F490960
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1157 | 549 | 2314 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0077551|Ga0451577_0077551_1190_2326 |
| Length | 378 |
| Sequence | VLDVHGSSCATATPGKCCAKKSAVPAVRSALGQVYCAADATRKLWRRQTTKHHHRLQRHAMLIRRPADIAPSEITPQDVWRQRRTLVEAAAAAGLVGVAAPLAAQNPSAQKLAGKPSALSTMEKATPYKLVTEYCNYYEFGTDKEDPAQYAPKFLKPRPWSVMVEGEVRKPRRFDIEELIKLAPMEERVYRLRCVEAWSAVVPWVGYPLAELIKAVEPTGNAKFVEFTTLADPKQMPGMRSPVLQWPYTEGLRIDEAMHPLTLLTFGMYGEVLPHQNGAPLRIVVPWKYGFKSAKSLVRIRFVEKQPVNSWQRSAPQEYGFYSNVNPTVDHPRWSQATERRLGEEGGLFAKRRQTLMFNGYGDQVAALYAGLDLKKNY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 136 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 259 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 260 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 262 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 263 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 264 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 265 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 266 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 267 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 268 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 269 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 270 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 271 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 272 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 273 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 274 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 275 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 276 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 395 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 396 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 397 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 398 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 399 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 400 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 415 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 422 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 433 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 434 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 436 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 437 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 438 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 439 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 442 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 443 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 444 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 445 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 446 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 447 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 448 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 449 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 450 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 451 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 452 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 453 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 454 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 455 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 456 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 457 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 458 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 459 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 460 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 461 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 462 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 463 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 464 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 465 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 466 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 467 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 468 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 469 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 470 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 471 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 472 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 473 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 474 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 475 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 476 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 477 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 478 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 479 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 480 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 481 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 482 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 483 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 484 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 485 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 486 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 487 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 488 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 489 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 490 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 491 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 492 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 493 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 494 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 495 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 496 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 497 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 498 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 499 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 500 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 501 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 502 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 503 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 504 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 505 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 506 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 507 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 508 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 509 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 510 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 511 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 512 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 513 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 514 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 515 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 516 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 517 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 518 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 519 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 520 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 521 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 522 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 523 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 524 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 525 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 526 | 2941479691 | |||
| 527 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 528 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 529 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 530 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 531 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 532 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 533 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 534 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 535 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 536 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 537 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 538 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 539 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 540 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 541 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 542 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 543 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 544 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 545 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 546 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 547 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 548 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 549 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.8 |
| Metatranscriptomes | 0.95 |
| Isolates | 9.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.15 |
| Nodule | 1.82 |
| Rhizoplane | 5.45 |
| Rhizosphere | 71.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451577_0077551 | 3300042876 | Bacteria | 2963 |
| 2 | JGI24740J21852_10002018 | 3300001979 | Bacteria | 9283 |
| 3 | JGI24739J22299_10009031 | 3300001989 | Bacteria | 3718 |
| 4 | JGI24739J22299_10017284 | 3300001989 | Bacteria | 2603 |
| 5 | JGI24737J22298_10005658 | 3300001990 | Bacteria | 4302 |
| 6 | JGI24735J21928_10000085 | 3300002067 | Bacteria | 35313 |
| 7 | JGI24735J21928_10004844 | 3300002067 | Bacteria | 4492 |
| 8 | JGI24735J21928_10011764 | 3300002067 | Bacteria | 2771 |
| 9 | JGI24738J21930_10002515 | 3300002075 | Bacteria | 4768 |
| 10 | JGI24738J21930_10020818 | 3300002075 | Bacteria | 1363 |
| 11 | JGI25156J39149_1000689 | 3300002705 | Bacteria | 18133 |
| 12 | JGI25156J39149_1001206 | 3300002705 | Bacteria | 11449 |
| 13 | JGI25156J39149_1002465 | 3300002705 | Bacteria | 6618 |
| 14 | JGI25158J39367_1000659 | 3300002739 | Bacteria | 6743 |
| 15 | JGI25158J39367_1001247 | 3300002739 | Bacteria | 4554 |
| 16 | JGI25152J39213_1000374 | 3300002773 | Bacteria | 27497 |
| 17 | JGI25152J39213_1008045 | 3300002773 | Bacteria | 2658 |
| 18 | JGI25150J39212_1001208 | 3300002774 | Bacteria | 7633 |
| 19 | JGI25159J45721_1003647 | 3300002987 | Bacteria | 5355 |
| 20 | JGI25159J45721_1004025 | 3300002987 | Bacteria | 5003 |
| 21 | JGI25165J46597_1001697 | 3300003214 | Bacteria | 9917 |
| 22 | JGI25153J46596_10007042 | 3300003215 | Bacteria | 5598 |
| 23 | rootL2_10024836 | 3300003322 | Bacteria | 2477 |
| 24 | JGI25160J50197_1000302 | 3300003354 | Bacteria | 34832 |
| 25 | JGI25160J50197_1002726 | 3300003354 | Bacteria | 8111 |
| 26 | JGI25161J50226_1001059 | 3300003374 | Bacteria | 9420 |
| 27 | JGI25161J50226_1002290 | 3300003374 | Bacteria | 5002 |
| 28 | JGI25161J50226_1011659 | 3300003374 | Bacteria | 1093 |
| 29 | Ga0055533_1000360 | 3300003756 | Bacteria | 19276 |
| 30 | Ga0055533_1000655 | 3300003756 | Bacteria | 11575 |
| 31 | Ga0055532_1000261 | 3300003758 | Bacteria | 35339 |
| 32 | Ga0055532_1001452 | 3300003758 | Bacteria | 6586 |
| 33 | Ga0055532_1001513 | 3300003758 | Bacteria | 6360 |
| 34 | Ga0055527_1000035 | 3300003760 | Bacteria | 138481 |
| 35 | Ga0055527_1000856 | 3300003760 | Bacteria | 7968 |
| 36 | Ga0055527_1001087 | 3300003760 | Bacteria | 6380 |
| 37 | Ga0055535_1000050 | 3300003761 | Bacteria | 138481 |
| 38 | Ga0055535_1002077 | 3300003761 | Bacteria | 7992 |
| 39 | Ga0055535_1002081 | 3300003761 | Bacteria | 7968 |
| 40 | Ga0055542_1000512 | 3300003762 | Bacteria | 35339 |
| 41 | Ga0055542_1001196 | 3300003762 | Bacteria | 14764 |
| 42 | Ga0055529_1000089 | 3300003763 | Bacteria | 138481 |
| 43 | Ga0055529_1000604 | 3300003763 | Bacteria | 27748 |
| 44 | Ga0055529_1001042 | 3300003763 | Bacteria | 13011 |
| 45 | Ga0055526_1011470 | 3300003771 | Bacteria | 3985 |
| 46 | Ga0055526_1013864 | 3300003771 | Bacteria | 3368 |
| 47 | Ga0055537_1008962 | 3300003773 | Bacteria | 2253 |
| 48 | Ga0055537_1012058 | 3300003773 | Bacteria | 1708 |
| 49 | Ga0055524_1003357 | 3300003775 | Bacteria | 7803 |
| 50 | Ga0055524_1004910 | 3300003775 | Bacteria | 6069 |
| 51 | Ga0055524_1037368 | 3300003775 | Bacteria | 1289 |
| 52 | Ga0055534_1008099 | 3300003784 | Bacteria | 2420 |
| 53 | Ga0055528_1000489 | 3300003790 | Bacteria | 31350 |
| 54 | Ga0055528_1002787 | 3300003790 | Bacteria | 9155 |
| 55 | Ga0055530_10005313 | 3300003791 | Bacteria | 6176 |
| 56 | Ga0055530_10008910 | 3300003791 | Bacteria | 3939 |
| 57 | Ga0055530_10015201 | 3300003791 | Bacteria | 2527 |
| 58 | Ga0055531_10013481 | 3300003794 | Bacteria | 3763 |
| 59 | Ga0055531_10025971 | 3300003794 | Bacteria | 2105 |
| 60 | Ga0058692_1001156 | 3300003856 | Bacteria | 10178 |
| 61 | Ga0055543_1001828 | 3300004625 | Bacteria | 7795 |
| 62 | Ga0055543_1002861 | 3300004625 | Bacteria | 5438 |
| 63 | Ga0058863_11081137 | 3300004799 | Bacteria | 1373 |
| 64 | Ga0065165_1000116 | 3300005262 | Bacteria | 134997 |
| 65 | Ga0065165_1000885 | 3300005262 | Bacteria | 38659 |
| 66 | Ga0065165_1001236 | 3300005262 | Bacteria | 29209 |
| 67 | Ga0065165_1004323 | 3300005262 | Bacteria | 8933 |
| 68 | Ga0065707_10083199 | 3300005295 | Bacteria | 10049 |
| 69 | Ga0065707_10084693 | 3300005295 | Bacteria | 6879 |
| 70 | Ga0070658_10009293 | 3300005327 | Bacteria | 7906 |
| 71 | Ga0070658_10033857 | 3300005327 | Bacteria | 4111 |
| 72 | Ga0070658_10038504 | 3300005327 | Bacteria | 3855 |
| 73 | Ga0070676_10023216 | 3300005328 | Bacteria | 3485 |
| 74 | Ga0070683_100003232 | 3300005329 | Bacteria | 13160 |
| 75 | Ga0070683_100374838 | 3300005329 | Bacteria | 1356 |
| 76 | Ga0070690_100039763 | 3300005330 | Bacteria | 2972 |
| 77 | Ga0070690_100091732 | 3300005330 | Bacteria | 2002 |
| 78 | Ga0070670_100006399 | 3300005331 | Bacteria | 9968 |
| 79 | Ga0070677_10053864 | 3300005333 | Bacteria | 1637 |
| 80 | Ga0070666_10038195 | 3300005335 | Bacteria | 3194 |
| 81 | Ga0070666_10082621 | 3300005335 | Bacteria | 2197 |
| 82 | Ga0068868_100012023 | 3300005338 | Bacteria | 6319 |
| 83 | Ga0070660_100000025 | 3300005339 | Bacteria | 90277 |
| 84 | Ga0070660_100108133 | 3300005339 | Bacteria | 2210 |
| 85 | Ga0070689_100029665 | 3300005340 | Bacteria | 4143 |
| 86 | Ga0070689_100034639 | 3300005340 | Bacteria | 3852 |
| 87 | Ga0070689_100169861 | 3300005340 | Bacteria | 1766 |
| 88 | Ga0070689_100288155 | 3300005340 | Bacteria | 1364 |
| 89 | Ga0070687_100030188 | 3300005343 | Bacteria | 2648 |
| 90 | Ga0070661_100026438 | 3300005344 | Bacteria | 4175 |
| 91 | Ga0070668_100036411 | 3300005347 | Bacteria | 3756 |
| 92 | Ga0070669_100068433 | 3300005353 | Bacteria | 2621 |
| 93 | Ga0070669_100079362 | 3300005353 | Bacteria | 2441 |
| 94 | Ga0070669_100095083 | 3300005353 | Bacteria | 2240 |
| 95 | Ga0070669_100144902 | 3300005353 | Bacteria | 1834 |
| 96 | Ga0070669_100242409 | 3300005353 | Bacteria | 1433 |
