F490956

General Info

Members Datasets Scaffolds Average Seq Length
1157 514 1044 306

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10003537|Ga0157369_100035379
Length 352
Sequence MAEHDIVTLPDSMRVFERGWLSSNNILFFDDEAQGGCALVDTGYLTHAPQTVALVQHALQGRPLRRLLNTHLHSDHCGGNAALQAIYGSHTRVPAAQIDDVRRWDTDALSYGPTGQECAHFTLPDRDADAGLADGMTARLGGFDWQVISAPGHDPHAVILFSPDTRVLISADALWERGFGVIFPELEGESGFAEQQAILERIAQLDARVVIPGHGRPFTSVNAAIDASLGRLAYLRADPERNALHAIRVLVKFKLLEQQALSHDALFAWFTQTTLMPRLQARFFASQSMETLVDAAIAALVKAGAATVEHGRILNRDWRAARRRCPATMQRRLFSSPGHAETRHIQSARVHH

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
14 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
20 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
21 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
22 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
23 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
24 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
25 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
26 2643221658 Variovorax sp. Root411 Isolate Unclassified
27 2643221672 Variovorax sp. Root434 Isolate Unclassified
28 2643221683 Variovorax sp. Root473 Isolate Unclassified
29 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
30 2721755523 Delftia sp. HK171 Isolate Unclassified
31 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
32 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
33 2738541297 Duganella sp. GV083 Isolate Unclassified
34 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
35 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
36 2738541357 Duganella sp. GV053 Isolate Unclassified
37 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
38 2738543003 Duganella sp. GV066 Isolate Unclassified
39 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
40 2738543026 Duganella sp. GV089 Isolate Unclassified
41 2738543029 Duganella sp. GV039 Isolate Unclassified
42 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
43 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
44 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
45 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
46 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
47 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
48 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
49 2818991446 Variovorax sp. 1180 Isolate Unclassified
50 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
51 2818991450 Burkholderia sp. 604 Isolate Unclassified
52 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
53 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
54 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
55 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
56 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
57 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
58 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
59 2842677519 Variovorax sp. R-72495 Isolate Unclassified
60 2842711865 Duganella sp. R-73148 Isolate Unclassified
61 2842747753 Variovorax sp. R-72060 Isolate Unclassified
62 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
63 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
64 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
65 2857558681 Duganella sp. R-74565 Isolate Unclassified
66 2857564685 Duganella sp. R-74599 Isolate Unclassified
67 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
68 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
69 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
70 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
71 2885198086 Variovorax sp. 679 Isolate Unclassified
72 2885211737 Variovorax sp. 553 Isolate Unclassified
73 2885266251 Ralstonia sp. SET104 Isolate Nodule
74 2899924645 Variovorax sp. 369 Isolate Unclassified
75 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
76 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
77 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
78 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
79 2904456579 Variovorax sp. 2002 Isolate Unclassified
80 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
81 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
82 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
83 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
84 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
85 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
86 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
87 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
88 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
89 2928037797 Variovorax sp. 1126 Isolate Unclassified
90 2928044640 Variovorax sp. 1128 Isolate Unclassified
91 2928051484 Variovorax sp. 1133 Isolate Unclassified
92 2928058823 Ralstonia sp. 1138 Isolate Unclassified
93 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
94 2928070936 Variovorax gossypii 1167 Isolate Unclassified
95 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
96 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
97 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
98 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
99 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
100 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
101 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
102 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
103 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
104 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
105 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
106 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
107 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
108 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
109 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
110 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
111 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
112 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
113 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
114 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
115 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
116 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
117 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
118 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
119 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
120 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
121 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
122 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
123 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
124 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
125 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
126 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
127 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
128 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
129 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
130 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
131 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
132 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
133 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
134 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
135 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
136 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
137 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
138 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
139 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
140 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
141 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
142 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
143 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
144 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
145 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
146 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
147 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
148 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
149 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
150 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
151 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
152 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
153 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
154 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
155 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
156 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
157 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
158 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
159 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
160 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
161 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
162 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
163 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
164 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
165 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
166 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
167 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
168 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
169 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
170 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
171 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
172 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
173 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
174 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
175 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
176 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
177 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
178 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
179 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
180 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
181 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
182 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
183 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
184 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
185 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
186 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
187 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
188 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
189 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
190 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
191 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
192 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
193 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
195 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
196 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
197 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
198 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
199 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
200 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
201 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
202 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
203 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
204 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
205 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
206 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
207 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
209 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
210 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
217 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
219 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
220 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
221 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
224 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
225 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
226 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
230 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
233 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
235 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
238 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
267 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
269 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
270 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
272 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
273 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
274 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
275 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
276 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
277 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
278 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
279 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
280 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
281 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
282 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
283 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
284 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
285 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
286 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
287 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
288 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
289 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
290 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
291 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
292 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
293 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
294 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
295 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
296 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
297 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
298 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
302 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
303 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
304 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
305 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
306 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
307 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
308 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
309 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
310 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
311 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
312 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
313 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
314 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
315 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
316 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
317 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
318 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
319 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
320 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
321 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
322 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
323 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
324 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
325 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
326 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
327 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
328 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
329 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
330 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
331 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
334 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
335 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
336 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
337 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
338 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
339 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
340 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
344 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
345 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
348 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
349 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
350 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
351 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
362 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
363 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
364 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
365 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
366 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
367 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
370 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
371 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
372 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
373 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
374 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
375 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
376 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
377 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
378 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
379 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
380 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
381 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
382 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
383 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
384 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
385 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
386 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
387 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
388 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
389 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
390 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
391 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
392 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
393 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
394 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
395 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
