F490968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1158 | 472 | 2316 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300025294|Ga0209025_1066093|Ga0209025_10660931 |
| Length | 311 |
| Sequence | MHCTQALTALARPALPWHAKYRRGCAPFVTDKVFMFSAISPGELAFLAASLIVAGAITGILAGLFGVGGGAVIVPILYEIFRIIGVPEEVRMPLCVGTSLAIIIPTSIRSFNAHRAKGLVDLSILKIWAVPVVLGVLAGSYIARFAPPDLFKIIFVLVAVLSALRLLFAADKWKFGEDLPGKPVMVGYGGLIGVLSALMGIGGGQLSSLFMTFYGRPIHQAIATSSGLGVLISIPGALGFIYAGWPKMDLLPPLSLGYVSFIGFLLFIPTSIWMAPVGARMAHRLSKRKLEVVFGIFLLTVAGRFIWSLLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 21 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 22 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 28 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 162 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 163 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 245 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 251 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 260 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 262 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 264 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 265 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 266 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 267 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 283 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 290 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 292 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 294 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 295 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 296 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 299 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 300 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 303 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 304 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 305 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 306 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 307 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 308 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 309 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 310 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 396 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 423 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 425 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 426 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 427 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 428 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 440 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 443 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 445 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 446 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 449 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 450 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 451 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 452 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 453 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 454 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 455 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 458 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 459 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 460 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 461 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 462 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 463 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 464 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 465 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 466 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 467 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 468 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 469 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 470 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 471 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 472 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 0 |