| 97 | Ga0070675_100033527 | 3300005354 | Bacteria | 4164 |
| 98 | Ga0070671_100004031 | 3300005355 | Bacteria | 11577 |
| 99 | Ga0070671_100195504 | 3300005355 | Bacteria | 1715 |
| 100 | Ga0070673_100038632 | 3300005364 | Bacteria | 3646 |
| 101 | Ga0070673_100066412 | 3300005364 | Bacteria | 2881 |
| 102 | Ga0070688_100001291 | 3300005365 | Bacteria | 12481 |
| 103 | Ga0070659_100000426 | 3300005366 | Bacteria | 31940 |
| 104 | Ga0070659_100002895 | 3300005366 | Bacteria | 12221 |
| 105 | Ga0070667_100032917 | 3300005367 | Bacteria | 4327 |
| 106 | Ga0070709_10013919 | 3300005434 | Bacteria | 4535 |
| 107 | Ga0070711_100053406 | 3300005439 | Bacteria | 2784 |
| 108 | Ga0070700_100076525 | 3300005441 | Bacteria | 2149 |
| 109 | Ga0070663_100109268 | 3300005455 | Bacteria | 2076 |
| 110 | Ga0070663_100267476 | 3300005455 | Bacteria | 1358 |
| 111 | Ga0070678_100080861 | 3300005456 | Bacteria | 2462 |
| 112 | Ga0070678_100176032 | 3300005456 | Bacteria | 1747 |
| 113 | Ga0070662_100009064 | 3300005457 | Bacteria | 6493 |
| 114 | Ga0070681_10062438 | 3300005458 | Bacteria | 3699 |
| 115 | Ga0070681_10237202 | 3300005458 | Bacteria | 1737 |
| 116 | Ga0068867_100083347 | 3300005459 | Bacteria | 2414 |
| 117 | Ga0070685_10009316 | 3300005466 | Bacteria | 5067 |
| 118 | Ga0070706_100001854 | 3300005467 | Bacteria | 21867 |
| 119 | Ga0070707_100236999 | 3300005468 | Bacteria | 1776 |
| 120 | Ga0070699_100154327 | 3300005518 | Bacteria | 2032 |
| 121 | Ga0070679_100124324 | 3300005530 | Bacteria | 2563 |
| 122 | Ga0070679_100282264 | 3300005530 | Bacteria | 1613 |
| 123 | Ga0070684_100003023 | 3300005535 | Bacteria | 12534 |
| 124 | Ga0070684_100615587 | 3300005535 | Bacteria | 1010 |
| 125 | Ga0068853_100446285 | 3300005539 | Bacteria | 1216 |
| 126 | Ga0070672_100049328 | 3300005543 | Bacteria | 3275 |
| 127 | Ga0070672_100049386 | 3300005543 | Bacteria | 3273 |
| 128 | Ga0070686_100128165 | 3300005544 | Bacteria | 1752 |
| 129 | Ga0070695_100193643 | 3300005545 | Bacteria | 1449 |
| 130 | Ga0070695_100248673 | 3300005545 | Bacteria | 1293 |
| 131 | Ga0070693_100019782 | 3300005547 | Bacteria | 3538 |
| 132 | Ga0070665_100000660 | 3300005548 | Bacteria | 46496 |
| 133 | Ga0070665_100013780 | 3300005548 | Bacteria | 8134 |
| 134 | Ga0070665_100017631 | 3300005548 | Bacteria | 7171 |
| 135 | Ga0070665_100357639 | 3300005548 | Bacteria | 1466 |
| 136 | Ga0068855_100008244 | 3300005563 | Bacteria | 12596 |
| 137 | Ga0068855_100034453 | 3300005563 | Bacteria | 6038 |
| 138 | Ga0068855_100089624 | 3300005563 | Bacteria | 3551 |
| 139 | Ga0070664_100018275 | 3300005564 | Bacteria | 5755 |
| 140 | Ga0070664_100254947 | 3300005564 | Bacteria | 1578 |
| 141 | Ga0068857_100066745 | 3300005577 | Bacteria | 3202 |
| 142 | Ga0068856_100005075 | 3300005614 | Bacteria | 13030 |
| 143 | Ga0070702_100248186 | 3300005615 | Bacteria | 1205 |
| 144 | Ga0068852_100016015 | 3300005616 | Bacteria | 5837 |
| 145 | Ga0068859_100237201 | 3300005617 | Bacteria | 1913 |
| 146 | Ga0068866_10011754 | 3300005718 | Bacteria | 3798 |
| 147 | Ga0068861_100000476 | 3300005719 | Bacteria | 23317 |
| 148 | Ga0068861_100001522 | 3300005719 | Bacteria | 14683 |
| 149 | Ga0068870_10004878 | 3300005840 | Bacteria | 5804 |
| 150 | Ga0068870_10020377 | 3300005840 | Bacteria | 3228 |
| 151 | Ga0068863_100059350 | 3300005841 | Bacteria | 3619 |
| 152 | Ga0068863_100449940 | 3300005841 | Bacteria | 1264 |
| 153 | Ga0068858_100176531 | 3300005842 | Bacteria | 2016 |
| 154 | Ga0068860_100059231 | 3300005843 | Bacteria | 3641 |
| 155 | Ga0068860_100194900 | 3300005843 | Bacteria | 1962 |
| 156 | Ga0068862_100000987 | 3300005844 | Bacteria | 27217 |
| 157 | Ga0075368_10013182 | 3300006042 | Bacteria | 3033 |
| 158 | Ga0075364_10001271 | 3300006051 | Bacteria | 13570 |
| 159 | Ga0070716_100185489 | 3300006173 | Bacteria | 1370 |
| 160 | Ga0075367_10062286 | 3300006178 | Bacteria | 2228 |
| 161 | Ga0075366_10044507 | 3300006195 | Bacteria | 2631 |
| 162 | Ga0097621_100006113 | 3300006237 | Bacteria | 8523 |
| 163 | Ga0097621_100309656 | 3300006237 | Bacteria | 1397 |
| 164 | Ga0075428_100000668 | 3300006844 | Bacteria | 35236 |
| 165 | Ga0075428_100012845 | 3300006844 | Bacteria | 9319 |
| 166 | Ga0075428_100214215 | 3300006844 | Bacteria | 2081 |
| 167 | Ga0075428_100254919 | 3300006844 | Bacteria | 1890 |
| 168 | Ga0075428_100334827 | 3300006844 | Bacteria | 1626 |
| 169 | Ga0075430_100003515 | 3300006846 | Bacteria | 13111 |
| 170 | Ga0075430_100023748 | 3300006846 | Bacteria | 5222 |
| 171 | Ga0075430_100046030 | 3300006846 | Bacteria | 3684 |
| 172 | Ga0075430_100047463 | 3300006846 | Bacteria | 3627 |
| 173 | Ga0075431_100010835 | 3300006847 | Bacteria | 9169 |
| 174 | Ga0075431_100013304 | 3300006847 | Bacteria | 8316 |
| 175 | Ga0075431_100028254 | 3300006847 | Bacteria | 5760 |
| 176 | Ga0075431_100279102 | 3300006847 | Bacteria | 1692 |
| 177 | Ga0075431_100332354 | 3300006847 | Bacteria | 1530 |
| 178 | Ga0075434_100061116 | 3300006871 | Bacteria | 3747 |
| 179 | Ga0075429_100013404 | 3300006880 | Bacteria | 7108 |
| 180 | Ga0075429_100066056 | 3300006880 | Bacteria | 3149 |
| 181 | Ga0068865_100076214 | 3300006881 | Bacteria | 2393 |
| 182 | Ga0075436_100016767 | 3300006914 | Bacteria | 5014 |
| 183 | Ga0075436_100056897 | 3300006914 | Bacteria | 2701 |
| 184 | Ga0097620_100237207 | 3300006931 | Bacteria | 1913 |
| 185 | Ga0099794_10015598 | 3300007265 | Bacteria | 3358 |
| 186 | Ga0099795_10076636 | 3300007788 | Bacteria | 1271 |
| 187 | Ga0105251_10000422 | 3300009011 | Bacteria | 41157 |
| 188 | Ga0105251_10001215 | 3300009011 | Bacteria | 22270 |
| 189 | Ga0105251_10043445 | 3300009011 | Bacteria | 2176 |
| 190 | Ga0105244_10042907 | 3300009036 | Bacteria | 2336 |
| 191 | Ga0105250_10000006 | 3300009092 | Bacteria | 390071 |
| 192 | Ga0105250_10008008 | 3300009092 | Bacteria | 4507 |
| 193 | Ga0105240_10002542 | 3300009093 | Bacteria | 29256 |
| 194 | Ga0105240_10003657 | 3300009093 | Bacteria | 23805 |
| 195 | Ga0105240_10008032 | 3300009093 | Bacteria | 15186 |
| 196 | Ga0105240_10044011 | 3300009093 | Bacteria | 5676 |
| 197 | Ga0105240_10060442 | 3300009093 | Bacteria | 4724 |
| 198 | Ga0105240_10086152 | 3300009093 | Bacteria | 3847 |
| 199 | Ga0105240_10107666 | 3300009093 | Bacteria | 3379 |
| 200 | Ga0111539_10004402 | 3300009094 | Bacteria | 18415 |
| 201 | Ga0111539_10020994 | 3300009094 | Bacteria | 8041 |
| 202 | Ga0105245_10015862 | 3300009098 | Bacteria | 6564 |
| 203 | Ga0105245_10127450 | 3300009098 | Bacteria | 2384 |
| 204 | Ga0114129_10002340 | 3300009147 | Bacteria | 26307 |
| 205 | Ga0114129_10350121 | 3300009147 | Bacteria | 1957 |
| 206 | Ga0105243_10467640 | 3300009148 | Bacteria | 1187 |
| 207 | Ga0105241_10008245 | 3300009174 | Bacteria | 7674 |
| 208 | Ga0105242_10118974 | 3300009176 | Bacteria | 2264 |
| 209 | Ga0105242_10221195 | 3300009176 | Bacteria | 1692 |
| 210 | Ga0105242_10235707 | 3300009176 | Bacteria | 1642 |
| 211 | Ga0105248_10001770 | 3300009177 | Bacteria | 24034 |
| 212 | Ga0105248_10058727 | 3300009177 | Bacteria | 4320 |
| 213 | Ga0105248_10093341 | 3300009177 | Bacteria | 3389 |
| 214 | Ga0105248_10115448 | 3300009177 | Bacteria | 3028 |
| 215 | Ga0105248_10222527 | 3300009177 | Bacteria | 2125 |
| 216 | Ga0105248_10572444 | 3300009177 | Bacteria | 1274 |
| 217 | Ga0105237_10000806 | 3300009545 | Bacteria | 42774 |
| 218 | Ga0105237_10015030 | 3300009545 | Bacteria | 8066 |
| 219 | Ga0105237_10206678 | 3300009545 | Bacteria | 1964 |
| 220 | Ga0105237_10222133 | 3300009545 | Bacteria | 1889 |
| 221 | Ga0105238_10023771 | 3300009551 | Bacteria | 6247 |
| 222 | Ga0105238_10136996 | 3300009551 | Bacteria | 2426 |
| 223 | Ga0105238_10138000 | 3300009551 | Bacteria | 2416 |
| 224 | Ga0105238_10275361 | 3300009551 | Bacteria | 1664 |
| 225 | Ga0105249_10000932 | 3300009553 | Bacteria | 25858 |
| 226 | Ga0105249_10410807 | 3300009553 | Bacteria | 1386 |
| 227 | Ga0105249_10467951 | 3300009553 | Bacteria | 1302 |
| 228 | Ga0105239_10000292 | 3300010375 | Bacteria | 73809 |
| 229 | Ga0105239_10265140 | 3300010375 | Bacteria | 1931 |
| 230 | Ga0157370_10004409 | 3300013104 | Bacteria | 16142 |
| 231 | Ga0157370_10170975 | 3300013104 | Bacteria | 2020 |
| 232 | Ga0157369_10000147 | 3300013105 | Bacteria | 100084 |
| 233 | Ga0157369_10001132 | 3300013105 | Bacteria | 33339 |
| 234 | Ga0157369_10150467 | 3300013105 | Bacteria | 2460 |
| 235 | Ga0157369_10286170 | 3300013105 | Bacteria | 1716 |
| 236 | Ga0157374_10000117 | 3300013296 | Bacteria | 73027 |
| 237 | Ga0157374_10089701 | 3300013296 | Bacteria | 2930 |
| 238 | Ga0157374_10162633 | 3300013296 | Bacteria | 2174 |
| 239 | Ga0157378_10000848 | 3300013297 | Bacteria | 28318 |
| 240 | Ga0157378_10051905 | 3300013297 | Bacteria | 3648 |
| 241 | Ga0163162_10001267 | 3300013306 | Bacteria | 23605 |
| 242 | Ga0163162_10250959 | 3300013306 | Bacteria | 1901 |
| 243 | Ga0157375_10116663 | 3300013308 | Bacteria | 2774 |
| 244 | Ga0163163_10358215 | 3300014325 | Bacteria | 1515 |
| 245 | Ga0163163_10415122 | 3300014325 | Bacteria | 1405 |
| 246 | Ga0157380_10002130 | 3300014326 | Bacteria | 13288 |
| 247 | Ga0157379_10000337 | 3300014968 | Bacteria | 37644 |
| 248 | Ga0157379_10080167 | 3300014968 | Bacteria | 2924 |
| 249 | Ga0157379_10086887 | 3300014968 | Bacteria | 2804 |
| 250 | Ga0157376_10006374 | 3300014969 | Bacteria | 8334 |
| 251 | Ga0182005_1015683 | 3300015265 | Bacteria | 2112 |
| 252 | Ga0183361_10015 | 3300016635 | Bacteria | 166772 |
| 253 | Ga0163161_10144592 | 3300017792 | Bacteria | 1803 |
| 254 | Ga0163161_10313658 | 3300017792 | Bacteria | 1238 |
| 255 | Ga0197907_10170016 | 3300020069 | Bacteria | 1576 |
| 256 | Ga0206356_10440101 | 3300020070 | Bacteria | 2817 |
| 257 | Ga0206355_1192289 | 3300020076 | Bacteria | 1203 |
| 258 | Ga0206350_11042565 | 3300020080 | Bacteria | 1281 |
| 259 | Ga0206354_10161165 | 3300020081 | Bacteria | 3640 |
| 260 | Ga0206354_11326690 | 3300020081 | Bacteria | 2351 |
| 261 | Ga0206353_10230299 | 3300020082 | Bacteria | 2431 |
| 262 | Ga0213872_10000031 | 3300021361 | Bacteria | 139321 |
| 263 | Ga0213872_10000373 | 3300021361 | Bacteria | 37639 |
| 264 | Ga0213872_10000561 | 3300021361 | Bacteria | 28726 |
| 265 | Ga0213872_10002125 | 3300021361 | Bacteria | 11924 |
| 266 | Ga0213872_10003375 | 3300021361 | Bacteria | 8887 |
| 267 | Ga0213872_10003455 | 3300021361 | Bacteria | 8780 |
| 268 | Ga0213872_10004304 | 3300021361 | Bacteria | 7604 |
| 269 | Ga0213872_10012950 | 3300021361 | Bacteria | 3913 |
| 270 | Ga0213872_10014710 | 3300021361 | Bacteria | 3646 |
| 271 | Ga0213872_10020644 | 3300021361 | Bacteria | 3036 |
| 272 | Ga0213872_10029298 | 3300021361 | Bacteria | 2524 |
| 273 | Ga0213872_10070218 | 3300021361 | Bacteria | 1579 |
| 274 | Ga0213872_10086200 | 3300021361 | Bacteria | 1407 |
| 275 | Ga0213872_10111107 | 3300021361 | Bacteria | 1217 |
| 276 | Ga0224712_10000271 | 3300022467 | Bacteria | 9519 |
| 277 | Ga0224712_10022673 | 3300022467 | Bacteria | 2168 |
| 278 | Ga0209436_100369 | 3300025208 | Bacteria | 20349 |
| 279 | Ga0209436_100434 | 3300025208 | Bacteria | 18696 |
| 280 | Ga0209436_101159 | 3300025208 | Bacteria | 9727 |
| 281 | Ga0209566_100901 | 3300025225 | Bacteria | 14198 |
| 282 | Ga0209674_100153 | 3300025226 | Bacteria | 94333 |
| 283 | Ga0209674_100272 | 3300025226 | Bacteria | 39275 |
| 284 | Ga0209674_101734 | 3300025226 | Bacteria | 5357 |
| 285 | Ga0209672_100054 | 3300025228 | Bacteria | 222217 |
| 286 | Ga0209672_100072 | 3300025228 | Bacteria | 167942 |
| 287 | Ga0209672_100073 | 3300025228 | Bacteria | 166621 |
| 288 | Ga0209672_102717 | 3300025228 | Bacteria | 4104 |
| 289 | Ga0209147_100093 | 3300025229 | Bacteria | 167196 |
| 290 | Ga0209147_100100 | 3300025229 | Bacteria | 162747 |
| 291 | Ga0209147_100328 | 3300025229 | Bacteria | 35916 |
| 292 | Ga0209147_100445 | 3300025229 | Bacteria | 26092 |
| 293 | Ga0207427_101410 | 3300025231 | Bacteria | 8783 |
| 294 | Ga0209258_100140 | 3300025242 | Bacteria | 167245 |
| 295 | Ga0209258_100579 | 3300025242 | Bacteria | 30754 |
| 296 | Ga0209258_100581 | 3300025242 | Bacteria | 30706 |
| 297 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 298 | Ga0207425_1000223 | 3300025245 | Bacteria | 44555 |
| 299 | Ga0209026_1002417 | 3300025250 | Bacteria | 7028 |
| 300 | Ga0209148_1000119 | 3300025254 | Bacteria | 188079 |
| 301 | Ga0209148_1000140 | 3300025254 | Bacteria | 166819 |
| 302 | Ga0209148_1001759 | 3300025254 | Bacteria | 9336 |
| 303 | Ga0209759_1000281 | 3300025256 | Bacteria | 71594 |
| 304 | Ga0209759_1000928 | 3300025256 | Bacteria | 21225 |
| 305 | Ga0209759_1005226 | 3300025256 | Bacteria | 4612 |
| 306 | Ga0209759_1008317 | 3300025256 | Bacteria | 3246 |
| 307 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 308 | Ga0209129_1003091 | 3300025258 | Bacteria | 7493 |
| 309 | Ga0209233_1000173 | 3300025261 | Bacteria | 145995 |
| 310 | Ga0209565_1000536 | 3300025263 | Bacteria | 26563 |
| 311 | Ga0209565_1000770 | 3300025263 | Bacteria | 18696 |
| 312 | Ga0209565_1004827 | 3300025263 | Bacteria | 4025 |
| 313 | Ga0209565_1004922 | 3300025263 | Bacteria | 3979 |
| 314 | Ga0209565_1009668 | 3300025263 | Bacteria | 2431 |
| 315 | Ga0209455_1000125 | 3300025272 | Bacteria | 166819 |
| 316 | Ga0209455_1000244 | 3300025272 | Bacteria | 67136 |
| 317 | Ga0209455_1000849 | 3300025272 | Bacteria | 16329 |
| 318 | Ga0209673_1000098 | 3300025273 | Bacteria | 193352 |
| 319 | Ga0209673_1012788 | 3300025273 | Bacteria | 3357 |
| 320 | Ga0209130_1002175 | 3300025284 | Bacteria | 10331 |
| 321 | Ga0209130_1003597 | 3300025284 | Bacteria | 6459 |
| 322 | Ga0209675_1000650 | 3300025291 | Bacteria | 24546 |
| 323 | Ga0209675_1003924 | 3300025291 | Bacteria | 6820 |
| 324 | Ga0209675_1004802 | 3300025291 | Bacteria | 5870 |
| 325 | Ga0209564_1000780 | 3300025295 | Bacteria | 44199 |
| 326 | Ga0209564_1003850 | 3300025295 | Bacteria | 9683 |
| 327 | Ga0209564_1010880 | 3300025295 | Bacteria | 4139 |
| 328 | Ga0209564_1013058 | 3300025295 | Bacteria | 3559 |
| 329 | Ga0209758_1000077 | 3300025297 | Bacteria | 268195 |
| 330 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 331 | Ga0209050_1000795 | 3300025298 | Bacteria | 44648 |
| 332 | Ga0209050_1007586 | 3300025298 | Bacteria | 6032 |
| 333 | Ga0209256_1000674 | 3300025299 | Bacteria | 46225 |
| 334 | Ga0209256_1001001 | 3300025299 | Bacteria | 33573 |
| 335 | Ga0209256_1014402 | 3300025299 | Bacteria | 2848 |
| 336 | Ga0207426_1000199 | 3300025302 | Bacteria | 145826 |
| 337 | Ga0207426_1002770 | 3300025302 | Bacteria | 10561 |
| 338 | Ga0207426_1003789 | 3300025302 | Bacteria | 7847 |
| 339 | Ga0209051_1024272 | 3300025303 | Bacteria | 2497 |