396 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
397 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
398 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
399 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
400 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
401 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
402 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
403 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
404 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
405 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
406 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
407 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
408 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
409 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
410 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
411 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
412 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
413 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
414 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
415 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
418 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
419 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
420 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
421 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
422 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
423 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
424 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
425 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
426 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
427 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
428 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
429 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
430 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
431 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
432 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
433 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
434 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
435 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
436 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
437 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
442 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
443 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
444 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
445 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
446 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
447 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
448 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
449 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
450 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
451 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
452 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
453 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
454 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
455 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
456 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
457 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
458 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
459 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
460 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
461 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
468 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
469 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
470 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
471 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
472 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
473 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
474 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
475 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
477 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
478 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
479 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
480 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
481 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
482 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
483 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
484 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
485 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
486 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
487 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
488 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
489 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
490 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
491 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
492 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
493 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
494 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
495 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
496 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
497 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
498 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
499 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
500 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
501 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
502 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
503 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
504 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
505 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
506 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
507 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
508 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
509 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
510 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
511 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
512 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
513 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
514 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.97
Metatranscriptomes 0.17
Isolates 9.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.53
Nodule 1.99
Rhizoplane 5.7
Rhizosphere 59.46
Stem 0
Stem Tuber 0
Unclassified 13.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000785 3300001915 Bacteria 9519
2 JGI24740J21852_10000258 3300001979 Bacteria 22346
3 JGI24740J21852_10001866 3300001979 Bacteria 9647
4 JGI24740J21852_10002029 3300001979 Bacteria 9257
5 JGI24740J21852_10016770 3300001979 Bacteria 2638
6 JGI24739J22299_10002254 3300001989 Bacteria 7412
7 JGI24739J22299_10010731 3300001989 Bacteria 3396
8 JGI24739J22299_10033380 3300001989 Bacteria 1761
9 JGI24739J22299_10051326 3300001989 Bacteria 1331
10 JGI24737J22298_10020747 3300001990 Bacteria 2096
11 JGI24735J21928_10000200 3300002067 Bacteria 21025
12 JGI24735J21928_10013211 3300002067 Bacteria 2600
13 JGI24735J21928_10041058 3300002067 Bacteria 1349
14 JGI24738J21930_10000642 3300002075 Bacteria 10088
15 JGI25156J39149_1000206 3300002705 Bacteria 40825
16 JGI25156J39149_1000316 3300002705 Bacteria 32017
17 JGI25156J39149_1000551 3300002705 Bacteria 21420
18 JGI25156J39149_1011204 3300002705 Bacteria 2045
19 JGI25156J39149_1015209 3300002705 Bacteria 1548
20 JGI25154J39366_1000712 3300002738 Bacteria 15122
21 JGI25154J39366_1001812 3300002738 Bacteria 6679
22 JGI25152J39213_1004088 3300002773 Bacteria 4730
23 JGI25150J39212_1001015 3300002774 Bacteria 8678
24 JGI25159J45721_1002308 3300002987 Bacteria 7336
25 JGI25159J45721_1019109 3300002987 Bacteria 1359
26 JGI25151J46595_10004529 3300003187 Bacteria 7332
27 JGI25151J46595_10008710 3300003187 Bacteria 4856
28 JGI25151J46595_10009102 3300003187 Bacteria 4730
29 JGI25165J46597_1000965 3300003214 Bacteria 19500
30 JGI25153J46596_10004515 3300003215 Bacteria 7488
31 rootH2_10011440 3300003320 Bacteria 6035
32 rootL2_10007165 3300003322 Bacteria 6042
33 rootL2_10007166 3300003322 Bacteria 5557
34 rootL2_10312837 3300003322 Bacteria 1169
35 rootH1_10014069 3300003316 Bacteria 4190
36 rootH1_10014069 3300003323 Bacteria 1560
37 rootH1_10216049 3300003323 Bacteria 3793
38 JGI25160J50197_1000343 3300003354 Bacteria 31330
39 JGI25160J50197_1003214 3300003354 Bacteria 7392
40 JGI25160J50197_1032377 3300003354 Bacteria 1329
41 JGI25161J50226_1001384 3300003374 Bacteria 7388
42 Ga0055538_1000024 3300003751 Bacteria 241526
43 Ga0055538_1002471 3300003751 Bacteria 2696
44 Ga0055538_1002475 3300003751 Bacteria 2692
45 Ga0055539_1000185 3300003752 Bacteria 52003
46 Ga0055533_1000112 3300003756 Bacteria 95020
47 Ga0055533_1000175 3300003756 Bacteria 57439
48 Ga0055533_1000673 3300003756 Bacteria 11270
49 Ga0055533_1001125 3300003756 Bacteria 7587
50 Ga0055532_1000006 3300003758 Bacteria 451244
51 Ga0055532_1000031 3300003758 Bacteria 231440
52 Ga0055525_1000501 3300003759 Bacteria 19691
53 Ga0055527_1000020 3300003760 Bacteria 231441
54 Ga0055527_1001991 3300003760 Bacteria 3723
55 Ga0055535_1000004 3300003761 Bacteria 451244
56 Ga0055535_1000023 3300003761 Bacteria 231441
57 Ga0055535_1000299 3300003761 Bacteria 50437
58 Ga0055542_1000035 3300003762 Bacteria 231441
59 Ga0055542_1000328 3300003762 Bacteria 50437
60 Ga0055542_1001561 3300003762 Bacteria 10780
61 Ga0055529_1000039 3300003763 Bacteria 231439
62 Ga0055529_1000273 3300003763 Bacteria 61443
63 Ga0055526_1005163 3300003771 Bacteria 7600
64 Ga0055526_1005272 3300003771 Bacteria 7488
65 Ga0055526_1008924 3300003771 Bacteria 4917
66 Ga0055537_1000486 3300003773 Bacteria 24570
67 Ga0055537_1001902 3300003773 Bacteria 7488
68 Ga0055537_1004388 3300003773 Bacteria 4039
69 Ga0055537_1015080 3300003773 Bacteria 1372
70 Ga0055524_1003583 3300003775 Bacteria 7488
71 Ga0055524_1015460 3300003775 Bacteria 2781
72 Ga0055524_1023072 3300003775 Bacteria 2013
73 Ga0055536_1010740 3300003781 Bacteria 3592
74 Ga0055536_1011591 3300003781 Bacteria 3360
75 Ga0055536_1015930 3300003781 Bacteria 2543
76 Ga0055534_1000439 3300003784 Bacteria 24570
77 Ga0055534_1002071 3300003784 Bacteria 7238
78 Ga0055534_1003605 3300003784 Bacteria 4815
79 Ga0055534_1003694 3300003784 Bacteria 4730
80 Ga0055528_1003758 3300003790 Bacteria 7488
81 Ga0055528_1010357 3300003790 Bacteria 3796
82 Ga0055528_1031618 3300003790 Bacteria 1372
83 Ga0055528_1034999 3300003790 Bacteria 1227
84 Ga0055530_10004040 3300003791 Bacteria 7879
85 Ga0055530_10007219 3300003791 Bacteria 4736
86 Ga0055540_1005061 3300003792 Bacteria 5702
87 Ga0055540_1009431 3300003792 Bacteria 3373
88 Ga0055540_1009461 3300003792 Bacteria 3360
89 Ga0055531_10005483 3300003794 Bacteria 7423
90 Ga0055531_10007805 3300003794 Bacteria 5764
91 Ga0055531_10007916 3300003794 Bacteria 5702
92 Ga0055531_10028701 3300003794 Bacteria 1912
93 Ga0055541_1011701 3300003841 Bacteria 1279
94 Ga0055543_1001937 3300004625 Bacteria 7405
95 Ga0055543_1005901 3300004625 Bacteria 3052
96 Ga0055543_1018420 3300004625 Bacteria 1302
97 Ga0055543_1022488 3300004625 Bacteria 1143
98 Ga0065165_1001102 3300005262 Bacteria 32088
99 Ga0065165_1001126 3300005262 Bacteria 31434
100 Ga0065165_1005144 3300005262 Bacteria 7570
101 Ga0065714_10005182 3300005288 Bacteria 5097
102 Ga0065704_10083485 3300005289 Bacteria 3458
103 Ga0068869_100024614 3300005334 Bacteria 4170
104 Ga0070666_10020927 3300005335 Bacteria 4235
105 Ga0070682_100018189 3300005337 Bacteria 4104
106 Ga0070682_100059832 3300005337 Bacteria 2407
107 Ga0068868_100088492 3300005338 Bacteria 2492
108 Ga0070661_100002918 3300005344 Bacteria 11784
109 Ga0070659_100001434 3300005366 Bacteria 17182
110 Ga0070659_100257527 3300005366 Bacteria 1447
111 Ga0070667_100035326 3300005367 Bacteria 4186
112 Ga0070667_100327395 3300005367 Bacteria 1383
113 Ga0070663_100000246 3300005455 Bacteria 27518
114 Ga0070663_100056262 3300005455 Bacteria 2818
115 Ga0070663_100128513 3300005455 Bacteria 1921
116 Ga0070678_100049511 3300005456 Bacteria 3033
117 Ga0070662_100116409 3300005457 Bacteria 2043
118 Ga0070662_100386599 3300005457 Bacteria 1152
119 Ga0068867_100120677 3300005459 Bacteria 2026
120 Ga0070707_100226855 3300005468 Bacteria 1819
121 Ga0068853_100041539 3300005539 Bacteria 3929
122 Ga0068853_100161652 3300005539 Bacteria 2021
123 Ga0068855_100000711 3300005563 Bacteria 40763
124 Ga0068855_100018406 3300005563 Bacteria 8393
125 Ga0068855_100025580 3300005563 Bacteria 7060
126 Ga0068855_100098090 3300005563 Bacteria 3376
127 Ga0070664_100000122 3300005564 Bacteria 51758
128 Ga0068857_100065940 3300005577 Bacteria 3221
129 Ga0068857_100626720 3300005577 Bacteria 1018
130 Ga0068854_100000121 3300005578 Bacteria 53603
131 Ga0068854_100009507 3300005578 Bacteria 6278
132 Ga0068854_100047034 3300005578 Bacteria 3074
133 Ga0068856_100001446 3300005614 Bacteria 24888
134 Ga0068852_100154213 3300005616 Bacteria 2138
135 Ga0068852_100411452 3300005616 Bacteria 1332
136 Ga0068851_10040908 3300005834 Bacteria 2330
137 Ga0068851_10118284 3300005834 Bacteria 1422
138 Ga0075365_10100480 3300006038 Bacteria 1980
139 Ga0075365_10163423 3300006038 Bacteria 1552
140 Ga0075363_100009243 3300006048 Bacteria 4629
141 Ga0075363_100037152 3300006048 Bacteria 2557
142 Ga0075364_10029260 3300006051 Bacteria 3532
143 Ga0075364_10160684 3300006051 Bacteria 1516
144 Ga0075432_10082038 3300006058 Bacteria 1170
145 Ga0075362_10009305 3300006177 Bacteria 3795
146 Ga0075366_10004441 3300006195 Bacteria 7526
147 Ga0075366_10010505 3300006195 Bacteria 5199
148 Ga0075366_10010822 3300006195 Bacteria 5131
149 Ga0075366_10019603 3300006195 Bacteria 3917
150 Ga0075366_10036687 3300006195 Bacteria 2890
151 Ga0075366_10107390 3300006195 Bacteria 1678
152 Ga0097621_100379390 3300006237 Bacteria 1262
153 Ga0075370_10001204 3300006353 Bacteria 10924
154 Ga0075370_10007017 3300006353 Bacteria 5712
155 Ga0075370_10024642 3300006353 Bacteria 3325
156 Ga0075370_10239352 3300006353 Bacteria 1075
157 Ga0079104_1000020 3300006946 Bacteria 256848
158 Ga0099826_10040205 3300006948 Bacteria 3263
159 Ga0105251_10000332 3300009011 Bacteria 47333
160 Ga0105251_10000447 3300009011 Bacteria 39853
161 Ga0105251_10040311 3300009011 Bacteria 2277
162 Ga0105244_10000935 3300009036 Bacteria 24595
163 Ga0105244_10033323 3300009036 Bacteria 2717
164 Ga0105244_10036959 3300009036 Bacteria 2555
165 Ga0105244_10043092 3300009036 Bacteria 2330
166 Ga0105250_10001224 3300009092 Bacteria 14257
167 Ga0105240_10026888 3300009093 Bacteria 7545
168 Ga0105240_10065397 3300009093 Bacteria 4514
169 Ga0105240_10263715 3300009093 Bacteria 1986
170 Ga0105240_10536060 3300009093 Bacteria 1297
171 Ga0105245_10327949 3300009098 Bacteria 1510
172 Ga0105243_10035400 3300009148 Bacteria 3870
173 Ga0105248_10024995 3300009177 Bacteria 6639
174 Ga0105237_10011522 3300009545 Bacteria 9355
175 Ga0105237_10043373 3300009545 Bacteria 4531
176 Ga0105237_10167945 3300009545 Bacteria 2193
177 Ga0105238_10000107 3300009551 Bacteria 91765
178 Ga0105238_10051269 3300009551 Bacteria 4151
179 Ga0105238_10311097 3300009551 Bacteria 1560
180 Ga0105238_10695647 3300009551 Bacteria 1028
181 Ga0105239_10001202 3300010375 Bacteria 35405
182 Ga0105246_10057760 3300011119 Bacteria 2686
183 Ga0105246_10188285 3300011119 Bacteria 1595
184 Ga0157347_1003243 3300012502 Bacteria 1447
185 Ga0157347_1003874 3300012502 Bacteria 1366
186 Ga0157373_10003474 3300013100 Bacteria 11913
187 Ga0157373_10019912 3300013100 Bacteria 4881
188 Ga0157373_10030277 3300013100 Bacteria 3894
189 Ga0157371_10000072 3300013102 Bacteria 163917
190 Ga0157371_10020702 3300013102 Bacteria 4839
191 Ga0157370_10000031 3300013104 Bacteria 139879
192 Ga0157370_10031584 3300013104 Bacteria 5178
193 Ga0157370_10495216 3300013104 Bacteria 1122
194 Ga0157369_10003537 3300013105 Bacteria 18566
195 Ga0157369_10009983 3300013105 Bacteria 10843
196 Ga0157369_10399645 3300013105 Bacteria 1426
197 Ga0157378_10217847 3300013297 Bacteria 1813
198 Ga0163162_10001505 3300013306 Bacteria 21711
199 Ga0163162_10293863 3300013306 Bacteria 1756
200 Ga0157372_10007632 3300013307 Bacteria 11501
201 Ga0157372_10020956 3300013307 Bacteria 7057
202 Ga0157372_10241963 3300013307 Bacteria 2094
203 Ga0157375_10021309 3300013308 Bacteria 5940
204 Ga0157375_10298438 3300013308 Bacteria 1775
205 Ga0163163_10588641 3300014325 Bacteria 1176
206 Ga0182008_10002261 3300014497 Bacteria 12160
207 Ga0182008_10041893 3300014497 Bacteria 2282
208 Ga0182008_10047927 3300014497 Bacteria 2122
209 Ga0182008_10081389 3300014497 Bacteria 1594
210 Ga0157376_10070110 3300014969 Bacteria 2974
211 Ga0157376_10197792 3300014969 Bacteria 1847
212 Ga0157376_10220755 3300014969 Bacteria 1755
213 Ga0182006_1000887 3300015261 Bacteria 20050
214 Ga0182006_1001327 3300015261 Bacteria 15150
215 Ga0182006_1003627 3300015261 Bacteria 7842
216 Ga0182007_10001296 3300015262 Bacteria 13520
217 Ga0182007_10002105 3300015262 Bacteria 10192
218 Ga0182007_10008808 3300015262 Bacteria 4116
219 Ga0182007_10029236 3300015262 Bacteria 1888
220 Ga0182007_10052423 3300015262 Bacteria 1344
221 Ga0183361_10001 3300016635 Bacteria 908583
222 Ga0163161_10000721 3300017792 Bacteria 26007
223 Ga0163161_10005221 3300017792 Bacteria 9037
224 Ga0163161_10134452 3300017792 Bacteria 1868
225 Ga0206351_10828020 3300020077 Bacteria 5153
226 Ga0154015_1137745 3300020610 Bacteria 8101
227 Ga0213872_10000227 3300021361 Bacteria 49306
228 Ga0213872_10000455 3300021361 Bacteria 33345
229 Ga0209435_100956 3300025206 Bacteria 4227
230 Ga0209784_100006 3300025224 Bacteria 930704
231 Ga0209784_100336 3300025224 Bacteria 23491
232 Ga0209784_100597 3300025224 Bacteria 11909
233 Ga0209566_100002 3300025225 Bacteria 2614868
234 Ga0209566_101778 3300025225 Bacteria 5062
235 Ga0209566_102676 3300025225 Bacteria 3120
236 Ga0209566_102841 3300025225 Bacteria 2943
237 Ga0209566_103712 3300025225 Bacteria 2249
238 Ga0209674_100010 3300025226 Bacteria 1038638
239 Ga0209674_100017 3300025226 Bacteria 689087
240 Ga0209674_100085 3300025226 Bacteria 190617
241 Ga0209674_100098 3300025226 Bacteria 167037
242 Ga0209674_100143 3300025226 Bacteria 107275
243 Ga0209674_102210 3300025226 Bacteria 4321
244 Ga0209674_105542 3300025226 Bacteria 1846
245 Ga0209672_100001 3300025228 Bacteria 2828210
246 Ga0209672_100448 3300025228 Bacteria 23309
