F490960

General Info

Members Datasets Scaffolds Average Seq Length
1157 549 2314 324

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0077551|Ga0451577_0077551_1190_2326
Length 378
Sequence VLDVHGSSCATATPGKCCAKKSAVPAVRSALGQVYCAADATRKLWRRQTTKHHHRLQRHAMLIRRPADIAPSEITPQDVWRQRRTLVEAAAAAGLVGVAAPLAAQNPSAQKLAGKPSALSTMEKATPYKLVTEYCNYYEFGTDKEDPAQYAPKFLKPRPWSVMVEGEVRKPRRFDIEELIKLAPMEERVYRLRCVEAWSAVVPWVGYPLAELIKAVEPTGNAKFVEFTTLADPKQMPGMRSPVLQWPYTEGLRIDEAMHPLTLLTFGMYGEVLPHQNGAPLRIVVPWKYGFKSAKSLVRIRFVEKQPVNSWQRSAPQEYGFYSNVNPTVDHPRWSQATERRLGEEGGLFAKRRQTLMFNGYGDQVAALYAGLDLKKNY

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
261 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
262 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
263 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
264 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
265 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
269 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
270 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
271 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
272 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
273 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
274 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
291 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
295 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
299 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
305 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
306 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
307 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
308 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
309 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
310 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
322 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
330 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
331 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
332 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
333 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
334 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
335 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
336 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
337 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
343 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
344 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
345 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
346 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
353 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
354 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
355 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
356 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
357 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
358 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
359 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
365 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
366 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
367 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
368 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
369 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
370 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
371 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
372 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
373 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
374 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
375 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
395 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
396 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
409 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
410 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
411 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
412 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
413 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
414 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
420 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
421 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
422 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
423 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
424 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
425 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
426 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
427 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
428 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
429 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
430 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
431 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
432 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
433 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
434 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
435 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
436 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
437 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
438 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
441 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
442 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
443 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
444 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
445 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
446 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
447 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
448 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
449 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
450 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
451 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
452 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
453 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
454 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
455 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
456 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
457 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
458 2519103095 Burkholderia sp. KJ006 Isolate Nodule
459 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
460 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
461 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
462 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
463 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
464 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
465 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
466 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
467 2643221594 Achromobacter sp. Root170 Isolate Unclassified
468 2643221621 Achromobacter sp. Root83 Isolate Unclassified
469 2643221638 Duganella sp. Root336D2 Isolate Unclassified
470 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
471 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
472 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
473 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
474 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
475 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
476 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
477 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
478 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
479 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
480 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
481 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
482 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
483 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
484 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
485 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
486 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
487 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
488 2818991450 Burkholderia sp. 604 Isolate Unclassified
489 2818991452 Burkholderia cepacia 561 Isolate Unclassified
490 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
491 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
492 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
493 2855730933 Achromobacter sp. HZ28 Isolate Nodule
494 2855767633 Achromobacter sp. HZ34 Isolate Nodule
495 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
496 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
497 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
498 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
499 2858950400 Achromobacter sp. K91 Isolate Unclassified
500 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
501 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
502 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
503 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
504 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
505 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
506 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
507 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
508 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
509 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
510 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
511 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
512 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
513 2904564687 Burkholderia sp. 571 Isolate Unclassified
514 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
515 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
516 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
517 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
518 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
519 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
520 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
521 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
522 2928163908 Burkholderia sp. 567 Isolate Unclassified
523 2928170801 Burkholderia sp. 572 Isolate Unclassified
524 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
525 2928536128 Burkholderia sola 565 Isolate Unclassified
526 2941479691
527 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
528 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
529 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
530 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
531 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
532 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
533 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
534 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
535 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
536 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
537 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
538 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
539 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
540 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
541 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
542 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
543 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
544 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
545 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
546 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
547 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
548 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
549 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.8
Metatranscriptomes 0.95
Isolates 9.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 1.82
Rhizoplane 5.45
Rhizosphere 71.39
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0077551 3300042876 Bacteria 2963
2 JGI24740J21852_10002018 3300001979 Bacteria 9283
3 JGI24739J22299_10009031 3300001989 Bacteria 3718