| 340 | Ga0209257_1000075 | 3300025304 | Bacteria | 324855 |
| 341 | Ga0209257_1012663 | 3300025304 | Bacteria | 3865 |
| 342 | Ga0207656_10015465 | 3300025321 | Unclassified | 2953 |
| 343 | Ga0207696_1000069 | 3300025711 | Bacteria | 227744 |
| 344 | Ga0207713_1000473 | 3300025735 | Bacteria | 41885 |
| 345 | Ga0207713_1011443 | 3300025735 | Bacteria | 4823 |
| 346 | Ga0207680_10078739 | 3300025903 | Bacteria | 2065 |
| 347 | Ga0207647_10000884 | 3300025904 | Bacteria | 23255 |
| 348 | Ga0207647_10011496 | 3300025904 | Bacteria | 6206 |
| 349 | Ga0207647_10023305 | 3300025904 | Bacteria | 4095 |
| 350 | Ga0207647_10036201 | 3300025904 | Bacteria | 3137 |
| 351 | Ga0207647_10068522 | 3300025904 | Bacteria | 2148 |
| 352 | Ga0207645_10005863 | 3300025907 | Bacteria | 8850 |
| 353 | Ga0207645_10012127 | 3300025907 | Bacteria | 5856 |
| 354 | Ga0207645_10104751 | 3300025907 | Bacteria | 1827 |
| 355 | Ga0207643_10016060 | 3300025908 | Bacteria | 4079 |
| 356 | Ga0207643_10023434 | 3300025908 | Bacteria | 3403 |
| 357 | Ga0207705_10002472 | 3300025909 | Bacteria | 14240 |
| 358 | Ga0207705_10039734 | 3300025909 | Bacteria | 3373 |
| 359 | Ga0207705_10091658 | 3300025909 | Bacteria | 2226 |
| 360 | Ga0207684_10003995 | 3300025910 | Bacteria | 14112 |
| 361 | Ga0207684_10129406 | 3300025910 | Bacteria | 2166 |
| 362 | Ga0207695_10002160 | 3300025913 | Bacteria | 29752 |
| 363 | Ga0207695_10004507 | 3300025913 | Bacteria | 18963 |
| 364 | Ga0207695_10010060 | 3300025913 | Bacteria | 11616 |
| 365 | Ga0207695_10109457 | 3300025913 | Bacteria | 2745 |
| 366 | Ga0207695_10117465 | 3300025913 | Bacteria | 2632 |
| 367 | Ga0207695_10149502 | 3300025913 | Bacteria | 2276 |
| 368 | Ga0207695_10266745 | 3300025913 | Unclassified | 1608 |
| 369 | Ga0207662_10037189 | 3300025918 | Bacteria | 2848 |
| 370 | Ga0207657_10000065 | 3300025919 | Bacteria | 98751 |
| 371 | Ga0207657_10176219 | 3300025919 | Bacteria | 1730 |
| 372 | Ga0207649_10050277 | 3300025920 | Bacteria | 2578 |
| 373 | Ga0207681_10009993 | 3300025923 | Bacteria | 5807 |
| 374 | Ga0207681_10024175 | 3300025923 | Bacteria | 3897 |
| 375 | Ga0207681_10063461 | 3300025923 | Bacteria | 2547 |
| 376 | Ga0207694_10049326 | 3300025924 | Bacteria | 3259 |
| 377 | Ga0207694_10096452 | 3300025924 | Bacteria | 2338 |
| 378 | Ga0207694_10217460 | 3300025924 | Bacteria | 1558 |
| 379 | Ga0207694_10251506 | 3300025924 | Bacteria | 1446 |
| 380 | Ga0207650_10176304 | 3300025925 | Bacteria | 1701 |
| 381 | Ga0207659_10006052 | 3300025926 | Bacteria | 7385 |
| 382 | Ga0207687_10010398 | 3300025927 | Bacteria | 6080 |
| 383 | Ga0207687_10062424 | 3300025927 | Bacteria | 2635 |
| 384 | Ga0207700_10252302 | 3300025928 | Bacteria | 1507 |
| 385 | Ga0207690_10000040 | 3300025932 | Bacteria | 130300 |
| 386 | Ga0207706_10012447 | 3300025933 | Bacteria | 7751 |
| 387 | Ga0207706_10196415 | 3300025933 | Bacteria | 1770 |
| 388 | Ga0207670_10065604 | 3300025936 | Bacteria | 2492 |
| 389 | Ga0207670_10274235 | 3300025936 | Bacteria | 1312 |
| 390 | Ga0207665_10026036 | 3300025939 | Bacteria | 3860 |
| 391 | Ga0207665_10462882 | 3300025939 | Bacteria | 975 |
| 392 | Ga0207691_10003458 | 3300025940 | Bacteria | 15365 |
| 393 | Ga0207691_10056855 | 3300025940 | Bacteria | 3562 |
| 394 | Ga0207711_10004182 | 3300025941 | Bacteria | 12359 |
| 395 | Ga0207711_10007645 | 3300025941 | Bacteria | 9040 |
| 396 | Ga0207711_10101453 | 3300025941 | Bacteria | 2547 |
| 397 | Ga0207711_10247003 | 3300025941 | Bacteria | 1637 |
| 398 | Ga0207661_10223831 | 3300025944 | Bacteria | 1664 |
| 399 | Ga0207679_10158804 | 3300025945 | Bacteria | 1849 |
| 400 | Ga0207667_10002770 | 3300025949 | Bacteria | 21687 |
| 401 | Ga0207667_10007228 | 3300025949 | Bacteria | 13400 |
| 402 | Ga0207651_10000299 | 3300025960 | Bacteria | 21268 |
| 403 | Ga0207651_10085542 | 3300025960 | Bacteria | 2288 |
| 404 | Ga0207712_10003324 | 3300025961 | Bacteria | 10195 |
| 405 | Ga0207712_10452111 | 3300025961 | Bacteria | 1089 |
| 406 | Ga0207668_10159205 | 3300025972 | Bacteria | 1757 |
| 407 | Ga0207678_10002359 | 3300026067 | Bacteria | 17124 |
| 408 | Ga0207678_10021510 | 3300026067 | Bacteria | 5656 |
| 409 | Ga0207678_10066655 | 3300026067 | Bacteria | 3091 |
| 410 | Ga0207708_10007971 | 3300026075 | Bacteria | 7848 |
| 411 | Ga0207708_10037895 | 3300026075 | Bacteria | 3673 |
| 412 | Ga0207702_10230241 | 3300026078 | Bacteria | 1731 |
| 413 | Ga0207641_10035820 | 3300026088 | Bacteria | 4138 |
| 414 | Ga0207648_10018611 | 3300026089 | Bacteria | 6284 |
| 415 | Ga0207648_10025670 | 3300026089 | Bacteria | 5245 |
| 416 | Ga0207674_10039350 | 3300026116 | Bacteria | 4902 |
| 417 | Ga0207675_100002950 | 3300026118 | Bacteria | 16726 |
| 418 | Ga0207675_100025458 | 3300026118 | Bacteria | 5508 |
| 419 | Ga0207675_100040413 | 3300026118 | Bacteria | 4356 |
| 420 | Ga0207675_100198935 | 3300026118 | Bacteria | 1924 |
| 421 | Ga0207675_100415533 | 3300026118 | Bacteria | 1328 |
| 422 | Ga0207675_100773829 | 3300026118 | Bacteria | 972 |
| 423 | Ga0207683_10099306 | 3300026121 | Bacteria | 2598 |
| 424 | Ga0207683_10119170 | 3300026121 | Bacteria | 2368 |
| 425 | Ga0207683_10133739 | 3300026121 | Bacteria | 2232 |
| 426 | Ga0207698_10018564 | 3300026142 | Bacteria | 4742 |
| 427 | Ga0209371_1000325 | 3300027312 | Bacteria | 52216 |
| 428 | Ga0209371_1000766 | 3300027312 | Bacteria | 26728 |
| 429 | Ga0209371_1004858 | 3300027312 | Bacteria | 5626 |
| 430 | Ga0209971_1037991 | 3300027682 | Bacteria | 1159 |
| 431 | Ga0209813_10062220 | 3300027866 | Bacteria | 1194 |
| 432 | Ga0207428_10031694 | 3300027907 | Bacteria | 4357 |
| 433 | Ga0268266_10000630 | 3300028379 | Bacteria | 47949 |
| 434 | Ga0268266_10142463 | 3300028379 | Bacteria | 2152 |
| 435 | Ga0268266_10338010 | 3300028379 | Bacteria | 1413 |
| 436 | Ga0265334_10000192 | 3300028573 | Bacteria | 35702 |
| 437 | Ga0265318_10004269 | 3300028577 | Bacteria | 6965 |
| 438 | Ga0307515_10000062 | 3300028794 | Bacteria | 247284 |
| 439 | Ga0307515_10011102 | 3300028794 | Bacteria | 17134 |
| 440 | Ga0307515_10063273 | 3300028794 | Bacteria | 5202 |
| 441 | Ga0265338_10028960 | 3300028800 | Bacteria | 5506 |
| 442 | Ga0265338_10032666 | 3300028800 | Bacteria | 5067 |
| 443 | Ga0268256_1006955 | 3300030500 | Bacteria | 4124 |
| 444 | Ga0268256_1013276 | 3300030500 | Bacteria | 2506 |
| 445 | Ga0265330_10014351 | 3300031235 | Bacteria | 3676 |
| 446 | Ga0265328_10004474 | 3300031239 | Bacteria | 6073 |
| 447 | Ga0265325_10026335 | 3300031241 | Bacteria | 3150 |
| 448 | Ga0265325_10079571 | 3300031241 | Unclassified | 1631 |
| 449 | Ga0265339_10020277 | 3300031249 | Bacteria | 3886 |
| 450 | Ga0265331_10005565 | 3300031250 | Bacteria | 7586 |
| 451 | Ga0265327_10025641 | 3300031251 | Bacteria | 3432 |
| 452 | Ga0265327_10042408 | 3300031251 | Bacteria | 2443 |
| 453 | Ga0265316_10015358 | 3300031344 | Bacteria | 6698 |
| 454 | Ga0265316_10050777 | 3300031344 | Bacteria | 3260 |
| 455 | Ga0307513_10017125 | 3300031456 | Bacteria | 8704 |
| 456 | Ga0307513_10258902 | 3300031456 | Bacteria | 1531 |
| 457 | Ga0307509_10000781 | 3300031507 | Bacteria | 54552 |
| 458 | Ga0307509_10140386 | 3300031507 | Bacteria | 2353 |
| 459 | Ga0307408_100000531 | 3300031548 | Bacteria | 32967 |
| 460 | Ga0307408_100006732 | 3300031548 | Bacteria | 7619 |
| 461 | Ga0307408_100015316 | 3300031548 | Bacteria | 5105 |
| 462 | Ga0307408_100025974 | 3300031548 | Bacteria | 4016 |
| 463 | Ga0307408_100049899 | 3300031548 | Bacteria | 3007 |
| 464 | Ga0307408_100223034 | 3300031548 | Bacteria | 1539 |
| 465 | Ga0265313_10009218 | 3300031595 | Bacteria | 6435 |
| 466 | Ga0265314_10051139 | 3300031711 | Bacteria | 2879 |
| 467 | Ga0265314_10215541 | 3300031711 | Bacteria | 1124 |
| 468 | Ga0265342_10036360 | 3300031712 | Bacteria | 3009 |
| 469 | Ga0307516_10102046 | 3300031730 | Bacteria | 2684 |
| 470 | Ga0307405_10228874 | 3300031731 | Bacteria | 1369 |
| 471 | Ga0307518_10017517 | 3300031838 | Bacteria | 5136 |
| 472 | Ga0307412_10000056 | 3300031911 | Bacteria | 145861 |
| 473 | Ga0307412_10000313 | 3300031911 | Bacteria | 30726 |
| 474 | Ga0307409_100183810 | 3300031995 | Bacteria | 1853 |
| 475 | Ga0307416_100003671 | 3300032002 | Bacteria | 9084 |
| 476 | Ga0307416_100006357 | 3300032002 | Bacteria | 7387 |
| 477 | Ga0307416_100037534 | 3300032002 | Bacteria | 3729 |
| 478 | Ga0307411_10083184 | 3300032005 | Bacteria | 2210 |
| 479 | Ga0307415_100236031 | 3300032126 | Bacteria | 1476 |
| 480 | Ga0316593_10013988 | 3300032168 | Bacteria | 2385 |
| 481 | Ga0373923_0057757 | 3300035111 | Bacteria | 1641 |
| 482 | Ga0373954_0003620 | 3300035118 | Bacteria | 6575 |
| 483 | Ga0373954_0073056 | 3300035118 | Bacteria | 1632 |
| 484 | Ga0373956_0112634 | 3300035119 | Bacteria | 1267 |
| 485 | Ga0373957_0021631 | 3300035120 | Bacteria | 2285 |
| 486 | Ga0373931_0122600 | 3300035691 | Bacteria | 1487 |
| 487 | Ga0373935_0034565 | 3300035692 | Bacteria | 3151 |
| 488 | Ga0373927_0056620 | 3300035695 | Bacteria | 2535 |
| 489 | Ga0373927_0135245 | 3300035695 | Bacteria | 1611 |
| 490 | Ga0373947_0012484 | 3300035725 | Bacteria | 4871 |
| 491 | Ga0373937_0144790 | 3300036401 | Bacteria | 2224 |
| 492 | Ga0373937_0203611 | 3300036401 | Bacteria | 1861 |
| 493 | Ga0316582_0049440 | 3300036647 | Bacteria | 2660 |
| 494 | Ga0373925_0376705 | 3300037068 | Bacteria | 1155 |
| 495 | Ga0395899_0000080 | 3300037312 | Bacteria | 171568 |
| 496 | Ga0395900_0000087 | 3300037418 | Bacteria | 171568 |
| 497 | Ga0395900_0000556 | 3300037418 | Bacteria | 51857 |
| 498 | Ga0395900_0001157 | 3300037418 | Bacteria | 33062 |
| 499 | Ga0395900_0061736 | 3300037418 | Bacteria | 3853 |
| 500 | Ga0395900_0299986 | 3300037418 | Bacteria | 1593 |
| 501 | Ga0395898_0000448 | 3300037466 | Bacteria | 84953 |
| 502 | Ga0395898_0000800 | 3300037466 | Bacteria | 53180 |
| 503 | Ga0395905_0000117 | 3300037471 | Bacteria | 133291 |
| 504 | Ga0395905_0001371 | 3300037471 | Bacteria | 29596 |
| 505 | Ga0395905_0020972 | 3300037471 | Bacteria | 6187 |
| 506 | Ga0395905_0034300 | 3300037471 | Bacteria | 4765 |
| 507 | Ga0395905_0050883 | 3300037471 | Bacteria | 3880 |
| 508 | Ga0395905_0385273 | 3300037471 | Bacteria | 1296 |
| 509 | Ga0395901_0487379 | 3300038443 | Bacteria | 1257 |
| 510 | Ga0400487_28356 | 3300039110 | Bacteria | 15581 |
| 511 | Ga0436365_1278966 | 3300039437 | Bacteria | 3413 |
| 512 | Ga0436360_1136634 | 3300039438 | Bacteria | 3281 |
| 513 | Ga0436361_0025205 | 3300039447 | Bacteria | 5639 |
| 514 | Ga0436361_0044305 | 3300039447 | Bacteria | 5584 |
| 515 | Ga0436361_0049092 | 3300039447 | Bacteria | 9990 |
| 516 | Ga0436361_0209856 | 3300039447 | Bacteria | 2492 |
| 517 | Ga0436361_0250234 | 3300039447 | Bacteria | 2046 |
| 518 | Ga0436361_0297903 | 3300039447 | Bacteria | 12260 |
| 519 | Ga0436361_0433430 | 3300039447 | Bacteria | 1519 |
| 520 | Ga0436361_0470837 | 3300039447 | Bacteria | 7008 |
| 521 | Ga0436361_0580915 | 3300039447 | Bacteria | 36900 |
| 522 | Ga0436361_0839867 | 3300039447 | Bacteria | 2582 |
| 523 | Ga0436361_0913791 | 3300039447 | Bacteria | 99691 |
| 524 | Ga0436361_0956051 | 3300039447 | Bacteria | 16278 |
| 525 | Ga0436361_1020767 | 3300039447 | Bacteria | 3421 |
| 526 | Ga0436361_1101895 | 3300039447 | Bacteria | 3286 |
| 527 | Ga0436361_1180414 | 3300039447 | Bacteria | 13143 |
| 528 | Ga0436361_1190118 | 3300039447 | Bacteria | 41161 |
| 529 | Ga0439436_0000549 | 3300041404 | Bacteria | 9884 |
| 530 | Ga0439465_0004524 | 3300041413 | Bacteria | 4495 |
| 531 | Ga0451797_0505633 | 3300041453 | Bacteria | 2027 |
| 532 | Ga0451833_1218993 | 3300041491 | Bacteria | 1960 |
| 533 | Ga0451845_0311299 | 3300041501 | Bacteria | 1462 |
| 534 | Ga0451853_2193203 | 3300041512 | Bacteria | 3472 |
| 535 | Ga0439433_0001392 | 3300041999 | Bacteria | 4967 |
| 536 | Ga0439445_0001193 | 3300042004 | Bacteria | 5588 |
| 537 | Ga0439432_002821 | 3300042006 | Bacteria | 6480 |
| 538 | Ga0439449_0003939 | 3300042007 | Bacteria | 5753 |
| 539 | Ga0439452_001555 | 3300042010 | Bacteria | 9199 |
| 540 | Ga0450920_022606 | 3300042122 | Bacteria | 1218 |
| 541 | Ga0439446_0018853 | 3300042156 | Bacteria | 1937 |
| 542 | Ga0450918_000029 | 3300042531 | Bacteria | 30016 |
| 543 | Ga0451577_0000096 | 3300042876 | Bacteria | 195129 |
| 544 | Ga0451577_0000256 | 3300042876 | Bacteria | 104951 |
| 545 | Ga0451577_0001289 | 3300042876 | Bacteria | 34481 |
| 546 | Ga0451577_0003168 | 3300042876 | Bacteria | 18532 |
| 547 | Ga0451577_0005291 | 3300042876 | Bacteria | 13266 |
| 548 | Ga0451577_0007875 | 3300042876 | Bacteria | 10417 |
| 549 | Ga0451577_0037915 | 3300042876 | Bacteria | 4337 |
| 550 | Ga0451577_0066410 | 3300042876 | Bacteria | 3218 |
| 551 | Ga0451577_0075027 | 3300042876 | Bacteria | 3016 |
| 552 | Ga0451577_0288103 | 3300042876 | Bacteria | 1488 |
| 553 | Ga0466969_0001645 | 3300044656 | Bacteria | 11977 |
| 554 | Ga0466969_0008945 | 3300044656 | Bacteria | 5310 |
| 555 | Ga0466969_0025962 | 3300044656 | Bacteria | 3007 |
| 556 | Ga0466972_0000140 | 3300044658 | Bacteria | 59505 |
| 557 | Ga0466973_0013087 | 3300044659 | Bacteria | 7781 |
| 558 | Ga0453683_0003537 | 3300044673 | Bacteria | 11484 |
| 559 | Ga0453683_0263696 | 3300044673 | Bacteria | 1099 |
| 560 | Ga0466965_0009616 | 3300044683 | Bacteria | 4496 |
| 561 | Ga0466965_0019640 | 3300044683 | Bacteria | 3244 |
| 562 | Ga0466966_0000070 | 3300044684 | Bacteria | 67510 |
| 563 | Ga0466966_0002513 | 3300044684 | Bacteria | 12030 |
| 564 | Ga0466966_0010700 | 3300044684 | Bacteria | 6099 |
| 565 | Ga0466966_0026858 | 3300044684 | Bacteria | 3755 |
| 566 | Ga0466961_0000274 | 3300044693 | Bacteria | 34505 |
| 567 | Ga0466961_0000296 | 3300044693 | Bacteria | 33082 |
| 568 | Ga0466961_0021297 | 3300044693 | Bacteria | 4173 |
| 569 | Ga0466963_0001034 | 3300044694 | Bacteria | 14451 |
| 570 | Ga0466963_0003397 | 3300044694 | Bacteria | 9104 |
| 571 | Ga0466963_0003741 | 3300044694 | Bacteria | 8760 |
| 572 | Ga0466964_0003298 | 3300044706 | Bacteria | 5877 |
| 573 | Ga0466964_0032719 | 3300044706 | Bacteria | 2068 |
| 574 | Ga0453684_0000842 | 3300044712 | Bacteria | 103487 |
| 575 | Ga0453684_0002108 | 3300044712 | Bacteria | 50205 |
| 576 | Ga0453684_0010441 | 3300044712 | Bacteria | 15884 |
| 577 | Ga0453684_0021746 | 3300044712 | Bacteria | 9562 |
| 578 | Ga0453684_0090971 | 3300044712 | Bacteria | 3768 |
| 579 | Ga0453684_0102117 | 3300044712 | Bacteria | 3507 |
| 580 | Ga0453684_0200476 | 3300044712 | Bacteria | 2327 |
| 581 | Ga0453684_0270730 | 3300044712 | Bacteria | 1941 |
| 582 | Ga0466971_0006136 | 3300044719 | Bacteria | 5224 |
| 583 | Ga0466971_0030118 | 3300044719 | Bacteria | 2428 |
| 584 | Ga0466968_0008623 | 3300044735 | Bacteria | 3907 |
