686_0320197 3300047472 Bacteria 850
876 Ga0495686_0350529 3300047472 Bacteria 802
877 Ga0496100_0196852 3300048903 Bacteria 1466
878 Ga0496101_0016231 3300048904 Bacteria 5026
879 Ga0496102_0000036 3300048905 Bacteria 201896
880 Ga0496102_0009074 3300048905 Bacteria 8532
881 Ga0496102_0407214 3300048905 Bacteria 1278
882 Ga0496102_0857482 3300048905 Bacteria 830
883 Ga0496102_1300882 3300048905 Bacteria 646
884 Ga0496103_0000074 3300048906 Bacteria 116385
885 Ga0496103_0007440 3300048906 Bacteria 6528
886 Ga0496103_0023715 3300048906 Bacteria 3700
887 Ga0496103_0079884 3300048906 Bacteria 2056
888 Ga0496103_0185776 3300048906 Bacteria 1336
889 Ga0496103_0240120 3300048906 Bacteria 1166
890 Ga0496104_0753832 3300048907 Bacteria 880
891 Ga0496105_0185147 3300048908 Bacteria 1704
892 Ga0496105_0213790 3300048908 Bacteria 1571
893 Ga0496106_0190164 3300048909 Bacteria 1632
894 Ga0496107_0037068 3300048910 Bacteria 3499
895 Ga0496107_0137154 3300048910 Bacteria 1808
896 Ga0496108_0003856 3300048911 Bacteria 12037
897 Ga0496108_0221697 3300048911 Bacteria 1643
898 Ga0496109_0003822 3300048912 Bacteria 12579
899 Ga0496110_0010100 3300048913 Bacteria 7665
900 Ga0496110_0049723 3300048913 Bacteria 3679
901 Ga0496110_0243283 3300048913 Bacteria 1637
902 Ga0496111_0039257 3300048914 Bacteria 3394
903 Ga0496111_0304629 3300048914 Bacteria 1181
904 Ga0496111_0406956 3300048914 Bacteria 1005
905 Ga0496111_1045172 3300048914 Bacteria 584
906 Ga0496113_0074937 3300048916 Bacteria 2581
907 Ga0496114_0714791 3300048917 Unclassified 878
908 Ga0496114_1377034 3300048917 Bacteria 593
909 Ga0496116_0022703 3300048919 Bacteria 4695
910 Ga0496116_0024263 3300048919 Bacteria 4491
911 Ga0496116_0112777 3300048919 Bacteria 1592
912 Ga0496116_0174234 3300048919 Bacteria 1161
913 Ga0496117_0000093 3300048920 Bacteria 201862
914 Ga0496117_0005266 3300048920 Bacteria 13717
915 Ga0496117_0022206 3300048920 Bacteria 5094
916 Ga0496117_0032491 3300048920 Bacteria 3964
917 Ga0496117_0033745 3300048920 Bacteria 3865
918 Ga0496117_0064004 3300048920 Bacteria 2510
919 Ga0496117_0247277 3300048920 Bacteria 975
920 Ga0496118_0000070 3300048921 Bacteria 201866
921 Ga0496118_0000416 3300048921 Bacteria 70809
922 Ga0496118_0008773 3300048921 Bacteria 10365
923 Ga0496118_0035449 3300048921 Bacteria 4050
924 Ga0496118_0039758 3300048921 Bacteria 3749
925 Ga0496118_0153844 3300048921 Bacteria 1434
926 Ga0496118_0220803 3300048921 Bacteria 1103
927 Ga0496118_0259246 3300048921 Bacteria 982
928 Ga0496118_0274897 3300048921 Bacteria 941
929 Ga0496118_0579343 3300048921 Bacteria 541
930 Ga0496119_0036352 3300048922 Bacteria 3216
931 Ga0496119_0049559 3300048922 Bacteria 2595
932 Ga0496119_0049636 3300048922 Bacteria 2593
933 Ga0496119_0096446 3300048922 Bacteria 1668
934 Ga0496120_0055188 3300048923 Bacteria 2247
935 Ga0496120_0221952 3300048923 Bacteria 902
936 Ga0496121_0000163 3300048924 Bacteria 145648
937 Ga0496121_0000880 3300048924 Bacteria 54384
938 Ga0496121_0001214 3300048924 Bacteria 44944
939 Ga0496121_0001608 3300048924 Bacteria 37482
940 Ga0496121_0047653 3300048924 Bacteria 3654
941 Ga0496121_0097100 3300048924 Bacteria 2284
942 Ga0496121_0097880 3300048924 Bacteria 2272
943 Ga0496121_0108596 3300048924 Bacteria 2122
944 Ga0496121_0139313 3300048924 Bacteria 1802
945 Ga0496121_0174019 3300048924 Bacteria 1561
946 Ga0496121_0296182 3300048924 Bacteria 1100
947 Ga0496122_0000176 3300048925 Bacteria 152190
948 Ga0496122_0010742 3300048925 Bacteria 9392
949 Ga0496122_0021362 3300048925 Bacteria 5798
950 Ga0496122_0436774 3300048925 Bacteria 653
951 Ga0496123_0000220 3300048926 Bacteria 115824
952 Ga0496123_0029884 3300048926 Bacteria 4000
953 Ga0496123_0115289 3300048926 Bacteria 1525
954 Ga0496123_0185645 3300048926 Bacteria 1081
955 Ga0496123_0228841 3300048926 Bacteria 932
956 Ga0496123_0295524 3300048926 Bacteria 776
957 Ga0496124_0000225 3300048927 Bacteria 110516
958 Ga0496124_0003343 3300048927 Bacteria 19739
959 Ga0496124_0012464 3300048927 Bacteria 8390
960 Ga0496124_0128992 3300048927 Bacteria 2011
961 Ga0496124_0256786 3300048927 Bacteria 1289
962 Ga0496124_0310133 3300048927 Bacteria 1135
963 Ga0496124_0419095 3300048927 Bacteria 923
964 Ga0496125_0008573 3300048928 Bacteria 10677
965 Ga0496125_0025087 3300048928 Bacteria 5468
966 Ga0496125_0042722 3300048928 Bacteria 3856
967 Ga0496125_0059858 3300048928 Bacteria 3065
968 Ga0496125_0149597 3300048928 Bacteria 1606
969 Ga0496125_0212925 3300048928 Bacteria 1253
970 Ga0496125_0251347 3300048928 Bacteria 1115
971 Ga0496125_0342385 3300048928 Bacteria 897
972 Ga0496125_0576544 3300048928 Bacteria 619
973 Ga0496126_0010605 3300048929 Bacteria 9635
974 Ga0496126_0011101 3300048929 Bacteria 9357
975 Ga0496126_0059986 3300048929 Bacteria 3424
976 Ga0496126_0252653 3300048929 Bacteria 1469
977 Ga0496126_0345432 3300048929 Bacteria 1218
978 Ga0496126_0806095 3300048929 Bacteria 720
979 Ga0495682_0370095 3300049460 Bacteria 505
980 Ga0501290_000401 3300049513 Bacteria 6887
981 Ga0501290_006423 3300049513 Bacteria 1473
982 Ga0501292_000049 3300049515 Bacteria 24987
983 Ga0501293_040770 3300049516 Bacteria 526
984 Ga0501294_000131 3300049517 Bacteria 8738
985 Ga0501299_060454 3300049522 Bacteria 802
986 Ga0501300_000260 3300049523 Bacteria 8045
987 Ga0501300_000689 3300049523 Bacteria 5061
988 Ga0501314_010069 3300049530 Bacteria 877