4 JGI24739J22299_10017284 3300001989 Bacteria 2603
5 JGI24737J22298_10005658 3300001990 Bacteria 4302
6 JGI24735J21928_10000085 3300002067 Bacteria 35313
7 JGI24735J21928_10004844 3300002067 Bacteria 4492
8 JGI24735J21928_10011764 3300002067 Bacteria 2771
9 JGI24738J21930_10002515 3300002075 Bacteria 4768
10 JGI24738J21930_10020818 3300002075 Bacteria 1363
11 JGI25156J39149_1000689 3300002705 Bacteria 18133
12 JGI25156J39149_1001206 3300002705 Bacteria 11449
13 JGI25156J39149_1002465 3300002705 Bacteria 6618
14 JGI25158J39367_1000659 3300002739 Bacteria 6743
15 JGI25158J39367_1001247 3300002739 Bacteria 4554
16 JGI25152J39213_1000374 3300002773 Bacteria 27497
17 JGI25152J39213_1008045 3300002773 Bacteria 2658
18 JGI25150J39212_1001208 3300002774 Bacteria 7633
19 JGI25159J45721_1003647 3300002987 Bacteria 5355
20 JGI25159J45721_1004025 3300002987 Bacteria 5003
21 JGI25165J46597_1001697 3300003214 Bacteria 9917
22 JGI25153J46596_10007042 3300003215 Bacteria 5598
23 rootL2_10024836 3300003322 Bacteria 2477
24 JGI25160J50197_1000302 3300003354 Bacteria 34832
25 JGI25160J50197_1002726 3300003354 Bacteria 8111
26 JGI25161J50226_1001059 3300003374 Bacteria 9420
27 JGI25161J50226_1002290 3300003374 Bacteria 5002
28 JGI25161J50226_1011659 3300003374 Bacteria 1093
29 Ga0055533_1000360 3300003756 Bacteria 19276
30 Ga0055533_1000655 3300003756 Bacteria 11575
31 Ga0055532_1000261 3300003758 Bacteria 35339
32 Ga0055532_1001452 3300003758 Bacteria 6586
33 Ga0055532_1001513 3300003758 Bacteria 6360
34 Ga0055527_1000035 3300003760 Bacteria 138481
35 Ga0055527_1000856 3300003760 Bacteria 7968
36 Ga0055527_1001087 3300003760 Bacteria 6380
37 Ga0055535_1000050 3300003761 Bacteria 138481
38 Ga0055535_1002077 3300003761 Bacteria 7992
39 Ga0055535_1002081 3300003761 Bacteria 7968
40 Ga0055542_1000512 3300003762 Bacteria 35339
41 Ga0055542_1001196 3300003762 Bacteria 14764
42 Ga0055529_1000089 3300003763 Bacteria 138481
43 Ga0055529_1000604 3300003763 Bacteria 27748
44 Ga0055529_1001042 3300003763 Bacteria 13011
45 Ga0055526_1011470 3300003771 Bacteria 3985
46 Ga0055526_1013864 3300003771 Bacteria 3368
47 Ga0055537_1008962 3300003773 Bacteria 2253
48 Ga0055537_1012058 3300003773 Bacteria 1708
49 Ga0055524_1003357 3300003775 Bacteria 7803
50 Ga0055524_1004910 3300003775 Bacteria 6069
51 Ga0055524_1037368 3300003775 Bacteria 1289
52 Ga0055534_1008099 3300003784 Bacteria 2420
53 Ga0055528_1000489 3300003790 Bacteria 31350
54 Ga0055528_1002787 3300003790 Bacteria 9155
55 Ga0055530_10005313 3300003791 Bacteria 6176
56 Ga0055530_10008910 3300003791 Bacteria 3939
57 Ga0055530_10015201 3300003791 Bacteria 2527
58 Ga0055531_10013481 3300003794 Bacteria 3763
59 Ga0055531_10025971 3300003794 Bacteria 2105
60 Ga0058692_1001156 3300003856 Bacteria 10178
61 Ga0055543_1001828 3300004625 Bacteria 7795
62 Ga0055543_1002861 3300004625 Bacteria 5438
63 Ga0058863_11081137 3300004799 Bacteria 1373
64 Ga0065165_1000116 3300005262 Bacteria 134997
65 Ga0065165_1000885 3300005262 Bacteria 38659
66 Ga0065165_1001236 3300005262 Bacteria 29209
67 Ga0065165_1004323 3300005262 Bacteria 8933
68 Ga0065707_10083199 3300005295 Bacteria 10049
69 Ga0065707_10084693 3300005295 Bacteria 6879
70 Ga0070658_10009293 3300005327 Bacteria 7906
71 Ga0070658_10033857 3300005327 Bacteria 4111
72 Ga0070658_10038504 3300005327 Bacteria 3855
73 Ga0070676_10023216 3300005328 Bacteria 3485
74 Ga0070683_100003232 3300005329 Bacteria 13160
75 Ga0070683_100374838 3300005329 Bacteria 1356
76 Ga0070690_100039763 3300005330 Bacteria 2972
77 Ga0070690_100091732 3300005330 Bacteria 2002
78 Ga0070670_100006399 3300005331 Bacteria 9968
79 Ga0070677_10053864 3300005333 Bacteria 1637
80 Ga0070666_10038195 3300005335 Bacteria 3194
81 Ga0070666_10082621 3300005335 Bacteria 2197
82 Ga0068868_100012023 3300005338 Bacteria 6319
83 Ga0070660_100000025 3300005339 Bacteria 90277
84 Ga0070660_100108133 3300005339 Bacteria 2210
85 Ga0070689_100029665 3300005340 Bacteria 4143
86 Ga0070689_100034639 3300005340 Bacteria 3852
87 Ga0070689_100169861 3300005340 Bacteria 1766
88 Ga0070689_100288155 3300005340 Bacteria 1364
89 Ga0070687_100030188 3300005343 Bacteria 2648
90 Ga0070661_100026438 3300005344 Bacteria 4175
91 Ga0070668_100036411 3300005347 Bacteria 3756
92 Ga0070669_100068433 3300005353 Bacteria 2621
93 Ga0070669_100079362 3300005353 Bacteria 2441
94 Ga0070669_100095083 3300005353 Bacteria 2240
95 Ga0070669_100144902 3300005353 Bacteria 1834
96 Ga0070669_100242409 3300005353 Bacteria 1433
97 Ga0070675_100033527 3300005354 Bacteria 4164
98 Ga0070671_100004031 3300005355 Bacteria 11577
99 Ga0070671_100195504 3300005355 Bacteria 1715
100 Ga0070673_100038632 3300005364 Bacteria 3646
101 Ga0070673_100066412 3300005364 Bacteria 2881
102 Ga0070688_100001291 3300005365 Bacteria 12481
103 Ga0070659_100000426 3300005366 Bacteria 31940
104 Ga0070659_100002895 3300005366 Bacteria 12221
105 Ga0070667_100032917 3300005367 Bacteria 4327
106 Ga0070709_10013919 3300005434 Bacteria 4535
107 Ga0070711_100053406 3300005439 Bacteria 2784
108 Ga0070700_100076525 3300005441 Bacteria 2149
109 Ga0070663_100109268 3300005455 Bacteria 2076
110 Ga0070663_100267476 3300005455 Bacteria 1358
111 Ga0070678_100080861 3300005456 Bacteria 2462
112 Ga0070678_100176032 3300005456 Bacteria 1747
113 Ga0070662_100009064 3300005457 Bacteria 6493
114 Ga0070681_10062438 3300005458 Bacteria 3699
115 Ga0070681_10237202 3300005458 Bacteria 1737
116 Ga0068867_100083347 3300005459 Bacteria 2414
117 Ga0070685_10009316 3300005466 Bacteria 5067
118 Ga0070706_100001854 3300005467 Bacteria 21867
119 Ga0070707_100236999 3300005468 Bacteria 1776
120 Ga0070699_100154327 3300005518 Bacteria 2032
121 Ga0070679_100124324 3300005530 Bacteria 2563
122 Ga0070679_100282264 3300005530 Bacteria 1613
123 Ga0070684_100003023 3300005535 Bacteria 12534
124 Ga0070684_100615587 3300005535 Bacteria 1010
125 Ga0068853_100446285 3300005539 Bacteria 1216
126 Ga0070672_100049328 3300005543 Bacteria 3275
127 Ga0070672_100049386 3300005543 Bacteria 3273
128 Ga0070686_100128165 3300005544 Bacteria 1752
129 Ga0070695_100193643 3300005545 Bacteria 1449
130 Ga0070695_100248673 3300005545 Bacteria 1293
131 Ga0070693_100019782 3300005547 Bacteria 3538
132 Ga0070665_100000660 3300005548 Bacteria 46496
133 Ga0070665_100013780 3300005548 Bacteria 8134
134 Ga0070665_100017631 3300005548 Bacteria 7171
135 Ga0070665_100357639 3300005548 Bacteria 1466
136 Ga0068855_100008244 3300005563 Bacteria 12596
137 Ga0068855_100034453 3300005563 Bacteria 6038
138 Ga0068855_100089624 3300005563 Bacteria 3551
139 Ga0070664_100018275 3300005564 Bacteria 5755
140 Ga0070664_100254947 3300005564 Bacteria 1578
141 Ga0068857_100066745 3300005577 Bacteria 3202
142 Ga0068856_100005075 3300005614 Bacteria 13030
143 Ga0070702_100248186 3300005615 Bacteria 1205
144 Ga0068852_100016015 3300005616 Bacteria 5837
145 Ga0068859_100237201 3300005617 Bacteria 1913
146 Ga0068866_10011754 3300005718 Bacteria 3798
147 Ga0068861_100000476 3300005719 Bacteria 23317
148 Ga0068861_100001522 3300005719 Bacteria 14683
149 Ga0068870_10004878 3300005840 Bacteria 5804
150 Ga0068870_10020377 3300005840 Bacteria 3228
151 Ga0068863_100059350 3300005841 Bacteria 3619
152 Ga0068863_100449940 3300005841 Bacteria 1264
153 Ga0068858_100176531 3300005842 Bacteria 2016
154 Ga0068860_100059231 3300005843 Bacteria 3641
155 Ga0068860_100194900 3300005843 Bacteria 1962
156 Ga0068862_100000987 3300005844 Bacteria 27217
157 Ga0075368_10013182 3300006042 Bacteria 3033
158 Ga0075364_10001271 3300006051 Bacteria 13570
159 Ga0070716_100185489 3300006173 Bacteria 1370
160 Ga0075367_10062286 3300006178 Bacteria 2228
161 Ga0075366_10044507 3300006195 Bacteria 2631
162 Ga0097621_100006113 3300006237 Bacteria 8523
163 Ga0097621_100309656 3300006237 Bacteria 1397
164 Ga0075428_100000668 3300006844 Bacteria 35236
165 Ga0075428_100012845 3300006844 Bacteria 9319
166 Ga0075428_100214215 3300006844 Bacteria 2081
167 Ga0075428_100254919 3300006844 Bacteria 1890
168 Ga0075428_100334827 3300006844 Bacteria 1626
169 Ga0075430_100003515 3300006846 Bacteria 13111
170 Ga0075430_100023748 3300006846 Bacteria 5222
171 Ga0075430_100046030 3300006846 Bacteria 3684
172 Ga0075430_100047463 3300006846 Bacteria 3627
173 Ga0075431_100010835 3300006847 Bacteria 9169
174 Ga0075431_100013304 3300006847 Bacteria 8316
175 Ga0075431_100028254 3300006847 Bacteria 5760
176 Ga0075431_100279102 3300006847 Bacteria 1692
177 Ga0075431_100332354 3300006847 Bacteria 1530
178 Ga0075434_100061116 3300006871 Bacteria 3747
179 Ga0075429_100013404 3300006880 Bacteria 7108
180 Ga0075429_100066056 3300006880 Bacteria 3149
181 Ga0068865_100076214 3300006881 Bacteria 2393
182 Ga0075436_100016767 3300006914 Bacteria 5014
183 Ga0075436_100056897 3300006914 Bacteria 2701
184 Ga0097620_100237207 3300006931 Bacteria 1913
185 Ga0099794_10015598 3300007265 Bacteria 3358
186 Ga0099795_10076636 3300007788 Bacteria 1271
187 Ga0105251_10000422 3300009011 Bacteria 41157
188 Ga0105251_10001215 3300009011 Bacteria 22270
189 Ga0105251_10043445 3300009011 Bacteria 2176
190 Ga0105244_10042907 3300009036 Bacteria 2336
191 Ga0105250_10000006 3300009092 Bacteria 390071
192 Ga0105250_10008008 3300009092 Bacteria 4507
193 Ga0105240_10002542 3300009093 Bacteria 29256
194 Ga0105240_10003657 3300009093 Bacteria 23805
195 Ga0105240_10008032 3300009093 Bacteria 15186
196 Ga0105240_10044011 3300009093 Bacteria 5676
197 Ga0105240_10060442 3300009093 Bacteria 4724
198 Ga0105240_10086152 3300009093 Bacteria 3847
199 Ga0105240_10107666 3300009093 Bacteria 3379
200 Ga0111539_10004402 3300009094 Bacteria 18415
201 Ga0111539_10020994 3300009094 Bacteria 8041
202 Ga0105245_10015862 3300009098 Bacteria 6564
203 Ga0105245_10127450 3300009098 Bacteria 2384
204 Ga0114129_10002340 3300009147 Bacteria 26307
205 Ga0114129_10350121 3300009147 Bacteria 1957
206 Ga0105243_10467640 3300009148 Bacteria 1187
207 Ga0105241_10008245 3300009174 Bacteria 7674
208 Ga0105242_10118974 3300009176 Bacteria 2264
209 Ga0105242_10221195 3300009176 Bacteria 1692
210 Ga0105242_10235707 3300009176 Bacteria 1642
211 Ga0105248_10001770 3300009177 Bacteria 24034
212 Ga0105248_10058727 3300009177 Bacteria 4320
213 Ga0105248_10093341 3300009177 Bacteria 3389
214 Ga0105248_10115448 3300009177 Bacteria 3028
215 Ga0105248_10222527 3300009177 Bacteria 2125
216 Ga0105248_10572444 3300009177 Bacteria 1274
217 Ga0105237_10000806 3300009545 Bacteria 42774
218 Ga0105237_10015030 3300009545 Bacteria 8066
219 Ga0105237_10206678 3300009545 Bacteria 1964
220 Ga0105237_10222133 3300009545 Bacteria 1889
221 Ga0105238_10023771 3300009551 Bacteria 6247
222 Ga0105238_10136996 3300009551 Bacteria 2426
223 Ga0105238_10138000 3300009551 Bacteria 2416
224 Ga0105238_10275361 3300009551 Bacteria 1664
225 Ga0105249_10000932 3300009553 Bacteria 25858
226 Ga0105249_10410807 3300009553 Bacteria 1386
227 Ga0105249_10467951 3300009553 Bacteria 1302
228 Ga0105239_10000292 3300010375 Bacteria 73809
229 Ga0105239_10265140 3300010375 Bacteria 1931
230 Ga0157370_10004409 3300013104 Bacteria 16142
231 Ga0157370_10170975 3300013104 Bacteria 2020
232 Ga0157369_10000147 3300013105 Bacteria 100084
233 Ga0157369_10001132 3300013105 Bacteria 33339
234 Ga0157369_10150467 3300013105 Bacteria 2460
235 Ga0157369_10286170 3300013105 Bacteria 1716
236 Ga0157374_10000117 3300013296 Bacteria 73027
237 Ga0157374_10089701 3300013296 Bacteria 2930
238 Ga0157374_10162633 3300013296 Bacteria 2174
239 Ga0157378_10000848 3300013297 Bacteria 28318
240 Ga0157378_10051905 3300013297 Bacteria 3648
241 Ga0163162_10001267 3300013306 Bacteria 23605
242 Ga0163162_10250959 3300013306 Bacteria 1901
243 Ga0157375_10116663 3300013308 Bacteria 2774
244 Ga0163163_10358215 3300014325 Bacteria 1515
245 Ga0163163_10415122 3300014325 Bacteria 1405
246 Ga0157380_10002130 3300014326 Bacteria 13288