| 585 | Ga0466968_0090109 | 3300044735 | Bacteria | 1357 |
| 586 | Ga0466970_0015274 | 3300044765 | Bacteria | 3947 |
| 587 | Ga0466970_0025747 | 3300044765 | Bacteria | 3082 |
| 588 | Ga0466970_0057543 | 3300044765 | Bacteria | 2079 |
| 589 | Ga0466970_0073486 | 3300044765 | Bacteria | 1840 |
| 590 | Ga0466957_0000633 | 3300044842 | Bacteria | 17833 |
| 591 | Ga0466957_0001619 | 3300044842 | Bacteria | 11796 |
| 592 | Ga0466957_0013598 | 3300044842 | Bacteria | 4724 |
| 593 | Ga0466957_0013790 | 3300044842 | Bacteria | 4695 |
| 594 | Ga0466957_0019220 | 3300044842 | Bacteria | 4018 |
| 595 | Ga0466957_0021719 | 3300044842 | Bacteria | 3782 |
| 596 | Ga0466957_0113603 | 3300044842 | Bacteria | 1720 |
| 597 | Ga0466959_0001210 | 3300045049 | Bacteria | 15585 |
| 598 | Ga0466959_0008161 | 3300045049 | Bacteria | 7387 |
| 599 | Ga0466959_0031735 | 3300045049 | Bacteria | 3909 |
| 600 | Ga0466959_0190336 | 3300045049 | Bacteria | 1432 |
| 601 | Ga0451576_0000494 | 3300045051 | Bacteria | 86988 |
| 602 | Ga0451576_0001170 | 3300045051 | Bacteria | 47077 |
| 603 | Ga0451576_0135204 | 3300045051 | Bacteria | 2570 |
| 604 | Ga0466958_0001446 | 3300045836 | Bacteria | 11268 |
| 605 | Ga0466958_0001792 | 3300045836 | Bacteria | 10418 |
| 606 | Ga0466958_0003938 | 3300045836 | Bacteria | 7785 |
| 607 | Ga0466967_0465587 | 3300045976 | Bacteria | 1237 |
| 608 | Ga0495617_041990 | 3300046452 | Bacteria | 1528 |
| 609 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 610 | Ga0495592_0007865 | 3300046454 | Bacteria | 7990 |
| 611 | Ga0495592_0023491 | 3300046454 | Bacteria | 4689 |
| 612 | Ga0495603_0002789 | 3300046455 | Bacteria | 10307 |
| 613 | Ga0495603_0005119 | 3300046455 | Bacteria | 7829 |
| 614 | Ga0495590_0000842 | 3300046457 | Bacteria | 13854 |
| 615 | Ga0495590_0001030 | 3300046457 | Bacteria | 12276 |
| 616 | Ga0495590_0002642 | 3300046457 | Bacteria | 7404 |
| 617 | Ga0495590_0009722 | 3300046457 | Bacteria | 3644 |
| 618 | Ga0495590_0015583 | 3300046457 | Bacteria | 2755 |
| 619 | Ga0495591_000765 | 3300046458 | Bacteria | 23210 |
| 620 | Ga0495591_034295 | 3300046458 | Bacteria | 1495 |
| 621 | Ga0495629_0000465 | 3300046459 | Bacteria | 33935 |
| 622 | Ga0495629_0000664 | 3300046459 | Bacteria | 27804 |
| 623 | Ga0495629_0002046 | 3300046459 | Bacteria | 15675 |
| 624 | Ga0495629_0010142 | 3300046459 | Bacteria | 6869 |
| 625 | Ga0495629_0019324 | 3300046459 | Bacteria | 4869 |
| 626 | Ga0495629_0214057 | 3300046459 | Bacteria | 1330 |
| 627 | Ga0495638_0010372 | 3300046460 | Bacteria | 6478 |
| 628 | Ga0495638_0080946 | 3300046460 | Bacteria | 1972 |
| 629 | Ga0495641_0008326 | 3300046461 | Bacteria | 6338 |
| 630 | Ga0495651_0019962 | 3300046462 | Bacteria | 5198 |
| 631 | Ga0495651_0026530 | 3300046462 | Bacteria | 4512 |
| 632 | Ga0495651_0130198 | 3300046462 | Bacteria | 1837 |
| 633 | Ga0495651_0162523 | 3300046462 | Bacteria | 1598 |
| 634 | Ga0495653_0002551 | 3300046463 | Bacteria | 14519 |
| 635 | Ga0495653_0004428 | 3300046463 | Bacteria | 11350 |
| 636 | Ga0495653_0004792 | 3300046463 | Bacteria | 10970 |
| 637 | Ga0495653_0012941 | 3300046463 | Bacteria | 6807 |
| 638 | Ga0495653_0032216 | 3300046463 | Bacteria | 4163 |
| 639 | Ga0495653_0119736 | 3300046463 | Bacteria | 1878 |
| 640 | Ga0495650_0001754 | 3300046471 | Bacteria | 19739 |
| 641 | Ga0495650_0002590 | 3300046471 | Bacteria | 14224 |
| 642 | Ga0495650_0004755 | 3300046471 | Bacteria | 9129 |
| 643 | Ga0495580_0004101 | 3300046472 | Bacteria | 12284 |
| 644 | Ga0495580_0004345 | 3300046472 | Bacteria | 11901 |
| 645 | Ga0495580_0004858 | 3300046472 | Bacteria | 11243 |
| 646 | Ga0495580_0006675 | 3300046472 | Bacteria | 9367 |
| 647 | Ga0495580_0010114 | 3300046472 | Bacteria | 7368 |
| 648 | Ga0495580_0023683 | 3300046472 | Bacteria | 4503 |
| 649 | Ga0495580_0043417 | 3300046472 | Bacteria | 3200 |
| 650 | Ga0495580_0059899 | 3300046472 | Bacteria | 2675 |
| 651 | Ga0495580_0071281 | 3300046472 | Bacteria | 2427 |
| 652 | Ga0495580_0101621 | 3300046472 | Bacteria | 1999 |
| 653 | Ga0495582_0000577 | 3300046473 | Bacteria | 20275 |
| 654 | Ga0495582_0026755 | 3300046473 | Bacteria | 3162 |
| 655 | Ga0495582_0055071 | 3300046473 | Bacteria | 2192 |
| 656 | Ga0495582_0207224 | 3300046473 | Bacteria | 1120 |
| 657 | Ga0495605_0001964 | 3300046474 | Bacteria | 13036 |
| 658 | Ga0495605_0003997 | 3300046474 | Bacteria | 8711 |
| 659 | Ga0495605_0007585 | 3300046474 | Bacteria | 6151 |
| 660 | Ga0495605_0085265 | 3300046474 | Bacteria | 1472 |
| 661 | Ga0495664_0000331 | 3300046477 | Bacteria | 22817 |
| 662 | Ga0495585_0018266 | 3300046492 | Bacteria | 4047 |
| 663 | Ga0495596_0009852 | 3300046500 | Bacteria | 4188 |
| 664 | Ga0495607_0000153 | 3300046501 | Bacteria | 72099 |
| 665 | Ga0495607_0076887 | 3300046501 | Bacteria | 1845 |
| 666 | Ga0495607_0137256 | 3300046501 | Bacteria | 1265 |
| 667 | Ga0495583_0011149 | 3300046506 | Bacteria | 5179 |
| 668 | Ga0495606_0000433 | 3300046507 | Bacteria | 69506 |
| 669 | Ga0495606_0015098 | 3300046507 | Bacteria | 5976 |
| 670 | Ga0495606_0016007 | 3300046507 | Bacteria | 5743 |
| 671 | Ga0495606_0056810 | 3300046507 | Bacteria | 2524 |
| 672 | Ga0495606_0070506 | 3300046507 | Bacteria | 2203 |
| 673 | Ga0495608_0006806 | 3300046511 | Bacteria | 8104 |
| 674 | Ga0495608_0013153 | 3300046511 | Bacteria | 5743 |
| 675 | Ga0495608_0061927 | 3300046511 | Bacteria | 2459 |
| 676 | Ga0495608_0130710 | 3300046511 | Bacteria | 1607 |
| 677 | Ga0495616_0000234 | 3300046513 | Bacteria | 45006 |
| 678 | Ga0495616_0034804 | 3300046513 | Bacteria | 2612 |
| 679 | Ga0495618_0001925 | 3300046514 | Bacteria | 13613 |
| 680 | Ga0495618_0013435 | 3300046514 | Bacteria | 4981 |
| 681 | Ga0495620_0023214 | 3300046515 | Bacteria | 2971 |
| 682 | Ga0495620_0050404 | 3300046515 | Bacteria | 1776 |
| 683 | Ga0495628_0015152 | 3300046516 | Bacteria | 6440 |
| 684 | Ga0495628_0017374 | 3300046516 | Bacteria | 5991 |
| 685 | Ga0495628_0021727 | 3300046516 | Bacteria | 5273 |
| 686 | Ga0495628_0031277 | 3300046516 | Bacteria | 4306 |
| 687 | Ga0495628_0049658 | 3300046516 | Bacteria | 3321 |
| 688 | Ga0495628_0082423 | 3300046516 | Bacteria | 2498 |
| 689 | Ga0495628_0085744 | 3300046516 | Bacteria | 2442 |
| 690 | Ga0495628_0100160 | 3300046516 | Bacteria | 2237 |
| 691 | Ga0495630_0002428 | 3300046517 | Bacteria | 12907 |
| 692 | Ga0495630_0006450 | 3300046517 | Bacteria | 8344 |
| 693 | Ga0495630_0006602 | 3300046517 | Bacteria | 8268 |
| 694 | Ga0495630_0010033 | 3300046517 | Bacteria | 6821 |
| 695 | Ga0495630_0012786 | 3300046517 | Bacteria | 6099 |
| 696 | Ga0495630_0354652 | 3300046517 | Bacteria | 1123 |
| 697 | Ga0495632_0004583 | 3300046519 | Bacteria | 9366 |
| 698 | Ga0495643_0097777 | 3300046522 | Bacteria | 1508 |
| 699 | Ga0495644_0061324 | 3300046523 | Bacteria | 1413 |
| 700 | Ga0495648_0029393 | 3300046524 | Bacteria | 3648 |
| 701 | Ga0495648_0030733 | 3300046524 | Bacteria | 3546 |
| 702 | Ga0495648_0079767 | 3300046524 | Bacteria | 1866 |
| 703 | Ga0495648_0081004 | 3300046524 | Bacteria | 1848 |
| 704 | Ga0495663_0006383 | 3300046525 | Bacteria | 3256 |
| 705 | Ga0495666_0006771 | 3300046526 | Bacteria | 5758 |
| 706 | Ga0495666_0009632 | 3300046526 | Bacteria | 4830 |
| 707 | Ga0495666_0011613 | 3300046526 | Bacteria | 4390 |
| 708 | Ga0495666_0027810 | 3300046526 | Bacteria | 2783 |
| 709 | Ga0495666_0034417 | 3300046526 | Bacteria | 2473 |
| 710 | Ga0495652_0016075 | 3300046529 | Bacteria | 6694 |
| 711 | Ga0495652_0030679 | 3300046529 | Bacteria | 4712 |
| 712 | Ga0495652_0056480 | 3300046529 | Bacteria | 3333 |
| 713 | Ga0495654_0012995 | 3300046530 | Bacteria | 4462 |
| 714 | Ga0495654_0061372 | 3300046530 | Bacteria | 1805 |
| 715 | Ga0495654_0065534 | 3300046530 | Bacteria | 1734 |
| 716 | Ga0495665_0001459 | 3300046531 | Bacteria | 12686 |
| 717 | Ga0495665_0006630 | 3300046531 | Bacteria | 6248 |
| 718 | Ga0495665_0016829 | 3300046531 | Bacteria | 3936 |
| 719 | Ga0495665_0044772 | 3300046531 | Bacteria | 2351 |
| 720 | Ga0495665_0085131 | 3300046531 | Bacteria | 1661 |
| 721 | Ga0495665_0186810 | 3300046531 | Bacteria | 1076 |
| 722 | Ga0495640_0010529 | 3300046533 | Bacteria | 7141 |
| 723 | Ga0495640_0018994 | 3300046533 | Bacteria | 5083 |
| 724 | Ga0495640_0096125 | 3300046533 | Bacteria | 1949 |
| 725 | Ga0495640_0159241 | 3300046533 | Bacteria | 1448 |
| 726 | Ga0495640_0189107 | 3300046533 | Bacteria | 1309 |
| 727 | Ga0495586_0003609 | 3300046535 | Bacteria | 8290 |
| 728 | Ga0495586_0097168 | 3300046535 | Bacteria | 1632 |
| 729 | Ga0495586_0098974 | 3300046535 | Bacteria | 1617 |
| 730 | Ga0495586_0205709 | 3300046535 | Bacteria | 1116 |
| 731 | Ga0495586_0262489 | 3300046535 | Bacteria | 986 |
| 732 | Ga0495587_0001543 | 3300046536 | Bacteria | 15299 |
| 733 | Ga0495587_0003899 | 3300046536 | Bacteria | 9898 |
| 734 | Ga0495587_0063834 | 3300046536 | Bacteria | 2153 |
| 735 | Ga0495587_0074676 | 3300046536 | Bacteria | 1969 |
| 736 | Ga0495621_0000689 | 3300046539 | Bacteria | 8521 |
| 737 | Ga0495621_0001595 | 3300046539 | Bacteria | 5918 |
| 738 | Ga0495597_0000542 | 3300046542 | Bacteria | 31279 |
| 739 | Ga0495597_0017543 | 3300046542 | Bacteria | 3366 |
| 740 | Ga0495597_0037036 | 3300046542 | Bacteria | 2193 |
| 741 | Ga0495645_0000582 | 3300046543 | Bacteria | 25023 |
| 742 | Ga0495645_0004295 | 3300046543 | Bacteria | 9735 |
| 743 | Ga0495645_0005517 | 3300046543 | Bacteria | 8694 |
| 744 | Ga0495645_0006959 | 3300046543 | Bacteria | 7860 |
| 745 | Ga0495645_0066532 | 3300046543 | Bacteria | 2604 |
| 746 | Ga0495645_0123803 | 3300046543 | Bacteria | 1818 |
| 747 | Ga0495622_0006058 | 3300046557 | Bacteria | 5619 |
| 748 | Ga0495622_0069022 | 3300046557 | Bacteria | 1632 |
| 749 | Ga0495633_0014003 | 3300046558 | Bacteria | 4204 |
| 750 | Ga0495667_0025517 | 3300046559 | Bacteria | 3982 |
| 751 | Ga0495656_0050364 | 3300046615 | Bacteria | 1778 |
| 752 | Ga0495634_0007523 | 3300046642 | Bacteria | 8165 |
| 753 | Ga0495634_0027591 | 3300046642 | Bacteria | 3949 |
| 754 | Ga0495634_0053834 | 3300046642 | Bacteria | 2694 |
| 755 | Ga0495611_0124316 | 3300046648 | Bacteria | 1203 |
| 756 | Ga0495625_0012680 | 3300046660 | Bacteria | 6817 |
| 757 | Ga0495625_0135755 | 3300046660 | Bacteria | 1663 |
| 758 | Ga0495625_0204836 | 3300046660 | Bacteria | 1300 |
| 759 | Ga0495635_0005253 | 3300046663 | Bacteria | 9009 |
| 760 | Ga0495635_0007081 | 3300046663 | Bacteria | 7839 |
| 761 | Ga0495635_0008059 | 3300046663 | Bacteria | 7359 |
| 762 | Ga0495635_0022329 | 3300046663 | Bacteria | 4405 |
| 763 | Ga0495635_0112884 | 3300046663 | Bacteria | 1856 |
| 764 | Ga0495661_0017422 | 3300046665 | Bacteria | 4745 |
| 765 | Ga0495588_0078532 | 3300046674 | Bacteria | 1722 |
| 766 | Ga0495657_0147267 | 3300046675 | Bacteria | 1464 |
| 767 | Ga0495657_0200898 | 3300046675 | Bacteria | 1215 |
| 768 | Ga0495599_0015330 | 3300046678 | Bacteria | 4756 |
| 769 | Ga0495599_0040909 | 3300046678 | Bacteria | 2910 |
| 770 | Ga0495599_0088879 | 3300046678 | Bacteria | 1928 |
| 771 | Ga0495623_0006038 | 3300046679 | Bacteria | 7878 |
| 772 | Ga0495623_0013415 | 3300046679 | Bacteria | 5312 |
| 773 | Ga0495623_0016411 | 3300046679 | Bacteria | 4784 |
| 774 | Ga0495623_0028079 | 3300046679 | Bacteria | 3622 |
| 775 | Ga0495623_0070502 | 3300046679 | Bacteria | 2177 |
| 776 | Ga0495623_0184793 | 3300046679 | Bacteria | 1208 |
| 777 | Ga0495646_0000772 | 3300046680 | Bacteria | 17847 |
| 778 | Ga0495646_0003040 | 3300046680 | Bacteria | 10396 |
| 779 | Ga0495646_0006796 | 3300046680 | Bacteria | 7258 |
| 780 | Ga0495646_0028155 | 3300046680 | Bacteria | 3520 |
| 781 | Ga0495646_0039554 | 3300046680 | Bacteria | 2907 |
| 782 | Ga0495646_0044952 | 3300046680 | Bacteria | 2699 |
| 783 | Ga0495646_0063689 | 3300046680 | Bacteria | 2188 |
| 784 | Ga0495647_0003224 | 3300046681 | Bacteria | 5221 |
| 785 | Ga0495658_0013494 | 3300046683 | Bacteria | 4158 |
| 786 | Ga0495658_0014311 | 3300046683 | Bacteria | 4052 |
| 787 | Ga0495669_0026048 | 3300046684 | Bacteria | 2554 |
| 788 | Ga0495613_0002584 | 3300046689 | Bacteria | 13610 |
| 789 | Ga0495613_0015119 | 3300046689 | Bacteria | 5732 |
| 790 | Ga0495613_0043589 | 3300046689 | Bacteria | 3319 |
| 791 | Ga0495613_0084658 | 3300046689 | Bacteria | 2302 |
| 792 | Ga0495613_0258920 | 3300046689 | Bacteria | 1213 |
| 793 | Ga0495624_0017117 | 3300046690 | Bacteria | 4871 |
| 794 | Ga0495624_0027568 | 3300046690 | Bacteria | 3718 |
| 795 | Ga0495624_0053286 | 3300046690 | Bacteria | 2554 |
| 796 | Ga0495624_0074621 | 3300046690 | Bacteria | 2106 |
| 797 | Ga0495624_0092295 | 3300046690 | Bacteria | 1867 |
| 798 | Ga0495624_0182649 | 3300046690 | Bacteria | 1278 |
| 799 | Ga0495670_0005977 | 3300046691 | Bacteria | 5962 |
| 800 | Ga0495671_0042506 | 3300046692 | Bacteria | 2284 |
| 801 | Ga0495649_0011563 | 3300046694 | Bacteria | 5172 |
| 802 | Ga0495649_0022313 | 3300046694 | Bacteria | 3542 |
| 803 | Ga0495649_0028030 | 3300046694 | Bacteria | 3122 |
| 804 | Ga0495649_0030777 | 3300046694 | Bacteria | 2962 |
| 805 | Ga0495589_0004671 | 3300046794 | Bacteria | 7276 |
| 806 | Ga0495589_0006429 | 3300046794 | Bacteria | 6199 |
| 807 | Ga0495589_0042176 | 3300046794 | Bacteria | 2274 |
| 808 | Ga0495589_0070299 | 3300046794 | Bacteria | 1711 |
| 809 | Ga0495589_0092990 | 3300046794 | Bacteria | 1464 |
| 810 | Ga0495600_0002240 | 3300046809 | Bacteria | 11014 |
| 811 | Ga0495600_0010921 | 3300046809 | Bacteria | 5647 |
| 812 | Ga0495600_0157605 | 3300046809 | Bacteria | 1468 |
| 813 | Ga0495660_0002284 | 3300046810 | Bacteria | 12315 |
| 814 | Ga0495581_0006028 | 3300047315 | Bacteria | 7025 |
| 815 | Ga0495581_0096485 | 3300047315 | Bacteria | 1717 |
| 816 | Ga0495581_0118487 | 3300047315 | Bacteria | 1540 |
| 817 | Ga0495604_0001471 | 3300047317 | Bacteria | 19385 |
| 818 | Ga0495604_0007351 | 3300047317 | Bacteria | 8726 |
| 819 | Ga0495604_0010243 | 3300047317 | Bacteria | 7425 |
| 820 | Ga0495604_0010861 | 3300047317 | Bacteria | 7233 |
| 821 | Ga0495604_0087771 | 3300047317 | Bacteria | 2315 |
| 822 | Ga0495636_0105202 | 3300047318 | Bacteria | 1237 |
| 823 | Ga0495674_0017363 | 3300047319 | Bacteria | 6695 |
| 824 | Ga0495674_0047032 | 3300047319 | Bacteria | 3827 |
| 825 | Ga0495674_0052410 | 3300047319 | Bacteria | 3590 |
| 826 | Ga0495674_0059707 | 3300047319 | Bacteria | 3330 |
| 827 | Ga0495674_0142191 | 3300047319 | Bacteria | 2017 |
| 828 | Ga0495674_0225338 | 3300047319 | Bacteria | 1548 |
| 829 | Ga0495674_0282417 | 3300047319 | Bacteria | 1360 |
| 830 | Ga0495672_0027576 | 3300047320 | Bacteria | 3606 |
| 831 | Ga0495672_0043622 | 3300047320 | Bacteria | 2695 |
| 832 | Ga0495672_0123778 | 3300047320 | Bacteria | 1370 |
| 833 | Ga0495676_0001803 | 3300047321 | Bacteria | 18753 |