| Isolates | 1.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.53 |
| Nodule | 0.52 |
| Rhizoplane | 4.66 |
| Rhizosphere | 87.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209025_1066093 | 3300025294 | Bacteria | 1316 |
| 2 | 2214767425 | 2209111006 | Bacteria | 2786 |
| 3 | ARcpr5oldR_c000015 | 3300000041 | Bacteria | 37040 |
| 4 | ARSoilYngRDRAFT_c00006 | 3300000042 | Bacteria | 34836 |
| 5 | ARcpr5yngRDRAFT_c000041 | 3300000043 | Bacteria | 20456 |
| 6 | ARSoilOldRDRAFT_c000020 | 3300000044 | Bacteria | 36475 |
| 7 | ARCol0oldRDRAFT_c00041 | 3300000045 | Bacteria | 9974 |
| 8 | ARCol0yngRDRAFT_1000465 | 3300000652 | Bacteria | 4874 |
| 9 | JGI24746J21847_1001428 | 3300001977 | Bacteria | 3802 |
| 10 | JGI24747J21853_1002861 | 3300001978 | Unclassified | 1451 |
| 11 | JGI24739J22299_10000344 | 3300001989 | Bacteria | 15875 |
| 12 | JGI24737J22298_10000203 | 3300001990 | Bacteria | 19319 |
| 13 | JGI24737J22298_10023970 | 3300001990 | Bacteria | 1933 |
| 14 | JGI24750J21931_1000159 | 3300002070 | Bacteria | 11336 |
| 15 | JGI24745J21846_1000003 | 3300002073 | Bacteria | 15974 |
| 16 | JGI24748J21848_1000190 | 3300002074 | Bacteria | 7872 |
| 17 | JGI24738J21930_10000042 | 3300002075 | Bacteria | 24954 |
| 18 | JGI24749J21850_1000350 | 3300002076 | Bacteria | 6870 |
| 19 | JGI24035J26624_1000010 | 3300002126 | Bacteria | 13491 |
| 20 | JGI24742J22300_10000016 | 3300002244 | Bacteria | 26706 |
| 21 | JGI25159J45721_1004563 | 3300002987 | Bacteria | 4563 |
| 22 | JGI25151J46595_10000040 | 3300003187 | Bacteria | 176750 |
| 23 | JGI25404J52841_10000207 | 3300003659 | Bacteria | 7108 |
| 24 | Ga0055526_1000351 | 3300003771 | Bacteria | 37413 |
| 25 | Ga0055526_1001693 | 3300003771 | Bacteria | 15409 |
| 26 | Ga0055526_1003504 | 3300003771 | Bacteria | 9924 |
| 27 | Ga0055524_1000023 | 3300003775 | Bacteria | 221408 |
| 28 | JGI25405J52794_10003103 | 3300003911 | Bacteria | 2892 |
| 29 | Ga0065165_1000218 | 3300005262 | Bacteria | 100161 |
| 30 | Ga0065717_1002525 | 3300005276 | Bacteria | 1865 |
| 31 | Ga0065716_1002178 | 3300005277 | Bacteria | 2134 |
| 32 | Ga0065704_10073457 | 3300005289 | Bacteria | 7145 |
| 33 | Ga0065712_10002616 | 3300005290 | Bacteria | 7662 |
| 34 | Ga0065712_10068673 | 3300005290 | Bacteria | 9438 |
| 35 | Ga0065712_10116506 | 3300005290 | Bacteria | 1735 |
| 36 | Ga0065712_10119855 | 3300005290 | Bacteria | 1682 |
| 37 | Ga0065715_10001423 | 3300005293 | Bacteria | 13648 |
| 38 | Ga0065715_10088987 | 3300005293 | Bacteria | 18087 |
| 39 | Ga0065715_10200234 | 3300005293 | Unclassified | 1365 |
| 40 | Ga0065707_10107116 | 3300005295 | Bacteria | 2568 |
| 41 | Ga0070658_10146191 | 3300005327 | Bacteria | 1977 |
| 42 | Ga0070658_10344368 | 3300005327 | Bacteria | 1275 |
| 43 | Ga0070676_10000784 | 3300005328 | Bacteria | 15682 |
| 44 | Ga0070676_10016846 | 3300005328 | Bacteria | 4040 |
| 45 | Ga0070683_100000114 | 3300005329 | Bacteria | 52980 |
| 46 | Ga0070683_100088017 | 3300005329 | Bacteria | 2913 |
| 47 | Ga0070683_100173151 | 3300005329 | Bacteria | 2049 |
| 48 | Ga0070683_100232230 | 3300005329 | Bacteria | 1754 |
| 49 | Ga0070683_100335950 | 3300005329 | Unclassified | 1438 |
| 50 | Ga0070690_100000064 | 3300005330 | Bacteria | 53027 |