247 Ga0157379_10000337 3300014968 Bacteria 37644
248 Ga0157379_10080167 3300014968 Bacteria 2924
249 Ga0157379_10086887 3300014968 Bacteria 2804
250 Ga0157376_10006374 3300014969 Bacteria 8334
251 Ga0182005_1015683 3300015265 Bacteria 2112
252 Ga0183361_10015 3300016635 Bacteria 166772
253 Ga0163161_10144592 3300017792 Bacteria 1803
254 Ga0163161_10313658 3300017792 Bacteria 1238
255 Ga0197907_10170016 3300020069 Bacteria 1576
256 Ga0206356_10440101 3300020070 Bacteria 2817
257 Ga0206355_1192289 3300020076 Bacteria 1203
258 Ga0206350_11042565 3300020080 Bacteria 1281
259 Ga0206354_10161165 3300020081 Bacteria 3640
260 Ga0206354_11326690 3300020081 Bacteria 2351
261 Ga0206353_10230299 3300020082 Bacteria 2431
262 Ga0213872_10000031 3300021361 Bacteria 139321
263 Ga0213872_10000373 3300021361 Bacteria 37639
264 Ga0213872_10000561 3300021361 Bacteria 28726
265 Ga0213872_10002125 3300021361 Bacteria 11924
266 Ga0213872_10003375 3300021361 Bacteria 8887
267 Ga0213872_10003455 3300021361 Bacteria 8780
268 Ga0213872_10004304 3300021361 Bacteria 7604
269 Ga0213872_10012950 3300021361 Bacteria 3913
270 Ga0213872_10014710 3300021361 Bacteria 3646
271 Ga0213872_10020644 3300021361 Bacteria 3036
272 Ga0213872_10029298 3300021361 Bacteria 2524
273 Ga0213872_10070218 3300021361 Bacteria 1579
274 Ga0213872_10086200 3300021361 Bacteria 1407
275 Ga0213872_10111107 3300021361 Bacteria 1217
276 Ga0224712_10000271 3300022467 Bacteria 9519
277 Ga0224712_10022673 3300022467 Bacteria 2168
278 Ga0209436_100369 3300025208 Bacteria 20349
279 Ga0209436_100434 3300025208 Bacteria 18696
280 Ga0209436_101159 3300025208 Bacteria 9727
281 Ga0209566_100901 3300025225 Bacteria 14198
282 Ga0209674_100153 3300025226 Bacteria 94333
283 Ga0209674_100272 3300025226 Bacteria 39275
284 Ga0209674_101734 3300025226 Bacteria 5357
285 Ga0209672_100054 3300025228 Bacteria 222217
286 Ga0209672_100072 3300025228 Bacteria 167942
287 Ga0209672_100073 3300025228 Bacteria 166621
288 Ga0209672_102717 3300025228 Bacteria 4104
289 Ga0209147_100093 3300025229 Bacteria 167196
290 Ga0209147_100100 3300025229 Bacteria 162747
291 Ga0209147_100328 3300025229 Bacteria 35916
292 Ga0209147_100445 3300025229 Bacteria 26092
293 Ga0207427_101410 3300025231 Bacteria 8783
294 Ga0209258_100140 3300025242 Bacteria 167245
295 Ga0209258_100579 3300025242 Bacteria 30754
296 Ga0209258_100581 3300025242 Bacteria 30706
297 Ga0207425_1000021 3300025245 Bacteria 367537
298 Ga0207425_1000223 3300025245 Bacteria 44555
299 Ga0209026_1002417 3300025250 Bacteria 7028
300 Ga0209148_1000119 3300025254 Bacteria 188079
301 Ga0209148_1000140 3300025254 Bacteria 166819
302 Ga0209148_1001759 3300025254 Bacteria 9336
303 Ga0209759_1000281 3300025256 Bacteria 71594
304 Ga0209759_1000928 3300025256 Bacteria 21225
305 Ga0209759_1005226 3300025256 Bacteria 4612
306 Ga0209759_1008317 3300025256 Bacteria 3246
307 Ga0209129_1000020 3300025258 Bacteria 457053
308 Ga0209129_1003091 3300025258 Bacteria 7493
309 Ga0209233_1000173 3300025261 Bacteria 145995
310 Ga0209565_1000536 3300025263 Bacteria 26563
311 Ga0209565_1000770 3300025263 Bacteria 18696
312 Ga0209565_1004827 3300025263 Bacteria 4025
313 Ga0209565_1004922 3300025263 Bacteria 3979
314 Ga0209565_1009668 3300025263 Bacteria 2431
315 Ga0209455_1000125 3300025272 Bacteria 166819
316 Ga0209455_1000244 3300025272 Bacteria 67136
317 Ga0209455_1000849 3300025272 Bacteria 16329
318 Ga0209673_1000098 3300025273 Bacteria 193352
319 Ga0209673_1012788 3300025273 Bacteria 3357
320 Ga0209130_1002175 3300025284 Bacteria 10331
321 Ga0209130_1003597 3300025284 Bacteria 6459
322 Ga0209675_1000650 3300025291 Bacteria 24546
323 Ga0209675_1003924 3300025291 Bacteria 6820
324 Ga0209675_1004802 3300025291 Bacteria 5870
325 Ga0209564_1000780 3300025295 Bacteria 44199
326 Ga0209564_1003850 3300025295 Bacteria 9683
327 Ga0209564_1010880 3300025295 Bacteria 4139
328 Ga0209564_1013058 3300025295 Bacteria 3559
329 Ga0209758_1000077 3300025297 Bacteria 268195
330 Ga0209050_1000050 3300025298 Bacteria 362578
331 Ga0209050_1000795 3300025298 Bacteria 44648
332 Ga0209050_1007586 3300025298 Bacteria 6032
333 Ga0209256_1000674 3300025299 Bacteria 46225
334 Ga0209256_1001001 3300025299 Bacteria 33573
335 Ga0209256_1014402 3300025299 Bacteria 2848
336 Ga0207426_1000199 3300025302 Bacteria 145826
337 Ga0207426_1002770 3300025302 Bacteria 10561
338 Ga0207426_1003789 3300025302 Bacteria 7847
339 Ga0209051_1024272 3300025303 Bacteria 2497
340 Ga0209257_1000075 3300025304 Bacteria 324855
341 Ga0209257_1012663 3300025304 Bacteria 3865
342 Ga0207656_10015465 3300025321 Unclassified 2953
343 Ga0207696_1000069 3300025711 Bacteria 227744
344 Ga0207713_1000473 3300025735 Bacteria 41885
345 Ga0207713_1011443 3300025735 Bacteria 4823
346 Ga0207680_10078739 3300025903 Bacteria 2065
347 Ga0207647_10000884 3300025904 Bacteria 23255
348 Ga0207647_10011496 3300025904 Bacteria 6206
349 Ga0207647_10023305 3300025904 Bacteria 4095
350 Ga0207647_10036201 3300025904 Bacteria 3137
351 Ga0207647_10068522 3300025904 Bacteria 2148
352 Ga0207645_10005863 3300025907 Bacteria 8850
353 Ga0207645_10012127 3300025907 Bacteria 5856
354 Ga0207645_10104751 3300025907 Bacteria 1827
355 Ga0207643_10016060 3300025908 Bacteria 4079
356 Ga0207643_10023434 3300025908 Bacteria 3403
357 Ga0207705_10002472 3300025909 Bacteria 14240
358 Ga0207705_10039734 3300025909 Bacteria 3373
359 Ga0207705_10091658 3300025909 Bacteria 2226
360 Ga0207684_10003995 3300025910 Bacteria 14112
361 Ga0207684_10129406 3300025910 Bacteria 2166
362 Ga0207695_10002160 3300025913 Bacteria 29752
363 Ga0207695_10004507 3300025913 Bacteria 18963
364 Ga0207695_10010060 3300025913 Bacteria 11616
365 Ga0207695_10109457 3300025913 Bacteria 2745
366 Ga0207695_10117465 3300025913 Bacteria 2632
367 Ga0207695_10149502 3300025913 Bacteria 2276
368 Ga0207695_10266745 3300025913 Unclassified 1608
369 Ga0207662_10037189 3300025918 Bacteria 2848
370 Ga0207657_10000065 3300025919 Bacteria 98751
371 Ga0207657_10176219 3300025919 Bacteria 1730
372 Ga0207649_10050277 3300025920 Bacteria 2578
373 Ga0207681_10009993 3300025923 Bacteria 5807
374 Ga0207681_10024175 3300025923 Bacteria 3897
375 Ga0207681_10063461 3300025923 Bacteria 2547
376 Ga0207694_10049326 3300025924 Bacteria 3259
377 Ga0207694_10096452 3300025924 Bacteria 2338
378 Ga0207694_10217460 3300025924 Bacteria 1558
379 Ga0207694_10251506 3300025924 Bacteria 1446
380 Ga0207650_10176304 3300025925 Bacteria 1701
381 Ga0207659_10006052 3300025926 Bacteria 7385
382 Ga0207687_10010398 3300025927 Bacteria 6080
383 Ga0207687_10062424 3300025927 Bacteria 2635
384 Ga0207700_10252302 3300025928 Bacteria 1507
385 Ga0207690_10000040 3300025932 Bacteria 130300
386 Ga0207706_10012447 3300025933 Bacteria 7751
387 Ga0207706_10196415 3300025933 Bacteria 1770
388 Ga0207670_10065604 3300025936 Bacteria 2492
389 Ga0207670_10274235 3300025936 Bacteria 1312
390 Ga0207665_10026036 3300025939 Bacteria 3860
391 Ga0207665_10462882 3300025939 Bacteria 975
392 Ga0207691_10003458 3300025940 Bacteria 15365
393 Ga0207691_10056855 3300025940 Bacteria 3562
394 Ga0207711_10004182 3300025941 Bacteria 12359
395 Ga0207711_10007645 3300025941 Bacteria 9040
396 Ga0207711_10101453 3300025941 Bacteria 2547
397 Ga0207711_10247003 3300025941 Bacteria 1637
398 Ga0207661_10223831 3300025944 Bacteria 1664
399 Ga0207679_10158804 3300025945 Bacteria 1849
400 Ga0207667_10002770 3300025949 Bacteria 21687
401 Ga0207667_10007228 3300025949 Bacteria 13400
402 Ga0207651_10000299 3300025960 Bacteria 21268
403 Ga0207651_10085542 3300025960 Bacteria 2288
404 Ga0207712_10003324 3300025961 Bacteria 10195
405 Ga0207712_10452111 3300025961 Bacteria 1089
406 Ga0207668_10159205 3300025972 Bacteria 1757
407 Ga0207678_10002359 3300026067 Bacteria 17124
408 Ga0207678_10021510 3300026067 Bacteria 5656
409 Ga0207678_10066655 3300026067 Bacteria 3091
410 Ga0207708_10007971 3300026075 Bacteria 7848
411 Ga0207708_10037895 3300026075 Bacteria 3673
412 Ga0207702_10230241 3300026078 Bacteria 1731
413 Ga0207641_10035820 3300026088 Bacteria 4138
414 Ga0207648_10018611 3300026089 Bacteria 6284
415 Ga0207648_10025670 3300026089 Bacteria 5245
416 Ga0207674_10039350 3300026116 Bacteria 4902
417 Ga0207675_100002950 3300026118 Bacteria 16726
418 Ga0207675_100025458 3300026118 Bacteria 5508
419 Ga0207675_100040413 3300026118 Bacteria 4356
420 Ga0207675_100198935 3300026118 Bacteria 1924
421 Ga0207675_100415533 3300026118 Bacteria 1328
422 Ga0207675_100773829 3300026118 Bacteria 972
423 Ga0207683_10099306 3300026121 Bacteria 2598
424 Ga0207683_10119170 3300026121 Bacteria 2368
425 Ga0207683_10133739 3300026121 Bacteria 2232
426 Ga0207698_10018564 3300026142 Bacteria 4742
427 Ga0209371_1000325 3300027312 Bacteria 52216
428 Ga0209371_1000766 3300027312 Bacteria 26728
429 Ga0209371_1004858 3300027312 Bacteria 5626
430 Ga0209971_1037991 3300027682 Bacteria 1159
431 Ga0209813_10062220 3300027866 Bacteria 1194
432 Ga0207428_10031694 3300027907 Bacteria 4357
433 Ga0268266_10000630 3300028379 Bacteria 47949
434 Ga0268266_10142463 3300028379 Bacteria 2152
435 Ga0268266_10338010 3300028379 Bacteria 1413
436 Ga0265334_10000192 3300028573 Bacteria 35702
437 Ga0265318_10004269 3300028577 Bacteria 6965
438 Ga0307515_10000062 3300028794 Bacteria 247284
439 Ga0307515_10011102 3300028794 Bacteria 17134
440 Ga0307515_10063273 3300028794 Bacteria 5202
441 Ga0265338_10028960 3300028800 Bacteria 5506
442 Ga0265338_10032666 3300028800 Bacteria 5067
443 Ga0268256_1006955 3300030500 Bacteria 4124
444 Ga0268256_1013276 3300030500 Bacteria 2506
445 Ga0265330_10014351 3300031235 Bacteria 3676
446 Ga0265328_10004474 3300031239 Bacteria 6073
447 Ga0265325_10026335 3300031241 Bacteria 3150
448 Ga0265325_10079571 3300031241 Unclassified 1631
449 Ga0265339_10020277 3300031249 Bacteria 3886
450 Ga0265331_10005565 3300031250 Bacteria 7586
451 Ga0265327_10025641 3300031251 Bacteria 3432
452 Ga0265327_10042408 3300031251 Bacteria 2443
453 Ga0265316_10015358 3300031344 Bacteria 6698
454 Ga0265316_10050777 3300031344 Bacteria 3260
455 Ga0307513_10017125 3300031456 Bacteria 8704
456 Ga0307513_10258902 3300031456 Bacteria 1531
457 Ga0307509_10000781 3300031507 Bacteria 54552
458 Ga0307509_10140386 3300031507 Bacteria 2353
459 Ga0307408_100000531 3300031548 Bacteria 32967
460 Ga0307408_100006732 3300031548 Bacteria 7619
461 Ga0307408_100015316 3300031548 Bacteria 5105
462 Ga0307408_100025974 3300031548 Bacteria 4016
463 Ga0307408_100049899 3300031548 Bacteria 3007
464 Ga0307408_100223034 3300031548 Bacteria 1539
465 Ga0265313_10009218 3300031595 Bacteria 6435
466 Ga0265314_10051139 3300031711 Bacteria 2879
467 Ga0265314_10215541 3300031711 Bacteria 1124
468 Ga0265342_10036360 3300031712 Bacteria 3009
469 Ga0307516_10102046 3300031730 Bacteria 2684
470 Ga0307405_10228874 3300031731 Bacteria 1369
471 Ga0307518_10017517 3300031838 Bacteria 5136
472 Ga0307412_10000056 3300031911 Bacteria 145861
473 Ga0307412_10000313 3300031911 Bacteria 30726
474 Ga0307409_100183810 3300031995 Bacteria 1853
475 Ga0307416_100003671 3300032002 Bacteria 9084
476 Ga0307416_100006357 3300032002 Bacteria 7387
477 Ga0307416_100037534 3300032002 Bacteria 3729
478 Ga0307411_10083184 3300032005 Bacteria 2210
479 Ga0307415_100236031 3300032126 Bacteria 1476
480 Ga0316593_10013988 3300032168 Bacteria 2385
481 Ga0373923_0057757 3300035111 Bacteria 1641
482 Ga0373954_0003620 3300035118 Bacteria 6575
483 Ga0373954_0073056 3300035118 Bacteria 1632
484 Ga0373956_0112634 3300035119 Bacteria 1267
485 Ga0373957_0021631 3300035120 Bacteria 2285
486 Ga0373931_0122600 3300035691 Bacteria 1487
487 Ga0373935_0034565 3300035692 Bacteria 3151
488 Ga0373927_0056620 3300035695 Bacteria 2535
489 Ga0373927_0135245 3300035695 Bacteria 1611
490 Ga0373947_0012484 3300035725 Bacteria 4871
491 Ga0373937_0144790 3300036401 Bacteria 2224