| 834 | Ga0495676_0026801 | 3300047321 | Bacteria | 4953 |
| 835 | Ga0495676_0142373 | 3300047321 | Bacteria | 1717 |
| 836 | Ga0495680_0007467 | 3300047322 | Bacteria | 10017 |
| 837 | Ga0495680_0037224 | 3300047322 | Bacteria | 3898 |
| 838 | Ga0495680_0081847 | 3300047322 | Bacteria | 2436 |
| 839 | Ga0495680_0084418 | 3300047322 | Bacteria | 2393 |
| 840 | Ga0495680_0175412 | 3300047322 | Bacteria | 1550 |
| 841 | Ga0495683_0001162 | 3300047323 | Bacteria | 18030 |
| 842 | Ga0495683_0005126 | 3300047323 | Bacteria | 7309 |
| 843 | Ga0495683_0012500 | 3300047323 | Bacteria | 4455 |
| 844 | Ga0495683_0022993 | 3300047323 | Bacteria | 3204 |
| 845 | Ga0495683_0046878 | 3300047323 | Bacteria | 2169 |
| 846 | Ga0495687_000216 | 3300047443 | Bacteria | 81734 |
| 847 | Ga0495687_001805 | 3300047443 | Bacteria | 18816 |
| 848 | Ga0495675_0004754 | 3300047444 | Bacteria | 8246 |
| 849 | Ga0495675_0012407 | 3300047444 | Bacteria | 5363 |
| 850 | Ga0495675_0018680 | 3300047444 | Bacteria | 4402 |
| 851 | Ga0495675_0029499 | 3300047444 | Bacteria | 3499 |
| 852 | Ga0495675_0052892 | 3300047444 | Bacteria | 2578 |
| 853 | Ga0495675_0076962 | 3300047444 | Bacteria | 2102 |
| 854 | Ga0495675_0079413 | 3300047444 | Bacteria | 2066 |
| 855 | Ga0495675_0150316 | 3300047444 | Bacteria | 1439 |
| 856 | Ga0495679_000413 | 3300047446 | Bacteria | 31972 |
| 857 | Ga0495679_001253 | 3300047446 | Bacteria | 14990 |
| 858 | Ga0495679_003515 | 3300047446 | Bacteria | 7494 |
| 859 | Ga0495673_0004937 | 3300047469 | Bacteria | 8209 |
| 860 | Ga0495673_0024457 | 3300047469 | Bacteria | 2918 |
| 861 | Ga0495673_0050044 | 3300047469 | Bacteria | 1836 |
| 862 | Ga0495681_0045272 | 3300047470 | Bacteria | 2107 |
| 863 | Ga0495684_0000521 | 3300047471 | Bacteria | 31227 |
| 864 | Ga0495684_0078249 | 3300047471 | Bacteria | 2510 |
| 865 | Ga0495684_0172922 | 3300047471 | Bacteria | 1605 |
| 866 | Ga0495686_0037369 | 3300047472 | Bacteria | 3111 |
| 867 | Ga0495593_0004599 | 3300047673 | Bacteria | 8205 |
| 868 | Ga0495593_0026339 | 3300047673 | Bacteria | 3211 |
| 869 | Ga0495593_0029327 | 3300047673 | Bacteria | 3017 |
| 870 | Ga0495593_0049474 | 3300047673 | Bacteria | 2230 |
| 871 | Ga0495593_0105212 | 3300047673 | Bacteria | 1445 |
| 872 | Ga0495593_0132743 | 3300047673 | Bacteria | 1263 |
| 873 | Ga0495602_0010289 | 3300048088 | Bacteria | 9711 |
| 874 | Ga0495602_0011139 | 3300048088 | Bacteria | 9310 |
| 875 | Ga0495602_0015826 | 3300048088 | Bacteria | 7597 |
| 876 | Ga0495602_0026876 | 3300048088 | Bacteria | 5542 |
| 877 | Ga0495602_0059284 | 3300048088 | Bacteria | 3342 |
| 878 | Ga0495602_0070012 | 3300048088 | Bacteria | 3004 |
| 879 | Ga0495602_0106427 | 3300048088 | Bacteria | 2289 |
| 880 | Ga0495602_0124376 | 3300048088 | Bacteria | 2069 |
| 881 | Ga0495602_0212179 | 3300048088 | Bacteria | 1468 |
| 882 | Ga0495614_0000067 | 3300048089 | Bacteria | 33617 |
| 883 | Ga0495614_0007051 | 3300048089 | Bacteria | 5020 |
| 884 | Ga0495614_0065601 | 3300048089 | Bacteria | 1562 |
| 885 | Ga0495626_0000105 | 3300048091 | Bacteria | 109725 |
| 886 | Ga0495626_0022568 | 3300048091 | Bacteria | 3106 |
| 887 | Ga0496100_0000523 | 3300048903 | Bacteria | 18365 |
| 888 | Ga0496100_0012549 | 3300048903 | Bacteria | 4860 |
| 889 | Ga0496100_0076423 | 3300048903 | Bacteria | 2249 |
| 890 | Ga0496100_0189441 | 3300048903 | Bacteria | 1492 |
| 891 | Ga0496101_0002493 | 3300048904 | Bacteria | 11304 |
| 892 | Ga0496101_0042288 | 3300048904 | Bacteria | 3252 |
| 893 | Ga0496101_0047186 | 3300048904 | Bacteria | 3091 |
| 894 | Ga0496101_0074379 | 3300048904 | Bacteria | 2498 |
| 895 | Ga0496101_0097767 | 3300048904 | Bacteria | 2193 |
| 896 | Ga0496101_0149015 | 3300048904 | Bacteria | 1788 |
| 897 | Ga0496102_0000074 | 3300048905 | Bacteria | 148938 |
| 898 | Ga0496102_0009040 | 3300048905 | Bacteria | 8549 |
| 899 | Ga0496102_0009565 | 3300048905 | Bacteria | 8337 |
| 900 | Ga0496102_0202261 | 3300048905 | Bacteria | 1872 |
| 901 | Ga0496102_0563126 | 3300048905 | Bacteria | 1062 |
| 902 | Ga0496103_0001532 | 3300048906 | Bacteria | 15433 |
| 903 | Ga0496103_0005147 | 3300048906 | Bacteria | 7871 |
| 904 | Ga0496103_0111526 | 3300048906 | Bacteria | 1738 |
| 905 | Ga0496104_0029298 | 3300048907 | Bacteria | 5105 |
| 906 | Ga0496104_0042090 | 3300048907 | Bacteria | 4285 |
| 907 | Ga0496104_0109848 | 3300048907 | Bacteria | 2643 |
| 908 | Ga0496104_0266001 | 3300048907 | Bacteria | 1627 |
| 909 | Ga0496104_0293329 | 3300048907 | Bacteria | 1539 |
| 910 | Ga0496104_0323779 | 3300048907 | Bacteria | 1454 |
| 911 | Ga0496105_0055060 | 3300048908 | Bacteria | 3285 |
| 912 | Ga0496105_0101000 | 3300048908 | Bacteria | 2382 |
| 913 | Ga0496105_0185519 | 3300048908 | Bacteria | 1702 |
| 914 | Ga0496106_0001248 | 3300048909 | Bacteria | 19038 |
| 915 | Ga0496106_0001808 | 3300048909 | Bacteria | 15988 |
| 916 | Ga0496106_0043216 | 3300048909 | Bacteria | 3381 |
| 917 | Ga0496106_0043968 | 3300048909 | Bacteria | 3353 |
| 918 | Ga0496106_0121132 | 3300048909 | Bacteria | 2045 |
| 919 | Ga0496107_0090605 | 3300048910 | Bacteria | 2234 |
| 920 | Ga0496107_0117202 | 3300048910 | Bacteria | 1961 |
| 921 | Ga0496107_0125150 | 3300048910 | Bacteria | 1895 |
| 922 | Ga0496107_0146943 | 3300048910 | Bacteria | 1743 |
| 923 | Ga0496108_0030248 | 3300048911 | Bacteria | 4488 |
| 924 | Ga0496108_0093854 | 3300048911 | Bacteria | 2553 |
| 925 | Ga0496109_0019061 | 3300048912 | Bacteria | 6043 |
| 926 | Ga0496109_0309810 | 3300048912 | Bacteria | 1489 |
| 927 | Ga0496110_0000450 | 3300048913 | Bacteria | 27963 |
| 928 | Ga0496110_0022640 | 3300048913 | Bacteria | 5338 |
| 929 | Ga0496110_0540879 | 3300048913 | Bacteria | 1059 |
| 930 | Ga0496112_0005931 | 3300048915 | Bacteria | 10657 |
| 931 | Ga0496112_0011799 | 3300048915 | Bacteria | 7999 |
| 932 | Ga0496112_0066722 | 3300048915 | Bacteria | 3551 |
| 933 | Ga0496112_0137211 | 3300048915 | Bacteria | 2416 |
| 934 | Ga0496112_0396280 | 3300048915 | Bacteria | 1320 |
| 935 | Ga0496113_0003925 | 3300048916 | Bacteria | 9023 |
| 936 | Ga0496113_0068501 | 3300048916 | Bacteria | 2693 |
| 937 | Ga0496114_0000572 | 3300048917 | Bacteria | 27230 |
| 938 | Ga0496114_0003283 | 3300048917 | Bacteria | 12414 |
| 939 | Ga0496114_0149289 | 3300048917 | Bacteria | 2027 |
| 940 | Ga0496114_0226778 | 3300048917 | Bacteria | 1641 |
| 941 | Ga0496115_0005371 | 3300048918 | Bacteria | 9325 |
| 942 | Ga0496115_0149046 | 3300048918 | Bacteria | 1931 |
| 943 | Ga0496115_0281660 | 3300048918 | Bacteria | 1365 |
| 944 | Ga0496116_0001318 | 3300048919 | Bacteria | 28314 |
| 945 | Ga0496116_0017662 | 3300048919 | Bacteria | 5528 |
| 946 | Ga0496116_0079785 | 3300048919 | Bacteria | 2035 |
| 947 | Ga0496117_0004062 | 3300048920 | Bacteria | 16439 |
| 948 | Ga0496117_0011401 | 3300048920 | Bacteria | 7961 |
| 949 | Ga0496117_0017703 | 3300048920 | Bacteria | 5943 |
| 950 | Ga0496117_0017755 | 3300048920 | Bacteria | 5930 |
| 951 | Ga0496117_0041645 | 3300048920 | Bacteria | 3361 |
| 952 | Ga0496117_0130320 | 3300048920 | Bacteria | 1525 |
| 953 | Ga0496118_0001851 | 3300048921 | Bacteria | 30308 |
| 954 | Ga0496118_0005204 | 3300048921 | Bacteria | 14883 |
| 955 | Ga0496118_0006098 | 3300048921 | Bacteria | 13397 |
| 956 | Ga0496118_0009426 | 3300048921 | Bacteria | 9859 |
| 957 | Ga0496118_0018288 | 3300048921 | Bacteria | 6328 |
| 958 | Ga0496118_0018744 | 3300048921 | Bacteria | 6218 |
| 959 | Ga0496118_0036533 | 3300048921 | Bacteria | 3970 |
| 960 | Ga0496121_0000306 | 3300048924 | Bacteria | 102245 |
| 961 | Ga0496121_0002426 | 3300048924 | Bacteria | 28488 |
| 962 | Ga0496121_0006168 | 3300048924 | Bacteria | 15036 |
| 963 | Ga0496121_0015481 | 3300048924 | Bacteria | 7987 |
| 964 | Ga0496121_0017741 | 3300048924 | Bacteria | 7241 |
| 965 | Ga0496121_0051991 | 3300048924 | Bacteria | 3445 |
| 966 | Ga0496121_0067128 | 3300048924 | Bacteria | 2908 |
| 967 | Ga0496121_0077258 | 3300048924 | Bacteria | 2652 |
| 968 | Ga0496121_0100695 | 3300048924 | Bacteria | 2230 |
| 969 | Ga0496122_0000865 | 3300048925 | Bacteria | 57024 |
| 970 | Ga0496122_0004543 | 3300048925 | Bacteria | 17109 |
| 971 | Ga0496123_0000203 | 3300048926 | Bacteria | 121361 |
| 972 | Ga0496123_0008097 | 3300048926 | Bacteria | 9721 |
| 973 | Ga0496124_0002427 | 3300048927 | Bacteria | 24450 |
| 974 | Ga0496124_0008332 | 3300048927 | Bacteria | 10854 |
| 975 | Ga0496124_0031972 | 3300048927 | Bacteria | 4654 |
| 976 | Ga0496124_0057514 | 3300048927 | Bacteria | 3276 |
| 977 | Ga0496125_0019818 | 3300048928 | Bacteria | 6329 |
| 978 | Ga0496125_0034344 | 3300048928 | Bacteria | 4472 |
| 979 | Ga0496126_0001579 | 3300048929 | Bacteria | 34827 |
| 980 | Ga0496126_0002578 | 3300048929 | Bacteria | 24191 |
| 981 | Ga0496126_0002619 | 3300048929 | Bacteria | 23973 |
| 982 | Ga0496126_0003244 | 3300048929 | Bacteria | 20790 |
| 983 | Ga0496126_0009708 | 3300048929 | Bacteria | 10195 |
| 984 | Ga0496126_0010990 | 3300048929 | Bacteria | 9419 |
| 985 | Ga0496126_0189476 | 3300048929 | Bacteria | 1743 |
| 986 | Ga0501034_0062153 | 3300049571 | Bacteria | 3750 |
| 987 | Ga0501036_0024209 | 3300049572 | Bacteria | 5118 |
| 988 | Ga0501040_0010800 | 3300049576 | Bacteria | 5970 |
| 989 | Ga0501041_0054375 | 3300049577 | Bacteria | 2442 |
| 990 | Ga0501042_0096044 | 3300049578 | Bacteria | 2129 |
| 991 | Ga0501042_0124198 | 3300049578 | Bacteria | 1858 |
| 992 | Ga0501043_0212561 | 3300049579 | Bacteria | 1499 |
| 993 | Ga0501047_0256216 | 3300049581 | Bacteria | 1598 |
| 994 | Ga0501048_0034392 | 3300049582 | Bacteria | 3656 |
| 995 | Ga0501072_0029953 | 3300049588 | Bacteria | 4253 |
| 996 | Ga0501073_0004074 | 3300049589 | Bacteria | 10964 |
| 997 | Ga0501074_0164906 | 3300049590 | Bacteria | 1582 |
| 998 | Ga0501075_0025389 | 3300049591 | Bacteria | 4353 |
| 999 | Ga0501076_0004740 | 3300049592 | Bacteria | 9703 |
| 1000 | Ga0501076_0039276 | 3300049592 | Bacteria | 3716 |
| 1001 | Ga0501077_0121301 | 3300049593 | Bacteria | 1657 |
| 1002 | Ga0501227_004557 | 3300049665 | Bacteria | 2978 |
| 1003 | Ga0501079_0008595 | 3300049741 | Bacteria | 7749 |
| 1004 | Ga0501080_0028440 | 3300049742 | Bacteria | 5200 |
| 1005 | Ga0501080_0248761 | 3300049742 | Bacteria | 1621 |
| 1006 | Ga0501081_0028601 | 3300049743 | Bacteria | 3762 |
| 1007 | Ga0501035_0027081 | 3300049822 | Bacteria | 5241 |
| 1008 | Ga0501035_0085549 | 3300049822 | Bacteria | 2779 |
| 1009 | Ga0501044_0001185 | 3300049823 | Bacteria | 30889 |
| 1010 | nmdc:mga03683_64480_c1 | 3300050489 | Bacteria | 1554 |
| 1011 | nmdc:mga00v17_171444_c1 | 3300050491 | Bacteria | 1399 |
| 1012 | nmdc:mga00v17_18346_c1 | 3300050491 | Bacteria | 3973 |
| 1013 | nmdc:mga07m45_57654_c1 | 3300050496 | Bacteria | 2196 |
| 1014 | nmdc:mga05p37_18968_c1 | 3300050507 | Bacteria | 8317 |
| 1015 | nmdc:mga05p37_85283_c1 | 3300050507 | Bacteria | 3513 |
| 1016 | nmdc:mga09592_144219_c1 | 3300050508 | Bacteria | 2053 |
| 1017 | nmdc:mga09592_19691_c1 | 3300050508 | Bacteria | 5543 |
| 1018 | nmdc:mga09592_30224_c1 | 3300050508 | Bacteria | 4507 |
| 1019 | nmdc:mga09592_89662_c1 | 3300050508 | Bacteria | 2627 |
| 1020 | nmdc:mga0qj67_27241_c1 | 3300050509 | Bacteria | 4427 |
| 1021 | nmdc:mga0qj67_401393_c1 | 3300050509 | Bacteria | 1106 |
| 1022 | nmdc:mga0qj67_4762_c1 | 3300050509 | Bacteria | 9860 |
| 1023 | nmdc:mga06r32_176_c1 | 3300050510 | Bacteria | 49909 |
| 1024 | nmdc:mga06r32_39557_c1 | 3300050510 | Bacteria | 4475 |
| 1025 | nmdc:mga06r32_80886_c1 | 3300050510 | Bacteria | 3163 |
| 1026 | nmdc:mga08y16_65777_c1 | 3300050511 | Bacteria | 3784 |
| 1027 | nmdc:mga0n895_107426_c1 | 3300050512 | Bacteria | 2804 |
| 1028 | nmdc:mga0n895_90712_c1 | 3300050512 | Bacteria | 3058 |
| 1029 | nmdc:mga08x19_17651_c1 | 3300050514 | Bacteria | 4370 |
| 1030 | Ga0495612_0002014 | 3300053078 | Bacteria | 8373 |
| 1031 | Ga0500644_0009381 | 3300053088 | Bacteria | 2616 |
| 1032 | Ga0500651_0000066 | 3300053093 | Bacteria | 69313 |
| 1033 | Ga0500566_0045874 | 3300053094 | Bacteria | 2514 |
| 1034 | Ga0500556_0001052 | 3300053104 | Bacteria | 14249 |
| 1035 | Ga0500642_0015279 | 3300053130 | Bacteria | 2882 |
| 1036 | Ga0500568_0000481 | 3300053139 | Bacteria | 29522 |
| 1037 | Ga0500568_0011636 | 3300053139 | Bacteria | 4070 |
| 1038 | Ga0500622_0001405 | 3300053156 | Bacteria | 19406 |
| 1039 | Ga0500622_0007370 | 3300053156 | Bacteria | 6251 |
| 1040 | Ga0500637_0081510 | 3300053178 | Bacteria | 1869 |
| 1041 | Ga0501084_0094903 | 3300054114 | Bacteria | 2505 |
| 1042 | Ga0501082_0003494 | 3300060353 | Bacteria | 13710 |
| 1043 | Ga0501082_0144033 | 3300060353 | Bacteria | 2068 |
| 1044 | Ga0466962_0001530 | 3300061719 | Bacteria | 10806 |
| 1045 | Ga0466962_0006704 | 3300061719 | Bacteria | 5519 |
| 1046 | Ga0466962_0022542 | 3300061719 | Bacteria | 3026 |
| 1047 | Ga0466962_0048264 | 3300061719 | Bacteria | 2035 |
| 1048 | Ga0466962_0076703 | 3300061719 | Bacteria | 1597 |
| 1049 | Ga0530510_0029184 | 3300061734 | Bacteria | 3958 |
| 1050 | Ga0530510_0244849 | 3300061734 | Bacteria | 1335 |
| 1051 | 2501074061 | 2501025501 | Bacteria | 7768574 |
| 1052 | 2501084103 | 2501025502 | Bacteria | 9641094 |
| 1053 | 2501414372 | 2501025504 | Bacteria | 8008976 |
| 1054 | 2509130830 | 2508501125 | Bacteria | 7208311 |
| 1055 | 2510252567 | 2510065045 | Bacteria | 7761063 |
| 1056 | 2511093345 | 2510917013 | Bacteria | 9951648 |
| 1057 | 2511099795 | 2510917014 | Bacteria | 8296963 |
| 1058 | 2511102434 | 2510917015 | Bacteria | 7950052 |
| 1059 | 2512348425 | 2512047030 | Bacteria | 9031815 |
| 1060 | 2513556125 | 2513237082 | Bacteria | 8640282 |
| 1061 | 2513564311 | 2513237083 | Bacteria | 8410967 |
| 1062 | 2513962609 | 2513237151 | Bacteria | 6309801 |
| 1063 | 2514050885 | 2513237166 | Bacteria | 10373764 |
| 1064 | 2515684844 | 2515154122 | Bacteria | 8609520 |
| 1065 | 2516022247 | 2515154189 | Bacteria | 9629850 |
| 1066 | 2519457531 | 2519103095 | Bacteria | 6629912 |
| 1067 | 2527080604 | 2526164713 | Bacteria | 6780608 |
| 1068 | 2563061539 | 2562617112 | Bacteria | 10918404 |
| 1069 | 2585294134 | 2582581311 | Bacteria | 6763856 |
| 1070 | 2599741059 | 2599185239 | Bacteria | 8686614 |
| 1071 | 2599748366 | 2599185240 | Bacteria | 7968121 |
| 1072 | 2600210278 | 2599185355 | Bacteria | 7968906 |
| 1073 | 2600813817 | 2600255067 | Bacteria | 6795583 |
| 1074 | 2643792050 | 2643221554 | Bacteria | 6603920 |
| 1075 | 2643980687 | 2643221594 | Bacteria | 5811388 |
| 1076 | 2644122111 | 2643221621 | Bacteria | 6212786 |
| 1077 | 2644216469 | 2643221638 | Bacteria | 6579467 |
| 1078 | 2676745797 | 2675903129 | Bacteria | 7964495 |
| 1079 | 2713478596 | 2711768613 | Bacteria | 11048459 |
| 1080 | 2719641665 | 2718217991 | Bacteria | 7829542 |