989 Ga0501335_007702 3300049551 Bacteria 1000
990 Ga0501032_0482230 3300049569 Bacteria 793
991 Ga0501033_0592962 3300049570 Bacteria 760
992 Ga0501033_0790175 3300049570 Bacteria 642
993 Ga0501034_0004038 3300049571 Bacteria 16469
994 Ga0501034_0037966 3300049571 Bacteria 4878
995 Ga0501034_0241441 3300049571 Bacteria 1753
996 Ga0501036_0231880 3300049572 Bacteria 1549
997 Ga0501037_0700054 3300049573 Bacteria 674
998 Ga0501038_0199248 3300049574 Bacteria 1608
999 Ga0501039_0270408 3300049575 Bacteria 1336
1000 Ga0501043_0070645 3300049579 Bacteria 2743
1001 Ga0501043_0124196 3300049579 Bacteria 2024
1002 Ga0501043_1323847 3300049579 Bacteria 502
1003 Ga0501047_0002660 3300049581 Bacteria 16998
1004 Ga0501047_0303094 3300049581 Bacteria 1440
1005 Ga0501047_0363946 3300049581 Bacteria 1282
1006 Ga0501048_0067221 3300049582 Bacteria 2534
1007 Ga0501069_0001144 3300049585 Bacteria 12827
1008 Ga0501071_0237548 3300049587 Bacteria 1374
1009 Ga0501198_003618 3300049649 Bacteria 2119
1010 Ga0501202_017144 3300049652 Bacteria 1412
1011 Ga0501207_022073 3300049654 Bacteria 1026
1012 Ga0501211_037350 3300049658 Bacteria 568
1013 Ga0501222_000186 3300049662 Bacteria 11204
1014 Ga0501223_000026 3300049663 Bacteria 58071
1015 Ga0501223_000155 3300049663 Bacteria 18141
1016 Ga0501223_000502 3300049663 Bacteria 9508
1017 Ga0501223_007293 3300049663 Bacteria 2265
1018 Ga0501223_013730 3300049663 Bacteria 1611
1019 Ga0501224_000006 3300049664 Bacteria 149611
1020 Ga0501224_000243 3300049664 Bacteria 6202
1021 Ga0501224_028771 3300049664 Bacteria 832
1022 Ga0501227_009170 3300049665 Bacteria 2127
1023 Ga0501233_000373 3300049668 Bacteria 7074
1024 Ga0501233_079369 3300049668 Bacteria 843
1025 Ga0501235_004175 3300049669 Bacteria 3130
1026 Ga0501235_005975 3300049669 Bacteria 2650
1027 Ga0501246_012043 3300049676 Bacteria 807
1028 Ga0501249_061921 3300049679 Bacteria 867
1029 Ga0501257_000014 3300049686 Bacteria 50280
1030 Ga0501259_003276 3300049688 Bacteria 2587
1031 Ga0501261_000013 3300049690 Bacteria 45622
1032 Ga0501221_002894 3300049704 Bacteria 2829
1033 Ga0501225_0000129 3300049705 Bacteria 23106
1034 Ga0501225_0000164 3300049705 Bacteria 20019
1035 Ga0501225_0012404 3300049705 Bacteria 2394
1036 Ga0501229_012275 3300049706 Bacteria 1093
1037 Ga0501245_002452 3300049708 Bacteria 2477
1038 Ga0501245_005990 3300049708 Bacteria 1693
1039 Ga0501080_0534872 3300049742 Bacteria 1045
1040 Ga0501241_009319 3300049758 Bacteria 1787
1041 Ga0501278_010491 3300049774 Bacteria 740
1042 Ga0501279_000017 3300049775 Bacteria 62448
1043 Ga0501280_000015 3300049776 Bacteria 55614
1044 Ga0501280_001970 3300049776 Bacteria 3575
1045 Ga0501281_00053 3300049777 Bacteria 13557
1046 Ga0501282_000557 3300049778 Bacteria 4362
1047 Ga0501035_0898978 3300049822 Bacteria 701
1048 Ga0501035_1276269 3300049822 Bacteria 567
1049 Ga0501044_0003361 3300049823 Bacteria 18041
1050 Ga0501044_0234100 3300049823 Bacteria 1783
1051 Ga0501204_074564 3300049850 Bacteria 565
1052 Ga0501212_101646 3300049851 Bacteria 540
1053 Ga0501226_000041 3300049853 Bacteria 59344
1054 Ga0501226_020454 3300049853 Bacteria 732
1055 nmdc:mga03n38_2083_c1 3300050490 Bacteria 6055
1056 nmdc:mga00v17_363493_c1 3300050491 Bacteria 941
1057 nmdc:mga06z11_69_c1 3300050494 Bacteria 42587
1058 nmdc:mga04h51_116_c1 3300050495 Bacteria 23330
1059 nmdc:mga07m45_119069_c1 3300050496 Bacteria 1524
1060 nmdc:mga07m45_33591_c1 3300050496 Bacteria 2849
1061 nmdc:mga07m45_559499_c1 3300050496 Bacteria 661
1062 nmdc:mga0sz30_184575_c1 3300050516 Bacteria 926
1063 Ga0495601_0891215 3300053077 Bacteria 562
1064 Ga0500635_0270068 3300053080 Bacteria 669
1065 Ga0495619_0871968 3300053085 Bacteria 606
1066 Ga0500643_000151 3300053087 Bacteria 70674
1067 Ga0500643_000242 3300053087 Bacteria 50505
1068 Ga0500643_000348 3300053087 Bacteria 36744
1069 Ga0500643_000471 3300053087 Bacteria 29518
1070 Ga0500643_000628 3300053087 Bacteria 23797
1071 Ga0500643_002009 3300053087 Bacteria 10953
1072 Ga0500643_097267 3300053087 Bacteria 800
1073 Ga0500643_180149 3300053087 Bacteria 567
1074 Ga0500644_0096104 3300053088 Bacteria 1118
1075 Ga0500644_0276246 3300053088 Bacteria 714
1076 Ga0500646_0374147 3300053090 Bacteria 523
1077 Ga0500647_0110793 3300053091 Bacteria 1305
1078 Ga0500647_0302306 3300053091 Bacteria 683
1079 Ga0500651_0001723 3300053093 Bacteria 11200
1080 Ga0500566_0119319 3300053094 Bacteria 1424
1081 Ga0500641_0440304 3300053096 Bacteria 504
1082 Ga0500556_0000025 3300053104 Bacteria 167307
1083 Ga0500562_037090 3300053108 Bacteria 1293
1084 Ga0500592_000037 3300053116 Bacteria 42549
1085 Ga0500592_002732 3300053116 Bacteria 2842
1086 Ga0500592_002889 3300053116 Bacteria 2761
1087 Ga0500593_154804 3300053117 Bacteria 884
1088 Ga0500594_0006394 3300053118 Bacteria 2645
1089 Ga0500642_0000001 3300053130 Bacteria 1468402
1090 Ga0500642_0002903 3300053130 Bacteria 5096
1091 Ga0500652_202890 3300053131 Bacteria 804
1092 Ga0500655_011783 3300053133 Bacteria 1586
1093 Ga0500658_0002052 3300053134 Bacteria 7853
1094 Ga0500658_0156648 3300053134 Bacteria 1029
1095 Ga0500559_0011994 3300053136 Bacteria 3693
1096 Ga0500559_0021863 3300053136 Bacteria 2713
1097 Ga0500559_0029654 3300053136 Bacteria 2344
1098 Ga0500559_0113736 3300053136 Bacteria 1255
1099 Ga0500568_0045317 3300053139 Bacteria 1751
1100 Ga0500568_0182185 3300053139 Bacteria 772
1101 Ga0500573_0000010 3300053140 Bacteria 210704