| 51 | Ga0070690_100015359 | 3300005330 | Plasmid | 4566 |
| 52 | Ga0070690_100056719 | 3300005330 | Bacteria | 2512 |
| 53 | Ga0070670_100002373 | 3300005331 | Bacteria | 15518 |
| 54 | Ga0070670_100005338 | 3300005331 | Bacteria | 10835 |
| 55 | Ga0070670_100054895 | 3300005331 | Bacteria | 3420 |
| 56 | Ga0070670_100509442 | 3300005331 | Bacteria | 1071 |
| 57 | Ga0070670_100524850 | 3300005331 | Unclassified | 1055 |
| 58 | Ga0070677_10000193 | 3300005333 | Bacteria | 20923 |
| 59 | Ga0068869_100000020 | 3300005334 | Bacteria | 66561 |
| 60 | Ga0070666_10005751 | 3300005335 | Bacteria | 7616 |
| 61 | Ga0070680_100000242 | 3300005336 | Bacteria | 36144 |
| 62 | Ga0070680_100049833 | 3300005336 | Bacteria | 3415 |
| 63 | Ga0070680_100059770 | 3300005336 | Bacteria | 3119 |
| 64 | Ga0070680_100192106 | 3300005336 | Bacteria | 1720 |
| 65 | Ga0070680_100362109 | 3300005336 | Bacteria | 1234 |
| 66 | Ga0070682_100000224 | 3300005337 | Bacteria | 41040 |
| 67 | Ga0070682_100016367 | 3300005337 | Bacteria | 4310 |
| 68 | Ga0070682_100075915 | 3300005337 | Unclassified | 2162 |
| 69 | Ga0070682_100318486 | 3300005337 | Bacteria | 1148 |
| 70 | Ga0068868_100003038 | 3300005338 | Bacteria | 11683 |
| 71 | Ga0068868_100005421 | 3300005338 | Bacteria | 8962 |
| 72 | Ga0068868_100327527 | 3300005338 | Bacteria | 1306 |
| 73 | Ga0070660_100000123 | 3300005339 | Bacteria | 48796 |
| 74 | Ga0070660_100075002 | 3300005339 | Bacteria | 2647 |
| 75 | Ga0070660_100480214 | 3300005339 | Unclassified | 1033 |
| 76 | Ga0070689_100000685 | 3300005340 | Bacteria | 20556 |
| 77 | Ga0070689_100010928 | 3300005340 | Bacteria | 6487 |
| 78 | Ga0070691_10001254 | 3300005341 | Bacteria | 10708 |
| 79 | Ga0070691_10088293 | 3300005341 | Bacteria | 1526 |
| 80 | Ga0070687_100000351 | 3300005343 | Bacteria | 15646 |
| 81 | Ga0070687_100016686 | 3300005343 | Bacteria | 3358 |
| 82 | Ga0070661_100000039 | 3300005344 | Bacteria | 102990 |
| 83 | Ga0070661_100144629 | 3300005344 | Bacteria | 1794 |
| 84 | Ga0070692_10062423 | 3300005345 | Bacteria | 1966 |
| 85 | Ga0070668_100003586 | 3300005347 | Bacteria | 11452 |
| 86 | Ga0070668_100128113 | 3300005347 | Unclassified | 2035 |
| 87 | Ga0070669_100000176 | 3300005353 | Bacteria | 55540 |
| 88 | Ga0070669_100073632 | 3300005353 | Bacteria | 2531 |
| 89 | Ga0070669_100204124 | 3300005353 | Bacteria | 1557 |
| 90 | Ga0070675_100000259 | 3300005354 | Bacteria | 34661 |
| 91 | Ga0070675_100254869 | 3300005354 | Bacteria | 1536 |
| 92 | Ga0070671_100005757 | 3300005355 | Bacteria | 9872 |
| 93 | Ga0070674_100000099 | 3300005356 | Bacteria | 40231 |
| 94 | Ga0070674_100018430 | 3300005356 | Bacteria | 4414 |
| 95 | Ga0070674_100193057 | 3300005356 | Bacteria | 1568 |
| 96 | Ga0070673_100018362 | 3300005364 | Bacteria | 4993 |
| 97 | Ga0070673_100359816 | 3300005364 | Bacteria | 1293 |
| 98 | Ga0070688_100000329 | 3300005365 | Bacteria | 24316 |
| 99 | Ga0070688_100050563 | 3300005365 | Bacteria | 2590 |
| 100 | Ga0070688_100207204 | 3300005365 | Bacteria | 1375 |
| 101 | Ga0070688_100368481 | 3300005365 | Bacteria | 1056 |
| 102 | Ga0070659_100005453 | 3300005366 | Bacteria | 9138 |
| 103 | Ga0070659_100094545 | 3300005366 | Bacteria | 2400 |
| 104 | Ga0070659_100323349 | 3300005366 | Bacteria | 1290 |
| 105 | Ga0070667_100001075 | 3300005367 | Bacteria | 24994 |
| 106 | Ga0070667_100021496 | 3300005367 | Bacteria | 5356 |
| 107 | Ga0070667_100267163 | 3300005367 | Bacteria | 1533 |
| 108 | Ga0070709_10002443 | 3300005434 | Bacteria | 10067 |
| 109 | Ga0070709_10029823 | 3300005434 | Bacteria | 3267 |
| 110 | Ga0070709_10205339 | 3300005434 | Bacteria | 1398 |