492 Ga0373937_0203611 3300036401 Bacteria 1861
493 Ga0316582_0049440 3300036647 Bacteria 2660
494 Ga0373925_0376705 3300037068 Bacteria 1155
495 Ga0395899_0000080 3300037312 Bacteria 171568
496 Ga0395900_0000087 3300037418 Bacteria 171568
497 Ga0395900_0000556 3300037418 Bacteria 51857
498 Ga0395900_0001157 3300037418 Bacteria 33062
499 Ga0395900_0061736 3300037418 Bacteria 3853
500 Ga0395900_0299986 3300037418 Bacteria 1593
501 Ga0395898_0000448 3300037466 Bacteria 84953
502 Ga0395898_0000800 3300037466 Bacteria 53180
503 Ga0395905_0000117 3300037471 Bacteria 133291
504 Ga0395905_0001371 3300037471 Bacteria 29596
505 Ga0395905_0020972 3300037471 Bacteria 6187
506 Ga0395905_0034300 3300037471 Bacteria 4765
507 Ga0395905_0050883 3300037471 Bacteria 3880
508 Ga0395905_0385273 3300037471 Bacteria 1296
509 Ga0395901_0487379 3300038443 Bacteria 1257
510 Ga0400487_28356 3300039110 Bacteria 15581
511 Ga0436365_1278966 3300039437 Bacteria 3413
512 Ga0436360_1136634 3300039438 Bacteria 3281
513 Ga0436361_0025205 3300039447 Bacteria 5639
514 Ga0436361_0044305 3300039447 Bacteria 5584
515 Ga0436361_0049092 3300039447 Bacteria 9990
516 Ga0436361_0209856 3300039447 Bacteria 2492
517 Ga0436361_0250234 3300039447 Bacteria 2046
518 Ga0436361_0297903 3300039447 Bacteria 12260
519 Ga0436361_0433430 3300039447 Bacteria 1519
520 Ga0436361_0470837 3300039447 Bacteria 7008
521 Ga0436361_0580915 3300039447 Bacteria 36900
522 Ga0436361_0839867 3300039447 Bacteria 2582
523 Ga0436361_0913791 3300039447 Bacteria 99691
524 Ga0436361_0956051 3300039447 Bacteria 16278
525 Ga0436361_1020767 3300039447 Bacteria 3421
526 Ga0436361_1101895 3300039447 Bacteria 3286
527 Ga0436361_1180414 3300039447 Bacteria 13143
528 Ga0436361_1190118 3300039447 Bacteria 41161
529 Ga0439436_0000549 3300041404 Bacteria 9884
530 Ga0439465_0004524 3300041413 Bacteria 4495
531 Ga0451797_0505633 3300041453 Bacteria 2027
532 Ga0451833_1218993 3300041491 Bacteria 1960
533 Ga0451845_0311299 3300041501 Bacteria 1462
534 Ga0451853_2193203 3300041512 Bacteria 3472
535 Ga0439433_0001392 3300041999 Bacteria 4967
536 Ga0439445_0001193 3300042004 Bacteria 5588
537 Ga0439432_002821 3300042006 Bacteria 6480
538 Ga0439449_0003939 3300042007 Bacteria 5753
539 Ga0439452_001555 3300042010 Bacteria 9199
540 Ga0450920_022606 3300042122 Bacteria 1218
541 Ga0439446_0018853 3300042156 Bacteria 1937
542 Ga0450918_000029 3300042531 Bacteria 30016
543 Ga0451577_0000096 3300042876 Bacteria 195129
544 Ga0451577_0000256 3300042876 Bacteria 104951
545 Ga0451577_0001289 3300042876 Bacteria 34481
546 Ga0451577_0003168 3300042876 Bacteria 18532
547 Ga0451577_0005291 3300042876 Bacteria 13266
548 Ga0451577_0007875 3300042876 Bacteria 10417
549 Ga0451577_0037915 3300042876 Bacteria 4337
550 Ga0451577_0066410 3300042876 Bacteria 3218
551 Ga0451577_0075027 3300042876 Bacteria 3016
552 Ga0451577_0288103 3300042876 Bacteria 1488
553 Ga0466969_0001645 3300044656 Bacteria 11977
554 Ga0466969_0008945 3300044656 Bacteria 5310
555 Ga0466969_0025962 3300044656 Bacteria 3007
556 Ga0466972_0000140 3300044658 Bacteria 59505
557 Ga0466973_0013087 3300044659 Bacteria 7781
558 Ga0453683_0003537 3300044673 Bacteria 11484
559 Ga0453683_0263696 3300044673 Bacteria 1099
560 Ga0466965_0009616 3300044683 Bacteria 4496
561 Ga0466965_0019640 3300044683 Bacteria 3244
562 Ga0466966_0000070 3300044684 Bacteria 67510
563 Ga0466966_0002513 3300044684 Bacteria 12030
564 Ga0466966_0010700 3300044684 Bacteria 6099
565 Ga0466966_0026858 3300044684 Bacteria 3755
566 Ga0466961_0000274 3300044693 Bacteria 34505
567 Ga0466961_0000296 3300044693 Bacteria 33082
568 Ga0466961_0021297 3300044693 Bacteria 4173
569 Ga0466963_0001034 3300044694 Bacteria 14451
570 Ga0466963_0003397 3300044694 Bacteria 9104
571 Ga0466963_0003741 3300044694 Bacteria 8760
572 Ga0466964_0003298 3300044706 Bacteria 5877
573 Ga0466964_0032719 3300044706 Bacteria 2068
574 Ga0453684_0000842 3300044712 Bacteria 103487
575 Ga0453684_0002108 3300044712 Bacteria 50205
576 Ga0453684_0010441 3300044712 Bacteria 15884
577 Ga0453684_0021746 3300044712 Bacteria 9562
578 Ga0453684_0090971 3300044712 Bacteria 3768
579 Ga0453684_0102117 3300044712 Bacteria 3507
580 Ga0453684_0200476 3300044712 Bacteria 2327
581 Ga0453684_0270730 3300044712 Bacteria 1941
582 Ga0466971_0006136 3300044719 Bacteria 5224
583 Ga0466971_0030118 3300044719 Bacteria 2428
584 Ga0466968_0008623 3300044735 Bacteria 3907
585 Ga0466968_0090109 3300044735 Bacteria 1357
586 Ga0466970_0015274 3300044765 Bacteria 3947
587 Ga0466970_0025747 3300044765 Bacteria 3082
588 Ga0466970_0057543 3300044765 Bacteria 2079
589 Ga0466970_0073486 3300044765 Bacteria 1840
590 Ga0466957_0000633 3300044842 Bacteria 17833
591 Ga0466957_0001619 3300044842 Bacteria 11796
592 Ga0466957_0013598 3300044842 Bacteria 4724
593 Ga0466957_0013790 3300044842 Bacteria 4695
594 Ga0466957_0019220 3300044842 Bacteria 4018
595 Ga0466957_0021719 3300044842 Bacteria 3782
596 Ga0466957_0113603 3300044842 Bacteria 1720
597 Ga0466959_0001210 3300045049 Bacteria 15585
598 Ga0466959_0008161 3300045049 Bacteria 7387
599 Ga0466959_0031735 3300045049 Bacteria 3909
600 Ga0466959_0190336 3300045049 Bacteria 1432
601 Ga0451576_0000494 3300045051 Bacteria 86988
602 Ga0451576_0001170 3300045051 Bacteria 47077
603 Ga0451576_0135204 3300045051 Bacteria 2570
604 Ga0466958_0001446 3300045836 Bacteria 11268
605 Ga0466958_0001792 3300045836 Bacteria 10418
606 Ga0466958_0003938 3300045836 Bacteria 7785
607 Ga0466967_0465587 3300045976 Bacteria 1237
608 Ga0495617_041990 3300046452 Bacteria 1528
609 Ga0495627_000011 3300046453 Bacteria 354522
610 Ga0495592_0007865 3300046454 Bacteria 7990
611 Ga0495592_0023491 3300046454 Bacteria 4689
612 Ga0495603_0002789 3300046455 Bacteria 10307
613 Ga0495603_0005119 3300046455 Bacteria 7829
614 Ga0495590_0000842 3300046457 Bacteria 13854
615 Ga0495590_0001030 3300046457 Bacteria 12276
616 Ga0495590_0002642 3300046457 Bacteria 7404
617 Ga0495590_0009722 3300046457 Bacteria 3644
618 Ga0495590_0015583 3300046457 Bacteria 2755
619 Ga0495591_000765 3300046458 Bacteria 23210
620 Ga0495591_034295 3300046458 Bacteria 1495
621 Ga0495629_0000465 3300046459 Bacteria 33935
622 Ga0495629_0000664 3300046459 Bacteria 27804
623 Ga0495629_0002046 3300046459 Bacteria 15675
624 Ga0495629_0010142 3300046459 Bacteria 6869
625 Ga0495629_0019324 3300046459 Bacteria 4869
626 Ga0495629_0214057 3300046459 Bacteria 1330
627 Ga0495638_0010372 3300046460 Bacteria 6478
628 Ga0495638_0080946 3300046460 Bacteria 1972
629 Ga0495641_0008326 3300046461 Bacteria 6338
630 Ga0495651_0019962 3300046462 Bacteria 5198
631 Ga0495651_0026530 3300046462 Bacteria 4512
632 Ga0495651_0130198 3300046462 Bacteria 1837
633 Ga0495651_0162523 3300046462 Bacteria 1598
634 Ga0495653_0002551 3300046463 Bacteria 14519
635 Ga0495653_0004428 3300046463 Bacteria 11350
636 Ga0495653_0004792 3300046463 Bacteria 10970
637 Ga0495653_0012941 3300046463 Bacteria 6807
638 Ga0495653_0032216 3300046463 Bacteria 4163
639 Ga0495653_0119736 3300046463 Bacteria 1878
640 Ga0495650_0001754 3300046471 Bacteria 19739
641 Ga0495650_0002590 3300046471 Bacteria 14224
642 Ga0495650_0004755 3300046471 Bacteria 9129
643 Ga0495580_0004101 3300046472 Bacteria 12284
644 Ga0495580_0004345 3300046472 Bacteria 11901
645 Ga0495580_0004858 3300046472 Bacteria 11243
646 Ga0495580_0006675 3300046472 Bacteria 9367
647 Ga0495580_0010114 3300046472 Bacteria 7368
648 Ga0495580_0023683 3300046472 Bacteria 4503
649 Ga0495580_0043417 3300046472 Bacteria 3200
650 Ga0495580_0059899 3300046472 Bacteria 2675
651 Ga0495580_0071281 3300046472 Bacteria 2427
652 Ga0495580_0101621 3300046472 Bacteria 1999
653 Ga0495582_0000577 3300046473 Bacteria 20275
654 Ga0495582_0026755 3300046473 Bacteria 3162
655 Ga0495582_0055071 3300046473 Bacteria 2192
656 Ga0495582_0207224 3300046473 Bacteria 1120
657 Ga0495605_0001964 3300046474 Bacteria 13036
658 Ga0495605_0003997 3300046474 Bacteria 8711
659 Ga0495605_0007585 3300046474 Bacteria 6151
660 Ga0495605_0085265 3300046474 Bacteria 1472
661 Ga0495664_0000331 3300046477 Bacteria 22817
662 Ga0495585_0018266 3300046492 Bacteria 4047
663 Ga0495596_0009852 3300046500 Bacteria 4188
664 Ga0495607_0000153 3300046501 Bacteria 72099
665 Ga0495607_0076887 3300046501 Bacteria 1845
666 Ga0495607_0137256 3300046501 Bacteria 1265
667 Ga0495583_0011149 3300046506 Bacteria 5179
668 Ga0495606_0000433 3300046507 Bacteria 69506
669 Ga0495606_0015098 3300046507 Bacteria 5976
670 Ga0495606_0016007 3300046507 Bacteria 5743
671 Ga0495606_0056810 3300046507 Bacteria 2524
672 Ga0495606_0070506 3300046507 Bacteria 2203
673 Ga0495608_0006806 3300046511 Bacteria 8104
674 Ga0495608_0013153 3300046511 Bacteria 5743
675 Ga0495608_0061927 3300046511 Bacteria 2459
676 Ga0495608_0130710 3300046511 Bacteria 1607
677 Ga0495616_0000234 3300046513 Bacteria 45006
678 Ga0495616_0034804 3300046513 Bacteria 2612
679 Ga0495618_0001925 3300046514 Bacteria 13613
680 Ga0495618_0013435 3300046514 Bacteria 4981
681 Ga0495620_0023214 3300046515 Bacteria 2971
682 Ga0495620_0050404 3300046515 Bacteria 1776
683 Ga0495628_0015152 3300046516 Bacteria 6440
684 Ga0495628_0017374 3300046516 Bacteria 5991
685 Ga0495628_0021727 3300046516 Bacteria 5273
686 Ga0495628_0031277 3300046516 Bacteria 4306
687 Ga0495628_0049658 3300046516 Bacteria 3321
688 Ga0495628_0082423 3300046516 Bacteria 2498
689 Ga0495628_0085744 3300046516 Bacteria 2442
690 Ga0495628_0100160 3300046516 Bacteria 2237
691 Ga0495630_0002428 3300046517 Bacteria 12907
692 Ga0495630_0006450 3300046517 Bacteria 8344
693 Ga0495630_0006602 3300046517 Bacteria 8268
694 Ga0495630_0010033 3300046517 Bacteria 6821
695 Ga0495630_0012786 3300046517 Bacteria 6099
696 Ga0495630_0354652 3300046517 Bacteria 1123
697 Ga0495632_0004583 3300046519 Bacteria 9366
698 Ga0495643_0097777 3300046522 Bacteria 1508
699 Ga0495644_0061324 3300046523 Bacteria 1413
700 Ga0495648_0029393 3300046524 Bacteria 3648
701 Ga0495648_0030733 3300046524 Bacteria 3546
702 Ga0495648_0079767 3300046524 Bacteria 1866
703 Ga0495648_0081004 3300046524 Bacteria 1848
704 Ga0495663_0006383 3300046525 Bacteria 3256
705 Ga0495666_0006771 3300046526 Bacteria 5758
706 Ga0495666_0009632 3300046526 Bacteria 4830
707 Ga0495666_0011613 3300046526 Bacteria 4390
708 Ga0495666_0027810 3300046526 Bacteria 2783
709 Ga0495666_0034417 3300046526 Bacteria 2473
710 Ga0495652_0016075 3300046529 Bacteria 6694
711 Ga0495652_0030679 3300046529 Bacteria 4712
712 Ga0495652_0056480 3300046529 Bacteria 3333
713 Ga0495654_0012995 3300046530 Bacteria 4462
714 Ga0495654_0061372 3300046530 Bacteria 1805
715 Ga0495654_0065534 3300046530 Bacteria 1734
716 Ga0495665_0001459 3300046531 Bacteria 12686
717 Ga0495665_0006630 3300046531 Bacteria 6248
718 Ga0495665_0016829 3300046531 Bacteria 3936
719 Ga0495665_0044772 3300046531 Bacteria 2351
720 Ga0495665_0085131 3300046531 Bacteria 1661
721 Ga0495665_0186810 3300046531 Bacteria 1076
722 Ga0495640_0010529 3300046533 Bacteria 7141
723 Ga0495640_0018994 3300046533 Bacteria 5083
724 Ga0495640_0096125 3300046533 Bacteria 1949
725 Ga0495640_0159241 3300046533 Bacteria 1448
726 Ga0495640_0189107 3300046533 Bacteria 1309
727 Ga0495586_0003609 3300046535 Bacteria 8290
728 Ga0495586_0097168 3300046535 Bacteria 1632
729 Ga0495586_0098974 3300046535 Bacteria 1617
730 Ga0495586_0205709 3300046535 Bacteria 1116
731 Ga0495586_0262489 3300046535 Bacteria 986
732 Ga0495587_0001543 3300046536 Bacteria 15299
733 Ga0495587_0003899 3300046536 Bacteria 9898
734 Ga0495587_0063834 3300046536 Bacteria 2153
735 Ga0495587_0074676 3300046536 Bacteria 1969
736 Ga0495621_0000689 3300046539 Bacteria 8521
737 Ga0495621_0001595 3300046539 Bacteria 5918
738 Ga0495597_0000542 3300046542 Bacteria 31279
739 Ga0495597_0017543 3300046542 Bacteria 3366
740 Ga0495597_0037036 3300046542 Bacteria 2193