1102 Ga0500573_0296822 3300053140 Bacteria 810
1103 Ga0500573_0508188 3300053140 Bacteria 543
1104 Ga0500577_0045158 3300053142 Bacteria 1627
1105 Ga0500590_053507 3300053148 Bacteria 2046
1106 Ga0500604_0002377 3300053151 Bacteria 5146
1107 Ga0500604_0005821 3300053151 Bacteria 3259
1108 Ga0500604_0032864 3300053151 Bacteria 1531
1109 Ga0500604_0096251 3300053151 Bacteria 972
1110 Ga0500604_0096993 3300053151 Bacteria 968
1111 Ga0500616_0007814 3300053153 Bacteria 6737
1112 Ga0500616_0091162 3300053153 Bacteria 1509
1113 Ga0500616_0259593 3300053153 Bacteria 738
1114 Ga0500622_0017836 3300053156 Bacteria 3776
1115 Ga0500622_0237033 3300053156 Bacteria 808
1116 Ga0500622_0422613 3300053156 Bacteria 536
1117 Ga0500624_000026 3300053157 Bacteria 109681
1118 Ga0500624_000058 3300053157 Bacteria 70829
1119 Ga0500627_0000411 3300053158 Bacteria 11566
1120 Ga0500627_0000731 3300053158 Bacteria 8741
1121 Ga0500627_0003404 3300053158 Bacteria 4909
1122 Ga0500627_0102669 3300053158 Bacteria 1284
1123 Ga0500627_0239955 3300053158 Bacteria 804
1124 Ga0500627_0466807 3300053158 Bacteria 529
1125 Ga0500636_0000920 3300053177 Bacteria 15845
1126 Ga0500636_0084556 3300053177 Bacteria 1824
1127 Ga0500636_0121211 3300053177 Bacteria 1467
1128 Ga0500570_022799 3300053724 Bacteria 3470
1129 Ga0500611_013745 3300053727 Bacteria 1396
1130 Ga0500645_000355 3300053730 Bacteria 32606
1131 Ga0500645_046727 3300053730 Bacteria 1270
1132 Ga0500645_089855 3300053730 Bacteria 871
1133 Ga0500596_008569 3300053735 Bacteria 1627
1134 Ga0500661_000136 3300055283 Bacteria 12432
1135 Ga0501082_0874047 3300060353 Bacteria 786
1136 Ga0466962_0016119 3300061719 Bacteria 3604
1137 Ga0466962_0183745 3300061719 Bacteria 1020
1138 2512645549 2512564014 Bacteria 4639632
1139 2585260411 2582581305 Bacteria 4895574
1140 2643729127 2643221541 Bacteria 5498788
1141 2644038611 2643221605 Bacteria 4772303
1142 2644045140 2643221606 Bacteria 5588032
1143 2644391312 2643221671 Bacteria 5496681
1144 2778126231 2775507255 Bacteria 3945731
1145 2809063216 2808606401 Bacteria 4586670
1146 2809079349 2808606404 Bacteria 4652788
1147 2809083278 2808606405 Bacteria 4586632
1148 2830075926 2830075706 Bacteria 3855215
1149 2880520485 2880518877 Bacteria 5012590
1150 2885432081 2885429604 Bacteria 3642894
1151 2919710726 2919709256 Bacteria 4318106
1152 2928028841 2928027323 Bacteria 4382488
1153 2984556397 2984555340 Bacteria 4247089
1154 2984565414 2984564862 Bacteria 4339992
1155 2990268949 2990265787 Bacteria 3943888
1156 2993356506 2993356040 Bacteria 4247105
1157 2993697239 2993693658 Bacteria 4040749
1158 Ga0097621_102009464
1159 SwRhRL2b_contig_200884
1160 SwRhRL2b_contig_682763
1161 JGI24034J14986_100946
1162 JGI24736J21556_1000015
1163 JGI24736J21556_1000379
1164 JGI24736J21556_1041369
1165 JGI24741J21665_1000200
1166 JGI24741J21665_1007687
1167 JGI24752J21851_1000029
1168 JGI24752J21851_1000343
1169 JGI24752J21851_1033475
1170 JGI24740J21852_10005510
1171 JGI24740J21852_10021799
1172 JGI24740J21852_10066980
1173 JGI24740J21852_10070938
1174 JGI24739J22299_10007450
1175 JGI24739J22299_10013160
1176 JGI24739J22299_10016802
1177 JGI24739J22299_10035566
1178 JGI24739J22299_10062228
1179 JGI24739J22299_10149173
1180 JGI24737J22298_10000844
1181 JGI24737J22298_10002091
1182 JGI24737J22298_10019795
1183 JGI24737J22298_10046085
1184 JGI24737J22298_10075128
1185 JGI24743J22301_10025233
1186 JGI24735J21928_10000451
1187 JGI24735J21928_10003995
1188 JGI24735J21928_10004623
1189 JGI24735J21928_10038022
1190 JGI24750J21931_1000259
1191 JGI24748J21848_1000023
1192 JGI24748J21848_1023771
1193 JGI24738J21930_10000728
1194 JGI24738J21930_10000824
1195 JGI24738J21930_10002030
1196 JGI24738J21930_10071374
1197 JGI24749J21850_1001696
1198 JGI24744J21845_10003312
1199 JGI24035J26624_1002255
1200 JGI24034J26672_10000010
1201 JGI24034J26672_10005447
1202 JGI24034J26672_10008951
1203 JGI24742J22300_10000537
1204 JGI24751J29686_10056506
1205 JGI25165J46597_1000124
1206 rootH1_10081084
1207 Ga0055542_1001963
1208 Ga0055542_1028623
1209 Ga0055530_10000485
1210 Ga0055531_10000524
1211 Ga0065165_1063338
1212 Ga0065704_10005679
1213 Ga0065704_10074420
1214 Ga0065704_10093669
1215 Ga0065707_10027121
1216 Ga0065707_10082699
1217 Ga0065707_10100815
1218 Ga0065707_10153765
1219 Ga0065707_10160566
1220 Ga0065707_10665677
1221 Ga0070658_10000050
1222 Ga0070658_10000057
1223 Ga0070658_10008422
1224 Ga0070658_10104912
1225 Ga0070658_10646559
1226 Ga0070658_10704415
1227 Ga0070676_10001112
1228 Ga0070676_10255743
1229 Ga0070683_100049964
1230 Ga0070683_101112413
1231 Ga0070670_100000003
1232 Ga0070670_100000135
1233 Ga0070670_100000815
1234 Ga0070670_100001203
1235 Ga0070670_100056819
1236 Ga0070670_100126486
1237 Ga0070670_101133684
1238 Ga0068869_100000528
1239 Ga0068869_100432191
1240 Ga0070666_10000009
1241 Ga0070666_10000115
1242 Ga0070666_10004754
1243 Ga0070666_10027244
1244 Ga0070682_100143730
1245 Ga0068868_100000074
1246 Ga0070660_100002838
1247 Ga0070660_100004367
1248 Ga0070660_100008583
1249 Ga0070660_100013497
1250 Ga0070660_100056725
1251 Ga0070660_100058458
1252 Ga0070660_100957382
1253 Ga0070689_101607124
1254 Ga0070687_100185112
1255 Ga0070661_100043344
1256 Ga0070661_100056833
1257 Ga0070661_100111742
1258 Ga0070661_100467201
1259 Ga0070668_100000117
1260 Ga0070668_100000119
1261 Ga0070668_100008086
1262 Ga0070668_100025713