247 Ga0209672_100942 3300025228 Bacteria 13005
248 Ga0209147_100001 3300025229 Bacteria 2384371
249 Ga0209147_100015 3300025229 Bacteria 565073
250 Ga0209147_101002 3300025229 Bacteria 12229
251 Ga0209563_100004 3300025230 Bacteria 1814108
252 Ga0209563_100371 3300025230 Bacteria 16423
253 Ga0207427_100779 3300025231 Bacteria 14514
254 Ga0209258_100001 3300025242 Bacteria 2384269
255 Ga0209258_100021 3300025242 Bacteria 565073
256 Ga0209258_100416 3300025242 Bacteria 50935
257 Ga0207425_1001142 3300025245 Bacteria 11944
258 Ga0207425_1002002 3300025245 Bacteria 7609
259 Ga0207425_1006486 3300025245 Bacteria 3196
260 Ga0209646_1000042 3300025246 Bacteria 343923
261 Ga0209646_1000082 3300025246 Bacteria 200645
262 Ga0209026_1004885 3300025250 Bacteria 3795
263 Ga0209677_100007 3300025253 Bacteria 1021332
264 Ga0209148_1000003 3300025254 Bacteria 2384288
265 Ga0209148_1000033 3300025254 Bacteria 555508
266 Ga0209148_1000395 3300025254 Bacteria 51537
267 Ga0209759_1000037 3300025256 Bacteria 259200
268 Ga0209759_1000163 3300025256 Bacteria 113845
269 Ga0209759_1000200 3300025256 Bacteria 94590
270 Ga0209759_1001087 3300025256 Bacteria 17706
271 Ga0209759_1011906 3300025256 Bacteria 2439
272 Ga0209759_1013497 3300025256 Bacteria 2206
273 Ga0209129_1000274 3300025258 Bacteria 49988
274 Ga0209129_1009674 3300025258 Bacteria 2504
275 Ga0209233_1000123 3300025261 Bacteria 228400
276 Ga0209565_1000106 3300025263 Bacteria 122574
277 Ga0209565_1000918 3300025263 Bacteria 15767
278 Ga0209565_1001943 3300025263 Bacteria 8117
279 Ga0209565_1020412 3300025263 Bacteria 1398
280 Ga0209455_1000001 3300025272 Bacteria 2384278
281 Ga0209455_1000028 3300025272 Bacteria 565073
282 Ga0209673_1000072 3300025273 Bacteria 236935
283 Ga0209673_1000619 3300025273 Bacteria 54306
284 Ga0209673_1004370 3300025273 Bacteria 7609
285 Ga0209673_1004987 3300025273 Bacteria 6881
286 Ga0209673_1011146 3300025273 Bacteria 3728
287 Ga0209130_1001472 3300025284 Bacteria 15421
288 Ga0209675_1000640 3300025291 Bacteria 24883
289 Ga0209675_1001887 3300025291 Bacteria 11301
290 Ga0209675_1006247 3300025291 Bacteria 4819
291 Ga0209675_1016368 3300025291 Bacteria 2162
292 Ga0209676_1000088 3300025292 Bacteria 263010
293 Ga0209676_1002102 3300025292 Bacteria 15367
294 Ga0209676_1004436 3300025292 Bacteria 7828
295 Ga0209025_1000776 3300025294 Bacteria 52843
296 Ga0209025_1002118 3300025294 Bacteria 22348
297 Ga0209025_1014725 3300025294 Bacteria 4781
298 Ga0209025_1014828 3300025294 Bacteria 4756
299 Ga0209025_1018553 3300025294 Bacteria 3931
300 Ga0209564_1000573 3300025295 Bacteria 58351
301 Ga0209564_1000684 3300025295 Bacteria 49988
302 Ga0209564_1000816 3300025295 Bacteria 42443
303 Ga0209564_1005009 3300025295 Bacteria 7779
304 Ga0209758_1000691 3300025297 Bacteria 49988
305 Ga0209758_1007543 3300025297 Bacteria 7361
306 Ga0209758_1027809 3300025297 Bacteria 2408
307 Ga0209050_1000110 3300025298 Bacteria 216664
308 Ga0209050_1000447 3300025298 Bacteria 74743
309 Ga0209256_1000065 3300025299 Bacteria 248104
310 Ga0209256_1000554 3300025299 Bacteria 53681
311 Ga0209256_1000591 3300025299 Bacteria 50522
312 Ga0209256_1000713 3300025299 Bacteria 44089
313 Ga0209256_1016039 3300025299 Bacteria 2579
314 Ga0207426_1000007 3300025302 Bacteria 971011
315 Ga0207426_1000124 3300025302 Bacteria 218145
316 Ga0207426_1000568 3300025302 Bacteria 49988
317 Ga0209051_1000454 3300025303 Bacteria 54312
318 Ga0209051_1000578 3300025303 Bacteria 43994
319 Ga0209051_1000686 3300025303 Bacteria 37500
320 Ga0209051_1001351 3300025303 Bacteria 21273
321 Ga0209051_1005018 3300025303 Bacteria 7887
322 Ga0209051_1013717 3300025303 Bacteria 3834
323 Ga0209051_1062425 3300025303 Bacteria 1165
324 Ga0209051_1063048 3300025303 Bacteria 1156
325 Ga0209257_1000022 3300025304 Bacteria 765258
326 Ga0209257_1000093 3300025304 Bacteria 263088
327 Ga0209257_1000417 3300025304 Bacteria 82249
328 Ga0209257_1006397 3300025304 Bacteria 7609
329 Ga0209257_1037295 3300025304 Bacteria 1483
330 Ga0207656_10020722 3300025321 Bacteria 2616
331 Ga0207696_1004560 3300025711 Bacteria 5936
332 Ga0207655_1010023 3300025728 Bacteria 5804
333 Ga0207713_1000875 3300025735 Bacteria 27539
334 Ga0207713_1001844 3300025735 Bacteria 16167
335 Ga0207680_10044341 3300025903 Bacteria 2615
336 Ga0207647_10001408 3300025904 Bacteria 18464
337 Ga0207647_10001996 3300025904 Bacteria 15612
338 Ga0207647_10038844 3300025904 Bacteria 3007
339 Ga0207695_10001449 3300025913 Bacteria 39706
340 Ga0207695_10002542 3300025913 Bacteria 26794
341 Ga0207695_10027634 3300025913 Bacteria 6313
342 Ga0207671_10006552 3300025914 Bacteria 10345
343 Ga0207649_10001719 3300025920 Bacteria 12593
344 Ga0207694_10000130 3300025924 Bacteria 77624
345 Ga0207694_10020853 3300025924 Bacteria 4961
346 Ga0207694_10261885 3300025924 Bacteria 1417
347 Ga0207644_10212074 3300025931 Bacteria 1532
348 Ga0207690_10007146 3300025932 Bacteria 6631
349 Ga0207690_10122127 3300025932 Bacteria 1894
350 Ga0207706_10051661 3300025933 Bacteria 3629
351 Ga0207706_10142047 3300025933 Bacteria 2112
352 Ga0207709_10000267 3300025935 Bacteria 61457
353 Ga0207709_10000941 3300025935 Bacteria 21805
354 Ga0207709_10001726 3300025935 Bacteria 14735
355 Ga0207709_10012361 3300025935 Bacteria 4704
356 Ga0207711_10014917 3300025941 Bacteria 6455
357 Ga0207711_10106989 3300025941 Bacteria 2483
358 Ga0207679_10000007 3300025945 Bacteria 460140
359 Ga0207667_10134814 3300025949 Bacteria 2543
360 Ga0207640_10000107 3300025981 Bacteria 63143
361 Ga0207640_10033445 3300025981 Bacteria 3199
362 Ga0207658_10011030 3300025986 Bacteria 6152
363 Ga0207658_10171682 3300025986 Bacteria 1787
364 Ga0207658_10201881 3300025986 Bacteria 1660
365 Ga0207677_10023580 3300026023 Bacteria 3805
366 Ga0207677_10348544 3300026023 Bacteria 1240
367 Ga0207639_10040157 3300026041 Bacteria 3491
368 Ga0207639_10166509 3300026041 Bacteria 1863
369 Ga0207678_10000207 3300026067 Bacteria 51939
370 Ga0207678_10434165 3300026067 Bacteria 1140
371 Ga0207702_10000260 3300026078 Bacteria 61036
372 Ga0207674_10133860 3300026116 Bacteria 2441
373 Ga0207683_10084446 3300026121 Bacteria 2822
374 Ga0207683_10084964 3300026121 Bacteria 2814
375 Ga0207698_10065115 3300026142 Bacteria 2860
376 Ga0209281_1000002 3300027111 Bacteria 1924012
377 Ga0209371_1006422 3300027312 Bacteria 4357
378 Ga0209282_1056267 3300027666 Bacteria 2220
379 Ga0207428_10279054 3300027907 Bacteria 1241
380 Ga0268266_10185824 3300028379 Bacteria 1895
381 Ga0307517_10006619 3300028786 Bacteria 17080
382 Ga0307517_10161740 3300028786 Bacteria 1500
383 Ga0307515_10000975 3300028794 Bacteria 65367
384 Ga0307515_10001526 3300028794 Bacteria 51800
385 Ga0265338_10000335 3300028800 Bacteria 85548
386 Ga0268256_1007251 3300030500 Bacteria 3983
387 Ga0307512_10009073 3300030522 Bacteria 9621
388 Ga0316177_1077576 3300030731 Bacteria 1844
389 Ga0316176_1153596 3300030732 Bacteria 2753
390 Ga0314311_1010593 3300030733 Bacteria 7569
391 Ga0316179_1077944 3300030734 Bacteria 1206
392 Ga0316178_1121589 3300030735 Bacteria 2641
393 Ga0316180_1051098 3300030736 Bacteria 1390
394 Ga0316183_1023089 3300030742 Bacteria 7862
395 Ga0316182_1007091 3300030745 Bacteria 2506
396 Ga0265332_10000005 3300031238 Bacteria 377525
397 Ga0307513_10000730 3300031456 Bacteria 47218
398 Ga0307513_10035123 3300031456 Bacteria 5615
399 Ga0307513_10336970 3300031456 Bacteria 1260
400 Ga0307509_10006623 3300031507 Bacteria 15481
401 Ga0307408_100002798 3300031548 Bacteria 12112
402 Ga0307408_100162818 3300031548 Bacteria 1773
403 Ga0307408_100471218 3300031548 Bacteria 1093
404 Ga0307514_10000646 3300031649 Bacteria 63402
405 Ga0307405_10008289 3300031731 Bacteria 5258
406 Ga0307405_10019867 3300031731 Bacteria 3743
407 Ga0307405_10049582 3300031731 Bacteria 2595
408 Ga0307405_10314680 3300031731 Bacteria 1193
409 Ga0307410_10432695 3300031852 Bacteria 1070
410 Ga0307406_10111864 3300031901 Bacteria 1882
411 Ga0307406_10156074 3300031901 Bacteria 1634
412 Ga0307406_10222647 3300031901 Bacteria 1403
413 Ga0307406_10262768 3300031901 Bacteria 1307
414 Ga0307412_10000014 3300031911 Bacteria 353795
415 Ga0307412_10118567 3300031911 Bacteria 1901
416 Ga0307412_10187953 3300031911 Bacteria 1559
417 Ga0307412_10222367 3300031911 Bacteria 1448
418 Ga0307412_10409209 3300031911 Bacteria 1107
419 Ga0307416_100149156 3300032002 Bacteria 2141
420 Ga0307416_100301528 3300032002 Bacteria 1593
421 Ga0307414_10030204 3300032004 Bacteria 3537
422 Ga0307414_10290327 3300032004 Bacteria 1378
423 Ga0307411_10025712 3300032005 Bacteria 3532
424 Ga0307411_10041548 3300032005 Bacteria 2927
425 Ga0307411_10112134 3300032005 Bacteria 1954
426 Ga0307411_10445249 3300032005 Bacteria 1082
427 Ga0307415_100206016 3300032126 Bacteria 1565
428 Ga0307510_10117433 3300033180 Bacteria 2377
429 Ga0373939_0069760 3300035114 Bacteria 1141
430 Ga0395899_0005221 3300037312 Bacteria 10100
431 Ga0395899_0312362 3300037312 Bacteria 1061
432 Ga0395900_0003101 3300037418 Bacteria 18047
433 Ga0395900_0137015 3300037418 Bacteria 2508
434 Ga0395900_0428413 3300037418 Bacteria 1282
435 Ga0395900_0433856 3300037418 Bacteria 1272
436 Ga0395900_0508172 3300037418 Bacteria 1154
437 Ga0395905_0000014 3300037471 Bacteria 394209
438 Ga0395905_0001455 3300037471 Bacteria 28407
439 Ga0395905_0025111 3300037471 Bacteria 5620
440 Ga0395905_0054470 3300037471 Bacteria 3743
441 Ga0395905_0090074 3300037471 Bacteria 2875
442 Ga0395905_0221177 3300037471 Bacteria 1772
443 Ga0395905_0331432 3300037471 Bacteria 1412
444 Ga0395901_0086837 3300038443 Bacteria 3271
445 Ga0395901_0589057 3300038443 Bacteria 1123
446 Ga0436360_0199866 3300039438 Bacteria 1351
447 Ga0436361_0108001 3300039447 Bacteria 112244
448 Ga0439461_0010773 3300041410 Bacteria 1685
449 Ga0439442_009852 3300042002 Bacteria 1932
450 Ga0439445_0025388 3300042004 Bacteria 1511
451 Ga0439449_0002480 3300042007 Bacteria 7212
452 Ga0439449_0003932 3300042007 Bacteria 5759
453 Ga0439457_025419 3300042014 Bacteria 1310
454 Ga0439462_0002161 3300042015 Bacteria 4525
455 Ga0450911_000960 3300042115 Bacteria 7518
456 Ga0450898_003346 3300042134 Bacteria 2298
457 Ga0450904_000699 3300042139 Bacteria 5932
458 Ga0450906_012352 3300042145 Bacteria 1584
459 Ga0439446_0049366 3300042156 Bacteria 1254
460 Ga0439458_0035191 3300042157 Bacteria 1203
461 Ga0450908_008194 3300042184 Bacteria 1960
462 Ga0450893_0006408 3300042532 Bacteria 1902
463 Ga0451577_0000126 3300042876 Bacteria 168037
464 Ga0451577_0007365 3300042876 Bacteria 10803
465 Ga0451577_0030526 3300042876 Bacteria 4869
466 Ga0451577_0118247 3300042876 Bacteria 2374
467 Ga0466986_0063161 3300044650 Bacteria 2566
468 Ga0466969_0008094 3300044656 Bacteria 5582
469 Ga0466977_0000177 3300044666 Bacteria 16300
470 Ga0466978_0006210 3300044671 Bacteria 6062
471 Ga0466982_0113955 3300044672 Bacteria 1671
472 Ga0466965_0002685 3300044683 Bacteria 7614
473 Ga0466961_0000242 3300044693 Bacteria 36694
474 Ga0466961_0054128 3300044693 Bacteria 2560
475 Ga0466961_0079253 3300044693 Bacteria 2080
476 Ga0466961_0088202 3300044693 Bacteria 1960
477 Ga0466964_0010895 3300044706 Bacteria 3435
478 Ga0466964_0035019 3300044706 Bacteria 2005
479 Ga0453684_0000365 3300044712 Bacteria 186233
480 Ga0453684_0010054 3300044712 Bacteria 16269
481 Ga0453684_0021318 3300044712 Bacteria 9690
482 Ga0453684_0061229 3300044712 Bacteria 4834
483 Ga0453684_0147519 3300044712 Bacteria 2800
484 Ga0466971_0024344 3300044719 Bacteria 2701
485 Ga0466968_0044692 3300044735 Bacteria 1877
486 Ga0466970_0000666 3300044765 Bacteria 16847
487 Ga0466957_0084808 3300044842 Bacteria 1977
488 Ga0466957_0404862 3300044842 Bacteria 934
489 Ga0466960_0006119 3300044901 Bacteria 4814
490 Ga0466959_0001530 3300045049 Bacteria 14219
491 Ga0451576_0002838 3300045051 Bacteria 24922
492 Ga0466958_0009209 3300045836 Bacteria 5493
493 Ga0466967_0003039 3300045976 Bacteria 10765
494 Ga0466967_0118498 3300045976 Bacteria 2442
495 Ga0495617_000763 3300046452 Bacteria 15741
496 Ga0495627_007127 3300046453 Bacteria 4322
497 Ga0495592_0002694 3300046454 Bacteria 12565
498 Ga0495592_0008567 3300046454 Bacteria 7677
499 Ga0495592_0014938 3300046454 Bacteria 5895
500 Ga0495603_0003963 3300046455 Bacteria 8817
501 Ga0495603_0020309 3300046455 Bacteria 4026
502 Ga0495603_0059399 3300046455 Bacteria 2261
503 Ga0495590_0000012 3300046457 Bacteria 303377
504 Ga0495590_0000084 3300046457 Bacteria 62246
505 Ga0495590_0000977 3300046457 Bacteria 12589
506 Ga0495590_0008723 3300046457 Bacteria 3857
507 Ga0495590_0012050 3300046457 Bacteria 3218
508 Ga0495590_0014281 3300046457 Bacteria 2900
509 Ga0495590_0024905 3300046457 Bacteria 2106
510 Ga0495591_000034 3300046458 Bacteria 170328
511 Ga0495591_002308 3300046458 Bacteria 10792
512 Ga0495591_015488 3300046458 Bacteria 2691
513 Ga0495629_0000034 3300046459 Bacteria 118709
514 Ga0495629_0000787 3300046459 Bacteria 25598
515 Ga0495629_0002603 3300046459 Bacteria 13832
516 Ga0495629_0012376 3300046459 Bacteria 6178
517 Ga0495629_0053295 3300046459 Bacteria 2830
518 Ga0495629_0074829 3300046459 Bacteria 2365
519 Ga0495638_0001311 3300046460 Bacteria 22988
520 Ga0495638_0012516 3300046460 Bacteria 5810
521 Ga0495638_0012661 3300046460 Bacteria 5771
522 Ga0495638_0014469 3300046460 Bacteria 5330
523 Ga0495638_0016093 3300046460 Bacteria 5012
524 Ga0495638_0040870 3300046460 Bacteria 2937
525 Ga0495651_0004534 3300046462 Bacteria 10625
526 Ga0495651_0007605 3300046462 Bacteria 8284
527 Ga0495653_0000016 3300046463 Bacteria 200976
528 Ga0495653_0004112 3300046463 Bacteria 11769
529 Ga0495653_0039173 3300046463 Bacteria 3714
530 Ga0495653_0089879 3300046463 Bacteria 2249
531 Ga0495653_0144721 3300046463 Bacteria 1667
532 Ga0495650_0004616 3300046471 Bacteria 9348
533 Ga0495650_0007810 3300046471 Bacteria 6361
534 Ga0495650_0027039 3300046471 Bacteria 2658
535 Ga0495650_0045471 3300046471 Bacteria 1848
536 Ga0495580_0000278 3300046472 Bacteria 41441
537 Ga0495580_0004404 3300046472 Bacteria 11830
538 Ga0495580_0004918 3300046472 Bacteria 11171
539 Ga0495580_0005049 3300046472 Bacteria 10999
540 Ga0495580_0091172 3300046472 Bacteria 2121
541 Ga0495580_0289079 3300046472 Bacteria 1117
542 Ga0495580_0289091 3300046472 Bacteria 1117
543 Ga0495582_0002667 3300046473 Bacteria 9957
544 Ga0495582_0045727 3300046473 Bacteria 2411
545 Ga0495582_0051466 3300046473 Bacteria 2271
546 Ga0495605_0000043 3300046474 Bacteria 185216
547 Ga0495605_0000830 3300046474 Bacteria 21843
548 Ga0495605_0002974 3300046474 Bacteria 10254
549 Ga0495605_0006073 3300046474 Bacteria 6977
550 Ga0495605_0006180 3300046474 Bacteria 6906
551 Ga0495605_0013540 3300046474 Bacteria 4489
552 Ga0495639_0146749 3300046475 Bacteria 1136
553 Ga0495662_0077082 3300046476 Bacteria 1619
554 Ga0495664_0006772 3300046477 Bacteria 6338
555 Ga0495664_0009131 3300046477 Bacteria 5542
556 Ga0495664_0076225 3300046477 Bacteria 2007
557 Ga0495584_0000895 3300046491 Bacteria 19104
558 Ga0495584_0039735 3300046491 Bacteria 2377
559 Ga0495585_0049601 3300046492 Bacteria 2330
560 Ga0495585_0199217 3300046492 Bacteria 1020
561 Ga0495596_0012523 3300046500 Bacteria 3630
562 Ga0495596_0014462 3300046500 Bacteria 3327
563 Ga0495596_0036085 3300046500 Bacteria 1959
564 Ga0495596_0045304 3300046500 Bacteria 1729
565 Ga0495607_0012772 3300046501 Bacteria 5527
566 Ga0495607_0015720 3300046501 Bacteria 4898
567 Ga0495607_0017079 3300046501 Bacteria 4668
568 Ga0495607_0018405 3300046501 Bacteria 4453
569 Ga0495607_0058271 3300046501 Bacteria 2209
570 Ga0495583_0003270 3300046506 Bacteria 12594
571 Ga0495583_0003699 3300046506 Bacteria 11377
572 Ga0495606_0000046 3300046507 Bacteria 210855
573 Ga0495606_0000051 3300046507 Bacteria 201659
574 Ga0495606_0001477 3300046507 Bacteria 31345
575 Ga0495606_0002448 3300046507 Bacteria 21561
576 Ga0495606_0019174 3300046507 Bacteria 5100
577 Ga0495606_0020480 3300046507 Bacteria 4873
578 Ga0495606_0039712 3300046507 Bacteria 3168
579 Ga0495606_0077350 3300046507 Bacteria 2077
580 Ga0495606_0094139 3300046507 Bacteria 1836
581 Ga0495606_0096306 3300046507 Bacteria 1810
582 Ga0495606_0135766 3300046507 Bacteria 1457
583 Ga0495608_0003810 3300046511 Bacteria 10838
584 Ga0495608_0004488 3300046511 Bacteria 9965
585 Ga0495610_0000212 3300046512 Bacteria 62904
586 Ga0495610_0001945 3300046512 Bacteria 17766
587 Ga0495610_0003677 3300046512 Bacteria 11780
588 Ga0495610_0006604 3300046512 Bacteria 7925
589 Ga0495610_0011887 3300046512 Bacteria 5285
590 Ga0495610_0014872 3300046512 Bacteria 4550
591 Ga0495610_0028838 3300046512 Bacteria 2930
592 Ga0495616_0019812 3300046513 Bacteria 3667
593 Ga0495616_0057564 3300046513 Bacteria 1916
594 Ga0495618_0012080 3300046514 Bacteria 5241
595 Ga0495618_0056644 3300046514 Bacteria 2481
596 Ga0495618_0121828 3300046514 Bacteria 1670
597 Ga0495620_0020398 3300046515 Bacteria 3238
598 Ga0495628_0007903 3300046516 Bacteria 9165
599 Ga0495628_0012022 3300046516 Bacteria 7301
600 Ga0495628_0016359 3300046516 Bacteria 6189
601 Ga0495628_0039442 3300046516 Bacteria 3777
602 Ga0495628_0061124 3300046516 Bacteria 2954
603 Ga0495628_0105506 3300046516 Bacteria 2171
604 Ga0495628_0268835 3300046516 Bacteria 1269
605 Ga0495630_0000773 3300046517 Bacteria 22481
606 Ga0495630_0002849 3300046517 Bacteria 11996
607 Ga0495630_0015979 3300046517 Bacteria 5484
608 Ga0495630_0033045 3300046517 Bacteria 3858
609 Ga0495631_0008968 3300046518 Bacteria 5014
610 Ga0495631_0009228 3300046518 Bacteria 4937
611 Ga0495631_0025724 3300046518 Bacteria 2707
612 Ga0495631_0138177 3300046518 Bacteria 1046
613 Ga0495632_0018571 3300046519 Bacteria 3812
614 Ga0495632_0062244 3300046519 Bacteria 1809
615 Ga0495637_0000003 3300046520 Bacteria 623293
616 Ga0495637_0067376 3300046520 Bacteria 1453
617 Ga0495643_0000387 3300046522 Bacteria 58350
618 Ga0495643_0000819 3300046522 Bacteria 33951
619 Ga0495643_0005752 3300046522 Bacteria 8297
620 Ga0495643_0019395 3300046522 Bacteria 3934
621 Ga0495643_0087809 3300046522 Bacteria 1609
622 Ga0495644_0014718 3300046523 Bacteria 2994
623 Ga0495644_0040075 3300046523 Bacteria 1766
624 Ga0495648_0001796 3300046524 Bacteria 20647
625 Ga0495648_0005645 3300046524 Bacteria 10354
626 Ga0495648_0036861 3300046524 Bacteria 3147
627 Ga0495648_0044505 3300046524 Bacteria 2770
628 Ga0495663_0045801 3300046525 Bacteria 1342
629 Ga0495666_0004846 3300046526 Bacteria 6800