| 1081 | 2723879652 | 2721755763 | Bacteria | 4464185 |
| 1082 | 2738824012 | 2738541296 | Bacteria | 7285013 |
| 1083 | 2738836403 | 2738541298 | Bacteria | 7286732 |
| 1084 | 2738877933 | 2738541306 | Bacteria | 7284992 |
| 1085 | 2739189639 | 2738543002 | Bacteria | 7284546 |
| 1086 | 2739224526 | 2738543008 | Bacteria | 7282815 |
| 1087 | 2739612183 | 2739367655 | Bacteria | 4051151 |
| 1088 | 2746087241 | 2744054900 | Bacteria | 8399525 |
| 1089 | 2746093252 | 2744054901 | Bacteria | 8397047 |
| 1090 | 2753566184 | 2751185846 | Bacteria | 7242164 |
| 1091 | 2792837079 | 2791355137 | Bacteria | 9654227 |
| 1092 | 2809031996 | 2808606395 | Bacteria | 6020352 |
| 1093 | 2817259722 | 2816332253 | Bacteria | 6764532 |
| 1094 | 2817277391 | 2816332256 | Bacteria | 6891714 |
| 1095 | 2817453557 | 2816332286 | Bacteria | 6853759 |
| 1096 | 2819624180 | 2818991450 | Bacteria | 6962147 |
| 1097 | 2819636812 | 2818991452 | Bacteria | 8442785 |
| 1098 | 2842332172 | 2842324504 | Bacteria | 9364110 |
| 1099 | 2842356376 | 2842348783 | Bacteria | 9002918 |
| 1100 | 2842461270 | 2842454564 | Bacteria | 8730687 |
| 1101 | 2855734606 | 2855730933 | Bacteria | 7047938 |
| 1102 | 2855770196 | 2855767633 | Bacteria | 7049357 |
| 1103 | 2856289391 | 2856287931 | Bacteria | 7223934 |
| 1104 | 2857362263 | 2857357740 | Bacteria | 9937880 |
| 1105 | 2857538479 | 2857537821 | Bacteria | 5248181 |
| 1106 | 2857578707 | 2857576091 | Bacteria | 5465855 |
| 1107 | 2858955747 | 2858950400 | Bacteria | 6783797 |
| 1108 | 2863426480 | 2863421361 | Bacteria | 7300805 |
| 1109 | 2870069386 | 2870068957 | Bacteria | 8925310 |
| 1110 | 2881414417 | 2881412998 | Bacteria | 6492157 |
| 1111 | 2881930281 | 2881927736 | Bacteria | 3993927 |
| 1112 | 2883091421 | 2883087390 | Bacteria | 9532701 |
| 1113 | 2885197017 | 2885192300 | Bacteria | 5882526 |
| 1114 | 2885272375 | 2885270888 | Bacteria | 9831543 |
| 1115 | 2887377881 | 2887375801 | Bacteria | 5334027 |
| 1116 | 2894514503 | 2894510363 | Bacteria | 5121143 |
| 1117 | 2900637084 | 2900634093 | Bacteria | 10263517 |
| 1118 | 2902686693 | 2902682994 | Bacteria | 8951596 |
| 1119 | 2904481617 | 2904479285 | Bacteria | 5073931 |
| 1120 | 2904490130 | 2904483920 | Bacteria | 7545285 |
| 1121 | 2904569356 | 2904564687 | Bacteria | 7609577 |
| 1122 | 2904576807 | 2904571731 | Bacteria | 7608790 |
| 1123 | 2904624850 | 2904615490 | Bacteria | 10047340 |
| 1124 | 2919533299 | 2919527303 | Bacteria | 7718827 |
| 1125 | 2920114129 | 2920107658 | Bacteria | 10042636 |
| 1126 | 2921651544 | 2921643360 | Bacteria | 11448031 |
| 1127 | 2928114195 | 2928108538 | Bacteria | 7360024 |
| 1128 | 2928141057 | 2928135762 | Bacteria | 7259641 |
| 1129 | 2928163065 | 2928157003 | Bacteria | 7522202 |
| 1130 | 2928170185 | 2928163908 | Bacteria | 7561269 |
| 1131 | 2928176321 | 2928170801 | Bacteria | 8785406 |
| 1132 | 2928509190 | 2928503688 | Bacteria | 7268108 |
| 1133 | 2928542033 | 2928536128 | Bacteria | 7657547 |
| 1134 | 2941481921 | |||
| 1135 | 2945934552 | 2945934425 | Bacteria | 7444609 |
| 1136 | 2974322330 | 2974320154 | Bacteria | 4571377 |
| 1137 | 2981996088 | 2981990288 | Bacteria | 7590678 |
| 1138 | 2989393450 | 2989392574 | Bacteria | 4554005 |
| 1139 | 2990704890 | 2990703756 | Bacteria | 7715990 |
| 1140 | 642426554 | 641736151 | Bacteria | 7477263 |
| 1141 | 642419614 | 641736154 | Bacteria | 7689995 |
| 1142 | 642594600 | 642555112 | Bacteria | 8676562 |
| 1143 | 642623188 | 642555113 | Bacteria | 8214658 |
| 1144 | 8003956804 | 8003955200 | Bacteria | 8601927 |
| 1145 | 8018847945 | 8018845410 | Bacteria | 8933938 |
| 1146 | 8020813933 | 8020807995 | Bacteria | 6801506 |
| 1147 | 8020939031 | 8020938398 | Bacteria | 7472757 |
| 1148 | 8020947746 | 8020945358 | Bacteria | 8467355 |
| 1149 | 8020953422 | 8020953355 | Bacteria | 7439080 |
| 1150 | 8021127529 | 8021120328 | Bacteria | 8782274 |
| 1151 | 8039099679 | 8039098773 | Bacteria | 6602928 |
| 1152 | 8040171510 | 8040167225 | Bacteria | 6542727 |
| 1153 | 8040174124 | 8040173305 | Bacteria | 6827067 |
| 1154 | 8048749758 | 8048746797 | Bacteria | 3557226 |
| 1155 | 8055227955 | 8055225921 | Bacteria | 3341787 |
| 1156 | 8055269439 | 8055266321 | Bacteria | 7999742 |
| 1157 | 8055307399 | 8055301274 | Bacteria | 8587385 |
| 1158 | Ga0451577_0077551 | |||
| 1159 | JGI24740J21852_10002018 | |||
| 1160 | JGI24739J22299_10009031 | |||
| 1161 | JGI24739J22299_10017284 | |||
| 1162 | JGI24737J22298_10005658 | |||
| 1163 | JGI24735J21928_10000085 | |||
| 1164 | JGI24735J21928_10004844 | |||
| 1165 | JGI24735J21928_10011764 | |||
| 1166 | JGI24738J21930_10002515 | |||
| 1167 | JGI24738J21930_10020818 | |||
| 1168 | JGI25156J39149_1000689 | |||
| 1169 | JGI25156J39149_1001206 | |||
| 1170 | JGI25156J39149_1002465 | |||
| 1171 | JGI25158J39367_1000659 | |||
| 1172 | JGI25158J39367_1001247 | |||
| 1173 | JGI25152J39213_1000374 | |||
| 1174 | JGI25152J39213_1008045 | |||
| 1175 | JGI25150J39212_1001208 | |||
| 1176 | JGI25159J45721_1003647 | |||
| 1177 | JGI25159J45721_1004025 | |||
| 1178 | JGI25165J46597_1001697 | |||
| 1179 | JGI25153J46596_10007042 | |||
| 1180 | rootL2_10024836 | |||
| 1181 | JGI25160J50197_1000302 | |||
| 1182 | JGI25160J50197_1002726 | |||
| 1183 | JGI25161J50226_1001059 | |||
| 1184 | JGI25161J50226_1002290 | |||
| 1185 | JGI25161J50226_1011659 | |||
| 1186 | Ga0055533_1000360 | |||
| 1187 | Ga0055533_1000655 | |||
| 1188 | Ga0055532_1000261 | |||
| 1189 | Ga0055532_1001452 | |||
| 1190 | Ga0055532_1001513 | |||
| 1191 | Ga0055527_1000035 | |||
| 1192 | Ga0055527_1000856 | |||
| 1193 | Ga0055527_1001087 | |||
| 1194 | Ga0055535_1000050 | |||
| 1195 | Ga0055535_1002077 | |||
| 1196 | Ga0055535_1002081 | |||
| 1197 | Ga0055542_1000512 | |||
| 1198 | Ga0055542_1001196 | |||
| 1199 | Ga0055529_1000089 | |||
| 1200 | Ga0055529_1000604 | |||
| 1201 | Ga0055529_1001042 | |||
| 1202 | Ga0055526_1011470 | |||
| 1203 | Ga0055526_1013864 | |||
| 1204 | Ga0055537_1008962 | |||
| 1205 | Ga0055537_1012058 | |||
| 1206 | Ga0055524_1003357 | |||
| 1207 | Ga0055524_1004910 | |||
| 1208 | Ga0055524_1037368 | |||
| 1209 | Ga0055534_1008099 | |||
| 1210 | Ga0055528_1000489 | |||
| 1211 | Ga0055528_1002787 | |||
| 1212 | Ga0055530_10005313 | |||
| 1213 | Ga0055530_10008910 | |||
| 1214 | Ga0055530_10015201 | |||
| 1215 | Ga0055531_10013481 | |||
| 1216 | Ga0055531_10025971 | |||
| 1217 | Ga0058692_1001156 | |||
| 1218 | Ga0055543_1001828 | |||
| 1219 | Ga0055543_1002861 | |||
| 1220 | Ga0058863_11081137 | |||
| 1221 | Ga0065165_1000116 | |||
| 1222 | Ga0065165_1000885 | |||
| 1223 | Ga0065165_1001236 | |||
| 1224 | Ga0065165_1004323 | |||
| 1225 | Ga0065707_10083199 | |||
| 1226 | Ga0065707_10084693 | |||
| 1227 | Ga0070658_10009293 | |||
| 1228 | Ga0070658_10033857 | |||
| 1229 | Ga0070658_10038504 | |||
| 1230 | Ga0070676_10023216 | |||
| 1231 | Ga0070683_100003232 | |||
| 1232 | Ga0070683_100374838 | |||
| 1233 | Ga0070690_100039763 | |||
| 1234 | Ga0070690_100091732 | |||
| 1235 | Ga0070670_100006399 | |||
| 1236 | Ga0070677_10053864 | |||
| 1237 | Ga0070666_10038195 | |||
| 1238 | Ga0070666_10082621 | |||
| 1239 | Ga0068868_100012023 | |||
| 1240 | Ga0070660_100000025 | |||
| 1241 | Ga0070660_100108133 | |||
| 1242 | Ga0070689_100029665 | |||
| 1243 | Ga0070689_100034639 | |||
| 1244 | Ga0070689_100169861 | |||
| 1245 | Ga0070689_100288155 | |||
| 1246 | Ga0070687_100030188 | |||
| 1247 | Ga0070661_100026438 | |||
| 1248 | Ga0070668_100036411 | |||
| 1249 | Ga0070669_100068433 | |||
| 1250 | Ga0070669_100079362 | |||
| 1251 | Ga0070669_100095083 | |||
| 1252 | Ga0070669_100144902 | |||
| 1253 | Ga0070669_100242409 | |||
| 1254 | Ga0070675_100033527 | |||
| 1255 | Ga0070671_100004031 | |||
| 1256 | Ga0070671_100195504 | |||
| 1257 | Ga0070673_100038632 | |||
| 1258 | Ga0070673_100066412 | |||
| 1259 | Ga0070688_100001291 | |||
| 1260 | Ga0070659_100000426 | |||
| 1261 | Ga0070659_100002895 | |||
| 1262 | Ga0070667_100032917 | |||
| 1263 | Ga0070709_10013919 | |||
| 1264 | Ga0070711_100053406 | |||
| 1265 | Ga0070700_100076525 | |||
| 1266 | Ga0070663_100109268 | |||
| 1267 | Ga0070663_100267476 | |||
| 1268 | Ga0070678_100080861 | |||
| 1269 | Ga0070678_100176032 | |||
| 1270 | Ga0070662_100009064 | |||
| 1271 | Ga0070681_10062438 | |||
| 1272 | Ga0070681_10237202 | |||
| 1273 | Ga0068867_100083347 | |||
| 1274 | Ga0070685_10009316 | |||
| 1275 | Ga0070706_100001854 | |||
| 1276 | Ga0070707_100236999 | |||
| 1277 | Ga0070699_100154327 | |||
| 1278 | Ga0070679_100124324 | |||
| 1279 | Ga0070679_100282264 | |||
| 1280 | Ga0070684_100003023 | |||
| 1281 | Ga0070684_100615587 | |||
| 1282 | Ga0068853_100446285 | |||
| 1283 | Ga0070672_100049328 | |||
| 1284 | Ga0070672_100049386 | |||
| 1285 | Ga0070686_100128165 | |||
| 1286 | Ga0070695_100193643 | |||
| 1287 | Ga0070695_100248673 | |||
| 1288 | Ga0070693_100019782 | |||
| 1289 | Ga0070665_100000660 | |||
| 1290 | Ga0070665_100013780 | |||
| 1291 | Ga0070665_100017631 | |||
| 1292 | Ga0070665_100357639 | |||
| 1293 | Ga0068855_100008244 | |||
| 1294 | Ga0068855_100034453 | |||
| 1295 | Ga0068855_100089624 | |||
| 1296 | Ga0070664_100018275 | |||
| 1297 | Ga0070664_100254947 | |||
| 1298 | Ga0068857_100066745 | |||
| 1299 | Ga0068856_100005075 | |||
| 1300 | Ga0070702_100248186 | |||
| 1301 | Ga0068852_100016015 | |||
| 1302 | Ga0068859_100237201 | |||
| 1303 | Ga0068866_10011754 | |||
| 1304 | Ga0068861_100000476 | |||
| 1305 | Ga0068861_100001522 | |||
| 1306 | Ga0068870_10004878 | |||
| 1307 | Ga0068870_10020377 | |||
| 1308 | Ga0068863_100059350 | |||
| 1309 | Ga0068863_100449940 | |||
| 1310 | Ga0068858_100176531 | |||
| 1311 | Ga0068860_100059231 | |||
| 1312 | Ga0068860_100194900 | |||
| 1313 | Ga0068862_100000987 | |||
| 1314 | Ga0075368_10013182 | |||
| 1315 | Ga0075364_10001271 | |||
| 1316 | Ga0070716_100185489 | |||
| 1317 | Ga0075367_10062286 | |||
| 1318 | Ga0075366_10044507 | |||
| 1319 | Ga0097621_100006113 | |||
| 1320 | Ga0097621_100309656 | |||
| 1321 | Ga0075428_100000668 | |||
| 1322 | Ga0075428_100012845 | |||
| 1323 | Ga0075428_100214215 | |||
| 1324 | Ga0075428_100254919 | |||
| 1325 | Ga0075428_100334827 | |||
| 1326 | Ga0075430_100003515 | |||
| 1327 | Ga0075430_100023748 | |||
| 1328 | Ga0075430_100046030 | |||
| 1329 | Ga0075430_100047463 | |||
| 1330 | Ga0075431_100010835 | |||
| 1331 | Ga0075431_100013304 | |||
| 1332 | Ga0075431_100028254 | |||
| 1333 | Ga0075431_100279102 | |||
| 1334 | Ga0075431_100332354 | |||
| 1335 | Ga0075434_100061116 | |||
| 1336 | Ga0075429_100013404 | |||
| 1337 | Ga0075429_100066056 | |||
| 1338 | Ga0068865_100076214 | |||
| 1339 | Ga0075436_100016767 | |||
| 1340 | Ga0075436_100056897 | |||
| 1341 | Ga0097620_100237207 | |||
| 1342 | Ga0099794_10015598 | |||
| 1343 | Ga0099795_10076636 | |||
| 1344 | Ga0105251_10000422 | |||
| 1345 | Ga0105251_10001215 | |||
| 1346 | Ga0105251_10043445 | |||
| 1347 | Ga0105244_10042907 | |||
| 1348 | Ga0105250_10000006 | |||
| 1349 | Ga0105250_10008008 | |||
| 1350 | Ga0105240_10002542 | |||
| 1351 | Ga0105240_10003657 | |||
| 1352 | Ga0105240_10008032 | |||
| 1353 | Ga0105240_10044011 | |||
| 1354 | Ga0105240_10060442 | |||
| 1355 | Ga0105240_10086152 | |||
| 1356 | Ga0105240_10107666 | |||
| 1357 | Ga0111539_10004402 | |||
| 1358 | Ga0111539_10020994 | |||
| 1359 | Ga0105245_10015862 | |||
| 1360 | Ga0105245_10127450 | |||
| 1361 | Ga0114129_10002340 | |||
| 1362 | Ga0114129_10350121 | |||
| 1363 | Ga0105243_10467640 | |||
| 1364 | Ga0105241_10008245 | |||
| 1365 | Ga0105242_10118974 | |||
| 1366 | Ga0105242_10221195 | |||
| 1367 | Ga0105242_10235707 | |||
| 1368 | Ga0105248_10001770 | |||
| 1369 | Ga0105248_10058727 | |||
| 1370 | Ga0105248_10093341 | |||
| 1371 | Ga0105248_10115448 | |||
| 1372 | Ga0105248_10222527 | |||
| 1373 | Ga0105248_10572444 | |||
| 1374 | Ga0105237_10000806 | |||
| 1375 | Ga0105237_10015030 | |||
| 1376 | Ga0105237_10206678 | |||
| 1377 | Ga0105237_10222133 | |||
| 1378 | Ga0105238_10023771 | |||
| 1379 | Ga0105238_10136996 | |||
| 1380 | Ga0105238_10138000 | |||
| 1381 | Ga0105238_10275361 | |||
| 1382 | Ga0105249_10000932 | |||
| 1383 | Ga0105249_10410807 | |||
| 1384 | Ga0105249_10467951 | |||
| 1385 | Ga0105239_10000292 | |||
| 1386 | Ga0105239_10265140 | |||
| 1387 | Ga0157370_10004409 | |||
| 1388 | Ga0157370_10170975 | |||
| 1389 | Ga0157369_10000147 | |||
| 1390 | Ga0157369_10001132 | |||
| 1391 | Ga0157369_10150467 | |||
| 1392 | Ga0157369_10286170 | |||
| 1393 | Ga0157374_10000117 | |||
| 1394 | Ga0157374_10089701 | |||
| 1395 | Ga0157374_10162633 | |||
| 1396 | Ga0157378_10000848 | |||
| 1397 | Ga0157378_10051905 | |||
| 1398 | Ga0163162_10001267 | |||
| 1399 | Ga0163162_10250959 | |||
| 1400 | Ga0157375_10116663 | |||
| 1401 | Ga0163163_10358215 | |||
| 1402 | Ga0163163_10415122 | |||
| 1403 | Ga0157380_10002130 | |||
| 1404 | Ga0157379_10000337 | |||
| 1405 | Ga0157379_10080167 | |||
| 1406 | Ga0157379_10086887 | |||
| 1407 | Ga0157376_10006374 | |||
| 1408 | Ga0182005_1015683 | |||
| 1409 | Ga0183361_10015 | |||
| 1410 | Ga0163161_10144592 | |||
| 1411 | Ga0163161_10313658 | |||
| 1412 | Ga0197907_10170016 | |||
| 1413 | Ga0206356_10440101 | |||
| 1414 | Ga0206355_1192289 | |||
| 1415 | Ga0206350_11042565 | |||
| 1416 | Ga0206354_10161165 | |||
| 1417 | Ga0206354_11326690 | |||
| 1418 | Ga0206353_10230299 | |||
| 1419 | Ga0213872_10000031 | |||
| 1420 | Ga0213872_10000373 | |||
| 1421 | Ga0213872_10000561 | |||
| 1422 | Ga0213872_10002125 | |||
| 1423 | Ga0213872_10003375 | |||
| 1424 | Ga0213872_10003455 | |||
| 1425 | Ga0213872_10004304 | |||
| 1426 | Ga0213872_10012950 | |||
| 1427 | Ga0213872_10014710 | |||
| 1428 | Ga0213872_10020644 | |||
| 1429 | Ga0213872_10029298 | |||
| 1430 | Ga0213872_10070218 | |||
| 1431 | Ga0213872_10086200 | |||
| 1432 | Ga0213872_10111107 | |||
| 1433 | Ga0224712_10000271 | |||
| 1434 | Ga0224712_10022673 | |||
| 1435 | Ga0209436_100369 | |||
| 1436 | Ga0209436_100434 | |||
| 1437 | Ga0209436_101159 | |||
| 1438 | Ga0209566_100901 | |||
| 1439 | Ga0209674_100153 | |||
| 1440 | Ga0209674_100272 | |||
| 1441 | Ga0209674_101734 | |||
| 1442 | Ga0209672_100054 | |||
| 1443 | Ga0209672_100072 | |||
| 1444 | Ga0209672_100073 | |||
| 1445 | Ga0209672_102717 | |||
| 1446 | Ga0209147_100093 | |||
| 1447 | Ga0209147_100100 | |||
| 1448 | Ga0209147_100328 | |||
| 1449 | Ga0209147_100445 | |||
| 1450 | Ga0207427_101410 | |||
| 1451 | Ga0209258_100140 | |||
| 1452 | Ga0209258_100579 | |||
| 1453 | Ga0209258_100581 | |||
| 1454 | Ga0207425_1000021 | |||
| 1455 | Ga0207425_1000223 | |||
| 1456 | Ga0209026_1002417 | |||
| 1457 | Ga0209148_1000119 | |||
| 1458 | Ga0209148_1000140 | |||
| 1459 | Ga0209148_1001759 | |||