1263 Ga0070668_100124001
1264 Ga0070668_100216084
1265 Ga0070668_100435792
1266 Ga0070668_102128782
1267 Ga0070669_100000004
1268 Ga0070669_100000017
1269 Ga0070669_100000020
1270 Ga0070669_100021925
1271 Ga0070669_100048028
1272 Ga0070669_101973825
1273 Ga0070675_100000482
1274 Ga0070675_100491535
1275 Ga0070671_100000004
1276 Ga0070671_100000426
1277 Ga0070671_100012098
1278 Ga0070671_100014451
1279 Ga0070671_100673147
1280 Ga0070674_100014876
1281 Ga0070674_100803879
1282 Ga0070674_100963512
1283 Ga0070673_100000008
1284 Ga0070673_100792423
1285 Ga0070688_100010711
1286 Ga0070688_100296952
1287 Ga0070659_100015151
1288 Ga0070659_100037194
1289 Ga0070659_100065464
1290 Ga0070659_100221119
1291 Ga0070659_100435276
1292 Ga0070659_100478239
1293 Ga0070667_100000016
1294 Ga0070667_100000113
1295 Ga0070667_100000357
1296 Ga0070667_100000969
1297 Ga0070667_100002047
1298 Ga0070667_100014603
1299 Ga0070667_100373346
1300 Ga0070667_101141709
1301 Ga0070667_101248868
1302 Ga0070667_101302372
1303 Ga0070705_100058395
1304 Ga0070708_100213171
1305 Ga0070663_100008375
1306 Ga0070663_100175974
1307 Ga0070663_100184030
1308 Ga0070663_100206062
1309 Ga0070663_100297134
1310 Ga0070678_100003552
1311 Ga0070678_100302164
1312 Ga0070662_100009993
1313 Ga0070662_100038291
1314 Ga0070662_100054299
1315 Ga0070662_100256482
1316 Ga0070662_100263336
1317 Ga0070662_101539970
1318 Ga0068867_100000003
1319 Ga0068867_100558914
1320 Ga0070685_10000291
1321 Ga0070685_10773857
1322 Ga0070707_100950460
1323 Ga0070679_100653556
1324 Ga0070684_100671317
1325 Ga0068853_100000408
1326 Ga0068853_100049504
1327 Ga0068853_100129707
1328 Ga0068853_100155785
1329 Ga0068853_100220351
1330 Ga0068853_100381375
1331 Ga0068853_101232667
1332 Ga0070672_100419806
1333 Ga0070672_101399494
1334 Ga0070686_100000041
1335 Ga0070693_100082827
1336 Ga0070693_100290623
1337 Ga0070665_100000368
1338 Ga0070665_100129628
1339 Ga0070665_100227729
1340 Ga0070665_100651920
1341 Ga0068855_100003895
1342 Ga0068855_100325483
1343 Ga0068855_100364233
1344 Ga0068855_100493147
1345 Ga0068855_100580485
1346 Ga0068855_100780631
1347 Ga0068855_100783044
1348 Ga0068855_101533168
1349 Ga0070664_100041964
1350 Ga0070664_100054636
1351 Ga0070664_100185252
1352 Ga0070664_101974678
1353 Ga0068857_100026906
1354 Ga0068857_100037444
1355 Ga0068857_100073026
1356 Ga0068857_100079335
1357 Ga0068857_100084504
1358 Ga0068857_100131683
1359 Ga0068857_100150957
1360 Ga0068854_100001318
1361 Ga0068854_100010079
1362 Ga0068854_100018727
1363 Ga0068854_100049284
1364 Ga0068854_100098886
1365 Ga0068854_100130300
1366 Ga0068854_101221017
1367 Ga0068856_100003087
1368 Ga0068856_100021580
1369 Ga0068856_100180410
1370 Ga0068856_100896913
1371 Ga0068856_101454313
1372 Ga0068856_101937912
1373 Ga0068856_101942530
1374 Ga0068852_100002299
1375 Ga0068852_100031099
1376 Ga0068852_100132840
1377 Ga0068852_100193270
1378 Ga0068852_100342914
1379 Ga0068852_100615321
1380 Ga0068852_100780069
1381 Ga0068852_100886793
1382 Ga0068852_101820514
1383 Ga0068859_100000233
1384 Ga0068859_100003392
1385 Ga0068859_100035740
1386 Ga0068859_100055791
1387 Ga0068859_100162429
1388 Ga0068859_100433024
1389 Ga0068859_100936126
1390 Ga0068859_102377425
1391 Ga0068864_100000005
1392 Ga0068864_100000191
1393 Ga0068864_100000798
1394 Ga0068864_100001033
1395 Ga0068864_100005449
1396 Ga0068864_100006140
1397 Ga0068864_100057140
1398 Ga0068861_100006153
1399 Ga0068861_100007109
1400 Ga0068861_100200940
1401 Ga0068861_101376968
1402 Ga0068851_10005533
1403 Ga0068851_10058089
1404 Ga0068851_10109605
1405 Ga0068870_10138802
1406 Ga0068863_100000132
1407 Ga0068863_100000166
1408 Ga0068863_100005052
1409 Ga0068863_100014467
1410 Ga0068863_100026394
1411 Ga0068863_100196458
1412 Ga0068863_100285874
1413 Ga0068863_101076647
1414 Ga0068858_100000288
1415 Ga0068858_100000291
1416 Ga0068858_100036066
1417 Ga0068858_100039517
1418 Ga0068858_100321273
1419 Ga0068860_100000022
1420 Ga0068860_100000215
1421 Ga0068860_100000256
1422 Ga0068860_100035312
1423 Ga0068860_100039119
1424 Ga0068862_100000001
1425 Ga0068862_100000151
1426 Ga0068862_100000346
1427 Ga0068862_100000581
1428 Ga0068862_100000596
1429 Ga0068862_100202785
1430 Ga0081455_10000049
1431 Ga0081455_10301827
1432 Ga0081539_10022573
1433 Ga0075368_10000139
1434 Ga0075363_100002110
1435 Ga0075364_10245609
1436 Ga0075367_10017797
1437 Ga0075366_10105588
1438 Ga0075366_10899607
1439 Ga0097621_100026787
1440 Ga0075370_10031127
1441 Ga0075370_10035043
1442 Ga0075370_10610688
1443 Ga0068871_100003615
1444 Ga0068865_100000002
1445 Ga0068865_100858645
1446 Ga0097620_100000233
1447 Ga0097620_100003392
1448 Ga0097620_100035739
1449 Ga0097620_100055791
1450 Ga0097620_100162424
1451 Ga0097620_100433012
1452 Ga0097620_100936300
1453 Ga0097620_102376612
1454 Ga0105251_10000264
1455 Ga0105251_10015469
1456 Ga0105251_10038670
1457 Ga0105251_10646565
1458 Ga0105240_10056330
1459 Ga0105240_10091245
1460 Ga0105240_10113964
1461 Ga0105240_10439268
1462 Ga0105240_11321680
1463 Ga0105245_10000184
1464 Ga0105247_10000989
1465 Ga0105247_10003404
1466 Ga0105247_10382478
1467 Ga0105247_10396008
1468 Ga0105247_10406811
1469 Ga0105247_11378572
1470 Ga0114129_10250889
1471 Ga0105243_10000031
1472 Ga0105243_10290320
1473 Ga0105243_10438223
1474 Ga0105241_10002989
1475 Ga0105241_10052516
1476 Ga0105241_11147730
1477 Ga0105242_10000171
1478 Ga0105248_10000012
1479 Ga0105248_10000192