630 Ga0495666_0011195 3300046526 Bacteria 4476
631 Ga0495666_0016228 3300046526 Bacteria 3709
632 Ga0495666_0019712 3300046526 Bacteria 3345
633 Ga0495642_0000811 3300046528 Bacteria 15155
634 Ga0495642_0022147 3300046528 Bacteria 2502
635 Ga0495642_0041221 3300046528 Bacteria 1878
636 Ga0495642_0042307 3300046528 Bacteria 1855
637 Ga0495642_0061613 3300046528 Bacteria 1557
638 Ga0495652_0008885 3300046529 Bacteria 9144
639 Ga0495652_0029842 3300046529 Bacteria 4786
640 Ga0495654_0001375 3300046530 Bacteria 16863
641 Ga0495654_0005335 3300046530 Bacteria 7489
642 Ga0495654_0016152 3300046530 Bacteria 3952
643 Ga0495654_0017288 3300046530 Bacteria 3794
644 Ga0495654_0102317 3300046530 Bacteria 1317
645 Ga0495665_0006309 3300046531 Bacteria 6397
646 Ga0495665_0032682 3300046531 Bacteria 2783
647 Ga0495665_0076756 3300046531 Bacteria 1758
648 Ga0495640_0012113 3300046533 Bacteria 6603
649 Ga0495640_0021939 3300046533 Bacteria 4677
650 Ga0495640_0029876 3300046533 Bacteria 3906
651 Ga0495640_0080507 3300046533 Bacteria 2166
652 Ga0495586_0017497 3300046535 Bacteria 3810
653 Ga0495586_0210404 3300046535 Bacteria 1103
654 Ga0495587_0076666 3300046536 Bacteria 1941
655 Ga0495587_0116595 3300046536 Bacteria 1531
656 Ga0495609_0027452 3300046538 Bacteria 2602
657 Ga0495609_0027764 3300046538 Bacteria 2585
658 Ga0495609_0028387 3300046538 Bacteria 2553
659 Ga0495609_0079377 3300046538 Bacteria 1435
660 Ga0495621_0131016 3300046539 Bacteria 976
661 Ga0495597_0000051 3300046542 Bacteria 97079
662 Ga0495597_0000427 3300046542 Bacteria 36177
663 Ga0495597_0002723 3300046542 Bacteria 10899
664 Ga0495597_0008352 3300046542 Bacteria 5188
665 Ga0495597_0044051 3300046542 Bacteria 1985
666 Ga0495645_0000160 3300046543 Bacteria 46637
667 Ga0495645_0010279 3300046543 Bacteria 6559
668 Ga0495645_0107393 3300046543 Bacteria 1978
669 Ga0495645_0172506 3300046543 Bacteria 1488
670 Ga0495645_0265623 3300046543 Bacteria 1134
671 Ga0495622_0000106 3300046557 Bacteria 72908
672 Ga0495622_0013697 3300046557 Bacteria 3760
673 Ga0495633_0000668 3300046558 Bacteria 31607
674 Ga0495633_0001509 3300046558 Bacteria 18015
675 Ga0495633_0001590 3300046558 Bacteria 17241
676 Ga0495633_0002416 3300046558 Bacteria 13204
677 Ga0495667_0085194 3300046559 Bacteria 2051
678 Ga0495656_0002335 3300046615 Bacteria 6276
679 Ga0495656_0072664 3300046615 Bacteria 1532
680 Ga0495668_0000541 3300046616 Bacteria 47075
681 Ga0495668_0000969 3300046616 Bacteria 31721
682 Ga0495668_0001070 3300046616 Bacteria 28906
683 Ga0495668_0001905 3300046616 Bacteria 18647
684 Ga0495668_0012245 3300046616 Bacteria 5093
685 Ga0495668_0042016 3300046616 Bacteria 2545
686 Ga0495668_0095672 3300046616 Bacteria 1625
687 Ga0495668_0241084 3300046616 Bacteria 990
688 Ga0495634_0039614 3300046642 Bacteria 3208
689 Ga0495611_0001217 3300046648 Bacteria 13312
690 Ga0495625_0000235 3300046660 Bacteria 86400
691 Ga0495625_0001517 3300046660 Bacteria 27799
692 Ga0495625_0002510 3300046660 Bacteria 19765
693 Ga0495625_0067378 3300046660 Bacteria 2519
694 Ga0495625_0090714 3300046660 Bacteria 2113
695 Ga0495625_0246772 3300046660 Bacteria 1160
696 Ga0495635_0003231 3300046663 Bacteria 11234
697 Ga0495635_0004430 3300046663 Bacteria 9730
698 Ga0495661_0002559 3300046665 Bacteria 13950
699 Ga0495661_0002706 3300046665 Bacteria 13503
700 Ga0495661_0006671 3300046665 Bacteria 8100
701 Ga0495661_0015207 3300046665 Bacteria 5138
702 Ga0495661_0034728 3300046665 Bacteria 3170
703 Ga0495661_0065527 3300046665 Bacteria 2140
704 Ga0495588_0000141 3300046674 Bacteria 104615
705 Ga0495588_0019804 3300046674 Bacteria 3301
706 Ga0495588_0022410 3300046674 Bacteria 3122
707 Ga0495588_0026830 3300046674 Bacteria 2877
708 Ga0495588_0047192 3300046674 Bacteria 2211
709 Ga0495588_0077497 3300046674 Bacteria 1733
710 Ga0495588_0116445 3300046674 Bacteria 1408
711 Ga0495588_0141528 3300046674 Bacteria 1271
712 Ga0495657_0019379 3300046675 Bacteria 4908
713 Ga0495599_0014702 3300046678 Bacteria 4847
714 Ga0495599_0023659 3300046678 Bacteria 3840
715 Ga0495599_0138724 3300046678 Bacteria 1508
716 Ga0495623_0010298 3300046679 Bacteria 6051
717 Ga0495623_0016332 3300046679 Bacteria 4795
718 Ga0495623_0040355 3300046679 Bacteria 2981
719 Ga0495623_0050912 3300046679 Bacteria 2621
720 Ga0495623_0074636 3300046679 Bacteria 2107
721 Ga0495623_0078178 3300046679 Bacteria 2051
722 Ga0495646_0001545 3300046680 Bacteria 13711
723 Ga0495646_0022615 3300046680 Bacteria 3964
724 Ga0495646_0070500 3300046680 Bacteria 2058
725 Ga0495669_0010551 3300046684 Bacteria 3906
726 Ga0495669_0034482 3300046684 Bacteria 2231
727 Ga0495669_0069006 3300046684 Bacteria 1609
728 Ga0495613_0020339 3300046689 Bacteria 4948
729 Ga0495613_0030708 3300046689 Bacteria 3991
730 Ga0495613_0122995 3300046689 Bacteria 1862
731 Ga0495613_0247094 3300046689 Bacteria 1246
732 Ga0495624_0000205 3300046690 Bacteria 45459
733 Ga0495624_0002290 3300046690 Bacteria 14587
734 Ga0495624_0021094 3300046690 Bacteria 4325
735 Ga0495624_0027573 3300046690 Bacteria 3718
736 Ga0495670_0004189 3300046691 Bacteria 7063
737 Ga0495670_0169846 3300046691 Bacteria 1148
738 Ga0495671_0024475 3300046692 Bacteria 3143
739 Ga0495671_0033963 3300046692 Bacteria 2596
740 Ga0495671_0043149 3300046692 Bacteria 2264
741 Ga0495671_0113965 3300046692 Bacteria 1320
742 Ga0495671_0136577 3300046692 Bacteria 1195
743 Ga0495649_0000695 3300046694 Bacteria 27461
744 Ga0495649_0002152 3300046694 Bacteria 14088
745 Ga0495649_0003268 3300046694 Bacteria 11044
746 Ga0495649_0010744 3300046694 Bacteria 5392
747 Ga0495649_0021312 3300046694 Bacteria 3631
748 Ga0495649_0036777 3300046694 Bacteria 2689
749 Ga0495649_0065298 3300046694 Bacteria 1953
750 Ga0495649_0070829 3300046694 Bacteria 1869
751 Ga0495589_0000439 3300046794 Bacteria 30550
752 Ga0495589_0002011 3300046794 Bacteria 11514
753 Ga0495589_0024097 3300046794 Bacteria 3094
754 Ga0495589_0025407 3300046794 Bacteria 3006
755 Ga0495589_0073514 3300046794 Bacteria 1668
756 Ga0495589_0101125 3300046794 Bacteria 1395
757 Ga0495589_0130748 3300046794 Bacteria 1205
758 Ga0495600_0008583 3300046809 Bacteria 6283
759 Ga0495600_0009034 3300046809 Bacteria 6141
760 Ga0495600_0114661 3300046809 Bacteria 1755
761 Ga0495600_0139396 3300046809 Bacteria 1574
762 Ga0495660_0000200 3300046810 Bacteria 62557
763 Ga0495660_0002106 3300046810 Bacteria 12885
764 Ga0495660_0007439 3300046810 Bacteria 6430
765 Ga0495660_0124081 3300046810 Bacteria 1303
766 Ga0495660_0128587 3300046810 Bacteria 1273
767 Ga0495581_0002092 3300047315 Bacteria 11240
768 Ga0495581_0016419 3300047315 Bacteria 4305
769 Ga0495604_0025184 3300047317 Bacteria 4741
770 Ga0495604_0031524 3300047317 Bacteria 4204
771 Ga0495674_0008494 3300047319 Bacteria 9782
772 Ga0495674_0008617 3300047319 Bacteria 9699
773 Ga0495674_0024325 3300047319 Bacteria 5566
774 Ga0495674_0040630 3300047319 Bacteria 4158
775 Ga0495674_0079741 3300047319 Bacteria 2811
776 Ga0495674_0113721 3300047319 Bacteria 2292
777 Ga0495674_0244065 3300047319 Bacteria 1479
778 Ga0495672_0000075 3300047320 Bacteria 175957
779 Ga0495672_0000406 3300047320 Bacteria 52324
780 Ga0495672_0000977 3300047320 Bacteria 29598
781 Ga0495672_0003813 3300047320 Bacteria 12687
782 Ga0495672_0018677 3300047320 Bacteria 4593
783 Ga0495672_0021686 3300047320 Bacteria 4186
784 Ga0495672_0069303 3300047320 Bacteria 2003
785 Ga0495676_0000025 3300047321 Bacteria 149350
786 Ga0495676_0006235 3300047321 Bacteria 10970
787 Ga0495676_0017343 3300047321 Bacteria 6368
788 Ga0495676_0023782 3300047321 Bacteria 5311
789 Ga0495676_0071745 3300047321 Bacteria 2661
790 Ga0495680_0020264 3300047322 Bacteria 5598
791 Ga0495680_0026087 3300047322 Bacteria 4825
792 Ga0495680_0033511 3300047322 Bacteria 4157
793 Ga0495680_0103633 3300047322 Bacteria 2117
794 Ga0495680_0171593 3300047322 Bacteria 1570
795 Ga0495683_0000155 3300047323 Bacteria 67620
796 Ga0495683_0002243 3300047323 Bacteria 11812
797 Ga0495683_0003429 3300047323 Bacteria 9250
798 Ga0495683_0004800 3300047323 Bacteria 7589
799 Ga0495683_0020685 3300047323 Bacteria 3393
800 Ga0495683_0043539 3300047323 Bacteria 2260
801 Ga0495687_000547 3300047443 Bacteria 44844
802 Ga0495687_000627 3300047443 Bacteria 40736
803 Ga0495687_000758 3300047443 Bacteria 34926
804 Ga0495687_001513 3300047443 Bacteria 21200
805 Ga0495687_002818 3300047443 Bacteria 13404
806 Ga0495687_014868 3300047443 Bacteria 3980
807 Ga0495687_016199 3300047443 Bacteria 3756
808 Ga0495687_025480 3300047443 Bacteria 2795
809 Ga0495687_051986 3300047443 Bacteria 1735
810 Ga0495675_0006427 3300047444 Bacteria 7194
811 Ga0495675_0006662 3300047444 Bacteria 7074
812 Ga0495675_0023306 3300047444 Bacteria 3944
813 Ga0495675_0084418 3300047444 Bacteria 1998
814 Ga0495677_0002217 3300047445 Bacteria 7695
815 Ga0495677_0002280 3300047445 Bacteria 7573
816 Ga0495679_000007 3300047446 Bacteria 401482
817 Ga0495679_001595 3300047446 Bacteria 12740
818 Ga0495679_003753 3300047446 Bacteria 7224
819 Ga0495679_007681 3300047446 Bacteria 4469
820 Ga0495679_021258 3300047446 Bacteria 2245
821 Ga0495679_028842 3300047446 Bacteria 1816
822 Ga0495673_0021439 3300047469 Bacteria 3189
823 Ga0495681_0001002 3300047470 Bacteria 21645
824 Ga0495681_0004123 3300047470 Bacteria 9985
825 Ga0495681_0007028 3300047470 Bacteria 7270
826 Ga0495681_0084506 3300047470 Bacteria 1411
827 Ga0495684_0017791 3300047471 Bacteria 5475
828 Ga0495686_0000129 3300047472 Bacteria 155797
829 Ga0495686_0003327 3300047472 Bacteria 14031
830 Ga0495686_0028449 3300047472 Bacteria 3640
831 Ga0495686_0031367 3300047472 Bacteria 3447
832 Ga0495593_0008516 3300047673 Bacteria 5962
833 Ga0495593_0012628 3300047673 Bacteria 4825
834 Ga0495593_0019982 3300047673 Bacteria 3751
835 Ga0495593_0022519 3300047673 Bacteria 3509
836 Ga0495593_0035082 3300047673 Bacteria 2724
837 Ga0495602_0003324 3300048088 Bacteria 16603
838 Ga0495602_0058304 3300048088 Bacteria 3380
839 Ga0495602_0061647 3300048088 Bacteria 3259
840 Ga0495602_0076100 3300048088 Bacteria 2846
841 Ga0495602_0085309 3300048088 Bacteria 2639
842 Ga0495614_0001884 3300048089 Bacteria 9209
843 Ga0495614_0012638 3300048089 Bacteria 3703
844 Ga0495614_0023508 3300048089 Bacteria 2660
845 Ga0495626_0001298 3300048091 Bacteria 20382
846 Ga0495626_0024558 3300048091 Bacteria 2954
847 Ga0495626_0028422 3300048091 Bacteria 2711
848 Ga0495626_0036127 3300048091 Bacteria 2355
849 Ga0495626_0075547 3300048091 Bacteria 1506
850 Ga0495626_0098939 3300048091 Bacteria 1273
851 Ga0495626_0116214 3300048091 Bacteria 1154
852 Ga0496100_0000810 3300048903 Bacteria 14975
853 Ga0496100_0045774 3300048903 Bacteria 2809
854 Ga0496100_0127468 3300048903 Bacteria 1788
855 Ga0496101_0000342 3300048904 Bacteria 31386
856 Ga0496101_0008291 3300048904 Bacteria 6789
857 Ga0496101_0014137 3300048904 Bacteria 5360
858 Ga0496101_0015620 3300048904 Bacteria 5121
859 Ga0496101_0024892 3300048904 Bacteria 4149
860 Ga0496102_0000539 3300048905 Bacteria 40961
861 Ga0496102_0010675 3300048905 Bacteria 7913
862 Ga0496102_0026595 3300048905 Bacteria 5163
863 Ga0496102_0049381 3300048905 Bacteria 3828
864 Ga0496102_0094659 3300048905 Bacteria 2768
865 Ga0496102_0147534 3300048905 Bacteria 2208
866 Ga0496102_0156525 3300048905 Bacteria 2142
867 Ga0496102_0359397 3300048905 Bacteria 1371
868 Ga0496103_0002434 3300048906 Bacteria 11713
869 Ga0496103_0003458 3300048906 Bacteria 9654
870 Ga0496103_0005140 3300048906 Bacteria 7875
871 Ga0496103_0005743 3300048906 Bacteria 7412
872 Ga0496103_0014214 3300048906 Bacteria 4725
873 Ga0496103_0075429 3300048906 Bacteria 2115
874 Ga0496103_0178626 3300048906 Bacteria 1364
875 Ga0496103_0254833 3300048906 Bacteria 1129
876 Ga0496104_0058997 3300048907 Bacteria 3633
877 Ga0496104_0076481 3300048907 Bacteria 3188
878 Ga0496104_0171644 3300048907 Bacteria 2079
879 Ga0496104_0219332 3300048907 Bacteria 1814
880 Ga0496104_0341016 3300048907 Bacteria 1411
881 Ga0496104_0365575 3300048907 Bacteria 1355
882 Ga0496105_0032827 3300048908 Bacteria 4261
883 Ga0496105_0064708 3300048908 Bacteria 3017
884 Ga0496105_0125678 3300048908 Bacteria 2114
885 Ga0496105_0155790 3300048908 Bacteria 1876
886 Ga0496105_0231000 3300048908 Bacteria 1503
887 Ga0496105_0299175 3300048908 Bacteria 1294
888 Ga0496106_0000021 3300048909 Bacteria 168346
889 Ga0496106_0035905 3300048909 Bacteria 3708
890 Ga0496106_0281598 3300048909 Bacteria 1332
891 Ga0496107_0018313 3300048910 Bacteria 4931
892 Ga0496107_0031069 3300048910 Bacteria 3809
893 Ga0496107_0288492 3300048910 Bacteria 1221
894 Ga0496108_0204998 3300048911 Bacteria 1711
895 Ga0496109_0438041 3300048912 Bacteria 1235
896 Ga0496110_0000711 3300048913 Bacteria 23018
897 Ga0496110_0027992 3300048913 Bacteria 4836
898 Ga0496110_0044395 3300048913 Bacteria 3881
899 Ga0496110_0142498 3300048913 Bacteria 2167
900 Ga0496110_0289928 3300048913 Bacteria 1490
901 Ga0496111_0089816 3300048914 Bacteria 2250
902 Ga0496112_0059110 3300048915 Bacteria 3777
903 Ga0496112_0151624 3300048915 Bacteria 2285
904 Ga0496113_0023633 3300048916 Bacteria 4359
905 Ga0496113_0027244 3300048916 Bacteria 4095
906 Ga0496113_0036318 3300048916 Bacteria 3609
907 Ga0496113_0056019 3300048916 Bacteria 2958
908 Ga0496113_0313911 3300048916 Bacteria 1256
909 Ga0496114_0019343 3300048917 Bacteria 5517
910 Ga0496114_0221697 3300048917 Bacteria 1660
911 Ga0496114_0359329 3300048917 Bacteria 1288
912 Ga0496115_0070283 3300048918 Bacteria 2838
913 Ga0496116_0010050 3300048919 Bacteria 7981
914 Ga0496116_0030738 3300048919 Bacteria 3853
915 Ga0496116_0042311 3300048919 Bacteria 3116
916 Ga0496116_0043575 3300048919 Bacteria 3056
917 Ga0496116_0210721 3300048919 Bacteria 1007
918 Ga0496117_0000147 3300048920 Bacteria 149471
919 Ga0496117_0002567 3300048920 Bacteria 22609
920 Ga0496117_0012918 3300048920 Bacteria 7318
921 Ga0496117_0021508 3300048920 Bacteria 5214
922 Ga0496117_0025244 3300048920 Bacteria 4677
923 Ga0496117_0044421 3300048920 Bacteria 3219
924 Ga0496117_0053127 3300048920 Bacteria 2849
925 Ga0496117_0076032 3300048920 Bacteria 2228
926 Ga0496117_0100212 3300048920 Bacteria 1835
927 Ga0496117_0104985 3300048920 Bacteria 1777
928 Ga0496118_0001655 3300048921 Bacteria 32731
929 Ga0496118_0002065 3300048921 Bacteria 28282
930 Ga0496118_0006406 3300048921 Bacteria 12957
931 Ga0496118_0007404 3300048921 Bacteria 11647
932 Ga0496118_0011909 3300048921 Bacteria 8420
933 Ga0496118_0027656 3300048921 Bacteria 4792
934 Ga0496118_0053029 3300048921 Bacteria 3087
935 Ga0496118_0055836 3300048921 Bacteria 2974
936 Ga0496118_0060088 3300048921 Bacteria 2825
937 Ga0496118_0087554 3300048921 Bacteria 2159
938 Ga0496118_0205264 3300048921 Bacteria 1162
939 Ga0496119_0129482 3300048922 Bacteria 1377
940 Ga0496120_0083436 3300048923 Bacteria 1725
941 Ga0496120_0101611 3300048923 Bacteria 1518
942 Ga0496121_0000357 3300048924 Bacteria 94003
943 Ga0496121_0005013 3300048924 Bacteria 17320
944 Ga0496121_0005655 3300048924 Bacteria 15902
945 Ga0496121_0006811 3300048924 Bacteria 13997
946 Ga0496121_0015816 3300048924 Bacteria 7854
947 Ga0496121_0028026 3300048924 Bacteria 5255
948 Ga0496121_0071563 3300048924 Bacteria 2788
949 Ga0496121_0207116 3300048924 Bacteria 1392
950 Ga0496122_0009757 3300048925 Bacteria 10029
951 Ga0496122_0029779 3300048925 Bacteria 4592
952 Ga0496122_0109260 3300048925 Bacteria 1821
953 Ga0496122_0199968 3300048925 Bacteria 1170
954 Ga0496123_0007671 3300048926 Bacteria 10087
955 Ga0496123_0014593 3300048926 Bacteria 6498
956 Ga0496123_0021370 3300048926 Bacteria 5032
957 Ga0496123_0025182 3300048926 Bacteria 4493
958 Ga0496124_0021066 3300048927 Bacteria 6012
959 Ga0496124_0081778 3300048927 Bacteria 2653
960 Ga0496124_0104152 3300048927 Bacteria 2294
961 Ga0496124_0270837 3300048927 Bacteria 1244
962 Ga0496125_0005570 3300048928 Bacteria 13925
963 Ga0496125_0021833 3300048928 Bacteria 5957
964 Ga0496125_0023273 3300048928 Bacteria 5722
965 Ga0496125_0066972 3300048928 Bacteria 2833
966 Ga0496125_0069233 3300048928 Bacteria 2771
967 Ga0496125_0101755 3300048928 Bacteria 2113
968 Ga0496125_0121868 3300048928 Bacteria 1858
969 Ga0496125_0195662 3300048928 Bacteria 1330
970 Ga0496126_0000038 3300048929 Bacteria 347738
971 Ga0496126_0002720 3300048929 Bacteria 23375
972 Ga0496126_0004689 3300048929 Bacteria 16149
973 Ga0496126_0019860 3300048929 Bacteria 6607
974 Ga0495678_000051 3300049459 Bacteria 159383
975 Ga0495678_000750 3300049459 Bacteria 29475
976 Ga0495678_039087 3300049459 Bacteria 1915
977 Ga0495678_048081 3300049459 Bacteria 1666
978 Ga0495682_0017828 3300049460 Bacteria 2675
979 Ga0495682_0029907 3300049460 Bacteria 2017
980 Ga0495682_0041770 3300049460 Bacteria 1681
981 Ga0501292_000563 3300049515 Bacteria 4578
982 Ga0501297_013258 3300049520 Bacteria 965
983 Ga0501031_0000595 3300049568 Bacteria 21292
984 Ga0501034_0002256 3300049571 Bacteria 23650
985 Ga0501043_0000572 3300049579 Bacteria 32900
986 Ga0501046_0000843 3300049580 Bacteria 29885
987 Ga0501047_0000906 3300049581 Bacteria 30269
988 Ga0501048_0165367 3300049582 Bacteria 1566
989 Ga0501071_0152560 3300049587 Bacteria 1724
990 Ga0501206_001433 3300049653 Bacteria 2979
991 Ga0501249_006712 3300049679 Bacteria 2370
992 Ga0501257_018246 3300049686 Bacteria 1635
993 Ga0501225_0010539 3300049705 Bacteria 2617
994 Ga0501262_000763 3300049759 Bacteria 3713
995 Ga0501265_000858 3300049762 Bacteria 3380
996 Ga0501281_00583 3300049777 Bacteria 3281
997 Ga0501035_0047135 3300049822 Bacteria 3871
998 Ga0501044_0016648 3300049823 Bacteria 7894
999 nmdc:mga03n38_71691_c1 3300050490 Bacteria 1604
1000 nmdc:mga0yw44_263157_c1 3300050492 Bacteria 1150
1001 nmdc:mga0k408_197345_c1 3300050493 Bacteria 1201
1002 nmdc:mga0k408_42889_c1 3300050493 Bacteria 2606
1003 nmdc:mga0k408_52318_c1 3300050493 Bacteria 2367
1004 nmdc:mga0k408_91335_c1 3300050493 Bacteria 1789
1005 nmdc:mga07m45_130056_c1 3300050496 Bacteria 1457
1006 nmdc:mga07m45_224510_c1 3300050496 Bacteria 1093
1007 nmdc:mga07m45_51279_c1 3300050496 Bacteria 2327
1008 nmdc:mga07m45_6317_c1 3300050496 Bacteria 5985
1009 nmdc:mga07m45_98731_c1 3300050496 Bacteria 1676
1010 nmdc:mga0qj67_73687_c1 3300050509 Bacteria 2727
1011 Ga0500610_0029739 3300053079 Bacteria 2762
1012 Ga0500610_0033853 3300053079 Bacteria 2610
1013 Ga0500643_010739 3300053087 Bacteria 3387
1014 Ga0500643_041512 3300053087 Bacteria 1351