741 Ga0495645_0000582 3300046543 Bacteria 25023
742 Ga0495645_0004295 3300046543 Bacteria 9735
743 Ga0495645_0005517 3300046543 Bacteria 8694
744 Ga0495645_0006959 3300046543 Bacteria 7860
745 Ga0495645_0066532 3300046543 Bacteria 2604
746 Ga0495645_0123803 3300046543 Bacteria 1818
747 Ga0495622_0006058 3300046557 Bacteria 5619
748 Ga0495622_0069022 3300046557 Bacteria 1632
749 Ga0495633_0014003 3300046558 Bacteria 4204
750 Ga0495667_0025517 3300046559 Bacteria 3982
751 Ga0495656_0050364 3300046615 Bacteria 1778
752 Ga0495634_0007523 3300046642 Bacteria 8165
753 Ga0495634_0027591 3300046642 Bacteria 3949
754 Ga0495634_0053834 3300046642 Bacteria 2694
755 Ga0495611_0124316 3300046648 Bacteria 1203
756 Ga0495625_0012680 3300046660 Bacteria 6817
757 Ga0495625_0135755 3300046660 Bacteria 1663
758 Ga0495625_0204836 3300046660 Bacteria 1300
759 Ga0495635_0005253 3300046663 Bacteria 9009
760 Ga0495635_0007081 3300046663 Bacteria 7839
761 Ga0495635_0008059 3300046663 Bacteria 7359
762 Ga0495635_0022329 3300046663 Bacteria 4405
763 Ga0495635_0112884 3300046663 Bacteria 1856
764 Ga0495661_0017422 3300046665 Bacteria 4745
765 Ga0495588_0078532 3300046674 Bacteria 1722
766 Ga0495657_0147267 3300046675 Bacteria 1464
767 Ga0495657_0200898 3300046675 Bacteria 1215
768 Ga0495599_0015330 3300046678 Bacteria 4756
769 Ga0495599_0040909 3300046678 Bacteria 2910
770 Ga0495599_0088879 3300046678 Bacteria 1928
771 Ga0495623_0006038 3300046679 Bacteria 7878
772 Ga0495623_0013415 3300046679 Bacteria 5312
773 Ga0495623_0016411 3300046679 Bacteria 4784
774 Ga0495623_0028079 3300046679 Bacteria 3622
775 Ga0495623_0070502 3300046679 Bacteria 2177
776 Ga0495623_0184793 3300046679 Bacteria 1208
777 Ga0495646_0000772 3300046680 Bacteria 17847
778 Ga0495646_0003040 3300046680 Bacteria 10396
779 Ga0495646_0006796 3300046680 Bacteria 7258
780 Ga0495646_0028155 3300046680 Bacteria 3520
781 Ga0495646_0039554 3300046680 Bacteria 2907
782 Ga0495646_0044952 3300046680 Bacteria 2699
783 Ga0495646_0063689 3300046680 Bacteria 2188
784 Ga0495647_0003224 3300046681 Bacteria 5221
785 Ga0495658_0013494 3300046683 Bacteria 4158
786 Ga0495658_0014311 3300046683 Bacteria 4052
787 Ga0495669_0026048 3300046684 Bacteria 2554
788 Ga0495613_0002584 3300046689 Bacteria 13610
789 Ga0495613_0015119 3300046689 Bacteria 5732
790 Ga0495613_0043589 3300046689 Bacteria 3319
791 Ga0495613_0084658 3300046689 Bacteria 2302
792 Ga0495613_0258920 3300046689 Bacteria 1213
793 Ga0495624_0017117 3300046690 Bacteria 4871
794 Ga0495624_0027568 3300046690 Bacteria 3718
795 Ga0495624_0053286 3300046690 Bacteria 2554
796 Ga0495624_0074621 3300046690 Bacteria 2106
797 Ga0495624_0092295 3300046690 Bacteria 1867
798 Ga0495624_0182649 3300046690 Bacteria 1278
799 Ga0495670_0005977 3300046691 Bacteria 5962
800 Ga0495671_0042506 3300046692 Bacteria 2284
801 Ga0495649_0011563 3300046694 Bacteria 5172
802 Ga0495649_0022313 3300046694 Bacteria 3542
803 Ga0495649_0028030 3300046694 Bacteria 3122
804 Ga0495649_0030777 3300046694 Bacteria 2962
805 Ga0495589_0004671 3300046794 Bacteria 7276
806 Ga0495589_0006429 3300046794 Bacteria 6199
807 Ga0495589_0042176 3300046794 Bacteria 2274
808 Ga0495589_0070299 3300046794 Bacteria 1711
809 Ga0495589_0092990 3300046794 Bacteria 1464
810 Ga0495600_0002240 3300046809 Bacteria 11014
811 Ga0495600_0010921 3300046809 Bacteria 5647
812 Ga0495600_0157605 3300046809 Bacteria 1468
813 Ga0495660_0002284 3300046810 Bacteria 12315
814 Ga0495581_0006028 3300047315 Bacteria 7025
815 Ga0495581_0096485 3300047315 Bacteria 1717
816 Ga0495581_0118487 3300047315 Bacteria 1540
817 Ga0495604_0001471 3300047317 Bacteria 19385
818 Ga0495604_0007351 3300047317 Bacteria 8726
819 Ga0495604_0010243 3300047317 Bacteria 7425
820 Ga0495604_0010861 3300047317 Bacteria 7233
821 Ga0495604_0087771 3300047317 Bacteria 2315
822 Ga0495636_0105202 3300047318 Bacteria 1237
823 Ga0495674_0017363 3300047319 Bacteria 6695
824 Ga0495674_0047032 3300047319 Bacteria 3827
825 Ga0495674_0052410 3300047319 Bacteria 3590
826 Ga0495674_0059707 3300047319 Bacteria 3330
827 Ga0495674_0142191 3300047319 Bacteria 2017
828 Ga0495674_0225338 3300047319 Bacteria 1548
829 Ga0495674_0282417 3300047319 Bacteria 1360
830 Ga0495672_0027576 3300047320 Bacteria 3606
831 Ga0495672_0043622 3300047320 Bacteria 2695
832 Ga0495672_0123778 3300047320 Bacteria 1370
833 Ga0495676_0001803 3300047321 Bacteria 18753
834 Ga0495676_0026801 3300047321 Bacteria 4953
835 Ga0495676_0142373 3300047321 Bacteria 1717
836 Ga0495680_0007467 3300047322 Bacteria 10017
837 Ga0495680_0037224 3300047322 Bacteria 3898
838 Ga0495680_0081847 3300047322 Bacteria 2436
839 Ga0495680_0084418 3300047322 Bacteria 2393
840 Ga0495680_0175412 3300047322 Bacteria 1550
841 Ga0495683_0001162 3300047323 Bacteria 18030
842 Ga0495683_0005126 3300047323 Bacteria 7309
843 Ga0495683_0012500 3300047323 Bacteria 4455
844 Ga0495683_0022993 3300047323 Bacteria 3204
845 Ga0495683_0046878 3300047323 Bacteria 2169
846 Ga0495687_000216 3300047443 Bacteria 81734
847 Ga0495687_001805 3300047443 Bacteria 18816
848 Ga0495675_0004754 3300047444 Bacteria 8246
849 Ga0495675_0012407 3300047444 Bacteria 5363
850 Ga0495675_0018680 3300047444 Bacteria 4402
851 Ga0495675_0029499 3300047444 Bacteria 3499
852 Ga0495675_0052892 3300047444 Bacteria 2578
853 Ga0495675_0076962 3300047444 Bacteria 2102
854 Ga0495675_0079413 3300047444 Bacteria 2066
855 Ga0495675_0150316 3300047444 Bacteria 1439
856 Ga0495679_000413 3300047446 Bacteria 31972
857 Ga0495679_001253 3300047446 Bacteria 14990
858 Ga0495679_003515 3300047446 Bacteria 7494
859 Ga0495673_0004937 3300047469 Bacteria 8209
860 Ga0495673_0024457 3300047469 Bacteria 2918
861 Ga0495673_0050044 3300047469 Bacteria 1836
862 Ga0495681_0045272 3300047470 Bacteria 2107
863 Ga0495684_0000521 3300047471 Bacteria 31227
864 Ga0495684_0078249 3300047471 Bacteria 2510
865 Ga0495684_0172922 3300047471 Bacteria 1605
866 Ga0495686_0037369 3300047472 Bacteria 3111
867 Ga0495593_0004599 3300047673 Bacteria 8205
868 Ga0495593_0026339 3300047673 Bacteria 3211
869 Ga0495593_0029327 3300047673 Bacteria 3017
870 Ga0495593_0049474 3300047673 Bacteria 2230
871 Ga0495593_0105212 3300047673 Bacteria 1445
872 Ga0495593_0132743 3300047673 Bacteria 1263
873 Ga0495602_0010289 3300048088 Bacteria 9711
874 Ga0495602_0011139 3300048088 Bacteria 9310
875 Ga0495602_0015826 3300048088 Bacteria 7597
876 Ga0495602_0026876 3300048088 Bacteria 5542
877 Ga0495602_0059284 3300048088 Bacteria 3342
878 Ga0495602_0070012 3300048088 Bacteria 3004
879 Ga0495602_0106427 3300048088 Bacteria 2289
880 Ga0495602_0124376 3300048088 Bacteria 2069
881 Ga0495602_0212179 3300048088 Bacteria 1468
882 Ga0495614_0000067 3300048089 Bacteria 33617
883 Ga0495614_0007051 3300048089 Bacteria 5020
884 Ga0495614_0065601 3300048089 Bacteria 1562
885 Ga0495626_0000105 3300048091 Bacteria 109725
886 Ga0495626_0022568 3300048091 Bacteria 3106
887 Ga0496100_0000523 3300048903 Bacteria 18365
888 Ga0496100_0012549 3300048903 Bacteria 4860
889 Ga0496100_0076423 3300048903 Bacteria 2249
890 Ga0496100_0189441 3300048903 Bacteria 1492
891 Ga0496101_0002493 3300048904 Bacteria 11304
892 Ga0496101_0042288 3300048904 Bacteria 3252
893 Ga0496101_0047186 3300048904 Bacteria 3091
894 Ga0496101_0074379 3300048904 Bacteria 2498
895 Ga0496101_0097767 3300048904 Bacteria 2193
896 Ga0496101_0149015 3300048904 Bacteria 1788
897 Ga0496102_0000074 3300048905 Bacteria 148938
898 Ga0496102_0009040 3300048905 Bacteria 8549
899 Ga0496102_0009565 3300048905 Bacteria 8337
900 Ga0496102_0202261 3300048905 Bacteria 1872
901 Ga0496102_0563126 3300048905 Bacteria 1062
902 Ga0496103_0001532 3300048906 Bacteria 15433
903 Ga0496103_0005147 3300048906 Bacteria 7871
904 Ga0496103_0111526 3300048906 Bacteria 1738
905 Ga0496104_0029298 3300048907 Bacteria 5105
906 Ga0496104_0042090 3300048907 Bacteria 4285
907 Ga0496104_0109848 3300048907 Bacteria 2643
908 Ga0496104_0266001 3300048907 Bacteria 1627
909 Ga0496104_0293329 3300048907 Bacteria 1539
910 Ga0496104_0323779 3300048907 Bacteria 1454
911 Ga0496105_0055060 3300048908 Bacteria 3285
912 Ga0496105_0101000 3300048908 Bacteria 2382
913 Ga0496105_0185519 3300048908 Bacteria 1702
914 Ga0496106_0001248 3300048909 Bacteria 19038
915 Ga0496106_0001808 3300048909 Bacteria 15988
916 Ga0496106_0043216 3300048909 Bacteria 3381
917 Ga0496106_0043968 3300048909 Bacteria 3353
918 Ga0496106_0121132 3300048909 Bacteria 2045
919 Ga0496107_0090605 3300048910 Bacteria 2234
920 Ga0496107_0117202 3300048910 Bacteria 1961
921 Ga0496107_0125150 3300048910 Bacteria 1895
922 Ga0496107_0146943 3300048910 Bacteria 1743
923 Ga0496108_0030248 3300048911 Bacteria 4488
924 Ga0496108_0093854 3300048911 Bacteria 2553
925 Ga0496109_0019061 3300048912 Bacteria 6043
926 Ga0496109_0309810 3300048912 Bacteria 1489
927 Ga0496110_0000450 3300048913 Bacteria 27963
928 Ga0496110_0022640 3300048913 Bacteria 5338
929 Ga0496110_0540879 3300048913 Bacteria 1059
930 Ga0496112_0005931 3300048915 Bacteria 10657
931 Ga0496112_0011799 3300048915 Bacteria 7999
932 Ga0496112_0066722 3300048915 Bacteria 3551
933 Ga0496112_0137211 3300048915 Bacteria 2416
934 Ga0496112_0396280 3300048915 Bacteria 1320
935 Ga0496113_0003925 3300048916 Bacteria 9023
936 Ga0496113_0068501 3300048916 Bacteria 2693
937 Ga0496114_0000572 3300048917 Bacteria 27230
938 Ga0496114_0003283 3300048917 Bacteria 12414
939 Ga0496114_0149289 3300048917 Bacteria 2027
940 Ga0496114_0226778 3300048917 Bacteria 1641
941 Ga0496115_0005371 3300048918 Bacteria 9325
942 Ga0496115_0149046 3300048918 Bacteria 1931
943 Ga0496115_0281660 3300048918 Bacteria 1365
944 Ga0496116_0001318 3300048919 Bacteria 28314
945 Ga0496116_0017662 3300048919 Bacteria 5528
946 Ga0496116_0079785 3300048919 Bacteria 2035
947 Ga0496117_0004062 3300048920 Bacteria 16439
948 Ga0496117_0011401 3300048920 Bacteria 7961
949 Ga0496117_0017703 3300048920 Bacteria 5943
950 Ga0496117_0017755 3300048920 Bacteria 5930
951 Ga0496117_0041645 3300048920 Bacteria 3361
952 Ga0496117_0130320 3300048920 Bacteria 1525
953 Ga0496118_0001851 3300048921 Bacteria 30308
954 Ga0496118_0005204 3300048921 Bacteria 14883
955 Ga0496118_0006098 3300048921 Bacteria 13397
956 Ga0496118_0009426 3300048921 Bacteria 9859
957 Ga0496118_0018288 3300048921 Bacteria 6328
958 Ga0496118_0018744 3300048921 Bacteria 6218
959 Ga0496118_0036533 3300048921 Bacteria 3970
960 Ga0496121_0000306 3300048924 Bacteria 102245
961 Ga0496121_0002426 3300048924 Bacteria 28488
962 Ga0496121_0006168 3300048924 Bacteria 15036
963 Ga0496121_0015481 3300048924 Bacteria 7987
964 Ga0496121_0017741 3300048924 Bacteria 7241
965 Ga0496121_0051991 3300048924 Bacteria 3445
966 Ga0496121_0067128 3300048924 Bacteria 2908
967 Ga0496121_0077258 3300048924 Bacteria 2652
968 Ga0496121_0100695 3300048924 Bacteria 2230
969 Ga0496122_0000865 3300048925 Bacteria 57024
970 Ga0496122_0004543 3300048925 Bacteria 17109
971 Ga0496123_0000203 3300048926 Bacteria 121361
972 Ga0496123_0008097 3300048926 Bacteria 9721
973 Ga0496124_0002427 3300048927 Bacteria 24450
974 Ga0496124_0008332 3300048927 Bacteria 10854
975 Ga0496124_0031972 3300048927 Bacteria 4654
976 Ga0496124_0057514 3300048927 Bacteria 3276
977 Ga0496125_0019818 3300048928 Bacteria 6329
978 Ga0496125_0034344 3300048928 Bacteria 4472
979 Ga0496126_0001579 3300048929 Bacteria 34827
980 Ga0496126_0002578 3300048929 Bacteria 24191
981 Ga0496126_0002619 3300048929 Bacteria 23973
982 Ga0496126_0003244 3300048929 Bacteria 20790
983 Ga0496126_0009708 3300048929 Bacteria 10195
984 Ga0496126_0010990 3300048929 Bacteria 9419
985 Ga0496126_0189476 3300048929 Bacteria 1743
986 Ga0501034_0062153 3300049571 Bacteria 3750
987 Ga0501036_0024209 3300049572 Bacteria 5118
988 Ga0501040_0010800 3300049576 Bacteria 5970
989 Ga0501041_0054375 3300049577 Bacteria 2442