1480 Ga0105248_10003135
1481 Ga0105248_10028054
1482 Ga0105248_10217454
1483 Ga0105248_10324045
1484 Ga0105248_10352642
1485 Ga0105248_10467294
1486 Ga0105248_12712317
1487 Ga0105237_10002820
1488 Ga0105237_10068927
1489 Ga0105237_10073893
1490 Ga0105237_10112662
1491 Ga0105238_10030882
1492 Ga0105238_10152857
1493 Ga0105238_10421315
1494 Ga0105238_10522637
1495 Ga0105238_10546884
1496 Ga0105249_10000014
1497 Ga0105249_10000099
1498 Ga0105249_10000699
1499 Ga0105249_10017636
1500 Ga0105249_10244793
1501 Ga0105249_10331263
1502 Ga0105249_10738720
1503 Ga0105249_10751522
1504 Ga0105148_100092
1505 Ga0105147_101503
1506 Ga0105239_10000451
1507 Ga0105239_10028478
1508 Ga0105239_10149947
1509 Ga0105239_10361584
1510 Ga0105239_10516815
1511 Ga0105239_10600086
1512 Ga0105246_10000056
1513 Ga0105246_10283343
1514 Ga0157326_1000375
1515 Ga0157373_10008588
1516 Ga0157373_10051976
1517 Ga0157373_10074440
1518 Ga0157373_10151590
1519 Ga0157373_10171969
1520 Ga0157373_10509271
1521 Ga0157371_10086710
1522 Ga0157371_10184773
1523 Ga0157371_11155234
1524 Ga0157370_10000080
1525 Ga0157370_10003119
1526 Ga0157370_10083609
1527 Ga0157370_10372884
1528 Ga0157370_10925981
1529 Ga0157369_10042446
1530 Ga0157369_10055589
1531 Ga0157369_10068286
1532 Ga0157369_10167917
1533 Ga0157369_11065092
1534 Ga0157369_12621612
1535 Ga0157374_10000184
1536 Ga0157374_10041949
1537 Ga0157378_10000205
1538 Ga0163162_10002879
1539 Ga0163162_10013910
1540 Ga0163162_10117460
1541 Ga0163162_10159072
1542 Ga0163162_10209195
1543 Ga0163162_10350467
1544 Ga0163162_10377805
1545 Ga0163162_11061666
1546 Ga0157372_10064970
1547 Ga0157372_10075492
1548 Ga0157372_10078364
1549 Ga0157372_10498080
1550 Ga0157372_11433170
1551 Ga0157372_11765392
1552 Ga0157375_10080217
1553 Ga0157375_10729144
1554 Ga0163163_10025413
1555 Ga0163163_10067038
1556 Ga0163163_10223664
1557 Ga0163163_10471431
1558 Ga0163163_10721878
1559 Ga0157380_10000107
1560 Ga0157380_10000350
1561 Ga0157380_10001483
1562 Ga0157380_10034350
1563 Ga0157379_10034748
1564 Ga0157379_10057086
1565 Ga0157379_10058471
1566 Ga0157379_12119996
1567 Ga0157376_10000148
1568 Ga0157376_12617527
1569 Ga0183363_1007
1570 Ga0183361_10472
1571 Ga0163161_10000860
1572 Ga0163161_10030187
1573 Ga0163161_10030480
1574 Ga0163161_10300304
1575 Ga0163161_10603456
1576 Ga0163161_10758566
1577 Ga0207672_1002763
1578 Ga0209147_101130
1579 Ga0207427_101618
1580 Ga0209026_1002559
1581 Ga0209148_1000112
1582 Ga0209148_1000974
1583 Ga0209233_1000189
1584 Ga0209455_1001147
1585 Ga0207673_1004543
1586 Ga0209050_1000832
1587 Ga0209257_1000929
1588 Ga0209257_1048009
1589 Ga0207697_10000101
1590 Ga0207697_10009818
1591 Ga0207697_10203779
1592 Ga0207656_10004950
1593 Ga0207656_10178021
1594 Ga0207713_1001017
1595 Ga0207710_10004035
1596 Ga0207710_10367134
1597 Ga0207710_10372457
1598 Ga0207710_10477319
1599 Ga0207688_10367906
1600 Ga0207680_10000007
1601 Ga0207680_10000078
1602 Ga0207680_10017766
1603 Ga0207680_10018003
1604 Ga0207680_10234188
1605 Ga0207680_11142866
1606 Ga0207647_10000323
1607 Ga0207647_10004162
1608 Ga0207647_10010729
1609 Ga0207647_10318710
1610 Ga0207645_10001019
1611 Ga0207645_10491252
1612 Ga0207645_10775422
1613 Ga0207705_10000014
1614 Ga0207705_10000145
1615 Ga0207705_10193347
1616 Ga0207705_10327551
1617 Ga0207654_10000521
1618 Ga0207654_10025400
1619 Ga0207695_10004592
1620 Ga0207695_10015825
1621 Ga0207695_10075373
1622 Ga0207695_10821677
1623 Ga0207695_10989976
1624 Ga0207671_10000740
1625 Ga0207671_10001130
1626 Ga0207671_10050539
1627 Ga0207671_10206859
1628 Ga0207671_10426551
1629 Ga0207662_10211064
1630 Ga0207657_10001736
1631 Ga0207657_10010116
1632 Ga0207657_10013912
1633 Ga0207657_10022481
1634 Ga0207657_10054229
1635 Ga0207657_10058524
1636 Ga0207649_10060326
1637 Ga0207649_10128672
1638 Ga0207649_10307869
1639 Ga0207649_10794313
1640 Ga0207652_10893322
1641 Ga0207646_10478627
1642 Ga0207681_10000005
1643 Ga0207681_10000010
1644 Ga0207681_10000029
1645 Ga0207681_10007837
1646 Ga0207681_10009997
1647 Ga0207681_10162446
1648 Ga0207681_10401826
1649 Ga0207694_10002569
1650 Ga0207694_10021154
1651 Ga0207694_10044490
1652 Ga0207694_10123314
1653 Ga0207694_10151946
1654 Ga0207694_10448556
1655 Ga0207694_11145990
1656 Ga0207650_10000004
1657 Ga0207650_10000182
1658 Ga0207650_10006854
1659 Ga0207650_10079934
1660 Ga0207650_10137542
1661 Ga0207650_10143934
1662 Ga0207650_11343351
1663 Ga0207659_10001548
1664 Ga0207687_10004300
1665 Ga0207644_10000007
1666 Ga0207644_10000112
1667 Ga0207644_10003240
1668 Ga0207644_10032789
1669 Ga0207644_10083105
1670 Ga0207644_10692959
1671 Ga0207690_10048615
1672 Ga0207690_10058336
1673 Ga0207690_10100517
1674 Ga0207690_10177938
1675 Ga0207690_10321198
1676 Ga0207690_10420183
1677 Ga0207690_10894151
1678 Ga0207706_10002566
1679 Ga0207706_10008580
1680 Ga0207706_10045273
1681 Ga0207706_10057010
1682 Ga0207706_10059202
1683 Ga0207706_10064667
1684 Ga0207706_10081560
1685 Ga0207686_10000178
1686 Ga0207709_10000237
1687 Ga0207709_10365883
1688 Ga0207709_10459821
1689 Ga0207670_10014687
1690 Ga0207669_10008300
1691 Ga0207669_10486132
1692 Ga0207704_10000003
1693 Ga0207691_10409382
1694 Ga0207711_10000004
1695 Ga0207711_10000075
1696 Ga0207711_10198744
1697 Ga0207711_10300786
1698 Ga0207711_10787656
1699 Ga0207711_10974078
1700 Ga0207711_12029027
1701 Ga0207689_10001512
1702 Ga0207689_10401777
1703 Ga0207689_11175008