1015 Ga0500643_047212 3300053087 Bacteria 1241
1016 Ga0500583_0007293 3300053092 Bacteria 3881
1017 Ga0500651_0009059 3300053093 Bacteria 5892
1018 Ga0500651_0143449 3300053093 Bacteria 1438
1019 Ga0500650_0083717 3300053098 Bacteria 1492
1020 Ga0500562_008109 3300053108 Bacteria 2648
1021 Ga0500571_000063 3300053110 Bacteria 32832
1022 Ga0500592_002030 3300053116 Bacteria 3259
1023 Ga0500593_004575 3300053117 Bacteria 5376
1024 Ga0500594_0000775 3300053118 Bacteria 6806
1025 Ga0500607_001363 3300053121 Bacteria 22191
1026 Ga0500607_069106 3300053121 Bacteria 1827
1027 Ga0500608_005042 3300053122 Bacteria 5191
1028 Ga0500626_026781 3300053128 Bacteria 2595
1029 Ga0500655_000382 3300053133 Bacteria 9499
1030 Ga0500658_0000200 3300053134 Bacteria 28358
1031 Ga0500658_0003764 3300053134 Bacteria 5711
1032 Ga0500559_0004356 3300053136 Bacteria 6743
1033 Ga0500559_0107367 3300053136 Bacteria 1291
1034 Ga0500559_0132763 3300053136 Bacteria 1163
1035 Ga0500573_0081752 3300053140 Bacteria 1835
1036 Ga0500574_002196 3300053141 Bacteria 3152
1037 Ga0500586_000300 3300053145 Bacteria 9940
1038 Ga0500616_0171317 3300053153 Bacteria 985
1039 Ga0500622_0114146 3300053156 Bacteria 1316
1040 Ga0500627_0003094 3300053158 Bacteria 5078
1041 Ga0500634_0002634 3300053161 Bacteria 7643
1042 Ga0500634_0007255 3300053161 Bacteria 5446
1043 Ga0500636_0080994 3300053177 Bacteria 1870
1044 Ga0500645_012197 3300053730 Bacteria 2782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0404862 Ga0466957_0404862_26_775 248
2 iso_pu_bacteria 2643221683 2644466562 248
3 iso_pu_bacteria 2928037797 2928040654 257
4 iso_pu_bacteria 2928044640 2928047496 257
5 3300046528 Ga0495642_0061613 Ga0495642_0061613_744_1544 266
6 3300033180 Ga0307510_10117433 Ga0307510_101174332 272
7 3300046539 Ga0495621_0131016 Ga0495621_0131016_128_952 272
8 3300053153 Ga0500616_0171317 Ga0500616_0171317_144_968 273
9 3300046530 Ga0495654_0005335 Ga0495654_0005335_4475_5392 279
10 3300046538 Ga0495609_0028387 Ga0495609_0028387_1350_2267 279
11 3300046542 Ga0495597_0002723 Ga0495597_0002723_2670_3587 279
12 3300046616 Ga0495668_0012245 Ga0495668_0012245_2676_3593 279
13 3300046794 Ga0495589_0024097 Ga0495589_0024097_871_1788 279
14 3300047320 Ga0495672_0003813 Ga0495672_0003813_9112_10029 279
15 3300005262 Ga0065165_1001102 Ga0065165_10011022 281
16 3300046660 Ga0495625_0246772 Ga0495625_0246772_10_855 281
17 3300048913 Ga0496110_0044395 Ga0496110_0044395_150_1004 283
18 3300047321 Ga0495676_0006235 Ga0495676_0006235_3773_4627 284
19 3300006038 Ga0075365_10163423 Ga0075365_101634232 288
20 3300006048 Ga0075363_100009243 Ga0075363_1000092433 288
21 3300006195 Ga0075366_10010822 Ga0075366_100108225 288
22 3300042876 Ga0451577_0030526 Ga0451577_0030526_1359_2279 288
23 3300046460 Ga0495638_0040870 Ga0495638_0040870_258_1220 288
24 3300050492 nmdc:mga0yw44_263157_c1 nmdc:mga0yw44_263157_c1_39_968 288
25 3300046492 Ga0495585_0049601 Ga0495585_0049601_72_950 292
26 3300046492 Ga0495585_0199217 Ga0495585_0199217_76_954 292
27 3300046507 Ga0495606_0096306 Ga0495606_0096306_875_1753 292
28 3300046518 Ga0495631_0025724 Ga0495631_0025724_1772_2650 292
29 3300046518 Ga0495631_0138177 Ga0495631_0138177_86_964 292
30 3300046525 Ga0495663_0045801 Ga0495663_0045801_230_1108 292
31 3300046528 Ga0495642_0042307 Ga0495642_0042307_426_1304 292
32 3300046616 Ga0495668_0095672 Ga0495668_0095672_141_1019 292
33 3300046616 Ga0495668_0241084 Ga0495668_0241084_49_927 292
34 3300046665 Ga0495661_0034728 Ga0495661_0034728_2032_2910 292
35 3300046679 Ga0495623_0074636 Ga0495623_0074636_400_1278 292
36 3300046691 Ga0495670_0169846 Ga0495670_0169846_201_1079 292
37 3300046692 Ga0495671_0033963 Ga0495671_0033963_704_1582 292
38 3300046692 Ga0495671_0136577 Ga0495671_0136577_235_1113 292
39 3300046809 Ga0495600_0139396 Ga0495600_0139396_139_1017 292
40 3300004625 Ga0055543_1005901 Ga0055543_10059012 293
41 3300031901 Ga0307406_10111864 Ga0307406_101118642 293
42 3300046542 Ga0495597_0044051 Ga0495597_0044051_536_1417 293
43 iso_pu_bacteria 644736347 644746466 293
44 3300042139 Ga0450904_000699 Ga0450904_000699_3609_4538 294
45 3300045051 Ga0451576_0002838 Ga0451576_0002838_13591_14481 294
46 3300047469 Ga0495673_0021439 Ga0495673_0021439_16_909 294
47 3300037312 Ga0395899_0312362 Ga0395899_0312362_116_1024 295
48 3300037418 Ga0395900_0508172 Ga0395900_0508172_127_1035 295
49 3300042157 Ga0439458_0035191 Ga0439458_0035191_179_1069 295
50 3300047446 Ga0495679_021258 Ga0495679_021258_1179_2066 295
51 3300050496 nmdc:mga07m45_224510_c1 nmdc:mga07m45_224510_c1_190_1080 295
52 3300053128 Ga0500626_026781 Ga0500626_026781_413_1345 295
53 3300017792 Ga0163161_10134452 Ga0163161_101344522 296
54 3300037471 Ga0395905_0054470 Ga0395905_0054470_537_1427 296
55 3300042007 Ga0439449_0002480 Ga0439449_0002480_5765_6658 296
56 3300042014 Ga0439457_025419 Ga0439457_025419_263_1156 296
57 3300042015 Ga0439462_0002161 Ga0439462_0002161_3434_4327 296
58 3300046457 Ga0495590_0000977 Ga0495590_0000977_9056_9946 296
59 3300046463 Ga0495653_0089879 Ga0495653_0089879_295_1185 296
60 3300046475 Ga0495639_0146749 Ga0495639_0146749_229_1119 296
61 3300046477 Ga0495664_0009131 Ga0495664_0009131_1959_2849 296
62 3300046515 Ga0495620_0020398 Ga0495620_0020398_934_1824 296
63 3300046542 Ga0495597_0008352 Ga0495597_0008352_331_1221 296
64 3300046615 Ga0495656_0002335 Ga0495656_0002335_5231_6124 296
65 3300046684 Ga0495669_0069006 Ga0495669_0069006_461_1351 296
66 3300046690 Ga0495624_0021094 Ga0495624_0021094_14_904 296
67 3300047319 Ga0495674_0113721 Ga0495674_0113721_913_1803 296
68 3300047320 Ga0495672_0069303 Ga0495672_0069303_11_901 296
69 3300047322 Ga0495680_0103633 Ga0495680_0103633_553_1443 296
70 3300047323 Ga0495683_0004800 Ga0495683_0004800_3317_4207 296
71 3300047443 Ga0495687_016199 Ga0495687_016199_962_1852 296
72 3300047470 Ga0495681_0084506 Ga0495681_0084506_508_1398 296
73 3300047673 Ga0495593_0012628 Ga0495593_0012628_2415_3305 296
74 3300048903 Ga0496100_0045774 Ga0496100_0045774_234_1124 296
75 3300048904 Ga0496101_0024892 Ga0496101_0024892_547_1437 296
76 3300048905 Ga0496102_0147534 Ga0496102_0147534_925_1815 296
77 3300048906 Ga0496103_0002434 Ga0496103_0002434_2728_3618 296
78 3300048907 Ga0496104_0341016 Ga0496104_0341016_32_922 296
79 3300048910 Ga0496107_0018313 Ga0496107_0018313_2175_3065 296
80 3300048913 Ga0496110_0027992 Ga0496110_0027992_365_1255 296
81 3300048914 Ga0496111_0089816 Ga0496111_0089816_64_954 296
82 3300048916 Ga0496113_0023633 Ga0496113_0023633_924_1814 296
83 3300048920 Ga0496117_0021508 Ga0496117_0021508_932_1822 296
84 3300048921 Ga0496118_0006406 Ga0496118_0006406_10106_10996 296
85 3300048924 Ga0496121_0015816 Ga0496121_0015816_4694_5584 296
86 3300048926 Ga0496123_0014593 Ga0496123_0014593_3025_3915 296
87 3300048927 Ga0496124_0021066 Ga0496124_0021066_1541_2431 296
88 3300048928 Ga0496125_0023273 Ga0496125_0023273_2388_3278 296
89 3300053136 Ga0500559_0107367 Ga0500559_0107367_118_1050 296
90 3300037471 Ga0395905_0221177 Ga0395905_0221177_257_1150 297
91 3300046526 Ga0495666_0016228 Ga0495666_0016228_346_1239 297
92 3300047317 Ga0495604_0025184 Ga0495604_0025184_1379_2272 297
93 3300046520 Ga0495637_0067376 Ga0495637_0067376_342_1238 298
94 iso_pu_bacteria 2721755763 2723876119 298
95 iso_pu_bacteria 2738541297 2738826429 298
96 iso_pu_bacteria 2738541357 2739150226 298
97 iso_pu_bacteria 2738543003 2739192145 298
98 iso_pu_bacteria 2738543026 2739318622 298
99 iso_pu_bacteria 2738543029 2739336863 298
100 iso_pu_bacteria 2842711865 2842717035 298
101 iso_pu_bacteria 2856287931 2856293152 298
102 iso_pu_bacteria 2857357740 2857366731 298
103 iso_pu_bacteria 2857558681 2857558988 298
104 iso_pu_bacteria 2857564685 2857567637 298
105 3300041410 Ga0439461_0010773 Ga0439461_0010773_203_1147 299
106 iso_pu_bacteria 2508501125 2509129244 299
107 iso_pu_bacteria 2513237151 2513959325 299
108 iso_pu_bacteria 2513237166 2514048807 299
109 iso_pu_bacteria 2526164713 2527080185 299
110 iso_pu_bacteria 2562617112 2563055231 299
111 iso_pu_bacteria 2711768613 2713479128 299
112 iso_pu_bacteria 2744054900 2746086481 299
113 iso_pu_bacteria 2744054901 2746093880 299
114 iso_pu_bacteria 2751185846 2753566382 299
115 iso_pu_bacteria 2791355137 2792834808 299
116 iso_pu_bacteria 2818991450 2819625054 299
117 iso_pu_bacteria 2842324504 2842331709 299
118 iso_pu_bacteria 2842348783 2842356022 299
119 iso_pu_bacteria 2842454564 2842459221 299
120 iso_pu_bacteria 2842747753 2842752251 299
121 iso_pu_bacteria 2900634093 2900636538 299
122 iso_pu_bacteria 2904615490 2904619198 299
123 iso_pu_bacteria 2919527303 2919532023 299
124 iso_pu_bacteria 2921643360 2921654481 299
125 iso_pu_bacteria 2928108538 2928109381 299
126 iso_pu_bacteria 2928135762 2928137165 299
127 iso_pu_bacteria 2928503688 2928506692 299
128 iso_pu_bacteria 642555112 642591923 299
129 iso_pu_bacteria 642555113 642620000 299
130 iso_pu_bacteria 8055266321 8055268046 299
131 iso_pu_bacteria 8055301274 8055304200 299
132 3300009036 Ga0105244_10036959 Ga0105244_100369594 300
133 3300025294 Ga0209025_1018553 Ga0209025_10185535 300
134 3300025933 Ga0207706_10142047 Ga0207706_101420473 300
135 3300037418 Ga0395900_0137015 Ga0395900_0137015_738_1640 300
136 3300044693 Ga0466961_0079253 Ga0466961_0079253_453_1355 300
137 3300046457 Ga0495590_0012050 Ga0495590_0012050_1813_2715 300
138 3300046474 Ga0495605_0000830 Ga0495605_0000830_18697_19599 300
139 3300046500 Ga0495596_0036085 Ga0495596_0036085_476_1378 300
140 3300046501 Ga0495607_0017079 Ga0495607_0017079_1014_1916 300
141 3300046501 Ga0495607_0018405 Ga0495607_0018405_1014_1916 300
142 3300046507 Ga0495606_0135766 Ga0495606_0135766_328_1230 300
143 3300046513 Ga0495616_0057564 Ga0495616_0057564_39_941 300
144 3300046522 Ga0495643_0005752 Ga0495643_0005752_4348_5250 300
145 3300046524 Ga0495648_0001796 Ga0495648_0001796_10580_11482 300
146 3300046665 Ga0495661_0002706 Ga0495661_0002706_2986_3888 300
147 3300046674 Ga0495588_0000141 Ga0495588_0000141_93224_94126 300
148 3300046674 Ga0495588_0116445 Ga0495588_0116445_443_1345 300
149 3300046694 Ga0495649_0065298 Ga0495649_0065298_183_1085 300
150 3300046794 Ga0495589_0000439 Ga0495589_0000439_19190_20092 300
151 3300046810 Ga0495660_0000200 Ga0495660_0000200_58896_59798 300
152 3300046810 Ga0495660_0007439 Ga0495660_0007439_2742_3644 300
153 3300047320 Ga0495672_0000977 Ga0495672_0000977_10494_11396 300
154 3300047443 Ga0495687_001513 Ga0495687_001513_17953_18855 300
155 3300047445 Ga0495677_0002280 Ga0495677_0002280_2340_3242 300
156 3300048091 Ga0495626_0001298 Ga0495626_0001298_10546_11448 300
157 3300048905 Ga0496102_0094659 Ga0496102_0094659_1016_1918 300
158 3300048926 Ga0496123_0021370 Ga0496123_0021370_896_1798 300
159 3300048927 Ga0496124_0081778 Ga0496124_0081778_1550_2452 300
160 3300049587 Ga0501071_0152560 Ga0501071_0152560_602_1525 300
161 3300021361 Ga0213872_10000227 Ga0213872_1000022710 301
162 3300031911 Ga0307412_10409209 Ga0307412_104092091 301
163 3300037471 Ga0395905_0090074 Ga0395905_0090074_1741_2646 301
164 3300039447 Ga0436361_0108001 Ga0436361_0108001_39974_40879 301
165 3300044706 Ga0466964_0010895 Ga0466964_0010895_1106_2038 301
166 3300046453 Ga0495627_007127 Ga0495627_007127_2893_3798 301
167 3300046457 Ga0495590_0000084 Ga0495590_0000084_3190_4095 301
168 3300046458 Ga0495591_000034 Ga0495591_000034_13279_14184 301
169 3300046491 Ga0495584_0000895 Ga0495584_0000895_6957_7862 301
170 3300046500 Ga0495596_0012523 Ga0495596_0012523_2525_3430 301
171 3300046501 Ga0495607_0012772 Ga0495607_0012772_769_1674 301
172 3300046506 Ga0495583_0003270 Ga0495583_0003270_10921_11826 301
173 3300046506 Ga0495583_0003699 Ga0495583_0003699_7930_8835 301
174 3300046507 Ga0495606_0039712 Ga0495606_0039712_715_1620 301
175 3300046512 Ga0495610_0001945 Ga0495610_0001945_12674_13579 301
176 3300046513 Ga0495616_0019812 Ga0495616_0019812_756_1661 301
177 3300046518 Ga0495631_0008968 Ga0495631_0008968_1752_2657 301
178 3300046519 Ga0495632_0018571 Ga0495632_0018571_206_1111 301
179 3300046520 Ga0495637_0000003 Ga0495637_0000003_381613_382518 301
180 3300046523 Ga0495644_0014718 Ga0495644_0014718_535_1440 301
181 3300046528 Ga0495642_0022147 Ga0495642_0022147_1192_2097 301
182 3300046558 Ga0495633_0002416 Ga0495633_0002416_4223_5128 301
183 3300046616 Ga0495668_0042016 Ga0495668_0042016_900_1805 301
184 3300046648 Ga0495611_0001217 Ga0495611_0001217_9524_10429 301
185 3300046665 Ga0495661_0002559 Ga0495661_0002559_10587_11492 301
186 3300046684 Ga0495669_0034482 Ga0495669_0034482_148_1053 301
187 3300046691 Ga0495670_0004189 Ga0495670_0004189_2268_3173 301
188 3300046694 Ga0495649_0000695 Ga0495649_0000695_10954_11859 301
189 3300046794 Ga0495589_0002011 Ga0495589_0002011_1564_2469 301
190 3300047320 Ga0495672_0000406 Ga0495672_0000406_38092_38997 301
191 3300047320 Ga0495672_0021686 Ga0495672_0021686_898_1806 301
192 3300047323 Ga0495683_0000155 Ga0495683_0000155_63489_64394 301
193 3300047443 Ga0495687_002818 Ga0495687_002818_2547_3452 301
194 3300047443 Ga0495687_051986 Ga0495687_051986_491_1396 301
195 3300047445 Ga0495677_0002217 Ga0495677_0002217_4201_5106 301
196 3300047446 Ga0495679_007681 Ga0495679_007681_1207_2112 301
197 3300047470 Ga0495681_0004123 Ga0495681_0004123_5742_6647 301
198 3300047470 Ga0495681_0007028 Ga0495681_0007028_3337_4242 301
199 3300047472 Ga0495686_0000129 Ga0495686_0000129_143643_144551 301
200 3300047472 Ga0495686_0028449 Ga0495686_0028449_1565_2470 301
201 3300048091 Ga0495626_0028422 Ga0495626_0028422_855_1760 301
202 3300048903 Ga0496100_0127468 Ga0496100_0127468_405_1310 301
203 3300048905 Ga0496102_0156525 Ga0496102_0156525_39_947 301
204 3300048907 Ga0496104_0058997 Ga0496104_0058997_1277_2182 301
205 3300048908 Ga0496105_0032827 Ga0496105_0032827_3335_4240 301
206 3300048908 Ga0496105_0125678 Ga0496105_0125678_1011_1916 301
207 3300048911 Ga0496108_0204998 Ga0496108_0204998_25_930 301
208 3300048912 Ga0496109_0438041 Ga0496109_0438041_199_1104 301
209 3300048913 Ga0496110_0000711 Ga0496110_0000711_19231_20136 301
210 3300048915 Ga0496112_0151624 Ga0496112_0151624_360_1265 301
211 3300048916 Ga0496113_0027244 Ga0496113_0027244_2154_3059 301
212 3300048920 Ga0496117_0000147 Ga0496117_0000147_26808_27716 301
213 3300048921 Ga0496118_0002065 Ga0496118_0002065_1261_2169 301
214 3300048925 Ga0496122_0029779 Ga0496122_0029779_1073_1978 301
215 3300048926 Ga0496123_0025182 Ga0496123_0025182_1018_1923 301
216 3300048928 Ga0496125_0005570 Ga0496125_0005570_2804_3709 301
217 3300048929 Ga0496126_0000038 Ga0496126_0000038_116702_117610 301
218 3300049459 Ga0495678_000051 Ga0495678_000051_2871_3776 301
219 3300049460 Ga0495682_0029907 Ga0495682_0029907_121_1026 301
220 iso_pu_bacteria 2881101125 2881103230 301
221 iso_pu_bacteria 2928115317 2928121217 301
222 3300002738 JGI25154J39366_1000712 JGI25154J39366_100071219 302
223 3300002774 JGI25150J39212_1001015 JGI25150J39212_100101511 302
224 3300003214 JGI25165J46597_1000965 JGI25165J46597_10009652 302
225 3300003322 rootL2_10007165 rootL2_100071656 302
226 3300003322 rootL2_10007166 rootL2_100071663 302
227 3300005337 Ga0070682_100018189 Ga0070682_1000181895 302
228 3300009036 Ga0105244_10000935 Ga0105244_100009354 302
229 3300009093 Ga0105240_10263715 Ga0105240_102637152 302
230 3300014497 Ga0182008_10002261 Ga0182008_1000226111 302
231 3300021361 Ga0213872_10000455 Ga0213872_1000045526 302
232 3300025231 Ga0207427_100779 Ga0207427_1007797 302
233 3300025245 Ga0207425_1001142 Ga0207425_10011427 302
234 3300025246 Ga0209646_1000042 Ga0209646_1000042150 302
235 3300025261 Ga0209233_1000123 Ga0209233_100012328 302
236 3300025297 Ga0209758_1007543 Ga0209758_10075435 302
237 3300025728 Ga0207655_1010023 Ga0207655_10100234 302
238 3300035114 Ga0373939_0069760 Ga0373939_0069760_193_1101 302
239 3300037312 Ga0395899_0005221 Ga0395899_0005221_7614_8522 302
240 3300037418 Ga0395900_0428413 Ga0395900_0428413_285_1193 302
241 3300037418 Ga0395900_0433856 Ga0395900_0433856_120_1028 302
242 3300037471 Ga0395905_0001455 Ga0395905_0001455_14550_15458 302
243 3300037471 Ga0395905_0331432 Ga0395905_0331432_249_1157 302
244 3300042156 Ga0439446_0049366 Ga0439446_0049366_186_1100 302
245 3300045836 Ga0466958_0009209 Ga0466958_0009209_2151_3059 302
246 3300046452 Ga0495617_000763 Ga0495617_000763_4134_5042 302
247 3300046457 Ga0495590_0000012 Ga0495590_0000012_42162_43070 302
248 3300046459 Ga0495629_0012376 Ga0495629_0012376_5135_6082 302
249 3300046460 Ga0495638_0012661 Ga0495638_0012661_4075_4983 302
250 3300046460 Ga0495638_0014469 Ga0495638_0014469_1422_2330 302
251 3300046463 Ga0495653_0000016 Ga0495653_0000016_4486_5394 302
252 3300046471 Ga0495650_0004616 Ga0495650_0004616_1166_2074 302
253 3300046471 Ga0495650_0007810 Ga0495650_0007810_3376_4284 302
254 3300046474 Ga0495605_0000043 Ga0495605_0000043_19225_20133 302
255 3300046474 Ga0495605_0002974 Ga0495605_0002974_6925_7833 302
256 3300046501 Ga0495607_0015720 Ga0495607_0015720_3067_3975 302
257 3300046507 Ga0495606_0000046 Ga0495606_0000046_185877_186785 302
258 3300046507 Ga0495606_0000051 Ga0495606_0000051_26817_27725 302
259 3300046507 Ga0495606_0002448 Ga0495606_0002448_17437_18345 302
260 3300046511 Ga0495608_0004488 Ga0495608_0004488_5377_6324 302
261 3300046512 Ga0495610_0000212 Ga0495610_0000212_33727_34635 302
262 3300046512 Ga0495610_0003677 Ga0495610_0003677_1855_2763 302
263 3300046512 Ga0495610_0006604 Ga0495610_0006604_4363_5271 302
264 3300046512 Ga0495610_0011887 Ga0495610_0011887_956_1864 302
265 3300046512 Ga0495610_0014872 Ga0495610_0014872_3182_4090 302
266 3300046519 Ga0495632_0062244 Ga0495632_0062244_397_1305 302
267 3300046522 Ga0495643_0000387 Ga0495643_0000387_26100_27008 302
268 3300046522 Ga0495643_0000819 Ga0495643_0000819_25153_26061 302
269 3300046522 Ga0495643_0019395 Ga0495643_0019395_1179_2087 302
270 3300046522 Ga0495643_0087809 Ga0495643_0087809_251_1159 302
271 3300046524 Ga0495648_0005645 Ga0495648_0005645_9014_9922 302
272 3300046526 Ga0495666_0004846 Ga0495666_0004846_1901_2848 302
273 3300046530 Ga0495654_0016152 Ga0495654_0016152_2538_3446 302
274 3300046530 Ga0495654_0102317 Ga0495654_0102317_263_1177 302
275 3300046535 Ga0495586_0017497 Ga0495586_0017497_2752_3699 302
276 3300046538 Ga0495609_0027764 Ga0495609_0027764_1558_2466 302