990 Ga0501042_0096044 3300049578 Bacteria 2129
991 Ga0501042_0124198 3300049578 Bacteria 1858
992 Ga0501043_0212561 3300049579 Bacteria 1499
993 Ga0501047_0256216 3300049581 Bacteria 1598
994 Ga0501048_0034392 3300049582 Bacteria 3656
995 Ga0501072_0029953 3300049588 Bacteria 4253
996 Ga0501073_0004074 3300049589 Bacteria 10964
997 Ga0501074_0164906 3300049590 Bacteria 1582
998 Ga0501075_0025389 3300049591 Bacteria 4353
999 Ga0501076_0004740 3300049592 Bacteria 9703
1000 Ga0501076_0039276 3300049592 Bacteria 3716
1001 Ga0501077_0121301 3300049593 Bacteria 1657
1002 Ga0501227_004557 3300049665 Bacteria 2978
1003 Ga0501079_0008595 3300049741 Bacteria 7749
1004 Ga0501080_0028440 3300049742 Bacteria 5200
1005 Ga0501080_0248761 3300049742 Bacteria 1621
1006 Ga0501081_0028601 3300049743 Bacteria 3762
1007 Ga0501035_0027081 3300049822 Bacteria 5241
1008 Ga0501035_0085549 3300049822 Bacteria 2779
1009 Ga0501044_0001185 3300049823 Bacteria 30889
1010 nmdc:mga03683_64480_c1 3300050489 Bacteria 1554
1011 nmdc:mga00v17_171444_c1 3300050491 Bacteria 1399
1012 nmdc:mga00v17_18346_c1 3300050491 Bacteria 3973
1013 nmdc:mga07m45_57654_c1 3300050496 Bacteria 2196
1014 nmdc:mga05p37_18968_c1 3300050507 Bacteria 8317
1015 nmdc:mga05p37_85283_c1 3300050507 Bacteria 3513
1016 nmdc:mga09592_144219_c1 3300050508 Bacteria 2053
1017 nmdc:mga09592_19691_c1 3300050508 Bacteria 5543
1018 nmdc:mga09592_30224_c1 3300050508 Bacteria 4507
1019 nmdc:mga09592_89662_c1 3300050508 Bacteria 2627
1020 nmdc:mga0qj67_27241_c1 3300050509 Bacteria 4427
1021 nmdc:mga0qj67_401393_c1 3300050509 Bacteria 1106
1022 nmdc:mga0qj67_4762_c1 3300050509 Bacteria 9860
1023 nmdc:mga06r32_176_c1 3300050510 Bacteria 49909
1024 nmdc:mga06r32_39557_c1 3300050510 Bacteria 4475
1025 nmdc:mga06r32_80886_c1 3300050510 Bacteria 3163
1026 nmdc:mga08y16_65777_c1 3300050511 Bacteria 3784
1027 nmdc:mga0n895_107426_c1 3300050512 Bacteria 2804
1028 nmdc:mga0n895_90712_c1 3300050512 Bacteria 3058
1029 nmdc:mga08x19_17651_c1 3300050514 Bacteria 4370
1030 Ga0495612_0002014 3300053078 Bacteria 8373
1031 Ga0500644_0009381 3300053088 Bacteria 2616
1032 Ga0500651_0000066 3300053093 Bacteria 69313
1033 Ga0500566_0045874 3300053094 Bacteria 2514
1034 Ga0500556_0001052 3300053104 Bacteria 14249
1035 Ga0500642_0015279 3300053130 Bacteria 2882
1036 Ga0500568_0000481 3300053139 Bacteria 29522
1037 Ga0500568_0011636 3300053139 Bacteria 4070
1038 Ga0500622_0001405 3300053156 Bacteria 19406
1039 Ga0500622_0007370 3300053156 Bacteria 6251
1040 Ga0500637_0081510 3300053178 Bacteria 1869
1041 Ga0501084_0094903 3300054114 Bacteria 2505
1042 Ga0501082_0003494 3300060353 Bacteria 13710
1043 Ga0501082_0144033 3300060353 Bacteria 2068
1044 Ga0466962_0001530 3300061719 Bacteria 10806
1045 Ga0466962_0006704 3300061719 Bacteria 5519
1046 Ga0466962_0022542 3300061719 Bacteria 3026
1047 Ga0466962_0048264 3300061719 Bacteria 2035
1048 Ga0466962_0076703 3300061719 Bacteria 1597
1049 Ga0530510_0029184 3300061734 Bacteria 3958
1050 Ga0530510_0244849 3300061734 Bacteria 1335
1051 2501074061 2501025501 Bacteria 7768574
1052 2501084103 2501025502 Bacteria 9641094
1053 2501414372 2501025504 Bacteria 8008976
1054 2509130830 2508501125 Bacteria 7208311
1055 2510252567 2510065045 Bacteria 7761063
1056 2511093345 2510917013 Bacteria 9951648
1057 2511099795 2510917014 Bacteria 8296963
1058 2511102434 2510917015 Bacteria 7950052
1059 2512348425 2512047030 Bacteria 9031815
1060 2513556125 2513237082 Bacteria 8640282
1061 2513564311 2513237083 Bacteria 8410967
1062 2513962609 2513237151 Bacteria 6309801
1063 2514050885 2513237166 Bacteria 10373764
1064 2515684844 2515154122 Bacteria 8609520
1065 2516022247 2515154189 Bacteria 9629850
1066 2519457531 2519103095 Bacteria 6629912
1067 2527080604 2526164713 Bacteria 6780608
1068 2563061539 2562617112 Bacteria 10918404
1069 2585294134 2582581311 Bacteria 6763856
1070 2599741059 2599185239 Bacteria 8686614
1071 2599748366 2599185240 Bacteria 7968121
1072 2600210278 2599185355 Bacteria 7968906
1073 2600813817 2600255067 Bacteria 6795583
1074 2643792050 2643221554 Bacteria 6603920
1075 2643980687 2643221594 Bacteria 5811388
1076 2644122111 2643221621 Bacteria 6212786
1077 2644216469 2643221638 Bacteria 6579467
1078 2676745797 2675903129 Bacteria 7964495
1079 2713478596 2711768613 Bacteria 11048459
1080 2719641665 2718217991 Bacteria 7829542
1081 2723879652 2721755763 Bacteria 4464185
1082 2738824012 2738541296 Bacteria 7285013
1083 2738836403 2738541298 Bacteria 7286732
1084 2738877933 2738541306 Bacteria 7284992
1085 2739189639 2738543002 Bacteria 7284546
1086 2739224526 2738543008 Bacteria 7282815
1087 2739612183 2739367655 Bacteria 4051151
1088 2746087241 2744054900 Bacteria 8399525
1089 2746093252 2744054901 Bacteria 8397047
1090 2753566184 2751185846 Bacteria 7242164
1091 2792837079 2791355137 Bacteria 9654227
1092 2809031996 2808606395 Bacteria 6020352
1093 2817259722 2816332253 Bacteria 6764532
1094 2817277391 2816332256 Bacteria 6891714
1095 2817453557 2816332286 Bacteria 6853759
1096 2819624180 2818991450 Bacteria 6962147
1097 2819636812 2818991452 Bacteria 8442785
1098 2842332172 2842324504 Bacteria 9364110
1099 2842356376 2842348783 Bacteria 9002918
1100 2842461270 2842454564 Bacteria 8730687
1101 2855734606 2855730933 Bacteria 7047938
1102 2855770196 2855767633 Bacteria 7049357
1103 2856289391 2856287931 Bacteria 7223934
1104 2857362263 2857357740 Bacteria 9937880
1105 2857538479 2857537821 Bacteria 5248181
1106 2857578707 2857576091 Bacteria 5465855
1107 2858955747 2858950400 Bacteria 6783797
1108 2863426480 2863421361 Bacteria 7300805
1109 2870069386 2870068957 Bacteria 8925310
1110 2881414417 2881412998 Bacteria 6492157
1111 2881930281 2881927736 Bacteria 3993927
1112 2883091421 2883087390 Bacteria 9532701
1113 2885197017 2885192300 Bacteria 5882526
1114 2885272375 2885270888 Bacteria 9831543
1115 2887377881 2887375801 Bacteria 5334027
1116 2894514503 2894510363 Bacteria 5121143
1117 2900637084 2900634093 Bacteria 10263517
1118 2902686693 2902682994 Bacteria 8951596
1119 2904481617 2904479285 Bacteria 5073931
1120 2904490130 2904483920 Bacteria 7545285
1121 2904569356 2904564687 Bacteria 7609577
1122 2904576807 2904571731 Bacteria 7608790
1123 2904624850 2904615490 Bacteria 10047340
1124 2919533299 2919527303 Bacteria 7718827
1125 2920114129 2920107658 Bacteria 10042636
1126 2921651544 2921643360 Bacteria 11448031
1127 2928114195 2928108538 Bacteria 7360024
1128 2928141057 2928135762 Bacteria 7259641
1129 2928163065 2928157003 Bacteria 7522202
1130 2928170185 2928163908 Bacteria 7561269
1131 2928176321 2928170801 Bacteria 8785406
1132 2928509190 2928503688 Bacteria 7268108
1133 2928542033 2928536128 Bacteria 7657547
1134 2941481921
1135 2945934552 2945934425 Bacteria 7444609
1136 2974322330 2974320154 Bacteria 4571377
1137 2981996088 2981990288 Bacteria 7590678
1138 2989393450 2989392574 Bacteria 4554005
1139 2990704890 2990703756 Bacteria 7715990
1140 642426554 641736151 Bacteria 7477263
1141 642419614 641736154 Bacteria 7689995
1142 642594600 642555112 Bacteria 8676562
1143 642623188 642555113 Bacteria 8214658
1144 8003956804 8003955200 Bacteria 8601927
1145 8018847945 8018845410 Bacteria 8933938
1146 8020813933 8020807995 Bacteria 6801506
1147 8020939031 8020938398 Bacteria 7472757
1148 8020947746 8020945358 Bacteria 8467355
1149 8020953422 8020953355 Bacteria 7439080
1150 8021127529 8021120328 Bacteria 8782274
1151 8039099679 8039098773 Bacteria 6602928
1152 8040171510 8040167225 Bacteria 6542727
1153 8040174124 8040173305 Bacteria 6827067
1154 8048749758 8048746797 Bacteria 3557226
1155 8055227955 8055225921 Bacteria 3341787
1156 8055269439 8055266321 Bacteria 7999742
1157 8055307399 8055301274 Bacteria 8587385
1158 Ga0451577_0077551
1159 JGI24740J21852_10002018
1160 JGI24739J22299_10009031
1161 JGI24739J22299_10017284
1162 JGI24737J22298_10005658
1163 JGI24735J21928_10000085
1164 JGI24735J21928_10004844
1165 JGI24735J21928_10011764
1166 JGI24738J21930_10002515
1167 JGI24738J21930_10020818
1168 JGI25156J39149_1000689
1169 JGI25156J39149_1001206
1170 JGI25156J39149_1002465
1171 JGI25158J39367_1000659
1172 JGI25158J39367_1001247
1173 JGI25152J39213_1000374
1174 JGI25152J39213_1008045
1175 JGI25150J39212_1001208
1176 JGI25159J45721_1003647
1177 JGI25159J45721_1004025
1178 JGI25165J46597_1001697
1179 JGI25153J46596_10007042
1180 rootL2_10024836
1181 JGI25160J50197_1000302
1182 JGI25160J50197_1002726
1183 JGI25161J50226_1001059
1184 JGI25161J50226_1002290
1185 JGI25161J50226_1011659
1186 Ga0055533_1000360
1187 Ga0055533_1000655
1188 Ga0055532_1000261
1189 Ga0055532_1001452
1190 Ga0055532_1001513
1191 Ga0055527_1000035
1192 Ga0055527_1000856
1193 Ga0055527_1001087
1194 Ga0055535_1000050
1195 Ga0055535_1002077
1196 Ga0055535_1002081
1197 Ga0055542_1000512
1198 Ga0055542_1001196
1199 Ga0055529_1000089
1200 Ga0055529_1000604
1201 Ga0055529_1001042
1202 Ga0055526_1011470
1203 Ga0055526_1013864
1204 Ga0055537_1008962
1205 Ga0055537_1012058
1206 Ga0055524_1003357
1207 Ga0055524_1004910
1208 Ga0055524_1037368
1209 Ga0055534_1008099
1210 Ga0055528_1000489
1211 Ga0055528_1002787
1212 Ga0055530_10005313
1213 Ga0055530_10008910
1214 Ga0055530_10015201
1215 Ga0055531_10013481
1216 Ga0055531_10025971
1217 Ga0058692_1001156
1218 Ga0055543_1001828
1219 Ga0055543_1002861
1220 Ga0058863_11081137
1221 Ga0065165_1000116
1222 Ga0065165_1000885
1223 Ga0065165_1001236
1224 Ga0065165_1004323
1225 Ga0065707_10083199
1226 Ga0065707_10084693
1227 Ga0070658_10009293
1228 Ga0070658_10033857
1229 Ga0070658_10038504
1230 Ga0070676_10023216
1231 Ga0070683_100003232
1232 Ga0070683_100374838
1233 Ga0070690_100039763
1234 Ga0070690_100091732
1235 Ga0070670_100006399
1236 Ga0070677_10053864
1237 Ga0070666_10038195
1238 Ga0070666_10082621
1239 Ga0068868_100012023
1240 Ga0070660_100000025
1241 Ga0070660_100108133
1242 Ga0070689_100029665
1243 Ga0070689_100034639
1244 Ga0070689_100169861
1245 Ga0070689_100288155
1246 Ga0070687_100030188
1247 Ga0070661_100026438
1248 Ga0070668_100036411
1249 Ga0070669_100068433
1250 Ga0070669_100079362
1251 Ga0070669_100095083
1252 Ga0070669_100144902
1253 Ga0070669_100242409
1254 Ga0070675_100033527
1255 Ga0070671_100004031
1256 Ga0070671_100195504
1257 Ga0070673_100038632
1258 Ga0070673_100066412
1259 Ga0070688_100001291
1260 Ga0070659_100000426
1261 Ga0070659_100002895
1262 Ga0070667_100032917
1263 Ga0070709_10013919
1264 Ga0070711_100053406
1265 Ga0070700_100076525
1266 Ga0070663_100109268
1267 Ga0070663_100267476
1268 Ga0070678_100080861
1269 Ga0070678_100176032
1270 Ga0070662_100009064
1271 Ga0070681_10062438
1272 Ga0070681_10237202
1273 Ga0068867_100083347
1274 Ga0070685_10009316
1275 Ga0070706_100001854
1276 Ga0070707_100236999
1277 Ga0070699_100154327
1278 Ga0070679_100124324
1279 Ga0070679_100282264
1280 Ga0070684_100003023
1281 Ga0070684_100615587
1282 Ga0068853_100446285
1283 Ga0070672_100049328
1284 Ga0070672_100049386
1285 Ga0070686_100128165
1286 Ga0070695_100193643
1287 Ga0070695_100248673
1288 Ga0070693_100019782
1289 Ga0070665_100000660
1290 Ga0070665_100013780
1291 Ga0070665_100017631
1292 Ga0070665_100357639
1293 Ga0068855_100008244
1294 Ga0068855_100034453
1295 Ga0068855_100089624
1296 Ga0070664_100018275
1297 Ga0070664_100254947
1298 Ga0068857_100066745
1299 Ga0068856_100005075
1300 Ga0070702_100248186
1301 Ga0068852_100016015
1302 Ga0068859_100237201
1303 Ga0068866_10011754
1304 Ga0068861_100000476
1305 Ga0068861_100001522
1306 Ga0068870_10004878
1307 Ga0068870_10020377
1308 Ga0068863_100059350
1309 Ga0068863_100449940
1310 Ga0068858_100176531
1311 Ga0068860_100059231
1312 Ga0068860_100194900
1313 Ga0068862_100000987
1314 Ga0075368_10013182
1315 Ga0075364_10001271
1316 Ga0070716_100185489
1317 Ga0075367_10062286
1318 Ga0075366_10044507
1319 Ga0097621_100006113
1320 Ga0097621_100309656