1704 Ga0207661_10539359
1705 Ga0207661_10795915
1706 Ga0207679_10503067
1707 Ga0207679_10609976
1708 Ga0207667_10000007
1709 Ga0207667_10000825
1710 Ga0207667_10053298
1711 Ga0207667_10368324
1712 Ga0207667_10387507
1713 Ga0207667_10493180
1714 Ga0207651_10000003
1715 Ga0207651_10403117
1716 Ga0207712_10000004
1717 Ga0207712_10000161
1718 Ga0207712_10008789
1719 Ga0207712_10155829
1720 Ga0207712_10239582
1721 Ga0207712_10390537
1722 Ga0207668_10000142
1723 Ga0207668_10000186
1724 Ga0207668_10000348
1725 Ga0207668_10024299
1726 Ga0207668_10058964
1727 Ga0207668_10165219
1728 Ga0207640_10000031
1729 Ga0207640_10018606
1730 Ga0207640_10026524
1731 Ga0207640_10028518
1732 Ga0207640_10058937
1733 Ga0207640_10154731
1734 Ga0207640_10313034
1735 Ga0207658_10000034
1736 Ga0207658_10000213
1737 Ga0207658_10000309
1738 Ga0207658_10000405
1739 Ga0207658_10000462
1740 Ga0207658_10005078
1741 Ga0207658_10013403
1742 Ga0207658_10335502
1743 Ga0207677_10000194
1744 Ga0207703_10000499
1745 Ga0207703_10000918
1746 Ga0207703_10003457
1747 Ga0207703_10005021
1748 Ga0207703_11043808
1749 Ga0207639_10002175
1750 Ga0207639_10017740
1751 Ga0207639_10019235
1752 Ga0207639_10052900
1753 Ga0207639_10187889
1754 Ga0207639_10305834
1755 Ga0207639_10549495
1756 Ga0207639_10588591
1757 Ga0207678_10000095
1758 Ga0207678_10000608
1759 Ga0207678_10011244
1760 Ga0207678_10332873
1761 Ga0207702_10002411
1762 Ga0207702_10007703
1763 Ga0207702_10047819
1764 Ga0207702_10174651
1765 Ga0207702_10307887
1766 Ga0207702_11842699
1767 Ga0207702_12088482
1768 Ga0207641_10000010
1769 Ga0207641_10000239
1770 Ga0207641_10000263
1771 Ga0207641_10001750
1772 Ga0207641_10049402
1773 Ga0207641_10088779
1774 Ga0207641_10110067
1775 Ga0207641_10127601
1776 Ga0207648_10000007
1777 Ga0207648_11177217
1778 Ga0207676_10000006
1779 Ga0207676_10000046
1780 Ga0207676_10000137
1781 Ga0207676_10002267
1782 Ga0207676_10006162
1783 Ga0207676_10014115
1784 Ga0207676_10042837
1785 Ga0207674_10006156
1786 Ga0207674_10019665
1787 Ga0207674_10029230
1788 Ga0207674_10077073
1789 Ga0207674_10170099
1790 Ga0207674_10880340
1791 Ga0207675_100000131
1792 Ga0207675_100000418
1793 Ga0207675_100001453
1794 Ga0207675_100675975
1795 Ga0207675_101390528
1796 Ga0207683_10003569
1797 Ga0207683_10161557
1798 Ga0207698_10000182
1799 Ga0207698_10013572
1800 Ga0207698_10039816
1801 Ga0207698_10228613
1802 Ga0207698_10359308
1803 Ga0207698_10541139
1804 Ga0207698_10607782
1805 Ga0207698_11709090
1806 Ga0209813_10000015
1807 Ga0209974_10125950
1808 Ga0268266_10000117
1809 Ga0268266_10133476
1810 Ga0268266_10222069
1811 Ga0268266_10421260
1812 Ga0268266_11263725
1813 Ga0268266_11292241
1814 Ga0268265_10000001
1815 Ga0268265_10000026
1816 Ga0268265_10000266
1817 Ga0268265_10000918
1818 Ga0268265_10005225
1819 Ga0268265_10189552
1820 Ga0268264_10000003
1821 Ga0268264_10000075
1822 Ga0268264_10000087
1823 Ga0268264_10000106
1824 Ga0268264_10028912
1825 Ga0268264_11986481
1826 Ga0307517_10216975
1827 Ga0307517_10511980
1828 Ga0307515_10489616
1829 Ga0307513_10040972
1830 Ga0307513_10041326
1831 Ga0307408_100036775
1832 Ga0307408_100103486
1833 Ga0307408_100373938
1834 Ga0307408_100692248
1835 Ga0307405_10037630
1836 Ga0307405_10122314
1837 Ga0307405_10172309
1838 Ga0307405_10182095
1839 Ga0307405_10271163
1840 Ga0307405_10305129
1841 Ga0307405_10648899
1842 Ga0307413_10221462
1843 Ga0307413_11749120
1844 Ga0307410_10156769
1845 Ga0307410_10232303
1846 Ga0307410_10285118
1847 Ga0307410_11048892
1848 Ga0307410_11534445
1849 Ga0307406_10002984
1850 Ga0307406_10276960
1851 Ga0307406_10818011
1852 Ga0307407_10210081
1853 Ga0307407_10502609
1854 Ga0307412_10000933
1855 Ga0307412_10025608
1856 Ga0307412_10069292
1857 Ga0307412_10089335
1858 Ga0307412_10134859
1859 Ga0307412_10150498
1860 Ga0307412_10696873
1861 Ga0307412_11485099
1862 Ga0307409_100045924
1863 Ga0307409_101131920
1864 Ga0307409_101240750
1865 Ga0307416_100146446
1866 Ga0307416_100174915
1867 Ga0307416_100737875
1868 Ga0307416_101126857
1869 Ga0307414_10001776
1870 Ga0307414_10013540
1871 Ga0307414_10061999
1872 Ga0307414_10214026
1873 Ga0307414_10574121
1874 Ga0307414_10816200
1875 Ga0307414_10905217
1876 Ga0307414_11381540
1877 Ga0307414_11627641
1878 Ga0307411_10034229
1879 Ga0307411_10164427
1880 Ga0307411_10343397
1881 Ga0307411_10346620
1882 Ga0307411_10381127
1883 Ga0307411_10990954
1884 Ga0307415_102121679
1885 Ga0307510_10002511
1886 Ga0307510_10145093
1887 Ga0307510_10414759
1888 Ga0373930_0189371
1889 Ga0373946_0275961
1890 Ga0373931_1087989
1891 Ga0373927_0216911
1892 Ga0373947_0195877
1893 Ga0373925_0403645
1894 Ga0395899_0004019
1895 Ga0395900_0034599
1896 Ga0395900_0184335
1897 Ga0395898_0144521
1898 Ga0395905_0114237
1899 Ga0395901_0069561
1900 Ga0395901_0201382
1901 Ga0436363_1192622
1902 Ga0436362_1167794
1903 Ga0451789_0732163
1904 Ga0451789_0744125
1905 Ga0451789_1233599
1906 Ga0451791_0600836
1907 Ga0451795_1238003
1908 Ga0451800_0373317
1909 Ga0451833_0700584
1910 Ga0451839_1504574
1911 Ga0451851_1298683
1912 Ga0451853_3049099
1913 Ga0439448_0036066
1914 Ga0439448_0203920
1915 Ga0439450_055929
1916 Ga0439455_0003092
1917 Ga0439455_0007290
1918 Ga0450890_026896
1919 Ga0439458_0000183
1920 Ga0439458_0038983
1921 Ga0439458_0056306
1922 Ga0466969_0044024
1923 Ga0466972_0006177
1924 Ga0466973_0276660
1925 Ga0466965_0140424
1926 Ga0466966_0016992
1927 Ga0466961_0102193
1928 Ga0466961_0188117