277 3300046538 Ga0495609_0079377 Ga0495609_0079377_369_1277 302
278 3300046542 Ga0495597_0000051 Ga0495597_0000051_93023_93931 302
279 3300046542 Ga0495597_0000427 Ga0495597_0000427_25119_26027 302
280 3300046543 Ga0495645_0107393 Ga0495645_0107393_36_944 302
281 3300046558 Ga0495633_0000668 Ga0495633_0000668_3527_4435 302
282 3300046558 Ga0495633_0001590 Ga0495633_0001590_2683_3591 302
283 3300046616 Ga0495668_0000541 Ga0495668_0000541_3709_4617 302
284 3300046616 Ga0495668_0000969 Ga0495668_0000969_3342_4250 302
285 3300046616 Ga0495668_0001070 Ga0495668_0001070_24303_25211 302
286 3300046660 Ga0495625_0001517 Ga0495625_0001517_3287_4195 302
287 3300046660 Ga0495625_0002510 Ga0495625_0002510_2674_3582 302
288 3300046660 Ga0495625_0067378 Ga0495625_0067378_45_953 302
289 3300046674 Ga0495588_0019804 Ga0495588_0019804_1460_2380 302
290 3300046689 Ga0495613_0247094 Ga0495613_0247094_278_1225 302
291 3300046692 Ga0495671_0024475 Ga0495671_0024475_1752_2669 302
292 3300046694 Ga0495649_0002152 Ga0495649_0002152_2875_3783 302
293 3300046694 Ga0495649_0003268 Ga0495649_0003268_6655_7563 302
294 3300046694 Ga0495649_0021312 Ga0495649_0021312_640_1548 302
295 3300046694 Ga0495649_0036777 Ga0495649_0036777_999_1907 302
296 3300046810 Ga0495660_0002106 Ga0495660_0002106_5564_6472 302
297 3300047320 Ga0495672_0000075 Ga0495672_0000075_147218_148126 302
298 3300047321 Ga0495676_0071745 Ga0495676_0071745_813_1760 302
299 3300047443 Ga0495687_000547 Ga0495687_000547_13401_14309 302
300 3300047443 Ga0495687_000758 Ga0495687_000758_2267_3175 302
301 3300047470 Ga0495681_0001002 Ga0495681_0001002_11484_12404 302
302 3300047471 Ga0495684_0017791 Ga0495684_0017791_3900_4847 302
303 3300047472 Ga0495686_0003327 Ga0495686_0003327_4769_5677 302
304 3300048089 Ga0495614_0001884 Ga0495614_0001884_4806_5753 302
305 3300048091 Ga0495626_0036127 Ga0495626_0036127_269_1177 302
306 3300048905 Ga0496102_0359397 Ga0496102_0359397_259_1167 302
307 3300048906 Ga0496103_0014214 Ga0496103_0014214_1825_2745 302
308 3300048909 Ga0496106_0035905 Ga0496106_0035905_2696_3604 302
309 3300048916 Ga0496113_0313911 Ga0496113_0313911_286_1194 302
310 3300048919 Ga0496116_0042311 Ga0496116_0042311_1356_2264 302
311 3300048919 Ga0496116_0210721 Ga0496116_0210721_32_940 302
312 3300048925 Ga0496122_0009757 Ga0496122_0009757_148_1062 302
313 3300048926 Ga0496123_0007671 Ga0496123_0007671_148_1062 302
314 3300048927 Ga0496124_0104152 Ga0496124_0104152_1084_1998 302
315 3300049459 Ga0495678_000750 Ga0495678_000750_24917_25825 302
316 3300053136 Ga0500559_0004356 Ga0500559_0004356_97_1044 302
317 3300053136 Ga0500559_0132763 Ga0500559_0132763_127_1041 302
318 3300053140 Ga0500573_0081752 Ga0500573_0081752_151_1098 302
319 3300053145 Ga0500586_000300 Ga0500586_000300_6244_7152 302
320 3300053156 Ga0500622_0114146 Ga0500622_0114146_151_1065 302
321 iso_pu_bacteria 2501025501 2501074295 302
322 iso_pu_bacteria 2501025502 2501080218 302
323 iso_pu_bacteria 2501025504 2501409865 302
324 iso_pu_bacteria 2510917013 2511089803 302
325 iso_pu_bacteria 2510917014 2511095196 302
326 iso_pu_bacteria 2510917015 2511104855 302
327 iso_pu_bacteria 2513237082 2513551288 302
328 iso_pu_bacteria 2513237083 2513559931 302
329 iso_pu_bacteria 2515154189 2516016691 302
330 iso_pu_bacteria 2521172590 2521560610 302
331 iso_pu_bacteria 2808606386 2808982127 302
332 iso_pu_bacteria 2808606415 2809130072 302
333 iso_pu_bacteria 2808606419 2809148873 302
334 iso_pu_bacteria 2818991449 2819617303 302
335 iso_pu_bacteria 2852618963 2852619006 302
336 iso_pu_bacteria 2883087390 2883090629 302
337 iso_pu_bacteria 2885192300 2885193285 302
338 iso_pu_bacteria 2904439833 2904442943 302
339 iso_pu_bacteria 2904483920 2904488407 302
340 iso_pu_bacteria 2904530477 2904534859 302
341 iso_pu_bacteria 2904601388 2904605037 302
342 iso_pu_bacteria 2919079590 2919083268 302
343 iso_pu_bacteria 8003955200 8003957196 302
344 3300001989 JGI24739J22299_10002254 JGI24739J22299_100022544 303
345 3300001989 JGI24739J22299_10051326 JGI24739J22299_100513262 303
346 3300002067 JGI24735J21928_10000200 JGI24735J21928_1000020018 303
347 3300002705 JGI25156J39149_1000206 JGI25156J39149_100020614 303
348 3300002705 JGI25156J39149_1000316 JGI25156J39149_100031624 303
349 3300002705 JGI25156J39149_1000551 JGI25156J39149_100055112 303
350 3300003320 rootH2_10011440 rootH2_100114406 303
351 3300003323 rootH1_10216049 rootH1_102160494 303
352 3300003354 JGI25160J50197_1000343 JGI25160J50197_100034321 303
353 3300003756 Ga0055533_1000112 Ga0055533_100011214 303
354 3300003756 Ga0055533_1000175 Ga0055533_100017534 303
355 3300003756 Ga0055533_1000673 Ga0055533_10006731 303
356 3300003758 Ga0055532_1000031 Ga0055532_1000031189 303
357 3300003760 Ga0055527_1000020 Ga0055527_1000020189 303
358 3300003761 Ga0055535_1000023 Ga0055535_100002330 303
359 3300003762 Ga0055542_1000035 Ga0055542_1000035189 303
360 3300003763 Ga0055529_1000039 Ga0055529_100003930 303
361 3300004625 Ga0055543_1022488 Ga0055543_10224882 303
362 3300005262 Ga0065165_1001126 Ga0065165_10011269 303
363 3300005335 Ga0070666_10020927 Ga0070666_100209273 303
364 3300005367 Ga0070667_100035326 Ga0070667_1000353263 303
365 3300005455 Ga0070663_100128513 Ga0070663_1001285131 303
366 3300005456 Ga0070678_100049511 Ga0070678_1000495112 303
367 3300006051 Ga0075364_10029260 Ga0075364_100292601 303
368 3300006195 Ga0075366_10004441 Ga0075366_100044412 303
369 3300006195 Ga0075366_10019603 Ga0075366_100196032 303
370 3300006195 Ga0075366_10036687 Ga0075366_100366872 303
371 3300009011 Ga0105251_10000332 Ga0105251_1000033224 303
372 3300009011 Ga0105251_10000447 Ga0105251_1000044723 303
373 3300009011 Ga0105251_10040311 Ga0105251_100403112 303
374 3300009093 Ga0105240_10026888 Ga0105240_100268889 303
375 3300009551 Ga0105238_10311097 Ga0105238_103110972 303
376 3300013105 Ga0157369_10009983 Ga0157369_100099837 303
377 3300013306 Ga0163162_10001505 Ga0163162_1000150511 303
378 3300013307 Ga0157372_10241963 Ga0157372_102419632 303
379 3300013308 Ga0157375_10021309 Ga0157375_100213094 303
380 3300014325 Ga0163163_10588641 Ga0163163_105886412 303
381 3300015262 Ga0182007_10002105 Ga0182007_100021055 303
382 3300016635 Ga0183361_10001 Ga0183361_10001343 303
383 3300025206 Ga0209435_100956 Ga0209435_1009562 303
384 3300025225 Ga0209566_102676 Ga0209566_1026762 303
385 3300025226 Ga0209674_100017 Ga0209674_100017131 303
386 3300025226 Ga0209674_100085 Ga0209674_10008589 303
387 3300025226 Ga0209674_100143 Ga0209674_10014383 303
388 3300025228 Ga0209672_100001 Ga0209672_1000012069 303
389 3300025229 Ga0209147_100001 Ga0209147_1000012069 303
390 3300025230 Ga0209563_100371 Ga0209563_10037111 303
391 3300025242 Ga0209258_100001 Ga0209258_1000012069 303
392 3300025254 Ga0209148_1000003 Ga0209148_10000032069 303
393 3300025256 Ga0209759_1000037 Ga0209759_1000037115 303
394 3300025256 Ga0209759_1000163 Ga0209759_100016385 303
395 3300025256 Ga0209759_1000200 Ga0209759_100020031 303
396 3300025256 Ga0209759_1011906 Ga0209759_10119062 303
397 3300025272 Ga0209455_1000001 Ga0209455_10000012069 303
398 3300025295 Ga0209564_1005009 Ga0209564_100500910 303
399 3300025302 Ga0207426_1000007 Ga0207426_1000007404 303
400 3300025735 Ga0207713_1000875 Ga0207713_100087513 303
401 3300025735 Ga0207713_1001844 Ga0207713_100184411 303
402 3300025903 Ga0207680_10044341 Ga0207680_100443411 303
403 3300025904 Ga0207647_10001996 Ga0207647_100019966 303
404 3300025904 Ga0207647_10038844 Ga0207647_100388442 303
405 3300025913 Ga0207695_10027634 Ga0207695_100276344 303
406 3300025924 Ga0207694_10020853 Ga0207694_100208535 303
407 3300025924 Ga0207694_10261885 Ga0207694_102618852 303
408 3300025931 Ga0207644_10212074 Ga0207644_102120741 303
409 3300025941 Ga0207711_10014917 Ga0207711_100149172 303
410 3300025986 Ga0207658_10011030 Ga0207658_100110304 303
411 3300025986 Ga0207658_10171682 Ga0207658_101716821 303
412 3300026067 Ga0207678_10434165 Ga0207678_104341652 303
413 3300026121 Ga0207683_10084446 Ga0207683_100844463 303
414 3300027312 Ga0209371_1006422 Ga0209371_10064223 303
415 3300028379 Ga0268266_10185824 Ga0268266_101858242 303
416 3300028786 Ga0307517_10006619 Ga0307517_1000661918 303
417 3300028786 Ga0307517_10161740 Ga0307517_101617402 303
418 3300030500 Ga0268256_1007251 Ga0268256_10072514 303
419 3300030522 Ga0307512_10009073 Ga0307512_1000907311 303
420 3300031238 Ga0265332_10000005 Ga0265332_100000052 303
421 3300031456 Ga0307513_10336970 Ga0307513_103369702 303
422 3300031507 Ga0307509_10006623 Ga0307509_100066232 303
423 3300031548 Ga0307408_100002798 Ga0307408_1000027982 303
424 3300031731 Ga0307405_10019867 Ga0307405_100198676 303
425 3300032005 Ga0307411_10041548 Ga0307411_100415485 303
426 3300037471 Ga0395905_0000014 Ga0395905_0000014_323130_324050 303
427 3300042876 Ga0451577_0118247 Ga0451577_0118247_153_1076 303
428 3300044666 Ga0466977_0000177 Ga0466977_0000177_3103_4026 303
429 3300044693 Ga0466961_0054128 Ga0466961_0054128_1170_2093 303
430 3300044693 Ga0466961_0088202 Ga0466961_0088202_24_962 303
431 3300046454 Ga0495592_0002694 Ga0495592_0002694_732_1655 303
432 3300046454 Ga0495592_0008567 Ga0495592_0008567_1361_2281 303
433 3300046454 Ga0495592_0014938 Ga0495592_0014938_2951_3889 303
434 3300046455 Ga0495603_0003963 Ga0495603_0003963_5603_6514 303
435 3300046455 Ga0495603_0020309 Ga0495603_0020309_2440_3360 303
436 3300046455 Ga0495603_0059399 Ga0495603_0059399_1040_1951 303
437 3300046457 Ga0495590_0008723 Ga0495590_0008723_654_1574 303
438 3300046457 Ga0495590_0014281 Ga0495590_0014281_150_1079 303
439 3300046457 Ga0495590_0024905 Ga0495590_0024905_75_995 303
440 3300046458 Ga0495591_002308 Ga0495591_002308_4834_5754 303
441 3300046458 Ga0495591_015488 Ga0495591_015488_738_1649 303
442 3300046459 Ga0495629_0000034 Ga0495629_0000034_107490_108410 303
443 3300046459 Ga0495629_0000787 Ga0495629_0000787_19089_20000 303
444 3300046459 Ga0495629_0002603 Ga0495629_0002603_10354_11274 303
445 3300046459 Ga0495629_0053295 Ga0495629_0053295_1513_2433 303
446 3300046459 Ga0495629_0074829 Ga0495629_0074829_731_1642 303
447 3300046460 Ga0495638_0001311 Ga0495638_0001311_4657_5568 303
448 3300046460 Ga0495638_0012516 Ga0495638_0012516_142_1062 303
449 3300046462 Ga0495651_0004534 Ga0495651_0004534_1922_2842 303
450 3300046462 Ga0495651_0007605 Ga0495651_0007605_4361_5281 303
451 3300046463 Ga0495653_0004112 Ga0495653_0004112_5999_6919 303
452 3300046463 Ga0495653_0039173 Ga0495653_0039173_667_1587 303
453 3300046463 Ga0495653_0144721 Ga0495653_0144721_157_1077 303
454 3300046471 Ga0495650_0027039 Ga0495650_0027039_1221_2132 303
455 3300046471 Ga0495650_0045471 Ga0495650_0045471_73_993 303
456 3300046472 Ga0495580_0000278 Ga0495580_0000278_20791_21711 303
457 3300046472 Ga0495580_0004404 Ga0495580_0004404_4992_5912 303
458 3300046472 Ga0495580_0004918 Ga0495580_0004918_4830_5750 303
459 3300046472 Ga0495580_0005049 Ga0495580_0005049_4851_5771 303
460 3300046472 Ga0495580_0091172 Ga0495580_0091172_657_1568 303
461 3300046472 Ga0495580_0289079 Ga0495580_0289079_51_971 303
462 3300046472 Ga0495580_0289091 Ga0495580_0289091_147_1067 303
463 3300046473 Ga0495582_0002667 Ga0495582_0002667_2695_3615 303
464 3300046473 Ga0495582_0045727 Ga0495582_0045727_646_1557 303
465 3300046473 Ga0495582_0051466 Ga0495582_0051466_1246_2166 303
466 3300046474 Ga0495605_0006073 Ga0495605_0006073_4894_5814 303
467 3300046474 Ga0495605_0006180 Ga0495605_0006180_4798_5709 303
468 3300046476 Ga0495662_0077082 Ga0495662_0077082_128_1048 303
469 3300046477 Ga0495664_0006772 Ga0495664_0006772_204_1124 303
470 3300046477 Ga0495664_0076225 Ga0495664_0076225_287_1198 303
471 3300046491 Ga0495584_0039735 Ga0495584_0039735_1303_2214 303
472 3300046500 Ga0495596_0014462 Ga0495596_0014462_2251_3171 303
473 3300046501 Ga0495607_0058271 Ga0495607_0058271_800_1711 303
474 3300046507 Ga0495606_0001477 Ga0495606_0001477_3562_4476 303
475 3300046507 Ga0495606_0019174 Ga0495606_0019174_2555_3466 303
476 3300046507 Ga0495606_0020480 Ga0495606_0020480_2140_3069 303
477 3300046507 Ga0495606_0094139 Ga0495606_0094139_46_966 303
478 3300046511 Ga0495608_0003810 Ga0495608_0003810_3834_4754 303
479 3300046514 Ga0495618_0012080 Ga0495618_0012080_1529_2476 303
480 3300046514 Ga0495618_0056644 Ga0495618_0056644_1305_2225 303
481 3300046514 Ga0495618_0121828 Ga0495618_0121828_180_1100 303
482 3300046516 Ga0495628_0007903 Ga0495628_0007903_3231_4151 303
483 3300046516 Ga0495628_0012022 Ga0495628_0012022_1575_2495 303
484 3300046516 Ga0495628_0016359 Ga0495628_0016359_3482_4402 303
485 3300046516 Ga0495628_0039442 Ga0495628_0039442_1758_2696 303
486 3300046516 Ga0495628_0061124 Ga0495628_0061124_1796_2734 303
487 3300046516 Ga0495628_0105506 Ga0495628_0105506_577_1497 303
488 3300046516 Ga0495628_0268835 Ga0495628_0268835_191_1102 303
489 3300046517 Ga0495630_0000773 Ga0495630_0000773_19738_20658 303
490 3300046517 Ga0495630_0002849 Ga0495630_0002849_10853_11773 303
491 3300046517 Ga0495630_0015979 Ga0495630_0015979_606_1526 303
492 3300046517 Ga0495630_0033045 Ga0495630_0033045_1474_2394 303
493 3300046523 Ga0495644_0040075 Ga0495644_0040075_512_1423 303
494 3300046524 Ga0495648_0036861 Ga0495648_0036861_694_1614 303
495 3300046524 Ga0495648_0044505 Ga0495648_0044505_770_1690 303
496 3300046526 Ga0495666_0011195 Ga0495666_0011195_3159_4079 303
497 3300046526 Ga0495666_0019712 Ga0495666_0019712_963_1883 303
498 3300046528 Ga0495642_0000811 Ga0495642_0000811_11977_12888 303
499 3300046528 Ga0495642_0041221 Ga0495642_0041221_381_1292 303
500 3300046529 Ga0495652_0008885 Ga0495652_0008885_2891_3838 303
501 3300046529 Ga0495652_0029842 Ga0495652_0029842_467_1387 303
502 3300046531 Ga0495665_0006309 Ga0495665_0006309_3185_4105 303
503 3300046531 Ga0495665_0076756 Ga0495665_0076756_95_1006 303
504 3300046533 Ga0495640_0012113 Ga0495640_0012113_5015_5935 303
505 3300046533 Ga0495640_0021939 Ga0495640_0021939_2205_3125 303
506 3300046533 Ga0495640_0029876 Ga0495640_0029876_2190_3128 303
507 3300046533 Ga0495640_0080507 Ga0495640_0080507_837_1757 303
508 3300046535 Ga0495586_0210404 Ga0495586_0210404_141_1061 303
509 3300046536 Ga0495587_0076666 Ga0495587_0076666_95_1015 303
510 3300046536 Ga0495587_0116595 Ga0495587_0116595_93_1013 303
511 3300046538 Ga0495609_0027452 Ga0495609_0027452_1455_2375 303
512 3300046543 Ga0495645_0000160 Ga0495645_0000160_30570_31481 303
513 3300046543 Ga0495645_0010279 Ga0495645_0010279_1018_1938 303
514 3300046543 Ga0495645_0172506 Ga0495645_0172506_484_1404 303
515 3300046543 Ga0495645_0265623 Ga0495645_0265623_83_1003 303
516 3300046557 Ga0495622_0000106 Ga0495622_0000106_41170_42090 303
517 3300046559 Ga0495667_0085194 Ga0495667_0085194_895_1815 303
518 3300046616 Ga0495668_0001905 Ga0495668_0001905_2623_3537 303
519 3300046642 Ga0495634_0039614 Ga0495634_0039614_467_1387 303
520 3300046660 Ga0495625_0090714 Ga0495625_0090714_651_1574 303
521 3300046663 Ga0495635_0003231 Ga0495635_0003231_10027_10974 303
522 3300046663 Ga0495635_0004430 Ga0495635_0004430_3927_4847 303
523 3300046665 Ga0495661_0006671 Ga0495661_0006671_2024_2944 303
524 3300046665 Ga0495661_0015207 Ga0495661_0015207_204_1124 303
525 3300046665 Ga0495661_0065527 Ga0495661_0065527_477_1397 303
526 3300046674 Ga0495588_0026830 Ga0495588_0026830_1707_2618 303
527 3300046674 Ga0495588_0047192 Ga0495588_0047192_1172_2092 303
528 3300046675 Ga0495657_0019379 Ga0495657_0019379_3584_4522 303
529 3300046678 Ga0495599_0014702 Ga0495599_0014702_963_1883 303
530 3300046678 Ga0495599_0023659 Ga0495599_0023659_1727_2647 303
531 3300046678 Ga0495599_0138724 Ga0495599_0138724_516_1436 303
532 3300046679 Ga0495623_0010298 Ga0495623_0010298_2664_3584 303
533 3300046679 Ga0495623_0016332 Ga0495623_0016332_34_954 303
534 3300046679 Ga0495623_0040355 Ga0495623_0040355_1397_2317 303
535 3300046679 Ga0495623_0050912 Ga0495623_0050912_436_1383 303
536 3300046679 Ga0495623_0078178 Ga0495623_0078178_666_1586 303
537 3300046680 Ga0495646_0001545 Ga0495646_0001545_1457_2377 303
538 3300046680 Ga0495646_0022615 Ga0495646_0022615_1770_2690 303
539 3300046680 Ga0495646_0070500 Ga0495646_0070500_907_1818 303
540 3300046684 Ga0495669_0010551 Ga0495669_0010551_111_1022 303
541 3300046689 Ga0495613_0020339 Ga0495613_0020339_2270_3190 303
542 3300046689 Ga0495613_0030708 Ga0495613_0030708_398_1318 303
543 3300046689 Ga0495613_0122995 Ga0495613_0122995_152_1072 303
544 3300046690 Ga0495624_0000205 Ga0495624_0000205_3651_4571 303
545 3300046690 Ga0495624_0002290 Ga0495624_0002290_6357_7277 303
546 3300046690 Ga0495624_0027573 Ga0495624_0027573_2759_3679 303
547 3300046692 Ga0495671_0043149 Ga0495671_0043149_580_1500 303
548 3300046694 Ga0495649_0010744 Ga0495649_0010744_1192_2103 303
549 3300046794 Ga0495589_0025407 Ga0495589_0025407_614_1525 303
550 3300046794 Ga0495589_0073514 Ga0495589_0073514_526_1446 303
551 3300046794 Ga0495589_0130748 Ga0495589_0130748_35_955 303
552 3300046809 Ga0495600_0008583 Ga0495600_0008583_1443_2363 303
553 3300046809 Ga0495600_0009034 Ga0495600_0009034_4806_5753 303
554 3300046809 Ga0495600_0114661 Ga0495600_0114661_575_1486 303
555 3300046810 Ga0495660_0124081 Ga0495660_0124081_252_1172 303
556 3300046810 Ga0495660_0128587 Ga0495660_0128587_334_1245 303
557 3300047315 Ga0495581_0002092 Ga0495581_0002092_4729_5649 303
558 3300047315 Ga0495581_0016419 Ga0495581_0016419_1910_2821 303
559 3300047317 Ga0495604_0031524 Ga0495604_0031524_1022_1942 303
560 3300047319 Ga0495674_0008494 Ga0495674_0008494_2787_3707 303
561 3300047319 Ga0495674_0008617 Ga0495674_0008617_2787_3707 303
562 3300047319 Ga0495674_0024325 Ga0495674_0024325_2057_2977 303
563 3300047319 Ga0495674_0040630 Ga0495674_0040630_1112_2032 303
564 3300047319 Ga0495674_0244065 Ga0495674_0244065_110_1030 303
565 3300047320 Ga0495672_0018677 Ga0495672_0018677_2852_3772 303
566 3300047321 Ga0495676_0017343 Ga0495676_0017343_4770_5690 303
567 3300047321 Ga0495676_0023782 Ga0495676_0023782_3926_4846 303
568 3300047322 Ga0495680_0020264 Ga0495680_0020264_46_966 303
569 3300047322 Ga0495680_0026087 Ga0495680_0026087_3389_4309 303
570 3300047322 Ga0495680_0033511 Ga0495680_0033511_1821_2741 303
571 3300047322 Ga0495680_0171593 Ga0495680_0171593_346_1266 303
572 3300047323 Ga0495683_0002243 Ga0495683_0002243_5538_6467 303
573 3300047323 Ga0495683_0003429 Ga0495683_0003429_2017_2937 303