1321 Ga0075428_100000668
1322 Ga0075428_100012845
1323 Ga0075428_100214215
1324 Ga0075428_100254919
1325 Ga0075428_100334827
1326 Ga0075430_100003515
1327 Ga0075430_100023748
1328 Ga0075430_100046030
1329 Ga0075430_100047463
1330 Ga0075431_100010835
1331 Ga0075431_100013304
1332 Ga0075431_100028254
1333 Ga0075431_100279102
1334 Ga0075431_100332354
1335 Ga0075434_100061116
1336 Ga0075429_100013404
1337 Ga0075429_100066056
1338 Ga0068865_100076214
1339 Ga0075436_100016767
1340 Ga0075436_100056897
1341 Ga0097620_100237207
1342 Ga0099794_10015598
1343 Ga0099795_10076636
1344 Ga0105251_10000422
1345 Ga0105251_10001215
1346 Ga0105251_10043445
1347 Ga0105244_10042907
1348 Ga0105250_10000006
1349 Ga0105250_10008008
1350 Ga0105240_10002542
1351 Ga0105240_10003657
1352 Ga0105240_10008032
1353 Ga0105240_10044011
1354 Ga0105240_10060442
1355 Ga0105240_10086152
1356 Ga0105240_10107666
1357 Ga0111539_10004402
1358 Ga0111539_10020994
1359 Ga0105245_10015862
1360 Ga0105245_10127450
1361 Ga0114129_10002340
1362 Ga0114129_10350121
1363 Ga0105243_10467640
1364 Ga0105241_10008245
1365 Ga0105242_10118974
1366 Ga0105242_10221195
1367 Ga0105242_10235707
1368 Ga0105248_10001770
1369 Ga0105248_10058727
1370 Ga0105248_10093341
1371 Ga0105248_10115448
1372 Ga0105248_10222527
1373 Ga0105248_10572444
1374 Ga0105237_10000806
1375 Ga0105237_10015030
1376 Ga0105237_10206678
1377 Ga0105237_10222133
1378 Ga0105238_10023771
1379 Ga0105238_10136996
1380 Ga0105238_10138000
1381 Ga0105238_10275361
1382 Ga0105249_10000932
1383 Ga0105249_10410807
1384 Ga0105249_10467951
1385 Ga0105239_10000292
1386 Ga0105239_10265140
1387 Ga0157370_10004409
1388 Ga0157370_10170975
1389 Ga0157369_10000147
1390 Ga0157369_10001132
1391 Ga0157369_10150467
1392 Ga0157369_10286170
1393 Ga0157374_10000117
1394 Ga0157374_10089701
1395 Ga0157374_10162633
1396 Ga0157378_10000848
1397 Ga0157378_10051905
1398 Ga0163162_10001267
1399 Ga0163162_10250959
1400 Ga0157375_10116663
1401 Ga0163163_10358215
1402 Ga0163163_10415122
1403 Ga0157380_10002130
1404 Ga0157379_10000337
1405 Ga0157379_10080167
1406 Ga0157379_10086887
1407 Ga0157376_10006374
1408 Ga0182005_1015683
1409 Ga0183361_10015
1410 Ga0163161_10144592
1411 Ga0163161_10313658
1412 Ga0197907_10170016
1413 Ga0206356_10440101
1414 Ga0206355_1192289
1415 Ga0206350_11042565
1416 Ga0206354_10161165
1417 Ga0206354_11326690
1418 Ga0206353_10230299
1419 Ga0213872_10000031
1420 Ga0213872_10000373
1421 Ga0213872_10000561
1422 Ga0213872_10002125
1423 Ga0213872_10003375
1424 Ga0213872_10003455
1425 Ga0213872_10004304
1426 Ga0213872_10012950
1427 Ga0213872_10014710
1428 Ga0213872_10020644
1429 Ga0213872_10029298
1430 Ga0213872_10070218
1431 Ga0213872_10086200
1432 Ga0213872_10111107
1433 Ga0224712_10000271
1434 Ga0224712_10022673
1435 Ga0209436_100369
1436 Ga0209436_100434
1437 Ga0209436_101159
1438 Ga0209566_100901
1439 Ga0209674_100153
1440 Ga0209674_100272
1441 Ga0209674_101734
1442 Ga0209672_100054
1443 Ga0209672_100072
1444 Ga0209672_100073
1445 Ga0209672_102717
1446 Ga0209147_100093
1447 Ga0209147_100100
1448 Ga0209147_100328
1449 Ga0209147_100445
1450 Ga0207427_101410
1451 Ga0209258_100140
1452 Ga0209258_100579
1453 Ga0209258_100581
1454 Ga0207425_1000021
1455 Ga0207425_1000223
1456 Ga0209026_1002417
1457 Ga0209148_1000119
1458 Ga0209148_1000140
1459 Ga0209148_1001759
1460 Ga0209759_1000281
1461 Ga0209759_1000928
1462 Ga0209759_1005226
1463 Ga0209759_1008317
1464 Ga0209129_1000020
1465 Ga0209129_1003091
1466 Ga0209233_1000173
1467 Ga0209565_1000536
1468 Ga0209565_1000770
1469 Ga0209565_1004827
1470 Ga0209565_1004922
1471 Ga0209565_1009668
1472 Ga0209455_1000125
1473 Ga0209455_1000244
1474 Ga0209455_1000849
1475 Ga0209673_1000098
1476 Ga0209673_1012788
1477 Ga0209130_1002175
1478 Ga0209130_1003597
1479 Ga0209675_1000650
1480 Ga0209675_1003924
1481 Ga0209675_1004802
1482 Ga0209564_1000780
1483 Ga0209564_1003850
1484 Ga0209564_1010880
1485 Ga0209564_1013058
1486 Ga0209758_1000077
1487 Ga0209050_1000050
1488 Ga0209050_1000795
1489 Ga0209050_1007586
1490 Ga0209256_1000674
1491 Ga0209256_1001001
1492 Ga0209256_1014402
1493 Ga0207426_1000199
1494 Ga0207426_1002770
1495 Ga0207426_1003789
1496 Ga0209051_1024272
1497 Ga0209257_1000075
1498 Ga0209257_1012663
1499 Ga0207656_10015465
1500 Ga0207696_1000069
1501 Ga0207713_1000473
1502 Ga0207713_1011443
1503 Ga0207680_10078739
1504 Ga0207647_10000884
1505 Ga0207647_10011496
1506 Ga0207647_10023305
1507 Ga0207647_10036201
1508 Ga0207647_10068522
1509 Ga0207645_10005863
1510 Ga0207645_10012127
1511 Ga0207645_10104751
1512 Ga0207643_10016060
1513 Ga0207643_10023434
1514 Ga0207705_10002472
1515 Ga0207705_10039734
1516 Ga0207705_10091658
1517 Ga0207684_10003995
1518 Ga0207684_10129406
1519 Ga0207695_10002160
1520 Ga0207695_10004507
1521 Ga0207695_10010060
1522 Ga0207695_10109457
1523 Ga0207695_10117465
1524 Ga0207695_10149502
1525 Ga0207695_10266745
1526 Ga0207662_10037189
1527 Ga0207657_10000065
1528 Ga0207657_10176219
1529 Ga0207649_10050277
1530 Ga0207681_10009993
1531 Ga0207681_10024175
1532 Ga0207681_10063461
1533 Ga0207694_10049326
1534 Ga0207694_10096452
1535 Ga0207694_10217460
1536 Ga0207694_10251506
1537 Ga0207650_10176304
1538 Ga0207659_10006052
1539 Ga0207687_10010398
1540 Ga0207687_10062424
1541 Ga0207700_10252302
1542 Ga0207690_10000040
1543 Ga0207706_10012447
1544 Ga0207706_10196415
1545 Ga0207670_10065604
1546 Ga0207670_10274235
1547 Ga0207665_10026036
1548 Ga0207665_10462882
1549 Ga0207691_10003458
1550 Ga0207691_10056855
1551 Ga0207711_10004182
1552 Ga0207711_10007645
1553 Ga0207711_10101453
1554 Ga0207711_10247003
1555 Ga0207661_10223831
1556 Ga0207679_10158804
1557 Ga0207667_10002770
1558 Ga0207667_10007228
1559 Ga0207651_10000299
1560 Ga0207651_10085542
1561 Ga0207712_10003324
1562 Ga0207712_10452111
1563 Ga0207668_10159205
1564 Ga0207678_10002359
1565 Ga0207678_10021510
1566 Ga0207678_10066655
1567 Ga0207708_10007971
1568 Ga0207708_10037895
1569 Ga0207702_10230241
1570 Ga0207641_10035820
1571 Ga0207648_10018611
1572 Ga0207648_10025670
1573 Ga0207674_10039350
1574 Ga0207675_100002950
1575 Ga0207675_100025458
1576 Ga0207675_100040413
1577 Ga0207675_100198935
1578 Ga0207675_100415533
1579 Ga0207675_100773829
1580 Ga0207683_10099306
1581 Ga0207683_10119170
1582 Ga0207683_10133739
1583 Ga0207698_10018564
1584 Ga0209371_1000325
1585 Ga0209371_1000766
1586 Ga0209371_1004858
1587 Ga0209971_1037991
1588 Ga0209813_10062220
1589 Ga0207428_10031694
1590 Ga0268266_10000630
1591 Ga0268266_10142463
1592 Ga0268266_10338010
1593 Ga0265334_10000192
1594 Ga0265318_10004269
1595 Ga0307515_10000062
1596 Ga0307515_10011102
1597 Ga0307515_10063273
1598 Ga0265338_10028960
1599 Ga0265338_10032666
1600 Ga0268256_1006955
1601 Ga0268256_1013276
1602 Ga0265330_10014351
1603 Ga0265328_10004474
1604 Ga0265325_10026335
1605 Ga0265325_10079571
1606 Ga0265339_10020277
1607 Ga0265331_10005565
1608 Ga0265327_10025641
1609 Ga0265327_10042408
1610 Ga0265316_10015358
1611 Ga0265316_10050777
1612 Ga0307513_10017125
1613 Ga0307513_10258902
1614 Ga0307509_10000781
1615 Ga0307509_10140386
1616 Ga0307408_100000531
1617 Ga0307408_100006732
1618 Ga0307408_100015316
1619 Ga0307408_100025974
1620 Ga0307408_100049899
1621 Ga0307408_100223034
1622 Ga0265313_10009218
1623 Ga0265314_10051139
1624 Ga0265314_10215541
1625 Ga0265342_10036360
1626 Ga0307516_10102046
1627 Ga0307405_10228874
1628 Ga0307518_10017517
1629 Ga0307412_10000056
1630 Ga0307412_10000313
1631 Ga0307409_100183810
1632 Ga0307416_100003671
1633 Ga0307416_100006357
1634 Ga0307416_100037534
1635 Ga0307411_10083184
1636 Ga0307415_100236031
1637 Ga0316593_10013988
1638 Ga0373923_0057757
1639 Ga0373954_0003620
1640 Ga0373954_0073056
1641 Ga0373956_0112634
1642 Ga0373957_0021631
1643 Ga0373931_0122600
1644 Ga0373935_0034565
1645 Ga0373927_0056620
1646 Ga0373927_0135245
1647 Ga0373947_0012484
1648 Ga0373937_0144790
1649 Ga0373937_0203611
1650 Ga0316582_0049440
1651 Ga0373925_0376705
1652 Ga0395899_0000080
1653 Ga0395900_0000087
1654 Ga0395900_0000556
1655 Ga0395900_0001157
1656 Ga0395900_0061736
1657 Ga0395900_0299986
1658 Ga0395898_0000448
1659 Ga0395898_0000800
1660 Ga0395905_0000117
1661 Ga0395905_0001371
1662 Ga0395905_0020972
1663 Ga0395905_0034300
1664 Ga0395905_0050883
1665 Ga0395905_0385273
1666 Ga0395901_0487379
1667 Ga0400487_28356
1668 Ga0436365_1278966
1669 Ga0436360_1136634
1670 Ga0436361_0025205
1671 Ga0436361_0044305
1672 Ga0436361_0049092
1673 Ga0436361_0209856
1674 Ga0436361_0250234
1675 Ga0436361_0297903
1676 Ga0436361_0433430
1677 Ga0436361_0470837
1678 Ga0436361_0580915
1679 Ga0436361_0839867
1680 Ga0436361_0913791
1681 Ga0436361_0956051
1682 Ga0436361_1020767
1683 Ga0436361_1101895
1684 Ga0436361_1180414
1685 Ga0436361_1190118
1686 Ga0439436_0000549
1687 Ga0439465_0004524
1688 Ga0451797_0505633
1689 Ga0451833_1218993
1690 Ga0451845_0311299
1691 Ga0451853_2193203
1692 Ga0439433_0001392
1693 Ga0439445_0001193
1694 Ga0439432_002821
1695 Ga0439449_0003939
1696 Ga0439452_001555
1697 Ga0450920_022606
1698 Ga0439446_0018853
1699 Ga0450918_000029
1700 Ga0451577_0000096
1701 Ga0451577_0000256
1702 Ga0451577_0001289
1703 Ga0451577_0003168
1704 Ga0451577_0005291
1705 Ga0451577_0007875
1706 Ga0451577_0037915
1707 Ga0451577_0066410
1708 Ga0451577_0075027
1709 Ga0451577_0288103
1710 Ga0466969_0001645
1711 Ga0466969_0008945
1712 Ga0466969_0025962
1713 Ga0466972_0000140
1714 Ga0466973_0013087
1715 Ga0453683_0003537
1716 Ga0453683_0263696
1717 Ga0466965_0009616
1718 Ga0466965_0019640
1719 Ga0466966_0000070
1720 Ga0466966_0002513
1721 Ga0466966_0010700
1722 Ga0466966_0026858
1723 Ga0466961_0000274
1724 Ga0466961_0000296
1725 Ga0466961_0021297
1726 Ga0466963_0001034
1727 Ga0466963_0003397
1728 Ga0466963_0003741
1729 Ga0466964_0003298
1730 Ga0466964_0032719
1731 Ga0453684_0000842
1732 Ga0453684_0002108
1733 Ga0453684_0010441
1734 Ga0453684_0021746
1735 Ga0453684_0090971
1736 Ga0453684_0102117
1737 Ga0453684_0200476
1738 Ga0453684_0270730
1739 Ga0466971_0006136
1740 Ga0466971_0030118
1741 Ga0466968_0008623
1742 Ga0466968_0090109
1743 Ga0466970_0015274
1744 Ga0466970_0025747
1745 Ga0466970_0057543
1746 Ga0466970_0073486
1747 Ga0466957_0000633
1748 Ga0466957_0001619
1749 Ga0466957_0013598
1750 Ga0466957_0013790
1751 Ga0466957_0019220
1752 Ga0466957_0021719
1753 Ga0466957_0113603
1754 Ga0466959_0001210
1755 Ga0466959_0008161
1756 Ga0466959_0031735
1757 Ga0466959_0190336
1758 Ga0451576_0000494
1759 Ga0451576_0001170
1760 Ga0451576_0135204
1761 Ga0466958_0001446
1762 Ga0466958_0001792
1763 Ga0466958_0003938
1764 Ga0466967_0465587
1765 Ga0495617_041990
1766 Ga0495627_000011
1767 Ga0495592_0007865
1768 Ga0495592_0023491
1769 Ga0495603_0002789
1770 Ga0495603_0005119
1771 Ga0495590_0000842
1772 Ga0495590_0001030
1773 Ga0495590_0002642
1774 Ga0495590_0009722
1775 Ga0495590_0015583
1776 Ga0495591_000765
1777 Ga0495591_034295
1778 Ga0495629_0000465
1779 Ga0495629_0000664
1780 Ga0495629_0002046
1781 Ga0495629_0010142
1782 Ga0495629_0019324
1783 Ga0495629_0214057
1784 Ga0495638_0010372
1785 Ga0495638_0080946
1786 Ga0495641_0008326
1787 Ga0495651_0019962
1788 Ga0495651_0026530
1789 Ga0495651_0130198
1790 Ga0495651_0162523
1791 Ga0495653_0002551
1792 Ga0495653_0004428
1793 Ga0495653_0004792
1794 Ga0495653_0012941
1795 Ga0495653_0032216
1796 Ga0495653_0119736
1797 Ga0495650_0001754
1798 Ga0495650_0002590
1799 Ga0495650_0004755
1800 Ga0495580_0004101
1801 Ga0495580_0004345
1802 Ga0495580_0004858
1803 Ga0495580_0006675
1804 Ga0495580_0010114
1805 Ga0495580_0023683
1806 Ga0495580_0043417
1807 Ga0495580_0059899
1808 Ga0495580_0071281
1809 Ga0495580_0101621
1810 Ga0495582_0000577
1811 Ga0495582_0026755
1812 Ga0495582_0055071
1813 Ga0495582_0207224
1814 Ga0495605_0001964
1815 Ga0495605_0003997
1816 Ga0495605_0007585
1817 Ga0495605_0085265
1818 Ga0495664_0000331
1819 Ga0495585_0018266
1820 Ga0495596_0009852
1821 Ga0495607_0000153