1929 Ga0466963_0002342
1930 Ga0466964_0029999
1931 Ga0466971_0086613
1932 Ga0466971_0086774
1933 Ga0466968_0021345
1934 Ga0466968_0050375
1935 Ga0466968_0686042
1936 Ga0466970_0076227
1937 Ga0466970_0731958
1938 Ga0466957_0224891
1939 Ga0466957_0695571
1940 Ga0466960_0011429
1941 Ga0466959_0013984
1942 Ga0466959_0133290
1943 Ga0466958_0002202
1944 Ga0466958_0014687
1945 Ga0466958_0682025
1946 Ga0466967_0007995
1947 Ga0466967_0450090
1948 Ga0495617_201093
1949 Ga0495627_000216
1950 Ga0495627_000273
1951 Ga0495627_173357
1952 Ga0495590_0089598
1953 Ga0495638_0000051
1954 Ga0495638_0000253
1955 Ga0495650_0000861
1956 Ga0495584_0119083
1957 Ga0495583_0000422
1958 Ga0495583_0009923
1959 Ga0495583_0282605
1960 Ga0495606_0152475
1961 Ga0495610_0000311
1962 Ga0495616_0000013
1963 Ga0495632_0000357
1964 Ga0495632_0000359
1965 Ga0495637_0006811
1966 Ga0495637_0012784
1967 Ga0495637_0024023
1968 Ga0495643_0000009
1969 Ga0495643_0037629
1970 Ga0495643_0100799
1971 Ga0495648_0000032
1972 Ga0495648_0001780
1973 Ga0495648_0025654
1974 Ga0495648_0031355
1975 Ga0495648_0310992
1976 Ga0495663_0000003
1977 Ga0495663_0007553
1978 Ga0495663_0008640
1979 Ga0495654_0003985
1980 Ga0495654_0019995
1981 Ga0495654_0064205
1982 Ga0495609_0275550
1983 Ga0495597_0191305
1984 Ga0495597_0209958
1985 Ga0495622_0011529
1986 Ga0495633_0000102
1987 Ga0495633_0000786
1988 Ga0495633_0025418
1989 Ga0495633_0073717
1990 Ga0495633_0076967
1991 Ga0495633_0088784
1992 Ga0495633_0289882
1993 Ga0495668_0007526
1994 Ga0495668_0017694
1995 Ga0495668_0023881
1996 Ga0495668_0062584
1997 Ga0495668_0073328
1998 Ga0495668_0121622
1999 Ga0495611_0107889
2000 Ga0495625_0000031
2001 Ga0495625_0006969
2002 Ga0495625_0008935
2003 Ga0495625_0111092
2004 Ga0495625_0148371
2005 Ga0495625_0373816
2006 Ga0495625_0433432
2007 Ga0495669_0095356
2008 Ga0495670_0008493
2009 Ga0495670_0491773
2010 Ga0495670_0572265
2011 Ga0495670_0823298
2012 Ga0495671_0000013
2013 Ga0495671_0000020
2014 Ga0495671_0001468
2015 Ga0495649_0167227
2016 Ga0495589_0027870
2017 Ga0495672_0060682
2018 Ga0495676_0532786
2019 Ga0495683_0463540
2020 Ga0495677_0014583
2021 Ga0495677_0139659
2022 Ga0495685_181100
2023 Ga0495673_0000076
2024 Ga0495673_0068055
2025 Ga0495681_0000059
2026 Ga0495681_0000202
2027 Ga0495686_0000141
2028 Ga0495686_0000238
2029 Ga0495686_0002243
2030 Ga0495686_0018319
2031 Ga0495686_0026212
2032 Ga0495686_0320197
2033 Ga0495686_0350529
2034 Ga0496100_0196852
2035 Ga0496101_0016231
2036 Ga0496102_0000036
2037 Ga0496102_0009074
2038 Ga0496102_0407214
2039 Ga0496102_0857482
2040 Ga0496102_1300882
2041 Ga0496103_0000074
2042 Ga0496103_0007440
2043 Ga0496103_0023715
2044 Ga0496103_0079884
2045 Ga0496103_0185776
2046 Ga0496103_0240120
2047 Ga0496104_0753832
2048 Ga0496105_0185147
2049 Ga0496105_0213790
2050 Ga0496106_0190164
2051 Ga0496107_0037068
2052 Ga0496107_0137154
2053 Ga0496108_0003856
2054 Ga0496108_0221697
2055 Ga0496109_0003822
2056 Ga0496110_0010100
2057 Ga0496110_0049723
2058 Ga0496110_0243283
2059 Ga0496111_0039257
2060 Ga0496111_0304629
2061 Ga0496111_0406956
2062 Ga0496111_1045172
2063 Ga0496113_0074937
2064 Ga0496114_0714791
2065 Ga0496114_1377034
2066 Ga0496116_0022703
2067 Ga0496116_0024263
2068 Ga0496116_0112777
2069 Ga0496116_0174234
2070 Ga0496117_0000093
2071 Ga0496117_0005266
2072 Ga0496117_0022206
2073 Ga0496117_0032491
2074 Ga0496117_0033745
2075 Ga0496117_0064004
2076 Ga0496117_0247277
2077 Ga0496118_0000070
2078 Ga0496118_0000416
2079 Ga0496118_0008773
2080 Ga0496118_0035449
2081 Ga0496118_0039758
2082 Ga0496118_0153844
2083 Ga0496118_0220803
2084 Ga0496118_0259246
2085 Ga0496118_0274897
2086 Ga0496118_0579343
2087 Ga0496119_0036352
2088 Ga0496119_0049559
2089 Ga0496119_0049636
2090 Ga0496119_0096446
2091 Ga0496120_0055188
2092 Ga0496120_0221952
2093 Ga0496121_0000163
2094 Ga0496121_0000880
2095 Ga0496121_0001214
2096 Ga0496121_0001608
2097 Ga0496121_0047653
2098 Ga0496121_0097100
2099 Ga0496121_0097880
2100 Ga0496121_0108596
2101 Ga0496121_0139313
2102 Ga0496121_0174019
2103 Ga0496121_0296182
2104 Ga0496122_0000176
2105 Ga0496122_0010742
2106 Ga0496122_0021362
2107 Ga0496122_0436774
2108 Ga0496123_0000220
2109 Ga0496123_0029884
2110 Ga0496123_0115289
2111 Ga0496123_0185645
2112 Ga0496123_0228841
2113 Ga0496123_0295524
2114 Ga0496124_0000225
2115 Ga0496124_0003343
2116 Ga0496124_0012464
2117 Ga0496124_0128992
2118 Ga0496124_0256786
2119 Ga0496124_0310133
2120 Ga0496124_0419095
2121 Ga0496125_0008573
2122 Ga0496125_0025087
2123 Ga0496125_0042722
2124 Ga0496125_0059858
2125 Ga0496125_0149597
2126 Ga0496125_0212925
2127 Ga0496125_0251347
2128 Ga0496125_0342385
2129 Ga0496125_0576544
2130 Ga0496126_0010605
2131 Ga0496126_0011101
2132 Ga0496126_0059986
2133 Ga0496126_0252653
2134 Ga0496126_0345432
2135 Ga0496126_0806095
2136 Ga0495682_0370095
2137 Ga0501290_000401
2138 Ga0501290_006423
2139 Ga0501292_000049
2140 Ga0501293_040770
2141 Ga0501294_000131
2142 Ga0501299_060454
2143 Ga0501300_000260
2144 Ga0501300_000689
2145 Ga0501314_010069
2146 Ga0501335_007702
2147 Ga0501032_0482230
2148 Ga0501033_0592962
2149 Ga0501033_0790175
2150 Ga0501034_0004038
2151 Ga0501034_0037966
2152 Ga0501034_0241441
2153 Ga0501036_0231880
2154 Ga0501037_0700054
2155 Ga0501038_0199248
2156 Ga0501039_0270408
2157 Ga0501043_0070645
2158 Ga0501043_0124196
2159 Ga0501043_1323847
2160 Ga0501047_0002660
2161 Ga0501047_0303094
2162 Ga0501047_0363946