574 3300047323 Ga0495683_0020685 Ga0495683_0020685_808_1728 303
575 3300047323 Ga0495683_0043539 Ga0495683_0043539_871_1791 303
576 3300047443 Ga0495687_000627 Ga0495687_000627_19547_20458 303
577 3300047443 Ga0495687_014868 Ga0495687_014868_723_1634 303
578 3300047443 Ga0495687_025480 Ga0495687_025480_137_1066 303
579 3300047444 Ga0495675_0006427 Ga0495675_0006427_1822_2769 303
580 3300047444 Ga0495675_0006662 Ga0495675_0006662_1139_2059 303
581 3300047444 Ga0495675_0023306 Ga0495675_0023306_2243_3163 303
582 3300047444 Ga0495675_0084418 Ga0495675_0084418_87_1007 303
583 3300047446 Ga0495679_000007 Ga0495679_000007_267525_268445 303
584 3300047446 Ga0495679_001595 Ga0495679_001595_10950_11870 303
585 3300047446 Ga0495679_003753 Ga0495679_003753_6054_6974 303
586 3300047446 Ga0495679_028842 Ga0495679_028842_328_1239 303
587 3300047673 Ga0495593_0008516 Ga0495593_0008516_2787_3707 303
588 3300047673 Ga0495593_0022519 Ga0495593_0022519_2084_3031 303
589 3300047673 Ga0495593_0035082 Ga0495593_0035082_71_991 303
590 3300048088 Ga0495602_0003324 Ga0495602_0003324_1256_2176 303
591 3300048088 Ga0495602_0058304 Ga0495602_0058304_1025_1945 303
592 3300048088 Ga0495602_0061647 Ga0495602_0061647_1846_2766 303
593 3300048088 Ga0495602_0076100 Ga0495602_0076100_121_1041 303
594 3300048088 Ga0495602_0085309 Ga0495602_0085309_1077_1997 303
595 3300048089 Ga0495614_0012638 Ga0495614_0012638_1826_2746 303
596 3300048089 Ga0495614_0023508 Ga0495614_0023508_679_1590 303
597 3300048091 Ga0495626_0024558 Ga0495626_0024558_367_1287 303
598 3300048091 Ga0495626_0098939 Ga0495626_0098939_203_1123 303
599 3300048091 Ga0495626_0116214 Ga0495626_0116214_80_991 303
600 3300048903 Ga0496100_0000810 Ga0496100_0000810_11899_12819 303
601 3300048904 Ga0496101_0000342 Ga0496101_0000342_6423_7343 303
602 3300048904 Ga0496101_0008291 Ga0496101_0008291_535_1446 303
603 3300048904 Ga0496101_0014137 Ga0496101_0014137_1656_2576 303
604 3300048905 Ga0496102_0000539 Ga0496102_0000539_25482_26402 303
605 3300048905 Ga0496102_0010675 Ga0496102_0010675_1440_2360 303
606 3300048906 Ga0496103_0003458 Ga0496103_0003458_4263_5183 303
607 3300048906 Ga0496103_0005140 Ga0496103_0005140_5860_6780 303
608 3300048906 Ga0496103_0075429 Ga0496103_0075429_22_942 303
609 3300048907 Ga0496104_0076481 Ga0496104_0076481_2200_3120 303
610 3300048907 Ga0496104_0219332 Ga0496104_0219332_215_1126 303
611 3300048908 Ga0496105_0064708 Ga0496105_0064708_68_988 303
612 3300048908 Ga0496105_0155790 Ga0496105_0155790_592_1503 303
613 3300048908 Ga0496105_0299175 Ga0496105_0299175_232_1152 303
614 3300048909 Ga0496106_0000021 Ga0496106_0000021_102679_103599 303
615 3300048909 Ga0496106_0281598 Ga0496106_0281598_20_931 303
616 3300048910 Ga0496107_0031069 Ga0496107_0031069_2514_3425 303
617 3300048913 Ga0496110_0142498 Ga0496110_0142498_1047_1958 303
618 3300048915 Ga0496112_0059110 Ga0496112_0059110_674_1594 303
619 3300048916 Ga0496113_0036318 Ga0496113_0036318_510_1430 303
620 3300048917 Ga0496114_0019343 Ga0496114_0019343_3934_4845 303
621 3300048918 Ga0496115_0070283 Ga0496115_0070283_1131_2042 303
622 3300048919 Ga0496116_0043575 Ga0496116_0043575_1082_2002 303
623 3300048920 Ga0496117_0002567 Ga0496117_0002567_4485_5405 303
624 3300048920 Ga0496117_0012918 Ga0496117_0012918_1687_2607 303
625 3300048920 Ga0496117_0025244 Ga0496117_0025244_2262_3182 303
626 3300048920 Ga0496117_0044421 Ga0496117_0044421_633_1559 303
627 3300048921 Ga0496118_0001655 Ga0496118_0001655_6337_7257 303
628 3300048921 Ga0496118_0007404 Ga0496118_0007404_10201_11121 303
629 3300048921 Ga0496118_0011909 Ga0496118_0011909_711_1637 303
630 3300048921 Ga0496118_0053029 Ga0496118_0053029_1959_2879 303
631 3300048921 Ga0496118_0205264 Ga0496118_0205264_32_943 303
632 3300048922 Ga0496119_0129482 Ga0496119_0129482_240_1160 303
633 3300048923 Ga0496120_0083436 Ga0496120_0083436_655_1575 303
634 3300048923 Ga0496120_0101611 Ga0496120_0101611_233_1153 303
635 3300048924 Ga0496121_0000357 Ga0496121_0000357_91493_92410 303
636 3300048924 Ga0496121_0005013 Ga0496121_0005013_16165_17085 303
637 3300048924 Ga0496121_0005655 Ga0496121_0005655_1506_2426 303
638 3300048924 Ga0496121_0028026 Ga0496121_0028026_1723_2643 303
639 3300048924 Ga0496121_0071563 Ga0496121_0071563_1738_2658 303
640 3300048927 Ga0496124_0270837 Ga0496124_0270837_37_957 303
641 3300048929 Ga0496126_0002720 Ga0496126_0002720_8308_9234 303
642 3300048929 Ga0496126_0004689 Ga0496126_0004689_10319_11239 303
643 3300048929 Ga0496126_0019860 Ga0496126_0019860_3924_4841 303
644 3300049459 Ga0495678_039087 Ga0495678_039087_297_1217 303
645 3300049459 Ga0495678_048081 Ga0495678_048081_716_1636 303
646 3300049460 Ga0495682_0017828 Ga0495682_0017828_502_1422 303
647 3300049460 Ga0495682_0041770 Ga0495682_0041770_142_1062 303
648 3300050493 nmdc:mga0k408_197345_c1 nmdc:mga0k408_197345_c1_109_1032 303
649 3300050493 nmdc:mga0k408_42889_c1 nmdc:mga0k408_42889_c1_194_1117 303
650 3300053087 Ga0500643_010739 Ga0500643_010739_121_1044 303
651 3300053092 Ga0500583_0007293 Ga0500583_0007293_2430_3353 303
652 3300053093 Ga0500651_0143449 Ga0500651_0143449_129_1052 303
653 3300053098 Ga0500650_0083717 Ga0500650_0083717_386_1309 303
654 iso_pu_bacteria 2600255067 2600810216 303
655 iso_pu_bacteria 2738541296 2738822387 303
656 iso_pu_bacteria 2738541298 2738835797 303
657 iso_pu_bacteria 2738541306 2738876073 303
658 iso_pu_bacteria 2738543002 2739188025 303
659 iso_pu_bacteria 2738543008 2739222670 303
660 iso_pu_bacteria 2842677519 2842680768 303
661 iso_pu_bacteria 2904449895 2904452860 303
662 iso_pu_bacteria 2904456579 2904460111 303
663 iso_pu_bacteria 2904541872 2904547339 303
664 iso_pu_bacteria 2919462493 2919463521 303
665 iso_pu_bacteria 2929160207 2929165852 303
666 iso_pu_bacteria 2945934425 2945935095 303
667 iso_pu_bacteria 2990703756 2990704313 303
668 iso_pu_bacteria 641736151 642422466 303
669 3300005468 Ga0070707_100226855 Ga0070707_1002268551 304
670 3300005616 Ga0068852_100154213 Ga0068852_1001542132 304
671 3300006058 Ga0075432_10082038 Ga0075432_100820382 304
672 3300013297 Ga0157378_10217847 Ga0157378_102178472 304
673 3300025294 Ga0209025_1000776 Ga0209025_100077615 304
674 3300027907 Ga0207428_10279054 Ga0207428_102790542 304
675 3300031456 Ga0307513_10000730 Ga0307513_100007302 304
676 3300031731 Ga0307405_10049582 Ga0307405_100495822 304
677 3300032002 Ga0307416_100301528 Ga0307416_1003015282 304
678 3300032005 Ga0307411_10445249 Ga0307411_104452492 304
679 3300042004 Ga0439445_0025388 Ga0439445_0025388_181_1113 304
680 3300042115 Ga0450911_000960 Ga0450911_000960_2579_3511 304
681 3300042134 Ga0450898_003346 Ga0450898_003346_389_1315 304
682 3300042532 Ga0450893_0006408 Ga0450893_0006408_248_1177 304
683 3300044712 Ga0453684_0010054 Ga0453684_0010054_2349_3308 304
684 3300044712 Ga0453684_0021318 Ga0453684_0021318_7685_8620 304
685 3300046558 Ga0495633_0001509 Ga0495633_0001509_9847_10770 304
686 3300047319 Ga0495674_0079741 Ga0495674_0079741_1806_2723 304
687 3300048924 Ga0496121_0006811 Ga0496121_0006811_1965_2894 304
688 3300048925 Ga0496122_0109260 Ga0496122_0109260_200_1129 304
689 3300048928 Ga0496125_0066972 Ga0496125_0066972_1844_2776 304
690 3300048928 Ga0496125_0069233 Ga0496125_0069233_289_1221 304
691 3300048928 Ga0496125_0195662 Ga0496125_0195662_144_1067 304
692 3300049515 Ga0501292_000563 Ga0501292_000563_3487_4413 304
693 3300049520 Ga0501297_013258 Ga0501297_013258_10_936 304
694 3300049579 Ga0501043_0000572 Ga0501043_0000572_4914_5840 304
695 3300049580 Ga0501046_0000843 Ga0501046_0000843_28174_29100 304
696 3300049581 Ga0501047_0000906 Ga0501047_0000906_27111_28037 304
697 3300049582 Ga0501048_0165367 Ga0501048_0165367_599_1525 304
698 3300049653 Ga0501206_001433 Ga0501206_001433_1418_2344 304
699 3300049686 Ga0501257_018246 Ga0501257_018246_227_1153 304
700 3300049762 Ga0501265_000858 Ga0501265_000858_671_1597 304
701 3300049777 Ga0501281_00583 Ga0501281_00583_2181_3107 304
702 3300053730 Ga0500645_012197 Ga0500645_012197_125_1045 304
703 iso_pu_bacteria 2513020051 2513230520 304
704 iso_pu_bacteria 2599185214 2599626055 304
705 iso_pu_bacteria 2599185226 2599677696 304
706 iso_pu_bacteria 2599185227 2599682423 304
707 iso_pu_bacteria 2599185229 2599697431 304
708 iso_pu_bacteria 2643221658 2644326682 304
709 iso_pu_bacteria 2643221672 2644400058 304
710 iso_pu_bacteria 2818991446 2819601346 304
711 iso_pu_bacteria 2831265667 2831272404 304
712 iso_pu_bacteria 2838054893 2838059561 304
713 iso_pu_bacteria 2885198086 2885202713 304
714 iso_pu_bacteria 2885211737 2885216891 304
715 iso_pu_bacteria 2899924645 2899926923 304
716 iso_pu_bacteria 2928051484 2928055273 304
717 iso_pu_bacteria 2928064002 2928069373 304
718 iso_pu_bacteria 2928084124 2928089612 304
719 iso_pu_bacteria 2932422444 2932424409 304
720 iso_pu_bacteria 2945909444 2945909449 304
721 iso_pu_bacteria 2945984333 2945988571 304
722 iso_pu_bacteria 2954767861 2954769305 304
723 3300002705 JGI25156J39149_1015209 JGI25156J39149_10152092 305
724 3300003794 Ga0055531_10005483 Ga0055531_100054837 305
725 3300005563 Ga0068855_100025580 Ga0068855_1000255807 305
726 3300005563 Ga0068855_100098090 Ga0068855_1000980902 305
727 3300006038 Ga0075365_10100480 Ga0075365_101004802 305
728 3300006048 Ga0075363_100037152 Ga0075363_1000371523 305
729 3300006195 Ga0075366_10107390 Ga0075366_101073902 305
730 3300009551 Ga0105238_10051269 Ga0105238_100512693 305
731 3300014969 Ga0157376_10070110 Ga0157376_100701102 305
732 3300025303 Ga0209051_1000454 Ga0209051_10004542 305
733 3300025304 Ga0209257_1000022 Ga0209257_1000022765 305
734 3300025949 Ga0207667_10134814 Ga0207667_101348142 305
735 3300028794 Ga0307515_10000975 Ga0307515_1000097560 305
736 3300028794 Ga0307515_10001526 Ga0307515_1000152616 305
737 3300028800 Ga0265338_10000335 Ga0265338_1000033566 305
738 3300031456 Ga0307513_10035123 Ga0307513_100351232 305
739 3300031649 Ga0307514_10000646 Ga0307514_1000064615 305
740 3300037471 Ga0395905_0025111 Ga0395905_0025111_2408_3340 305
741 3300038443 Ga0395901_0086837 Ga0395901_0086837_98_1030 305
742 3300038443 Ga0395901_0589057 Ga0395901_0589057_44_967 305
743 3300042007 Ga0439449_0003932 Ga0439449_0003932_4661_5584 305
744 3300042876 Ga0451577_0000126 Ga0451577_0000126_86355_87281 305
745 3300044712 Ga0453684_0000365 Ga0453684_0000365_93680_94606 305
746 3300046530 Ga0495654_0001375 Ga0495654_0001375_10218_11141 305
747 3300046557 Ga0495622_0013697 Ga0495622_0013697_246_1163 305
748 3300046674 Ga0495588_0022410 Ga0495588_0022410_1554_2471 305
749 3300047321 Ga0495676_0000025 Ga0495676_0000025_137131_138048 305
750 3300048905 Ga0496102_0049381 Ga0496102_0049381_1774_2694 305
751 3300050490 nmdc:mga03n38_71691_c1 nmdc:mga03n38_71691_c1_163_1086 305
752 3300050493 nmdc:mga0k408_52318_c1 nmdc:mga0k408_52318_c1_410_1333 305
753 iso_pu_bacteria 2513237150 2513957387 305
754 iso_pu_bacteria 2513237165 2514044715 305
755 iso_pu_bacteria 2721755523 2722885886 305
756 iso_pu_bacteria 2839138175 2839139728 305
757 iso_pu_bacteria 2858688981 2858690709 305
758 iso_pu_bacteria 2928070936 2928078448 305
759 3300001979 JGI24740J21852_10000258 JGI24740J21852_1000025815 306
760 3300001989 JGI24739J22299_10033380 JGI24739J22299_100333802 306
761 3300001990 JGI24737J22298_10020747 JGI24737J22298_100207474 306
762 3300002067 JGI24735J21928_10013211 JGI24735J21928_100132114 306
763 3300002067 JGI24735J21928_10041058 JGI24735J21928_100410581 306
764 3300002075 JGI24738J21930_10000642 JGI24738J21930_100006424 306
765 3300003751 Ga0055538_1000024 Ga0055538_100002470 306
766 3300003775 Ga0055524_1023072 Ga0055524_10230721 306
767 3300005334 Ga0068869_100024614 Ga0068869_1000246142 306
768 3300005338 Ga0068868_100088492 Ga0068868_1000884922 306
769 3300005367 Ga0070667_100327395 Ga0070667_1003273952 306
770 3300005455 Ga0070663_100056262 Ga0070663_1000562624 306
771 3300005563 Ga0068855_100000711 Ga0068855_10000071117 306
772 3300005563 Ga0068855_100018406 Ga0068855_1000184069 306
773 3300005577 Ga0068857_100065940 Ga0068857_1000659402 306
774 3300005578 Ga0068854_100009507 Ga0068854_1000095073 306
775 3300005834 Ga0068851_10040908 Ga0068851_100409082 306
776 3300009036 Ga0105244_10033323 Ga0105244_100333232 306
777 3300009177 Ga0105248_10024995 Ga0105248_100249954 306
778 3300009545 Ga0105237_10011522 Ga0105237_100115223 306
779 3300009545 Ga0105237_10043373 Ga0105237_100433732 306
780 3300009551 Ga0105238_10000107 Ga0105238_1000010744 306
781 3300010375 Ga0105239_10001202 Ga0105239_1000120235 306
782 3300013306 Ga0163162_10293863 Ga0163162_102938632 306
783 3300013308 Ga0157375_10298438 Ga0157375_102984382 306
784 3300014497 Ga0182008_10081389 Ga0182008_100813892 306
785 3300014969 Ga0157376_10197792 Ga0157376_101977922 306
786 3300015261 Ga0182006_1000887 Ga0182006_10008873 306
787 3300015262 Ga0182007_10052423 Ga0182007_100524232 306
788 3300025250 Ga0209026_1004885 Ga0209026_10048855 306
789 3300025294 Ga0209025_1002118 Ga0209025_10021185 306
790 3300025299 Ga0209256_1000554 Ga0209256_100055422 306
791 3300025303 Ga0209051_1013717 Ga0209051_10137172 306
792 3300025321 Ga0207656_10020722 Ga0207656_100207222 306
793 3300025904 Ga0207647_10001408 Ga0207647_100014086 306
794 3300025913 Ga0207695_10001449 Ga0207695_1000144922 306
795 3300025914 Ga0207671_10006552 Ga0207671_100065522 306
796 3300025924 Ga0207694_10000130 Ga0207694_1000013044 306
797 3300025941 Ga0207711_10106989 Ga0207711_101069892 306
798 3300025981 Ga0207640_10033445 Ga0207640_100334454 306
799 3300025986 Ga0207658_10201881 Ga0207658_102018811 306
800 3300026023 Ga0207677_10023580 Ga0207677_100235804 306
801 3300026023 Ga0207677_10348544 Ga0207677_103485442 306
802 3300026121 Ga0207683_10084964 Ga0207683_100849643 306
803 3300031911 Ga0307412_10000014 Ga0307412_10000014276 306
804 3300039438 Ga0436360_0199866 Ga0436360_0199866_382_1314 306
805 3300044712 Ga0453684_0061229 Ga0453684_0061229_188_1123 306
806 3300046474 Ga0495605_0013540 Ga0495605_0013540_3424_4362 306
807 3300046500 Ga0495596_0045304 Ga0495596_0045304_180_1118 306
808 3300046512 Ga0495610_0028838 Ga0495610_0028838_906_1844 306
809 3300046615 Ga0495656_0072664 Ga0495656_0072664_595_1518 306
810 3300046674 Ga0495588_0141528 Ga0495588_0141528_228_1151 306
811 3300046794 Ga0495589_0101125 Ga0495589_0101125_183_1121 306
812 3300047472 Ga0495686_0031367 Ga0495686_0031367_1876_2820 306
813 3300048091 Ga0495626_0075547 Ga0495626_0075547_493_1431 306
814 3300048904 Ga0496101_0015620 Ga0496101_0015620_150_1073 306
815 3300048905 Ga0496102_0026595 Ga0496102_0026595_200_1123 306
816 3300048906 Ga0496103_0005743 Ga0496103_0005743_2095_3018 306
817 3300048906 Ga0496103_0254833 Ga0496103_0254833_187_1110 306
818 3300048907 Ga0496104_0171644 Ga0496104_0171644_657_1580 306
819 3300048908 Ga0496105_0231000 Ga0496105_0231000_118_1041 306
820 3300048910 Ga0496107_0288492 Ga0496107_0288492_216_1139 306
821 3300048913 Ga0496110_0289928 Ga0496110_0289928_433_1356 306
822 3300048916 Ga0496113_0056019 Ga0496113_0056019_1947_2870 306
823 3300048917 Ga0496114_0221697 Ga0496114_0221697_616_1539 306
824 3300048917 Ga0496114_0359329 Ga0496114_0359329_352_1275 306
825 3300048920 Ga0496117_0076032 Ga0496117_0076032_147_1085 306
826 3300048920 Ga0496117_0104985 Ga0496117_0104985_654_1598 306
827 3300048921 Ga0496118_0027656 Ga0496118_0027656_2002_2940 306
828 3300048921 Ga0496118_0060088 Ga0496118_0060088_1593_2537 306
829 3300048925 Ga0496122_0199968 Ga0496122_0199968_111_1049 306
830 3300049568 Ga0501031_0000595 Ga0501031_0000595_18087_19013 306
831 3300003187 JGI25151J46595_10008710 JGI25151J46595_100087104 307
832 3300003322 rootL2_10312837 rootL2_103128371 307
833 3300003781 Ga0055536_1011591 Ga0055536_10115913 307
834 3300003790 Ga0055528_1034999 Ga0055528_10349992 307
835 3300003792 Ga0055540_1009461 Ga0055540_10094611 307
836 3300005288 Ga0065714_10005182 Ga0065714_100051825 307
837 3300005289 Ga0065704_10083485 Ga0065704_100834853 307
838 3300005366 Ga0070659_100001434 Ga0070659_1000014345 307
839 3300005459 Ga0068867_100120677 Ga0068867_1001206772 307
840 3300006051 Ga0075364_10160684 Ga0075364_101606842 307
841 3300006177 Ga0075362_10009305 Ga0075362_100093053 307
842 3300006353 Ga0075370_10024642 Ga0075370_100246423 307
843 3300009098 Ga0105245_10327949 Ga0105245_103279491 307
844 3300011119 Ga0105246_10188285 Ga0105246_101882852 307
845 3300013100 Ga0157373_10019912 Ga0157373_100199125 307
846 3300014497 Ga0182008_10041893 Ga0182008_100418931 307
847 3300015262 Ga0182007_10008808 Ga0182007_100088084 307
848 3300015262 Ga0182007_10029236 Ga0182007_100292362 307
849 3300017792 Ga0163161_10005221 Ga0163161_100052219 307
850 3300025273 Ga0209673_1004987 Ga0209673_10049872 307
851 3300025292 Ga0209676_1002102 Ga0209676_10021021 307
852 3300025303 Ga0209051_1001351 Ga0209051_10013513 307
853 3300025303 Ga0209051_1005018 Ga0209051_10050188 307
854 3300025304 Ga0209257_1037295 Ga0209257_10372952 307
855 3300025932 Ga0207690_10007146 Ga0207690_100071465 307
856 3300025935 Ga0207709_10000941 Ga0207709_100009413 307
857 3300030731 Ga0316177_1077576 Ga0316177_10775762 307
858 3300030732 Ga0316176_1153596 Ga0316176_11535962 307
859 3300030733 Ga0314311_1010593 Ga0314311_10105932 307
860 3300030734 Ga0316179_1077944 Ga0316179_10779442 307
861 3300030735 Ga0316178_1121589 Ga0316178_11215892 307
862 3300030736 Ga0316180_1051098 Ga0316180_10510982 307
863 3300030742 Ga0316183_1023089 Ga0316183_10230892 307
864 3300030745 Ga0316182_1007091 Ga0316182_10070912 307
865 3300031548 Ga0307408_100162818 Ga0307408_1001628181 307
866 3300031548 Ga0307408_100471218 Ga0307408_1004712181 307
867 3300031731 Ga0307405_10008289 Ga0307405_100082895 307
868 3300031731 Ga0307405_10314680 Ga0307405_103146801 307
869 3300031852 Ga0307410_10432695 Ga0307410_104326952 307
870 3300031901 Ga0307406_10156074 Ga0307406_101560742 307
871 3300031901 Ga0307406_10222647 Ga0307406_102226472 307
872 3300031901 Ga0307406_10262768 Ga0307406_102627682 307
873 3300031911 Ga0307412_10118567 Ga0307412_101185672 307
874 3300031911 Ga0307412_10222367 Ga0307412_102223671 307
875 3300032002 Ga0307416_100149156 Ga0307416_1001491562 307
876 3300032004 Ga0307414_10030204 Ga0307414_100302043 307
877 3300032004 Ga0307414_10290327 Ga0307414_102903272 307
878 3300032005 Ga0307411_10025712 Ga0307411_100257122 307
879 3300032005 Ga0307411_10112134 Ga0307411_101121342 307