1822 Ga0495607_0076887
1823 Ga0495607_0137256
1824 Ga0495583_0011149
1825 Ga0495606_0000433
1826 Ga0495606_0015098
1827 Ga0495606_0016007
1828 Ga0495606_0056810
1829 Ga0495606_0070506
1830 Ga0495608_0006806
1831 Ga0495608_0013153
1832 Ga0495608_0061927
1833 Ga0495608_0130710
1834 Ga0495616_0000234
1835 Ga0495616_0034804
1836 Ga0495618_0001925
1837 Ga0495618_0013435
1838 Ga0495620_0023214
1839 Ga0495620_0050404
1840 Ga0495628_0015152
1841 Ga0495628_0017374
1842 Ga0495628_0021727
1843 Ga0495628_0031277
1844 Ga0495628_0049658
1845 Ga0495628_0082423
1846 Ga0495628_0085744
1847 Ga0495628_0100160
1848 Ga0495630_0002428
1849 Ga0495630_0006450
1850 Ga0495630_0006602
1851 Ga0495630_0010033
1852 Ga0495630_0012786
1853 Ga0495630_0354652
1854 Ga0495632_0004583
1855 Ga0495643_0097777
1856 Ga0495644_0061324
1857 Ga0495648_0029393
1858 Ga0495648_0030733
1859 Ga0495648_0079767
1860 Ga0495648_0081004
1861 Ga0495663_0006383
1862 Ga0495666_0006771
1863 Ga0495666_0009632
1864 Ga0495666_0011613
1865 Ga0495666_0027810
1866 Ga0495666_0034417
1867 Ga0495652_0016075
1868 Ga0495652_0030679
1869 Ga0495652_0056480
1870 Ga0495654_0012995
1871 Ga0495654_0061372
1872 Ga0495654_0065534
1873 Ga0495665_0001459
1874 Ga0495665_0006630
1875 Ga0495665_0016829
1876 Ga0495665_0044772
1877 Ga0495665_0085131
1878 Ga0495665_0186810
1879 Ga0495640_0010529
1880 Ga0495640_0018994
1881 Ga0495640_0096125
1882 Ga0495640_0159241
1883 Ga0495640_0189107
1884 Ga0495586_0003609
1885 Ga0495586_0097168
1886 Ga0495586_0098974
1887 Ga0495586_0205709
1888 Ga0495586_0262489
1889 Ga0495587_0001543
1890 Ga0495587_0003899
1891 Ga0495587_0063834
1892 Ga0495587_0074676
1893 Ga0495621_0000689
1894 Ga0495621_0001595
1895 Ga0495597_0000542
1896 Ga0495597_0017543
1897 Ga0495597_0037036
1898 Ga0495645_0000582
1899 Ga0495645_0004295
1900 Ga0495645_0005517
1901 Ga0495645_0006959
1902 Ga0495645_0066532
1903 Ga0495645_0123803
1904 Ga0495622_0006058
1905 Ga0495622_0069022
1906 Ga0495633_0014003
1907 Ga0495667_0025517
1908 Ga0495656_0050364
1909 Ga0495634_0007523
1910 Ga0495634_0027591
1911 Ga0495634_0053834
1912 Ga0495611_0124316
1913 Ga0495625_0012680
1914 Ga0495625_0135755
1915 Ga0495625_0204836
1916 Ga0495635_0005253
1917 Ga0495635_0007081
1918 Ga0495635_0008059
1919 Ga0495635_0022329
1920 Ga0495635_0112884
1921 Ga0495661_0017422
1922 Ga0495588_0078532
1923 Ga0495657_0147267
1924 Ga0495657_0200898
1925 Ga0495599_0015330
1926 Ga0495599_0040909
1927 Ga0495599_0088879
1928 Ga0495623_0006038
1929 Ga0495623_0013415
1930 Ga0495623_0016411
1931 Ga0495623_0028079
1932 Ga0495623_0070502
1933 Ga0495623_0184793
1934 Ga0495646_0000772
1935 Ga0495646_0003040
1936 Ga0495646_0006796
1937 Ga0495646_0028155
1938 Ga0495646_0039554
1939 Ga0495646_0044952
1940 Ga0495646_0063689
1941 Ga0495647_0003224
1942 Ga0495658_0013494
1943 Ga0495658_0014311
1944 Ga0495669_0026048
1945 Ga0495613_0002584
1946 Ga0495613_0015119
1947 Ga0495613_0043589
1948 Ga0495613_0084658
1949 Ga0495613_0258920
1950 Ga0495624_0017117
1951 Ga0495624_0027568
1952 Ga0495624_0053286
1953 Ga0495624_0074621
1954 Ga0495624_0092295
1955 Ga0495624_0182649
1956 Ga0495670_0005977
1957 Ga0495671_0042506
1958 Ga0495649_0011563
1959 Ga0495649_0022313
1960 Ga0495649_0028030
1961 Ga0495649_0030777
1962 Ga0495589_0004671
1963 Ga0495589_0006429
1964 Ga0495589_0042176
1965 Ga0495589_0070299
1966 Ga0495589_0092990
1967 Ga0495600_0002240
1968 Ga0495600_0010921
1969 Ga0495600_0157605
1970 Ga0495660_0002284
1971 Ga0495581_0006028
1972 Ga0495581_0096485
1973 Ga0495581_0118487
1974 Ga0495604_0001471
1975 Ga0495604_0007351
1976 Ga0495604_0010243
1977 Ga0495604_0010861
1978 Ga0495604_0087771
1979 Ga0495636_0105202
1980 Ga0495674_0017363
1981 Ga0495674_0047032
1982 Ga0495674_0052410
1983 Ga0495674_0059707
1984 Ga0495674_0142191
1985 Ga0495674_0225338
1986 Ga0495674_0282417
1987 Ga0495672_0027576
1988 Ga0495672_0043622
1989 Ga0495672_0123778
1990 Ga0495676_0001803
1991 Ga0495676_0026801
1992 Ga0495676_0142373
1993 Ga0495680_0007467
1994 Ga0495680_0037224
1995 Ga0495680_0081847
1996 Ga0495680_0084418
1997 Ga0495680_0175412
1998 Ga0495683_0001162
1999 Ga0495683_0005126
2000 Ga0495683_0012500
2001 Ga0495683_0022993
2002 Ga0495683_0046878
2003 Ga0495687_000216
2004 Ga0495687_001805
2005 Ga0495675_0004754
2006 Ga0495675_0012407
2007 Ga0495675_0018680
2008 Ga0495675_0029499
2009 Ga0495675_0052892
2010 Ga0495675_0076962
2011 Ga0495675_0079413
2012 Ga0495675_0150316
2013 Ga0495679_000413
2014 Ga0495679_001253
2015 Ga0495679_003515
2016 Ga0495673_0004937
2017 Ga0495673_0024457
2018 Ga0495673_0050044
2019 Ga0495681_0045272
2020 Ga0495684_0000521
2021 Ga0495684_0078249
2022 Ga0495684_0172922
2023 Ga0495686_0037369
2024 Ga0495593_0004599
2025 Ga0495593_0026339
2026 Ga0495593_0029327
2027 Ga0495593_0049474
2028 Ga0495593_0105212
2029 Ga0495593_0132743
2030 Ga0495602_0010289
2031 Ga0495602_0011139
2032 Ga0495602_0015826
2033 Ga0495602_0026876
2034 Ga0495602_0059284
2035 Ga0495602_0070012
2036 Ga0495602_0106427
2037 Ga0495602_0124376
2038 Ga0495602_0212179
2039 Ga0495614_0000067
2040 Ga0495614_0007051
2041 Ga0495614_0065601
2042 Ga0495626_0000105
2043 Ga0495626_0022568
2044 Ga0496100_0000523
2045 Ga0496100_0012549
2046 Ga0496100_0076423
2047 Ga0496100_0189441
2048 Ga0496101_0002493
2049 Ga0496101_0042288
2050 Ga0496101_0047186
2051 Ga0496101_0074379
2052 Ga0496101_0097767
2053 Ga0496101_0149015
2054 Ga0496102_0000074
2055 Ga0496102_0009040
2056 Ga0496102_0009565
2057 Ga0496102_0202261
2058 Ga0496102_0563126
2059 Ga0496103_0001532
2060 Ga0496103_0005147
2061 Ga0496103_0111526
2062 Ga0496104_0029298
2063 Ga0496104_0042090
2064 Ga0496104_0109848
2065 Ga0496104_0266001
2066 Ga0496104_0293329
2067 Ga0496104_0323779
2068 Ga0496105_0055060
2069 Ga0496105_0101000
2070 Ga0496105_0185519
2071 Ga0496106_0001248
2072 Ga0496106_0001808
2073 Ga0496106_0043216
2074 Ga0496106_0043968
2075 Ga0496106_0121132
2076 Ga0496107_0090605
2077 Ga0496107_0117202
2078 Ga0496107_0125150
2079 Ga0496107_0146943
2080 Ga0496108_0030248
2081 Ga0496108_0093854
2082 Ga0496109_0019061
2083 Ga0496109_0309810
2084 Ga0496110_0000450
2085 Ga0496110_0022640
2086 Ga0496110_0540879
2087 Ga0496112_0005931
2088 Ga0496112_0011799
2089 Ga0496112_0066722
2090 Ga0496112_0137211
2091 Ga0496112_0396280
2092 Ga0496113_0003925
2093 Ga0496113_0068501
2094 Ga0496114_0000572
2095 Ga0496114_0003283
2096 Ga0496114_0149289
2097 Ga0496114_0226778
2098 Ga0496115_0005371
2099 Ga0496115_0149046
2100 Ga0496115_0281660
2101 Ga0496116_0001318
2102 Ga0496116_0017662
2103 Ga0496116_0079785
2104 Ga0496117_0004062
2105 Ga0496117_0011401
2106 Ga0496117_0017703
2107 Ga0496117_0017755
2108 Ga0496117_0041645
2109 Ga0496117_0130320
2110 Ga0496118_0001851
2111 Ga0496118_0005204
2112 Ga0496118_0006098
2113 Ga0496118_0009426
2114 Ga0496118_0018288
2115 Ga0496118_0018744
2116 Ga0496118_0036533
2117 Ga0496121_0000306
2118 Ga0496121_0002426
2119 Ga0496121_0006168
2120 Ga0496121_0015481
2121 Ga0496121_0017741
2122 Ga0496121_0051991
2123 Ga0496121_0067128
2124 Ga0496121_0077258
2125 Ga0496121_0100695
2126 Ga0496122_0000865
2127 Ga0496122_0004543
2128 Ga0496123_0000203
2129 Ga0496123_0008097
2130 Ga0496124_0002427
2131 Ga0496124_0008332
2132 Ga0496124_0031972
2133 Ga0496124_0057514
2134 Ga0496125_0019818
2135 Ga0496125_0034344
2136 Ga0496126_0001579
2137 Ga0496126_0002578
2138 Ga0496126_0002619
2139 Ga0496126_0003244
2140 Ga0496126_0009708
2141 Ga0496126_0010990
2142 Ga0496126_0189476
2143 Ga0501034_0062153
2144 Ga0501036_0024209
2145 Ga0501040_0010800
2146 Ga0501041_0054375
2147 Ga0501042_0096044
2148 Ga0501042_0124198
2149 Ga0501043_0212561
2150 Ga0501047_0256216
2151 Ga0501048_0034392
2152 Ga0501072_0029953
2153 Ga0501073_0004074
2154 Ga0501074_0164906
2155 Ga0501075_0025389
2156 Ga0501076_0004740
2157 Ga0501076_0039276
2158 Ga0501077_0121301
2159 Ga0501227_004557
2160 Ga0501079_0008595
2161 Ga0501080_0028440
2162 Ga0501080_0248761
2163 Ga0501081_0028601
2164 Ga0501035_0027081
2165 Ga0501035_0085549
2166 Ga0501044_0001185
2167 nmdc:mga03683_64480_c1
2168 nmdc:mga00v17_171444_c1
2169 nmdc:mga00v17_18346_c1
2170 nmdc:mga07m45_57654_c1
2171 nmdc:mga05p37_18968_c1
2172 nmdc:mga05p37_85283_c1
2173 nmdc:mga09592_144219_c1
2174 nmdc:mga09592_19691_c1
2175 nmdc:mga09592_30224_c1
2176 nmdc:mga09592_89662_c1
2177 nmdc:mga0qj67_27241_c1
2178 nmdc:mga0qj67_401393_c1
2179 nmdc:mga0qj67_4762_c1
2180 nmdc:mga06r32_176_c1
2181 nmdc:mga06r32_39557_c1
2182 nmdc:mga06r32_80886_c1
2183 nmdc:mga08y16_65777_c1
2184 nmdc:mga0n895_107426_c1
2185 nmdc:mga0n895_90712_c1
2186 nmdc:mga08x19_17651_c1
2187 Ga0495612_0002014
2188 Ga0500644_0009381
2189 Ga0500651_0000066
2190 Ga0500566_0045874
2191 Ga0500556_0001052
2192 Ga0500642_0015279
2193 Ga0500568_0000481
2194 Ga0500568_0011636
2195 Ga0500622_0001405
2196 Ga0500622_0007370
2197 Ga0500637_0081510
2198 Ga0501084_0094903
2199 Ga0501082_0003494
2200 Ga0501082_0144033
2201 Ga0466962_0001530
2202 Ga0466962_0006704
2203 Ga0466962_0022542
2204 Ga0466962_0048264
2205 Ga0466962_0076703
2206 Ga0530510_0029184
2207 Ga0530510_0244849
2208 2501074061
2209 2501084103
2210 2501414372
2211 2509130830
2212 2510252567
2213 2511093345
2214 2511099795
2215 2511102434
2216 2512348425
2217 2513556125
2218 2513564311
2219 2513962609
2220 2514050885
2221 2515684844
2222 2516022247
2223 2519457531
2224 2527080604
2225 2563061539
2226 2585294134
2227 2599741059
2228 2599748366
2229 2600210278
2230 2600813817
2231 2643792050
2232 2643980687
2233 2644122111
2234 2644216469
2235 2676745797
2236 2713478596
2237 2719641665
2238 2723879652
2239 2738824012
2240 2738836403
2241 2738877933
2242 2739189639
2243 2739224526
2244 2739612183
2245 2746087241
2246 2746093252
2247 2753566184
2248 2792837079
2249 2809031996
2250 2817259722
2251 2817277391
2252 2817453557
2253 2819624180
2254 2819636812
2255 2842332172
2256 2842356376
2257 2842461270
2258 2855734606
2259 2855770196
2260 2856289391
2261 2857362263
2262 2857538479
2263 2857578707
2264 2858955747
2265 2863426480
2266 2870069386
2267 2881414417
2268 2881930281
2269 2883091421
2270 2885197017
2271 2885272375
2272 2887377881
2273 2894514503
2274 2900637084
2275 2902686693
2276 2904481617
2277 2904490130
2278 2904569356
2279 2904576807
2280 2904624850
2281 2919533299
2282 2920114129
2283 2921651544
2284 2928114195
2285 2928141057
2286 2928163065
2287 2928170185
2288 2928176321
2289 2928509190
2290 2928542033
2291 2941481921
2292 2945934552
2293 2974322330
2294 2981996088
2295 2989393450
2296 2990704890
2297 642426554
2298 642419614
2299 642594600
2300 642623188
2301 8003956804
2302 8018847945
2303 8020813933
2304 8020939031
2305 8020947746
2306 8020953422
2307 8021127529
2308 8039099679
2309 8040171510
2310 8040174124
2311 8048749758
2312 8055227955
2313 8055269439
2314 8055307399

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

149

311

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9597 66 327
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9584 64 327
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9561 66 327
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9548 64 327
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.8387 109 269
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9597 64 327 3.90.420.10
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9561 64 327 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8387 109 269 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8337 101 259 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7885 101 259 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9959 95 240
AF-A0A7V8JR83-F1-model_v4 Protein-methionine-sulfoxide reductase catalytic subunit MsrP 0.9921 78 197
AF-A0A0L8ELQ7-F1-model_v4 deleted 0.9918 64 331
AF-A0A1Q3J469-F1-model_v4 deleted 0.9908 106 331
AF-A0A7S1GSH0-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9901 110 279

Map