2163 Ga0501048_0067221
2164 Ga0501069_0001144
2165 Ga0501071_0237548
2166 Ga0501198_003618
2167 Ga0501202_017144
2168 Ga0501207_022073
2169 Ga0501211_037350
2170 Ga0501222_000186
2171 Ga0501223_000026
2172 Ga0501223_000155
2173 Ga0501223_000502
2174 Ga0501223_007293
2175 Ga0501223_013730
2176 Ga0501224_000006
2177 Ga0501224_000243
2178 Ga0501224_028771
2179 Ga0501227_009170
2180 Ga0501233_000373
2181 Ga0501233_079369
2182 Ga0501235_004175
2183 Ga0501235_005975
2184 Ga0501246_012043
2185 Ga0501249_061921
2186 Ga0501257_000014
2187 Ga0501259_003276
2188 Ga0501261_000013
2189 Ga0501221_002894
2190 Ga0501225_0000129
2191 Ga0501225_0000164
2192 Ga0501225_0012404
2193 Ga0501229_012275
2194 Ga0501245_002452
2195 Ga0501245_005990
2196 Ga0501080_0534872
2197 Ga0501241_009319
2198 Ga0501278_010491
2199 Ga0501279_000017
2200 Ga0501280_000015
2201 Ga0501280_001970
2202 Ga0501281_00053
2203 Ga0501282_000557
2204 Ga0501035_0898978
2205 Ga0501035_1276269
2206 Ga0501044_0003361
2207 Ga0501044_0234100
2208 Ga0501204_074564
2209 Ga0501212_101646
2210 Ga0501226_000041
2211 Ga0501226_020454
2212 nmdc:mga03n38_2083_c1
2213 nmdc:mga00v17_363493_c1
2214 nmdc:mga06z11_69_c1
2215 nmdc:mga04h51_116_c1
2216 nmdc:mga07m45_119069_c1
2217 nmdc:mga07m45_33591_c1
2218 nmdc:mga07m45_559499_c1
2219 nmdc:mga0sz30_184575_c1
2220 Ga0495601_0891215
2221 Ga0500635_0270068
2222 Ga0495619_0871968
2223 Ga0500643_000151
2224 Ga0500643_000242
2225 Ga0500643_000348
2226 Ga0500643_000471
2227 Ga0500643_000628
2228 Ga0500643_002009
2229 Ga0500643_097267
2230 Ga0500643_180149
2231 Ga0500644_0096104
2232 Ga0500644_0276246
2233 Ga0500646_0374147
2234 Ga0500647_0110793
2235 Ga0500647_0302306
2236 Ga0500651_0001723
2237 Ga0500566_0119319
2238 Ga0500641_0440304
2239 Ga0500556_0000025
2240 Ga0500562_037090
2241 Ga0500592_000037
2242 Ga0500592_002732
2243 Ga0500592_002889
2244 Ga0500593_154804
2245 Ga0500594_0006394
2246 Ga0500642_0000001
2247 Ga0500642_0002903
2248 Ga0500652_202890
2249 Ga0500655_011783
2250 Ga0500658_0002052
2251 Ga0500658_0156648
2252 Ga0500559_0011994
2253 Ga0500559_0021863
2254 Ga0500559_0029654
2255 Ga0500559_0113736
2256 Ga0500568_0045317
2257 Ga0500568_0182185
2258 Ga0500573_0000010
2259 Ga0500573_0296822
2260 Ga0500573_0508188
2261 Ga0500577_0045158
2262 Ga0500590_053507
2263 Ga0500604_0002377
2264 Ga0500604_0005821
2265 Ga0500604_0032864
2266 Ga0500604_0096251
2267 Ga0500604_0096993
2268 Ga0500616_0007814
2269 Ga0500616_0091162
2270 Ga0500616_0259593
2271 Ga0500622_0017836
2272 Ga0500622_0237033
2273 Ga0500622_0422613
2274 Ga0500624_000026
2275 Ga0500624_000058
2276 Ga0500627_0000411
2277 Ga0500627_0000731
2278 Ga0500627_0003404
2279 Ga0500627_0102669
2280 Ga0500627_0239955
2281 Ga0500627_0466807
2282 Ga0500636_0000920
2283 Ga0500636_0084556
2284 Ga0500636_0121211
2285 Ga0500570_022799
2286 Ga0500611_013745
2287 Ga0500645_000355
2288 Ga0500645_046727
2289 Ga0500645_089855
2290 Ga0500596_008569
2291 Ga0500661_000136
2292 Ga0501082_0874047
2293 Ga0466962_0016119
2294 Ga0466962_0183745
2295 2512645549
2296 2585260411
2297 2643729127
2298 2644038611
2299 2644045140
2300 2644391312
2301 2778126231
2302 2809063216
2303 2809079349
2304 2809083278
2305 2830075926
2306 2880520485
2307 2885432081
2308 2919710726
2309 2928028841
2310 2984556397
2311 2984565414
2312 2990268949
2313 2993356506
2314 2993697239

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01052

FliMN_C

Type III flagellar switch regulator (C-ring) FliN C-term

23

95

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tt9-assembly2.cif.gz_C structure of the c-terminal spoa domain of shigella flexneri spa33 0.5869 46 94
7uq3-assembly1.cif.gz_A jmjc domain-containing protein 5 (jmjd5) in complex with mn and (s)-2-(1-hydroxy-2,5-dioxopyrrolidin-3-yl)acetic acid 0.5776 17 64
3uep-assembly1.cif.gz_B crystal structure of yscq-c from yersinia pseudotuberculosis 0.5726 24 94
3m7u-assembly1.cif.gz_A crystal structure of alpha-lytic protease sb1+2 r64a/e182q mutant 0.5608 29 95
1o9y-assembly1.cif.gz_B crystal structure of the c-terminal domain of the hrcqb protein from pseudomonas syringae pv. phaseolicola 0.5495 24 93
ID Description Score Start End Superfamily
3ff6D02 Mainly Beta;Beta Barrel;ClpP/crotonase fold;Biotin dependent carboxylase carboxyltransferase 0.8254 73 96 2.40.460.10
2x24A02 Mainly Beta;Beta Barrel;ClpP/crotonase fold;Biotin dependent carboxylase carboxyltransferase 0.7879 74 94 2.40.460.10
af_Q7G9P4_276_397_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.7557 23 49 3.30.465.10
af_P81312_3_70_2.40.10.230 Mainly Beta;Beta Barrel;Thrombin, subunit H;Probable tRNA pseudouridine synthase domain 0.588 48 93 2.40.10.230
3uepB00 Mainly Beta;Roll;Surface presentation of antigens (SPOA);SpoA-like 0.5726 24 94 2.30.330.10
ID Description Score Start End GO Terms
AF-A0A496RS26-F1-model_v4 Flagellar motor switch protein FliN-like C-terminal domain-containing protein 0.8069 10 94 GO:0005886
GO:0006935
GO:0097588
AF-A0A2N9MWJ5-F1-model_v4 Flagellar motor switch protein FliN 0.7503 1 99
AF-A0A2N9MWJ5-F1-model_v4 Flagellar motor switch protein FliN 0.6996 1 99
AF-A0A3L7V3X4-F1-model_v4 FliM/FliN family flagellar motor switch protein 0.6753 3 98 GO:0005886
GO:0006935
GO:0097588
AF-A0A2V9N341-F1-model_v4 Flagellar motor switch protein FliM 0.6751 2 98 GO:0000160
GO:0003677
GO:0003774
GO:0005886
GO:0006355
GO:0009425
GO:0050918
GO:0071978

Map