| 1460 | Ga0209759_1000281 | |||
| 1461 | Ga0209759_1000928 | |||
| 1462 | Ga0209759_1005226 | |||
| 1463 | Ga0209759_1008317 | |||
| 1464 | Ga0209129_1000020 | |||
| 1465 | Ga0209129_1003091 | |||
| 1466 | Ga0209233_1000173 | |||
| 1467 | Ga0209565_1000536 | |||
| 1468 | Ga0209565_1000770 | |||
| 1469 | Ga0209565_1004827 | |||
| 1470 | Ga0209565_1004922 | |||
| 1471 | Ga0209565_1009668 | |||
| 1472 | Ga0209455_1000125 | |||
| 1473 | Ga0209455_1000244 | |||
| 1474 | Ga0209455_1000849 | |||
| 1475 | Ga0209673_1000098 | |||
| 1476 | Ga0209673_1012788 | |||
| 1477 | Ga0209130_1002175 | |||
| 1478 | Ga0209130_1003597 | |||
| 1479 | Ga0209675_1000650 | |||
| 1480 | Ga0209675_1003924 | |||
| 1481 | Ga0209675_1004802 | |||
| 1482 | Ga0209564_1000780 | |||
| 1483 | Ga0209564_1003850 | |||
| 1484 | Ga0209564_1010880 | |||
| 1485 | Ga0209564_1013058 | |||
| 1486 | Ga0209758_1000077 | |||
| 1487 | Ga0209050_1000050 | |||
| 1488 | Ga0209050_1000795 | |||
| 1489 | Ga0209050_1007586 | |||
| 1490 | Ga0209256_1000674 | |||
| 1491 | Ga0209256_1001001 | |||
| 1492 | Ga0209256_1014402 | |||
| 1493 | Ga0207426_1000199 | |||
| 1494 | Ga0207426_1002770 | |||
| 1495 | Ga0207426_1003789 | |||
| 1496 | Ga0209051_1024272 | |||
| 1497 | Ga0209257_1000075 | |||
| 1498 | Ga0209257_1012663 | |||
| 1499 | Ga0207656_10015465 | |||
| 1500 | Ga0207696_1000069 | |||
| 1501 | Ga0207713_1000473 | |||
| 1502 | Ga0207713_1011443 | |||
| 1503 | Ga0207680_10078739 | |||
| 1504 | Ga0207647_10000884 | |||
| 1505 | Ga0207647_10011496 | |||
| 1506 | Ga0207647_10023305 | |||
| 1507 | Ga0207647_10036201 | |||
| 1508 | Ga0207647_10068522 | |||
| 1509 | Ga0207645_10005863 | |||
| 1510 | Ga0207645_10012127 | |||
| 1511 | Ga0207645_10104751 | |||
| 1512 | Ga0207643_10016060 | |||
| 1513 | Ga0207643_10023434 | |||
| 1514 | Ga0207705_10002472 | |||
| 1515 | Ga0207705_10039734 | |||
| 1516 | Ga0207705_10091658 | |||
| 1517 | Ga0207684_10003995 | |||
| 1518 | Ga0207684_10129406 | |||
| 1519 | Ga0207695_10002160 | |||
| 1520 | Ga0207695_10004507 | |||
| 1521 | Ga0207695_10010060 | |||
| 1522 | Ga0207695_10109457 | |||
| 1523 | Ga0207695_10117465 | |||
| 1524 | Ga0207695_10149502 | |||
| 1525 | Ga0207695_10266745 | |||
| 1526 | Ga0207662_10037189 | |||
| 1527 | Ga0207657_10000065 | |||
| 1528 | Ga0207657_10176219 | |||
| 1529 | Ga0207649_10050277 | |||
| 1530 | Ga0207681_10009993 | |||
| 1531 | Ga0207681_10024175 | |||
| 1532 | Ga0207681_10063461 | |||
| 1533 | Ga0207694_10049326 | |||
| 1534 | Ga0207694_10096452 | |||
| 1535 | Ga0207694_10217460 | |||
| 1536 | Ga0207694_10251506 | |||
| 1537 | Ga0207650_10176304 | |||
| 1538 | Ga0207659_10006052 | |||
| 1539 | Ga0207687_10010398 | |||
| 1540 | Ga0207687_10062424 | |||
| 1541 | Ga0207700_10252302 | |||
| 1542 | Ga0207690_10000040 | |||
| 1543 | Ga0207706_10012447 | |||
| 1544 | Ga0207706_10196415 | |||
| 1545 | Ga0207670_10065604 | |||
| 1546 | Ga0207670_10274235 | |||
| 1547 | Ga0207665_10026036 | |||
| 1548 | Ga0207665_10462882 | |||
| 1549 | Ga0207691_10003458 | |||
| 1550 | Ga0207691_10056855 | |||
| 1551 | Ga0207711_10004182 | |||
| 1552 | Ga0207711_10007645 | |||
| 1553 | Ga0207711_10101453 | |||
| 1554 | Ga0207711_10247003 | |||
| 1555 | Ga0207661_10223831 | |||
| 1556 | Ga0207679_10158804 | |||
| 1557 | Ga0207667_10002770 | |||
| 1558 | Ga0207667_10007228 | |||
| 1559 | Ga0207651_10000299 | |||
| 1560 | Ga0207651_10085542 | |||
| 1561 | Ga0207712_10003324 | |||
| 1562 | Ga0207712_10452111 | |||
| 1563 | Ga0207668_10159205 | |||
| 1564 | Ga0207678_10002359 | |||
| 1565 | Ga0207678_10021510 | |||
| 1566 | Ga0207678_10066655 | |||
| 1567 | Ga0207708_10007971 | |||
| 1568 | Ga0207708_10037895 | |||
| 1569 | Ga0207702_10230241 | |||
| 1570 | Ga0207641_10035820 | |||
| 1571 | Ga0207648_10018611 | |||
| 1572 | Ga0207648_10025670 | |||
| 1573 | Ga0207674_10039350 | |||
| 1574 | Ga0207675_100002950 | |||
| 1575 | Ga0207675_100025458 | |||
| 1576 | Ga0207675_100040413 | |||
| 1577 | Ga0207675_100198935 | |||
| 1578 | Ga0207675_100415533 | |||
| 1579 | Ga0207675_100773829 | |||
| 1580 | Ga0207683_10099306 | |||
| 1581 | Ga0207683_10119170 | |||
| 1582 | Ga0207683_10133739 | |||
| 1583 | Ga0207698_10018564 | |||
| 1584 | Ga0209371_1000325 | |||
| 1585 | Ga0209371_1000766 | |||
| 1586 | Ga0209371_1004858 | |||
| 1587 | Ga0209971_1037991 | |||
| 1588 | Ga0209813_10062220 | |||
| 1589 | Ga0207428_10031694 | |||
| 1590 | Ga0268266_10000630 | |||
| 1591 | Ga0268266_10142463 | |||
| 1592 | Ga0268266_10338010 | |||
| 1593 | Ga0265334_10000192 | |||
| 1594 | Ga0265318_10004269 | |||
| 1595 | Ga0307515_10000062 | |||
| 1596 | Ga0307515_10011102 | |||
| 1597 | Ga0307515_10063273 | |||
| 1598 | Ga0265338_10028960 | |||
| 1599 | Ga0265338_10032666 | |||
| 1600 | Ga0268256_1006955 | |||
| 1601 | Ga0268256_1013276 | |||
| 1602 | Ga0265330_10014351 | |||
| 1603 | Ga0265328_10004474 | |||
| 1604 | Ga0265325_10026335 | |||
| 1605 | Ga0265325_10079571 | |||
| 1606 | Ga0265339_10020277 | |||
| 1607 | Ga0265331_10005565 | |||
| 1608 | Ga0265327_10025641 | |||
| 1609 | Ga0265327_10042408 | |||
| 1610 | Ga0265316_10015358 | |||
| 1611 | Ga0265316_10050777 | |||
| 1612 | Ga0307513_10017125 | |||
| 1613 | Ga0307513_10258902 | |||
| 1614 | Ga0307509_10000781 | |||
| 1615 | Ga0307509_10140386 | |||
| 1616 | Ga0307408_100000531 | |||
| 1617 | Ga0307408_100006732 | |||
| 1618 | Ga0307408_100015316 | |||
| 1619 | Ga0307408_100025974 | |||
| 1620 | Ga0307408_100049899 | |||
| 1621 | Ga0307408_100223034 | |||
| 1622 | Ga0265313_10009218 | |||
| 1623 | Ga0265314_10051139 | |||
| 1624 | Ga0265314_10215541 | |||
| 1625 | Ga0265342_10036360 | |||
| 1626 | Ga0307516_10102046 | |||
| 1627 | Ga0307405_10228874 | |||
| 1628 | Ga0307518_10017517 | |||
| 1629 | Ga0307412_10000056 | |||
| 1630 | Ga0307412_10000313 | |||
| 1631 | Ga0307409_100183810 | |||
| 1632 | Ga0307416_100003671 | |||
| 1633 | Ga0307416_100006357 | |||
| 1634 | Ga0307416_100037534 | |||
| 1635 | Ga0307411_10083184 | |||
| 1636 | Ga0307415_100236031 | |||
| 1637 | Ga0316593_10013988 | |||
| 1638 | Ga0373923_0057757 | |||
| 1639 | Ga0373954_0003620 | |||
| 1640 | Ga0373954_0073056 | |||
| 1641 | Ga0373956_0112634 | |||
| 1642 | Ga0373957_0021631 | |||
| 1643 | Ga0373931_0122600 | |||
| 1644 | Ga0373935_0034565 | |||
| 1645 | Ga0373927_0056620 | |||
| 1646 | Ga0373927_0135245 | |||
| 1647 | Ga0373947_0012484 | |||
| 1648 | Ga0373937_0144790 | |||
| 1649 | Ga0373937_0203611 | |||
| 1650 | Ga0316582_0049440 | |||
| 1651 | Ga0373925_0376705 | |||
| 1652 | Ga0395899_0000080 | |||
| 1653 | Ga0395900_0000087 | |||
| 1654 | Ga0395900_0000556 | |||
| 1655 | Ga0395900_0001157 | |||
| 1656 | Ga0395900_0061736 | |||
| 1657 | Ga0395900_0299986 | |||
| 1658 | Ga0395898_0000448 | |||
| 1659 | Ga0395898_0000800 | |||
| 1660 | Ga0395905_0000117 | |||
| 1661 | Ga0395905_0001371 | |||
| 1662 | Ga0395905_0020972 | |||
| 1663 | Ga0395905_0034300 | |||
| 1664 | Ga0395905_0050883 | |||
| 1665 | Ga0395905_0385273 | |||
| 1666 | Ga0395901_0487379 | |||
| 1667 | Ga0400487_28356 | |||
| 1668 | Ga0436365_1278966 | |||
| 1669 | Ga0436360_1136634 | |||
| 1670 | Ga0436361_0025205 | |||
| 1671 | Ga0436361_0044305 | |||
| 1672 | Ga0436361_0049092 | |||
| 1673 | Ga0436361_0209856 | |||
| 1674 | Ga0436361_0250234 | |||
| 1675 | Ga0436361_0297903 | |||
| 1676 | Ga0436361_0433430 | |||
| 1677 | Ga0436361_0470837 | |||
| 1678 | Ga0436361_0580915 | |||
| 1679 | Ga0436361_0839867 | |||
| 1680 | Ga0436361_0913791 | |||
| 1681 | Ga0436361_0956051 | |||
| 1682 | Ga0436361_1020767 | |||
| 1683 | Ga0436361_1101895 | |||
| 1684 | Ga0436361_1180414 | |||
| 1685 | Ga0436361_1190118 | |||
| 1686 | Ga0439436_0000549 | |||
| 1687 | Ga0439465_0004524 | |||
| 1688 | Ga0451797_0505633 | |||
| 1689 | Ga0451833_1218993 | |||
| 1690 | Ga0451845_0311299 | |||
| 1691 | Ga0451853_2193203 | |||
| 1692 | Ga0439433_0001392 | |||
| 1693 | Ga0439445_0001193 | |||
| 1694 | Ga0439432_002821 | |||
| 1695 | Ga0439449_0003939 | |||
| 1696 | Ga0439452_001555 | |||
| 1697 | Ga0450920_022606 | |||
| 1698 | Ga0439446_0018853 | |||
| 1699 | Ga0450918_000029 | |||
| 1700 | Ga0451577_0000096 | |||
| 1701 | Ga0451577_0000256 | |||
| 1702 | Ga0451577_0001289 | |||
| 1703 | Ga0451577_0003168 | |||
| 1704 | Ga0451577_0005291 | |||
| 1705 | Ga0451577_0007875 | |||
| 1706 | Ga0451577_0037915 | |||
| 1707 | Ga0451577_0066410 | |||
| 1708 | Ga0451577_0075027 | |||
| 1709 | Ga0451577_0288103 | |||
| 1710 | Ga0466969_0001645 | |||
| 1711 | Ga0466969_0008945 | |||
| 1712 | Ga0466969_0025962 | |||
| 1713 | Ga0466972_0000140 | |||
| 1714 | Ga0466973_0013087 | |||
| 1715 | Ga0453683_0003537 | |||
| 1716 | Ga0453683_0263696 | |||
| 1717 | Ga0466965_0009616 | |||
| 1718 | Ga0466965_0019640 | |||
| 1719 | Ga0466966_0000070 | |||
| 1720 | Ga0466966_0002513 | |||
| 1721 | Ga0466966_0010700 | |||
| 1722 | Ga0466966_0026858 | |||
| 1723 | Ga0466961_0000274 | |||
| 1724 | Ga0466961_0000296 | |||
| 1725 | Ga0466961_0021297 | |||
| 1726 | Ga0466963_0001034 | |||
| 1727 | Ga0466963_0003397 | |||
| 1728 | Ga0466963_0003741 | |||
| 1729 | Ga0466964_0003298 | |||
| 1730 | Ga0466964_0032719 | |||
| 1731 | Ga0453684_0000842 | |||
| 1732 | Ga0453684_0002108 | |||
| 1733 | Ga0453684_0010441 | |||
| 1734 | Ga0453684_0021746 | |||
| 1735 | Ga0453684_0090971 | |||
| 1736 | Ga0453684_0102117 | |||
| 1737 | Ga0453684_0200476 | |||
| 1738 | Ga0453684_0270730 | |||
| 1739 | Ga0466971_0006136 | |||
| 1740 | Ga0466971_0030118 | |||
| 1741 | Ga0466968_0008623 | |||
| 1742 | Ga0466968_0090109 | |||
| 1743 | Ga0466970_0015274 | |||
| 1744 | Ga0466970_0025747 | |||
| 1745 | Ga0466970_0057543 | |||
| 1746 | Ga0466970_0073486 | |||
| 1747 | Ga0466957_0000633 | |||
| 1748 | Ga0466957_0001619 | |||
| 1749 | Ga0466957_0013598 | |||
| 1750 | Ga0466957_0013790 | |||
| 1751 | Ga0466957_0019220 | |||
| 1752 | Ga0466957_0021719 | |||
| 1753 | Ga0466957_0113603 | |||
| 1754 | Ga0466959_0001210 | |||
| 1755 | Ga0466959_0008161 | |||
| 1756 | Ga0466959_0031735 | |||
| 1757 | Ga0466959_0190336 | |||
| 1758 | Ga0451576_0000494 | |||
| 1759 | Ga0451576_0001170 | |||
| 1760 | Ga0451576_0135204 | |||
| 1761 | Ga0466958_0001446 | |||
| 1762 | Ga0466958_0001792 | |||
| 1763 | Ga0466958_0003938 | |||
| 1764 | Ga0466967_0465587 | |||
| 1765 | Ga0495617_041990 | |||
| 1766 | Ga0495627_000011 | |||
| 1767 | Ga0495592_0007865 | |||
| 1768 | Ga0495592_0023491 | |||
| 1769 | Ga0495603_0002789 | |||
| 1770 | Ga0495603_0005119 | |||
| 1771 | Ga0495590_0000842 | |||
| 1772 | Ga0495590_0001030 | |||
| 1773 | Ga0495590_0002642 | |||
| 1774 | Ga0495590_0009722 | |||
| 1775 | Ga0495590_0015583 | |||
| 1776 | Ga0495591_000765 | |||
| 1777 | Ga0495591_034295 | |||
| 1778 | Ga0495629_0000465 | |||
| 1779 | Ga0495629_0000664 | |||
| 1780 | Ga0495629_0002046 | |||
| 1781 | Ga0495629_0010142 | |||
| 1782 | Ga0495629_0019324 | |||
| 1783 | Ga0495629_0214057 | |||
| 1784 | Ga0495638_0010372 | |||
| 1785 | Ga0495638_0080946 | |||
| 1786 | Ga0495641_0008326 | |||
| 1787 | Ga0495651_0019962 | |||
| 1788 | Ga0495651_0026530 | |||
| 1789 | Ga0495651_0130198 | |||
| 1790 | Ga0495651_0162523 | |||
| 1791 | Ga0495653_0002551 | |||
| 1792 | Ga0495653_0004428 | |||
| 1793 | Ga0495653_0004792 | |||
| 1794 | Ga0495653_0012941 | |||
| 1795 | Ga0495653_0032216 | |||
| 1796 | Ga0495653_0119736 | |||
| 1797 | Ga0495650_0001754 | |||
| 1798 | Ga0495650_0002590 | |||
| 1799 | Ga0495650_0004755 | |||
| 1800 | Ga0495580_0004101 | |||
| 1801 | Ga0495580_0004345 | |||
| 1802 | Ga0495580_0004858 | |||
| 1803 | Ga0495580_0006675 | |||
| 1804 | Ga0495580_0010114 | |||
| 1805 | Ga0495580_0023683 | |||
| 1806 | Ga0495580_0043417 | |||
| 1807 | Ga0495580_0059899 | |||
| 1808 | Ga0495580_0071281 | |||
| 1809 | Ga0495580_0101621 | |||
| 1810 | Ga0495582_0000577 | |||
| 1811 | Ga0495582_0026755 | |||
| 1812 | Ga0495582_0055071 | |||
| 1813 | Ga0495582_0207224 | |||
| 1814 | Ga0495605_0001964 | |||
| 1815 | Ga0495605_0003997 | |||
| 1816 | Ga0495605_0007585 | |||
| 1817 | Ga0495605_0085265 | |||
| 1818 | Ga0495664_0000331 | |||
| 1819 | Ga0495585_0018266 | |||
| 1820 | Ga0495596_0009852 | |||
| 1821 | Ga0495607_0000153 | |||
| 1822 | Ga0495607_0076887 | |||
| 1823 | Ga0495607_0137256 | |||
| 1824 | Ga0495583_0011149 | |||
| 1825 | Ga0495606_0000433 | |||
| 1826 | Ga0495606_0015098 | |||
| 1827 | Ga0495606_0016007 | |||
| 1828 | Ga0495606_0056810 | |||
| 1829 | Ga0495606_0070506 | |||
| 1830 | Ga0495608_0006806 | |||
| 1831 | Ga0495608_0013153 | |||
| 1832 | Ga0495608_0061927 | |||
| 1833 | Ga0495608_0130710 | |||
| 1834 | Ga0495616_0000234 | |||
| 1835 | Ga0495616_0034804 | |||
| 1836 | Ga0495618_0001925 | |||
| 1837 | Ga0495618_0013435 | |||
| 1838 | Ga0495620_0023214 | |||
| 1839 | Ga0495620_0050404 | |||
| 1840 | Ga0495628_0015152 | |||
| 1841 | Ga0495628_0017374 | |||
| 1842 | Ga0495628_0021727 | |||
| 1843 | Ga0495628_0031277 | |||
| 1844 | Ga0495628_0049658 | |||
| 1845 | Ga0495628_0082423 | |||
| 1846 | Ga0495628_0085744 | |||
| 1847 | Ga0495628_0100160 | |||
| 1848 | Ga0495630_0002428 | |||
| 1849 | Ga0495630_0006450 | |||
| 1850 | Ga0495630_0006602 | |||
| 1851 | Ga0495630_0010033 | |||
| 1852 | Ga0495630_0012786 | |||
| 1853 | Ga0495630_0354652 | |||
| 1854 | Ga0495632_0004583 | |||
| 1855 | Ga0495643_0097777 | |||
| 1856 | Ga0495644_0061324 | |||
| 1857 | Ga0495648_0029393 | |||
| 1858 | Ga0495648_0030733 | |||
| 1859 | Ga0495648_0079767 | |||
| 1860 | Ga0495648_0081004 | |||
| 1861 | Ga0495663_0006383 | |||
| 1862 | Ga0495666_0006771 | |||
| 1863 | Ga0495666_0009632 | |||
| 1864 | Ga0495666_0011613 | |||
| 1865 | Ga0495666_0027810 | |||
| 1866 | Ga0495666_0034417 | |||
| 1867 | Ga0495652_0016075 | |||
| 1868 | Ga0495652_0030679 | |||
| 1869 | Ga0495652_0056480 | |||
| 1870 | Ga0495654_0012995 | |||
| 1871 | Ga0495654_0061372 | |||
| 1872 | Ga0495654_0065534 | |||
| 1873 | Ga0495665_0001459 | |||
| 1874 | Ga0495665_0006630 | |||
| 1875 | Ga0495665_0016829 | |||
| 1876 | Ga0495665_0044772 | |||
| 1877 | Ga0495665_0085131 | |||
| 1878 | Ga0495665_0186810 | |||
| 1879 | Ga0495640_0010529 | |||
| 1880 | Ga0495640_0018994 | |||
| 1881 | Ga0495640_0096125 | |||
| 1882 | Ga0495640_0159241 | |||
| 1883 | Ga0495640_0189107 | |||
| 1884 | Ga0495586_0003609 | |||
| 1885 | Ga0495586_0097168 | |||
| 1886 | Ga0495586_0098974 | |||
| 1887 | Ga0495586_0205709 | |||
| 1888 | Ga0495586_0262489 | |||
| 1889 | Ga0495587_0001543 | |||
| 1890 | Ga0495587_0003899 | |||
| 1891 | Ga0495587_0063834 | |||
| 1892 | Ga0495587_0074676 | |||
| 1893 | Ga0495621_0000689 | |||
| 1894 | Ga0495621_0001595 | |||
| 1895 | Ga0495597_0000542 | |||
| 1896 | Ga0495597_0017543 | |||
| 1897 | Ga0495597_0037036 | |||
| 1898 | Ga0495645_0000582 | |||
| 1899 | Ga0495645_0004295 | |||
| 1900 | Ga0495645_0005517 | |||