880 3300032126 Ga0307415_100206016 Ga0307415_1002060162 307
881 3300042002 Ga0439442_009852 Ga0439442_009852_826_1755 307
882 3300042145 Ga0450906_012352 Ga0450906_012352_196_1125 307
883 3300042184 Ga0450908_008194 Ga0450908_008194_37_966 307
884 3300046507 Ga0495606_0077350 Ga0495606_0077350_1063_2046 307
885 3300046531 Ga0495665_0032682 Ga0495665_0032682_1348_2331 307
886 3300046660 Ga0495625_0000235 Ga0495625_0000235_197_1126 307
887 3300046694 Ga0495649_0070829 Ga0495649_0070829_771_1754 307
888 3300049571 Ga0501034_0002256 Ga0501034_0002256_17708_18631 307
889 3300049679 Ga0501249_006712 Ga0501249_006712_1244_2173 307
890 3300049705 Ga0501225_0010539 Ga0501225_0010539_1491_2420 307
891 3300049759 Ga0501262_000763 Ga0501262_000763_29_958 307
892 3300049822 Ga0501035_0047135 Ga0501035_0047135_2613_3542 307
893 3300049823 Ga0501044_0016648 Ga0501044_0016648_2157_3086 307
894 3300050496 nmdc:mga07m45_51279_c1 nmdc:mga07m45_51279_c1_1296_2225 307
895 3300001979 JGI24740J21852_10016770 JGI24740J21852_100167702 308
896 3300001989 JGI24739J22299_10010731 JGI24739J22299_100107313 308
897 3300002773 JGI25152J39213_1004088 JGI25152J39213_10040885 308
898 3300002987 JGI25159J45721_1002308 JGI25159J45721_10023087 308
899 3300002987 JGI25159J45721_1019109 JGI25159J45721_10191091 308
900 3300003187 JGI25151J46595_10009102 JGI25151J46595_100091025 308
901 3300003215 JGI25153J46596_10004515 JGI25153J46596_100045158 308
902 3300003354 JGI25160J50197_1003214 JGI25160J50197_10032141 308
903 3300003354 JGI25160J50197_1032377 JGI25160J50197_10323772 308
904 3300003374 JGI25161J50226_1001384 JGI25161J50226_10013841 308
905 3300003761 Ga0055535_1000299 Ga0055535_100029947 308
906 3300003762 Ga0055542_1000328 Ga0055542_10003281 308
907 3300003771 Ga0055526_1005163 Ga0055526_10051638 308
908 3300003771 Ga0055526_1005272 Ga0055526_10052728 308
909 3300003773 Ga0055537_1000486 Ga0055537_10004862 308
910 3300003773 Ga0055537_1001902 Ga0055537_10019028 308
911 3300003773 Ga0055537_1015080 Ga0055537_10150802 308
912 3300003775 Ga0055524_1003583 Ga0055524_10035838 308
913 3300003775 Ga0055524_1015460 Ga0055524_10154602 308
914 3300003781 Ga0055536_1010740 Ga0055536_10107403 308
915 3300003781 Ga0055536_1015930 Ga0055536_10159302 308
916 3300003784 Ga0055534_1000439 Ga0055534_10004392 308
917 3300003784 Ga0055534_1003605 Ga0055534_10036051 308
918 3300003784 Ga0055534_1003694 Ga0055534_10036945 308
919 3300003790 Ga0055528_1003758 Ga0055528_10037588 308
920 3300003790 Ga0055528_1010357 Ga0055528_10103572 308
921 3300003790 Ga0055528_1031618 Ga0055528_10316182 308
922 3300003791 Ga0055530_10004040 Ga0055530_100040401 308
923 3300003791 Ga0055530_10007219 Ga0055530_100072195 308
924 3300003792 Ga0055540_1005061 Ga0055540_10050615 308
925 3300003792 Ga0055540_1009431 Ga0055540_10094311 308
926 3300003794 Ga0055531_10007805 Ga0055531_100078055 308
927 3300003794 Ga0055531_10007916 Ga0055531_100079165 308
928 3300003794 Ga0055531_10028701 Ga0055531_100287012 308
929 3300004625 Ga0055543_1001937 Ga0055543_10019371 308
930 3300004625 Ga0055543_1018420 Ga0055543_10184202 308
931 3300005262 Ga0065165_1005144 Ga0065165_10051448 308
932 3300005366 Ga0070659_100257527 Ga0070659_1002575271 308
933 3300005457 Ga0070662_100116409 Ga0070662_1001164092 308
934 3300005457 Ga0070662_100386599 Ga0070662_1003865991 308
935 3300005539 Ga0068853_100041539 Ga0068853_1000415391 308
936 3300005539 Ga0068853_100161652 Ga0068853_1001616522 308
937 3300005577 Ga0068857_100626720 Ga0068857_1006267201 308
938 3300005578 Ga0068854_100047034 Ga0068854_1000470342 308
939 3300005616 Ga0068852_100411452 Ga0068852_1004114522 308
940 3300005834 Ga0068851_10118284 Ga0068851_101182841 308
941 3300006195 Ga0075366_10010505 Ga0075366_100105055 308
942 3300006237 Ga0097621_100379390 Ga0097621_1003793902 308
943 3300006353 Ga0075370_10001204 Ga0075370_1000120410 308
944 3300006353 Ga0075370_10007017 Ga0075370_100070172 308
945 3300006353 Ga0075370_10239352 Ga0075370_102393521 308
946 3300006946 Ga0079104_1000020 Ga0079104_1000020115 308
947 3300006948 Ga0099826_10040205 Ga0099826_100402051 308
948 3300009036 Ga0105244_10043092 Ga0105244_100430923 308
949 3300009092 Ga0105250_10001224 Ga0105250_100012243 308
950 3300009148 Ga0105243_10035400 Ga0105243_100354001 308
951 3300009545 Ga0105237_10167945 Ga0105237_101679452 308
952 3300009551 Ga0105238_10695647 Ga0105238_106956471 308
953 3300011119 Ga0105246_10057760 Ga0105246_100577602 308
954 3300012502 Ga0157347_1003243 Ga0157347_10032432 308
955 3300012502 Ga0157347_1003874 Ga0157347_10038742 308
956 3300013100 Ga0157373_10030277 Ga0157373_100302772 308
957 3300013102 Ga0157371_10020702 Ga0157371_100207022 308
958 3300013104 Ga0157370_10031584 Ga0157370_100315842 308
959 3300013104 Ga0157370_10495216 Ga0157370_104952161 308
960 3300013105 Ga0157369_10399645 Ga0157369_103996452 308
961 3300013307 Ga0157372_10020956 Ga0157372_100209561 308
962 3300014497 Ga0182008_10047927 Ga0182008_100479272 308
963 3300014969 Ga0157376_10220755 Ga0157376_102207551 308
964 3300015261 Ga0182006_1003627 Ga0182006_10036272 308
965 3300015262 Ga0182007_10001296 Ga0182007_100012962 308
966 3300017792 Ga0163161_10000721 Ga0163161_100007213 308
967 3300025228 Ga0209672_100942 Ga0209672_1009421 308
968 3300025229 Ga0209147_101002 Ga0209147_10100211 308
969 3300025242 Ga0209258_100416 Ga0209258_10041647 308
970 3300025245 Ga0207425_1002002 Ga0207425_10020022 308
971 3300025245 Ga0207425_1006486 Ga0207425_10064861 308
972 3300025254 Ga0209148_1000033 Ga0209148_1000033530 308
973 3300025258 Ga0209129_1000274 Ga0209129_10002742 308
974 3300025258 Ga0209129_1009674 Ga0209129_10096742 308
975 3300025263 Ga0209565_1000918 Ga0209565_10009183 308
976 3300025263 Ga0209565_1001943 Ga0209565_10019432 308
977 3300025263 Ga0209565_1020412 Ga0209565_10204122 308
978 3300025273 Ga0209673_1000072 Ga0209673_1000072211 308
979 3300025273 Ga0209673_1000619 Ga0209673_10006192 308
980 3300025273 Ga0209673_1004370 Ga0209673_10043702 308
981 3300025284 Ga0209130_1001472 Ga0209130_100147215 308
982 3300025291 Ga0209675_1000640 Ga0209675_100064025 308
983 3300025291 Ga0209675_1006247 Ga0209675_10062472 308
984 3300025291 Ga0209675_1016368 Ga0209675_10163682 308
985 3300025292 Ga0209676_1000088 Ga0209676_1000088242 308
986 3300025292 Ga0209676_1004436 Ga0209676_10044368 308
987 3300025294 Ga0209025_1014725 Ga0209025_10147255 308
988 3300025294 Ga0209025_1014828 Ga0209025_10148285 308
989 3300025295 Ga0209564_1000684 Ga0209564_10006842 308
990 3300025295 Ga0209564_1000816 Ga0209564_10008162 308
991 3300025297 Ga0209758_1000691 Ga0209758_10006912 308
992 3300025298 Ga0209050_1000110 Ga0209050_10001101 308
993 3300025298 Ga0209050_1000447 Ga0209050_100044772 308
994 3300025299 Ga0209256_1000065 Ga0209256_1000065234 308
995 3300025299 Ga0209256_1000591 Ga0209256_10005913 308
996 3300025299 Ga0209256_1016039 Ga0209256_10160392 308
997 3300025302 Ga0207426_1000124 Ga0207426_1000124209 308
998 3300025302 Ga0207426_1000568 Ga0207426_10005682 308
999 3300025303 Ga0209051_1000578 Ga0209051_100057842 308
1000 3300025303 Ga0209051_1000686 Ga0209051_10006862 308
1001 3300025303 Ga0209051_1062425 Ga0209051_10624251 308
1002 3300025303 Ga0209051_1063048 Ga0209051_10630481 308
1003 3300025304 Ga0209257_1000093 Ga0209257_10000932 308
1004 3300025304 Ga0209257_1000417 Ga0209257_100041775 308
1005 3300025304 Ga0209257_1006397 Ga0209257_10063972 308
1006 3300025711 Ga0207696_1004560 Ga0207696_10045603 308
1007 3300025932 Ga0207690_10122127 Ga0207690_101221272 308
1008 3300025933 Ga0207706_10051661 Ga0207706_100516613 308
1009 3300025935 Ga0207709_10000267 Ga0207709_100002679 308
1010 3300025935 Ga0207709_10001726 Ga0207709_1000172614 308
1011 3300025935 Ga0207709_10012361 Ga0207709_100123611 308
1012 3300026041 Ga0207639_10040157 Ga0207639_100401571 308
1013 3300026041 Ga0207639_10166509 Ga0207639_101665092 308
1014 3300026116 Ga0207674_10133860 Ga0207674_101338602 308
1015 3300026142 Ga0207698_10065115 Ga0207698_100651152 308
1016 3300027111 Ga0209281_1000002 Ga0209281_1000002632 308
1017 3300027666 Ga0209282_1056267 Ga0209282_10562672 308
1018 3300031911 Ga0307412_10187953 Ga0307412_101879532 308
1019 3300046460 Ga0495638_0016093 Ga0495638_0016093_3368_4300 308
1020 3300046518 Ga0495631_0009228 Ga0495631_0009228_3876_4808 308
1021 3300046530 Ga0495654_0017288 Ga0495654_0017288_108_1040 308
1022 3300046674 Ga0495588_0077497 Ga0495588_0077497_412_1344 308
1023 3300046692 Ga0495671_0113965 Ga0495671_0113965_48_980 308
1024 3300047673 Ga0495593_0019982 Ga0495593_0019982_539_1471 308
1025 3300048919 Ga0496116_0030738 Ga0496116_0030738_1478_2410 308
1026 3300048920 Ga0496117_0053127 Ga0496117_0053127_1794_2726 308
1027 3300048920 Ga0496117_0100212 Ga0496117_0100212_152_1084 308
1028 3300048921 Ga0496118_0055836 Ga0496118_0055836_603_1535 308
1029 3300048921 Ga0496118_0087554 Ga0496118_0087554_142_1074 308
1030 3300048924 Ga0496121_0207116 Ga0496121_0207116_339_1271 308
1031 3300048928 Ga0496125_0101755 Ga0496125_0101755_185_1117 308
1032 3300048928 Ga0496125_0121868 Ga0496125_0121868_887_1819 308
1033 3300050493 nmdc:mga0k408_91335_c1 nmdc:mga0k408_91335_c1_433_1365 308
1034 3300050496 nmdc:mga07m45_130056_c1 nmdc:mga07m45_130056_c1_420_1352 308
1035 3300050496 nmdc:mga07m45_6317_c1 nmdc:mga07m45_6317_c1_4906_5838 308
1036 3300050496 nmdc:mga07m45_98731_c1 nmdc:mga07m45_98731_c1_407_1339 308
1037 3300053079 Ga0500610_0029739 Ga0500610_0029739_343_1275 308
1038 3300053079 Ga0500610_0033853 Ga0500610_0033853_148_1080 308
1039 3300053087 Ga0500643_041512 Ga0500643_041512_364_1296 308
1040 3300053087 Ga0500643_047212 Ga0500643_047212_129_1061 308
1041 3300053093 Ga0500651_0009059 Ga0500651_0009059_146_1078 308
1042 3300053108 Ga0500562_008109 Ga0500562_008109_1048_1980 308
1043 3300053110 Ga0500571_000063 Ga0500571_000063_110_1042 308
1044 3300053116 Ga0500592_002030 Ga0500592_002030_216_1148 308
1045 3300053117 Ga0500593_004575 Ga0500593_004575_134_1066 308
1046 3300053118 Ga0500594_0000775 Ga0500594_0000775_3685_4617 308
1047 3300053121 Ga0500607_001363 Ga0500607_001363_183_1115 308
1048 3300053121 Ga0500607_069106 Ga0500607_069106_746_1678 308
1049 3300053122 Ga0500608_005042 Ga0500608_005042_398_1330 308
1050 3300053133 Ga0500655_000382 Ga0500655_000382_3706_4638 308
1051 3300053134 Ga0500658_0000200 Ga0500658_0000200_27276_28208 308
1052 3300053134 Ga0500658_0003764 Ga0500658_0003764_4634_5566 308
1053 3300053141 Ga0500574_002196 Ga0500574_002196_1922_2854 308
1054 3300053158 Ga0500627_0003094 Ga0500627_0003094_145_1077 308
1055 3300053161 Ga0500634_0002634 Ga0500634_0002634_540_1472 308
1056 3300053161 Ga0500634_0007255 Ga0500634_0007255_4082_5014 308
1057 3300053177 Ga0500636_0080994 Ga0500636_0080994_798_1730 308
1058 3300048906 Ga0496103_0178626 Ga0496103_0178626_310_1239 309
1059 3300048907 Ga0496104_0365575 Ga0496104_0365575_354_1283 309
1060 3300048919 Ga0496116_0010050 Ga0496116_0010050_3915_4844 309
1061 3300050509 nmdc:mga0qj67_73687_c1 nmdc:mga0qj67_73687_c1_107_1069 309
1062 iso_pu_bacteria 2834641062 2834644156 309
1063 iso_pu_bacteria 8003400568 8003404415 309
1064 3300042876 Ga0451577_0007365 Ga0451577_0007365_2462_3448 310
1065 3300044712 Ga0453684_0147519 Ga0453684_0147519_289_1275 310
1066 3300003187 JGI25151J46595_10004529 JGI25151J46595_100045296 311
1067 3300003771 Ga0055526_1008924 Ga0055526_10089244 311
1068 3300003773 Ga0055537_1004388 Ga0055537_10043883 311
1069 3300003784 Ga0055534_1002071 Ga0055534_10020713 311
1070 3300025263 Ga0209565_1000106 Ga0209565_1000106103 311
1071 3300025273 Ga0209673_1011146 Ga0209673_10111463 311
1072 3300025291 Ga0209675_1001887 Ga0209675_10018878 311
1073 3300025295 Ga0209564_1000573 Ga0209564_100057353 311
1074 3300025297 Ga0209758_1027809 Ga0209758_10278092 311
1075 3300025299 Ga0209256_1000713 Ga0209256_10007135 311
1076 iso_pu_bacteria 2596583598 2597032617 313
1077 iso_pu_bacteria 2599185178 2599447280 313
1078 iso_pu_bacteria 2885266251 2885270053 313
1079 iso_pu_bacteria 2900577576 2900582418 313
1080 iso_pu_bacteria 2928058823 2928061017 313
1081 3300001979 JGI24740J21852_10002029 JGI24740J21852_100020296 315
1082 3300002705 JGI25156J39149_1011204 JGI25156J39149_10112041 315
1083 3300002738 JGI25154J39366_1001812 JGI25154J39366_10018122 315
1084 3300003762 Ga0055542_1001561 Ga0055542_10015617 315
1085 3300025224 Ga0209784_100336 Ga0209784_1003369 315
1086 3300025225 Ga0209566_102841 Ga0209566_1028412 315
1087 3300025226 Ga0209674_100098 Ga0209674_100098139 315
1088 3300025246 Ga0209646_1000082 Ga0209646_100008217 315
1089 3300025254 Ga0209148_1000395 Ga0209148_100039517 315
1090 3300025256 Ga0209759_1013497 Ga0209759_10134972 315
1091 3300044656 Ga0466969_0008094 Ga0466969_0008094_3581_4528 315
1092 3300044671 Ga0466978_0006210 Ga0466978_0006210_708_1655 315
1093 3300044672 Ga0466982_0113955 Ga0466982_0113955_637_1584 315
1094 3300044683 Ga0466965_0002685 Ga0466965_0002685_5589_6536 315
1095 3300044693 Ga0466961_0000242 Ga0466961_0000242_27149_28096 315
1096 3300044706 Ga0466964_0035019 Ga0466964_0035019_987_1934 315
1097 3300044719 Ga0466971_0024344 Ga0466971_0024344_634_1581 315
1098 3300044735 Ga0466968_0044692 Ga0466968_0044692_53_1000 315
1099 3300044765 Ga0466970_0000666 Ga0466970_0000666_3644_4591 315
1100 3300044842 Ga0466957_0084808 Ga0466957_0084808_854_1801 315
1101 3300044901 Ga0466960_0006119 Ga0466960_0006119_661_1608 315
1102 3300045049 Ga0466959_0001530 Ga0466959_0001530_12413_13360 315
1103 3300045976 Ga0466967_0003039 Ga0466967_0003039_826_1773 315
1104 3300001915 JGI24741J21665_1000785 JGI24741J21665_10007856 317
1105 3300001979 JGI24740J21852_10001866 JGI24740J21852_100018666 317
1106 3300003323 rootH1_10014069 rootH1_100140691 317
1107 3300003751 Ga0055538_1002471 Ga0055538_10024712 317
1108 3300003751 Ga0055538_1002475 Ga0055538_10024752 317
1109 3300003752 Ga0055539_1000185 Ga0055539_100018541 317
1110 3300003756 Ga0055533_1001125 Ga0055533_10011253 317
1111 3300003758 Ga0055532_1000006 Ga0055532_1000006406 317
1112 3300003759 Ga0055525_1000501 Ga0055525_100050111 317
1113 3300003760 Ga0055527_1001991 Ga0055527_10019914 317
1114 3300003761 Ga0055535_1000004 Ga0055535_1000004406 317
1115 3300003763 Ga0055529_1000273 Ga0055529_100027342 317
1116 3300003841 Ga0055541_1011701 Ga0055541_10117011 317
1117 3300005337 Ga0070682_100059832 Ga0070682_1000598322 317
1118 3300005344 Ga0070661_100002918 Ga0070661_1000029185 317
1119 3300005455 Ga0070663_100000246 Ga0070663_10000024619 317
1120 3300005564 Ga0070664_100000122 Ga0070664_10000012242 317
1121 3300005578 Ga0068854_100000121 Ga0068854_10000012139 317
1122 3300005614 Ga0068856_100001446 Ga0068856_1000014466 317
1123 3300009093 Ga0105240_10065397 Ga0105240_100653971 317
1124 3300009093 Ga0105240_10536060 Ga0105240_105360602 317
1125 3300013100 Ga0157373_10003474 Ga0157373_100034749 317
1126 3300013102 Ga0157371_10000072 Ga0157371_100000726 317
1127 3300013104 Ga0157370_10000031 Ga0157370_1000003141 317
1128 3300013105 Ga0157369_10003537 Ga0157369_100035379 317
1129 3300013307 Ga0157372_10007632 Ga0157372_100076326 317
1130 3300015261 Ga0182006_1001327 Ga0182006_100132710 317
1131 3300020077 Ga0206351_10828020 Ga0206351_108280206 317
1132 3300020610 Ga0154015_1137745 Ga0154015_11377455 317
1133 3300025224 Ga0209784_100006 Ga0209784_100006649 317
1134 3300025224 Ga0209784_100597 Ga0209784_1005972 317
1135 3300025225 Ga0209566_100002 Ga0209566_100002649 317
1136 3300025225 Ga0209566_101778 Ga0209566_1017784 317
1137 3300025225 Ga0209566_103712 Ga0209566_1037124 317
1138 3300025226 Ga0209674_100010 Ga0209674_100010487 317
1139 3300025226 Ga0209674_102210 Ga0209674_1022104 317
1140 3300025226 Ga0209674_105542 Ga0209674_1055423 317
1141 3300025228 Ga0209672_100448 Ga0209672_1004487 317
1142 3300025229 Ga0209147_100015 Ga0209147_100015144 317
1143 3300025230 Ga0209563_100004 Ga0209563_10000460 317
1144 3300025242 Ga0209258_100021 Ga0209258_100021144 317
1145 3300025253 Ga0209677_100007 Ga0209677_100007649 317
1146 3300025256 Ga0209759_1001087 Ga0209759_10010872 317
1147 3300025272 Ga0209455_1000028 Ga0209455_1000028144 317
1148 3300025913 Ga0207695_10002542 Ga0207695_100025429 317
1149 3300025920 Ga0207649_10001719 Ga0207649_100017196 317
1150 3300025945 Ga0207679_10000007 Ga0207679_10000007300 317
1151 3300025981 Ga0207640_10000107 Ga0207640_1000010740 317
1152 3300026067 Ga0207678_10000207 Ga0207678_100002076 317
1153 3300026078 Ga0207702_10000260 Ga0207702_1000026042 317
1154 3300037418 Ga0395900_0003101 Ga0395900_0003101_15578_16531 317
1155 3300044650 Ga0466986_0063161 Ga0466986_0063161_855_1808 317
1156 3300045976 Ga0466967_0118498 Ga0466967_0118498_1016_1969 317
1157 3300048928 Ga0496125_0021833 Ga0496125_0021833_874_1827 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

18

214

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bzh-assembly1.cif.gz_A solution structure of a dna binding protein from sulfolobus islandicus 0.8867 247 317
2va8-assembly2.cif.gz_B dna repair helicase hel308 0.8599 246 316
2va8-assembly1.cif.gz_A dna repair helicase hel308 0.8552 246 316
7bzh-assembly1.cif.gz_A solution structure of a dna binding protein from sulfolobus islandicus 0.8181 247 317
8caf-assembly1.cif.gz_H n8c_fab3b in complex with nedd8-cul1(whb) 0.8125 238 317
ID Description Score Start End Superfamily
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8797 244 314 1.10.10.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8756 130 220 3.60.15.10
2zwrB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8308 13 228 3.60.15.10
3dkwD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.828 290 317 1.10.10.10
af_K7KCY0_268_365_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8265 288 317 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3IQU8-F1-model_v4 deleted 0.9878 47 316
AF-A0A4Q3NTD4-F1-model_v4 deleted 0.9858 38 220
AF-F6G4H8-F1-model_v4 beta-lactamase (EC 3.5.2.6) 0.985 1 317 GO:0008270
GO:0008800
GO:0017001
GO:0042597
GO:0046677
AF-A0A375B8C5-F1-model_v4 Metallo-hydrolase/oxidoreductase, BETA LACTAMASE superfamily 0.9841 13 317
AF-A0A1N7CSH1-F1-model_v4 Glyoxylase, beta-lactamase superfamily II 0.9823 9 317

Feature Viewer

pLDDT pTM Quality
95.75 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map