| 1901 | Ga0495645_0006959 | |||
| 1902 | Ga0495645_0066532 | |||
| 1903 | Ga0495645_0123803 | |||
| 1904 | Ga0495622_0006058 | |||
| 1905 | Ga0495622_0069022 | |||
| 1906 | Ga0495633_0014003 | |||
| 1907 | Ga0495667_0025517 | |||
| 1908 | Ga0495656_0050364 | |||
| 1909 | Ga0495634_0007523 | |||
| 1910 | Ga0495634_0027591 | |||
| 1911 | Ga0495634_0053834 | |||
| 1912 | Ga0495611_0124316 | |||
| 1913 | Ga0495625_0012680 | |||
| 1914 | Ga0495625_0135755 | |||
| 1915 | Ga0495625_0204836 | |||
| 1916 | Ga0495635_0005253 | |||
| 1917 | Ga0495635_0007081 | |||
| 1918 | Ga0495635_0008059 | |||
| 1919 | Ga0495635_0022329 | |||
| 1920 | Ga0495635_0112884 | |||
| 1921 | Ga0495661_0017422 | |||
| 1922 | Ga0495588_0078532 | |||
| 1923 | Ga0495657_0147267 | |||
| 1924 | Ga0495657_0200898 | |||
| 1925 | Ga0495599_0015330 | |||
| 1926 | Ga0495599_0040909 | |||
| 1927 | Ga0495599_0088879 | |||
| 1928 | Ga0495623_0006038 | |||
| 1929 | Ga0495623_0013415 | |||
| 1930 | Ga0495623_0016411 | |||
| 1931 | Ga0495623_0028079 | |||
| 1932 | Ga0495623_0070502 | |||
| 1933 | Ga0495623_0184793 | |||
| 1934 | Ga0495646_0000772 | |||
| 1935 | Ga0495646_0003040 | |||
| 1936 | Ga0495646_0006796 | |||
| 1937 | Ga0495646_0028155 | |||
| 1938 | Ga0495646_0039554 | |||
| 1939 | Ga0495646_0044952 | |||
| 1940 | Ga0495646_0063689 | |||
| 1941 | Ga0495647_0003224 | |||
| 1942 | Ga0495658_0013494 | |||
| 1943 | Ga0495658_0014311 | |||
| 1944 | Ga0495669_0026048 | |||
| 1945 | Ga0495613_0002584 | |||
| 1946 | Ga0495613_0015119 | |||
| 1947 | Ga0495613_0043589 | |||
| 1948 | Ga0495613_0084658 | |||
| 1949 | Ga0495613_0258920 | |||
| 1950 | Ga0495624_0017117 | |||
| 1951 | Ga0495624_0027568 | |||
| 1952 | Ga0495624_0053286 | |||
| 1953 | Ga0495624_0074621 | |||
| 1954 | Ga0495624_0092295 | |||
| 1955 | Ga0495624_0182649 | |||
| 1956 | Ga0495670_0005977 | |||
| 1957 | Ga0495671_0042506 | |||
| 1958 | Ga0495649_0011563 | |||
| 1959 | Ga0495649_0022313 | |||
| 1960 | Ga0495649_0028030 | |||
| 1961 | Ga0495649_0030777 | |||
| 1962 | Ga0495589_0004671 | |||
| 1963 | Ga0495589_0006429 | |||
| 1964 | Ga0495589_0042176 | |||
| 1965 | Ga0495589_0070299 | |||
| 1966 | Ga0495589_0092990 | |||
| 1967 | Ga0495600_0002240 | |||
| 1968 | Ga0495600_0010921 | |||
| 1969 | Ga0495600_0157605 | |||
| 1970 | Ga0495660_0002284 | |||
| 1971 | Ga0495581_0006028 | |||
| 1972 | Ga0495581_0096485 | |||
| 1973 | Ga0495581_0118487 | |||
| 1974 | Ga0495604_0001471 | |||
| 1975 | Ga0495604_0007351 | |||
| 1976 | Ga0495604_0010243 | |||
| 1977 | Ga0495604_0010861 | |||
| 1978 | Ga0495604_0087771 | |||
| 1979 | Ga0495636_0105202 | |||
| 1980 | Ga0495674_0017363 | |||
| 1981 | Ga0495674_0047032 | |||
| 1982 | Ga0495674_0052410 | |||
| 1983 | Ga0495674_0059707 | |||
| 1984 | Ga0495674_0142191 | |||
| 1985 | Ga0495674_0225338 | |||
| 1986 | Ga0495674_0282417 | |||
| 1987 | Ga0495672_0027576 | |||
| 1988 | Ga0495672_0043622 | |||
| 1989 | Ga0495672_0123778 | |||
| 1990 | Ga0495676_0001803 | |||
| 1991 | Ga0495676_0026801 | |||
| 1992 | Ga0495676_0142373 | |||
| 1993 | Ga0495680_0007467 | |||
| 1994 | Ga0495680_0037224 | |||
| 1995 | Ga0495680_0081847 | |||
| 1996 | Ga0495680_0084418 | |||
| 1997 | Ga0495680_0175412 | |||
| 1998 | Ga0495683_0001162 | |||
| 1999 | Ga0495683_0005126 | |||
| 2000 | Ga0495683_0012500 | |||
| 2001 | Ga0495683_0022993 | |||
| 2002 | Ga0495683_0046878 | |||
| 2003 | Ga0495687_000216 | |||
| 2004 | Ga0495687_001805 | |||
| 2005 | Ga0495675_0004754 | |||
| 2006 | Ga0495675_0012407 | |||
| 2007 | Ga0495675_0018680 | |||
| 2008 | Ga0495675_0029499 | |||
| 2009 | Ga0495675_0052892 | |||
| 2010 | Ga0495675_0076962 | |||
| 2011 | Ga0495675_0079413 | |||
| 2012 | Ga0495675_0150316 | |||
| 2013 | Ga0495679_000413 | |||
| 2014 | Ga0495679_001253 | |||
| 2015 | Ga0495679_003515 | |||
| 2016 | Ga0495673_0004937 | |||
| 2017 | Ga0495673_0024457 | |||
| 2018 | Ga0495673_0050044 | |||
| 2019 | Ga0495681_0045272 | |||
| 2020 | Ga0495684_0000521 | |||
| 2021 | Ga0495684_0078249 | |||
| 2022 | Ga0495684_0172922 | |||
| 2023 | Ga0495686_0037369 | |||
| 2024 | Ga0495593_0004599 | |||
| 2025 | Ga0495593_0026339 | |||
| 2026 | Ga0495593_0029327 | |||
| 2027 | Ga0495593_0049474 | |||
| 2028 | Ga0495593_0105212 | |||
| 2029 | Ga0495593_0132743 | |||
| 2030 | Ga0495602_0010289 | |||
| 2031 | Ga0495602_0011139 | |||
| 2032 | Ga0495602_0015826 | |||
| 2033 | Ga0495602_0026876 | |||
| 2034 | Ga0495602_0059284 | |||
| 2035 | Ga0495602_0070012 | |||
| 2036 | Ga0495602_0106427 | |||
| 2037 | Ga0495602_0124376 | |||
| 2038 | Ga0495602_0212179 | |||
| 2039 | Ga0495614_0000067 | |||
| 2040 | Ga0495614_0007051 | |||
| 2041 | Ga0495614_0065601 | |||
| 2042 | Ga0495626_0000105 | |||
| 2043 | Ga0495626_0022568 | |||
| 2044 | Ga0496100_0000523 | |||
| 2045 | Ga0496100_0012549 | |||
| 2046 | Ga0496100_0076423 | |||
| 2047 | Ga0496100_0189441 | |||
| 2048 | Ga0496101_0002493 | |||
| 2049 | Ga0496101_0042288 | |||
| 2050 | Ga0496101_0047186 | |||
| 2051 | Ga0496101_0074379 | |||
| 2052 | Ga0496101_0097767 | |||
| 2053 | Ga0496101_0149015 | |||
| 2054 | Ga0496102_0000074 | |||
| 2055 | Ga0496102_0009040 | |||
| 2056 | Ga0496102_0009565 | |||
| 2057 | Ga0496102_0202261 | |||
| 2058 | Ga0496102_0563126 | |||
| 2059 | Ga0496103_0001532 | |||
| 2060 | Ga0496103_0005147 | |||
| 2061 | Ga0496103_0111526 | |||
| 2062 | Ga0496104_0029298 | |||
| 2063 | Ga0496104_0042090 | |||
| 2064 | Ga0496104_0109848 | |||
| 2065 | Ga0496104_0266001 | |||
| 2066 | Ga0496104_0293329 | |||
| 2067 | Ga0496104_0323779 | |||
| 2068 | Ga0496105_0055060 | |||
| 2069 | Ga0496105_0101000 | |||
| 2070 | Ga0496105_0185519 | |||
| 2071 | Ga0496106_0001248 | |||
| 2072 | Ga0496106_0001808 | |||
| 2073 | Ga0496106_0043216 | |||
| 2074 | Ga0496106_0043968 | |||
| 2075 | Ga0496106_0121132 | |||
| 2076 | Ga0496107_0090605 | |||
| 2077 | Ga0496107_0117202 | |||
| 2078 | Ga0496107_0125150 | |||
| 2079 | Ga0496107_0146943 | |||
| 2080 | Ga0496108_0030248 | |||
| 2081 | Ga0496108_0093854 | |||
| 2082 | Ga0496109_0019061 | |||
| 2083 | Ga0496109_0309810 | |||
| 2084 | Ga0496110_0000450 | |||
| 2085 | Ga0496110_0022640 | |||
| 2086 | Ga0496110_0540879 | |||
| 2087 | Ga0496112_0005931 | |||
| 2088 | Ga0496112_0011799 | |||
| 2089 | Ga0496112_0066722 | |||
| 2090 | Ga0496112_0137211 | |||
| 2091 | Ga0496112_0396280 | |||
| 2092 | Ga0496113_0003925 | |||
| 2093 | Ga0496113_0068501 | |||
| 2094 | Ga0496114_0000572 | |||
| 2095 | Ga0496114_0003283 | |||
| 2096 | Ga0496114_0149289 | |||
| 2097 | Ga0496114_0226778 | |||
| 2098 | Ga0496115_0005371 | |||
| 2099 | Ga0496115_0149046 | |||
| 2100 | Ga0496115_0281660 | |||
| 2101 | Ga0496116_0001318 | |||
| 2102 | Ga0496116_0017662 | |||
| 2103 | Ga0496116_0079785 | |||
| 2104 | Ga0496117_0004062 | |||
| 2105 | Ga0496117_0011401 | |||
| 2106 | Ga0496117_0017703 | |||
| 2107 | Ga0496117_0017755 | |||
| 2108 | Ga0496117_0041645 | |||
| 2109 | Ga0496117_0130320 | |||
| 2110 | Ga0496118_0001851 | |||
| 2111 | Ga0496118_0005204 | |||
| 2112 | Ga0496118_0006098 | |||
| 2113 | Ga0496118_0009426 | |||
| 2114 | Ga0496118_0018288 | |||
| 2115 | Ga0496118_0018744 | |||
| 2116 | Ga0496118_0036533 | |||
| 2117 | Ga0496121_0000306 | |||
| 2118 | Ga0496121_0002426 | |||
| 2119 | Ga0496121_0006168 | |||
| 2120 | Ga0496121_0015481 | |||
| 2121 | Ga0496121_0017741 | |||
| 2122 | Ga0496121_0051991 | |||
| 2123 | Ga0496121_0067128 | |||
| 2124 | Ga0496121_0077258 | |||
| 2125 | Ga0496121_0100695 | |||
| 2126 | Ga0496122_0000865 | |||
| 2127 | Ga0496122_0004543 | |||
| 2128 | Ga0496123_0000203 | |||
| 2129 | Ga0496123_0008097 | |||
| 2130 | Ga0496124_0002427 | |||
| 2131 | Ga0496124_0008332 | |||
| 2132 | Ga0496124_0031972 | |||
| 2133 | Ga0496124_0057514 | |||
| 2134 | Ga0496125_0019818 | |||
| 2135 | Ga0496125_0034344 | |||
| 2136 | Ga0496126_0001579 | |||
| 2137 | Ga0496126_0002578 | |||
| 2138 | Ga0496126_0002619 | |||
| 2139 | Ga0496126_0003244 | |||
| 2140 | Ga0496126_0009708 | |||
| 2141 | Ga0496126_0010990 | |||
| 2142 | Ga0496126_0189476 | |||
| 2143 | Ga0501034_0062153 | |||
| 2144 | Ga0501036_0024209 | |||
| 2145 | Ga0501040_0010800 | |||
| 2146 | Ga0501041_0054375 | |||
| 2147 | Ga0501042_0096044 | |||
| 2148 | Ga0501042_0124198 | |||
| 2149 | Ga0501043_0212561 | |||
| 2150 | Ga0501047_0256216 | |||
| 2151 | Ga0501048_0034392 | |||
| 2152 | Ga0501072_0029953 | |||
| 2153 | Ga0501073_0004074 | |||
| 2154 | Ga0501074_0164906 | |||
| 2155 | Ga0501075_0025389 | |||
| 2156 | Ga0501076_0004740 | |||
| 2157 | Ga0501076_0039276 | |||
| 2158 | Ga0501077_0121301 | |||
| 2159 | Ga0501227_004557 | |||
| 2160 | Ga0501079_0008595 | |||
| 2161 | Ga0501080_0028440 | |||
| 2162 | Ga0501080_0248761 | |||
| 2163 | Ga0501081_0028601 | |||
| 2164 | Ga0501035_0027081 | |||
| 2165 | Ga0501035_0085549 | |||
| 2166 | Ga0501044_0001185 | |||
| 2167 | nmdc:mga03683_64480_c1 | |||
| 2168 | nmdc:mga00v17_171444_c1 | |||
| 2169 | nmdc:mga00v17_18346_c1 | |||
| 2170 | nmdc:mga07m45_57654_c1 | |||
| 2171 | nmdc:mga05p37_18968_c1 | |||
| 2172 | nmdc:mga05p37_85283_c1 | |||
| 2173 | nmdc:mga09592_144219_c1 | |||
| 2174 | nmdc:mga09592_19691_c1 | |||
| 2175 | nmdc:mga09592_30224_c1 | |||
| 2176 | nmdc:mga09592_89662_c1 | |||
| 2177 | nmdc:mga0qj67_27241_c1 | |||
| 2178 | nmdc:mga0qj67_401393_c1 | |||
| 2179 | nmdc:mga0qj67_4762_c1 | |||
| 2180 | nmdc:mga06r32_176_c1 | |||
| 2181 | nmdc:mga06r32_39557_c1 | |||
| 2182 | nmdc:mga06r32_80886_c1 | |||
| 2183 | nmdc:mga08y16_65777_c1 | |||
| 2184 | nmdc:mga0n895_107426_c1 | |||
| 2185 | nmdc:mga0n895_90712_c1 | |||
| 2186 | nmdc:mga08x19_17651_c1 | |||
| 2187 | Ga0495612_0002014 | |||
| 2188 | Ga0500644_0009381 | |||
| 2189 | Ga0500651_0000066 | |||
| 2190 | Ga0500566_0045874 | |||
| 2191 | Ga0500556_0001052 | |||
| 2192 | Ga0500642_0015279 | |||
| 2193 | Ga0500568_0000481 | |||
| 2194 | Ga0500568_0011636 | |||
| 2195 | Ga0500622_0001405 | |||
| 2196 | Ga0500622_0007370 | |||
| 2197 | Ga0500637_0081510 | |||
| 2198 | Ga0501084_0094903 | |||
| 2199 | Ga0501082_0003494 | |||
| 2200 | Ga0501082_0144033 | |||
| 2201 | Ga0466962_0001530 | |||
| 2202 | Ga0466962_0006704 | |||
| 2203 | Ga0466962_0022542 | |||
| 2204 | Ga0466962_0048264 | |||
| 2205 | Ga0466962_0076703 | |||
| 2206 | Ga0530510_0029184 | |||
| 2207 | Ga0530510_0244849 | |||
| 2208 | 2501074061 | |||
| 2209 | 2501084103 | |||
| 2210 | 2501414372 | |||
| 2211 | 2509130830 | |||
| 2212 | 2510252567 | |||
| 2213 | 2511093345 | |||
| 2214 | 2511099795 | |||
| 2215 | 2511102434 | |||
| 2216 | 2512348425 | |||
| 2217 | 2513556125 | |||
| 2218 | 2513564311 | |||
| 2219 | 2513962609 | |||
| 2220 | 2514050885 | |||
| 2221 | 2515684844 | |||
| 2222 | 2516022247 | |||
| 2223 | 2519457531 | |||
| 2224 | 2527080604 | |||
| 2225 | 2563061539 | |||
| 2226 | 2585294134 | |||
| 2227 | 2599741059 | |||
| 2228 | 2599748366 | |||
| 2229 | 2600210278 | |||
| 2230 | 2600813817 | |||
| 2231 | 2643792050 | |||
| 2232 | 2643980687 | |||
| 2233 | 2644122111 | |||
| 2234 | 2644216469 | |||
| 2235 | 2676745797 | |||
| 2236 | 2713478596 | |||
| 2237 | 2719641665 | |||
| 2238 | 2723879652 | |||
| 2239 | 2738824012 | |||
| 2240 | 2738836403 | |||
| 2241 | 2738877933 | |||
| 2242 | 2739189639 | |||
| 2243 | 2739224526 | |||
| 2244 | 2739612183 | |||
| 2245 | 2746087241 | |||
| 2246 | 2746093252 | |||
| 2247 | 2753566184 | |||
| 2248 | 2792837079 | |||
| 2249 | 2809031996 | |||
| 2250 | 2817259722 | |||
| 2251 | 2817277391 | |||
| 2252 | 2817453557 | |||
| 2253 | 2819624180 | |||
| 2254 | 2819636812 | |||
| 2255 | 2842332172 | |||
| 2256 | 2842356376 | |||
| 2257 | 2842461270 | |||
| 2258 | 2855734606 | |||
| 2259 | 2855770196 | |||
| 2260 | 2856289391 | |||
| 2261 | 2857362263 | |||
| 2262 | 2857538479 | |||
| 2263 | 2857578707 | |||
| 2264 | 2858955747 | |||
| 2265 | 2863426480 | |||
| 2266 | 2870069386 | |||
| 2267 | 2881414417 | |||
| 2268 | 2881930281 | |||
| 2269 | 2883091421 | |||
| 2270 | 2885197017 | |||
| 2271 | 2885272375 | |||
| 2272 | 2887377881 | |||
| 2273 | 2894514503 | |||
| 2274 | 2900637084 | |||
| 2275 | 2902686693 | |||
| 2276 | 2904481617 | |||
| 2277 | 2904490130 | |||
| 2278 | 2904569356 | |||
| 2279 | 2904576807 | |||
| 2280 | 2904624850 | |||
| 2281 | 2919533299 | |||
| 2282 | 2920114129 | |||
| 2283 | 2921651544 | |||
| 2284 | 2928114195 | |||
| 2285 | 2928141057 | |||
| 2286 | 2928163065 | |||
| 2287 | 2928170185 | |||
| 2288 | 2928176321 | |||
| 2289 | 2928509190 | |||
| 2290 | 2928542033 | |||
| 2291 | 2941481921 | |||
| 2292 | 2945934552 | |||
| 2293 | 2974322330 | |||
| 2294 | 2981996088 | |||
| 2295 | 2989393450 | |||
| 2296 | 2990704890 | |||
| 2297 | 642426554 | |||
| 2298 | 642419614 | |||
| 2299 | 642594600 | |||
| 2300 | 642623188 | |||
| 2301 | 8003956804 | |||
| 2302 | 8018847945 | |||
| 2303 | 8020813933 | |||
| 2304 | 8020939031 | |||
| 2305 | 8020947746 | |||
| 2306 | 8020953422 | |||
| 2307 | 8021127529 | |||
| 2308 | 8039099679 | |||
| 2309 | 8040171510 | |||
| 2310 | 8040174124 | |||
| 2311 | 8048749758 | |||
| 2312 | 8055227955 | |||
| 2313 | 8055269439 | |||
| 2314 | 8055307399 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xdy-assembly7.cif.gz_G | structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor | 0.9597 | 66 | 327 |
| 1xdq-assembly3.cif.gz_C | structural and biochemical identification of a novel bacterial oxidoreductase | 0.9584 | 64 | 327 |
| 1xdy-assembly7.cif.gz_G | structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor | 0.9561 | 66 | 327 |
| 1xdq-assembly3.cif.gz_C | structural and biochemical identification of a novel bacterial oxidoreductase | 0.9548 | 64 | 327 |
| 2ca4-assembly1.cif.gz_A | sulfite dehydrogenase from starkeya novella mutant | 0.8387 | 109 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xdyH00 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9597 | 64 | 327 | 3.90.420.10 |
| 1xdyH00 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9561 | 64 | 327 | 3.90.420.10 |
| 2ca4A01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8387 | 109 | 269 | 3.90.420.10 |
| af_P96400_291_442_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8337 | 101 | 259 | 3.90.420.10 |
| af_P96400_291_442_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.7885 | 101 | 259 | 3.90.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A162C394-F1-model_v4 | Oxidoreductase molybdopterin-binding domain-containing protein | 0.9959 | 95 | 240 |
|
| AF-A0A7V8JR83-F1-model_v4 | Protein-methionine-sulfoxide reductase catalytic subunit MsrP | 0.9921 | 78 | 197 |
|
| AF-A0A0L8ELQ7-F1-model_v4 | deleted | 0.9918 | 64 | 331 |
|
| AF-A0A1Q3J469-F1-model_v4 | deleted | 0.9908 | 106 | 331 |
|
| AF-A0A7S1GSH0-F1-model_v4 | Oxidoreductase molybdopterin-binding domain-containing protein | 0.9901 | 110 | 279 |
|