| 111 | Ga0070709_10221187 | 3300005434 | Bacteria | 1350 |
| 112 | Ga0070714_100015432 | 3300005435 | Bacteria | 6147 |
| 113 | Ga0070714_100015694 | 3300005435 | Bacteria | 6098 |
| 114 | Ga0070714_100035280 | 3300005435 | Bacteria | 4191 |
| 115 | Ga0070714_100043358 | 3300005435 | Bacteria | 3804 |
| 116 | Ga0070714_100138726 | 3300005435 | Bacteria | 2180 |
| 117 | Ga0070714_100311042 | 3300005435 | Bacteria | 1471 |
| 118 | Ga0070714_100543000 | 3300005435 | Bacteria | 1112 |
| 119 | Ga0070713_100000654 | 3300005436 | Bacteria | 22167 |
| 120 | Ga0070713_100001555 | 3300005436 | Bacteria | 14678 |
| 121 | Ga0070713_100014148 | 3300005436 | Bacteria | 5912 |
| 122 | Ga0070713_100060404 | 3300005436 | Bacteria | 3168 |
| 123 | Ga0070713_100066169 | 3300005436 | Bacteria | 3038 |
| 124 | Ga0070710_10000619 | 3300005437 | Bacteria | 16925 |
| 125 | Ga0070710_10003937 | 3300005437 | Bacteria | 7037 |
| 126 | Ga0070710_10025993 | 3300005437 | Bacteria | 3106 |
| 127 | Ga0070710_10044111 | 3300005437 | Bacteria | 2473 |
| 128 | Ga0070701_10000025 | 3300005438 | Bacteria | 38966 |
| 129 | Ga0070711_100010734 | 3300005439 | Bacteria | 5677 |
| 130 | Ga0070711_100024053 | 3300005439 | Bacteria | 3969 |
| 131 | Ga0070711_100041441 | 3300005439 | Bacteria | 3110 |
| 132 | Ga0070711_100058358 | 3300005439 | Bacteria | 2676 |
| 133 | Ga0070711_100073806 | 3300005439 | Bacteria | 2412 |
| 134 | Ga0070711_100090065 | 3300005439 | Bacteria | 2208 |
| 135 | Ga0070711_100138772 | 3300005439 | Bacteria | 1820 |
| 136 | Ga0070705_100037650 | 3300005440 | Bacteria | 2730 |
| 137 | Ga0070705_100130307 | 3300005440 | Bacteria | 1639 |
| 138 | Ga0070700_100002215 | 3300005441 | Bacteria | 9887 |
| 139 | Ga0070694_100006957 | 3300005444 | Bacteria | 6869 |
| 140 | Ga0070708_100023192 | 3300005445 | Bacteria | 5274 |
| 141 | Ga0070663_100000064 | 3300005455 | Bacteria | 45232 |
| 142 | Ga0070663_100014208 | 3300005455 | Bacteria | 5105 |
| 143 | Ga0070663_100060234 | 3300005455 | Bacteria | 2730 |
| 144 | Ga0070678_100001526 | 3300005456 | Bacteria | 12364 |
| 145 | Ga0070678_100043310 | 3300005456 | Bacteria | 3205 |
| 146 | Ga0070678_100043991 | 3300005456 | Bacteria | 3185 |
| 147 | Ga0070662_100023064 | 3300005457 | Bacteria | 4271 |
| 148 | Ga0070662_100025880 | 3300005457 | Bacteria | 4057 |
| 149 | Ga0070662_100051625 | 3300005457 | Bacteria | 2970 |
| 150 | Ga0070662_100141585 | 3300005457 | Bacteria | 1864 |
| 151 | Ga0070662_100271400 | 3300005457 | Bacteria | 1370 |
| 152 | Ga0070662_100448009 | 3300005457 | Bacteria | 1071 |
| 153 | Ga0070681_10000435 | 3300005458 | Bacteria | 33975 |
| 154 | Ga0070681_10032023 | 3300005458 | Bacteria | 5278 |
| 155 | Ga0070681_10051421 | 3300005458 | Bacteria | 4110 |
| 156 | Ga0070681_10063320 | 3300005458 | Bacteria | 3670 |
| 157 | Ga0070681_10074981 | 3300005458 | Bacteria | 3343 |
| 158 | Ga0070681_10125790 | 3300005458 | Bacteria | 2496 |
| 159 | Ga0068867_100002108 | 3300005459 | Bacteria | 13947 |
| 160 | Ga0068867_100025717 | 3300005459 | Bacteria | 4225 |
| 161 | Ga0070685_10003445 | 3300005466 | Bacteria | 8045 |
| 162 | Ga0070685_10012156 | 3300005466 | Bacteria | 4516 |
| 163 | Ga0074259_10047191 | 3300005507 | Bacteria | 1695 |
| 164 | Ga0070699_100361940 | 3300005518 | Bacteria | 1308 |
| 165 | Ga0070679_100002876 | 3300005530 | Bacteria | 15657 |
| 166 | Ga0070679_100117245 | 3300005530 | Bacteria | 2647 |
| 167 | Ga0070684_100001610 | 3300005535 | Bacteria | 16308 |
| 168 | Ga0070684_100142642 | 3300005535 | Bacteria | 2167 |
| 169 | Ga0070684_100178374 | 3300005535 | Bacteria | 1931 |
| 170 | Ga0070684_100207569 | 3300005535 | Bacteria | 1785 |
| 171 | Ga0070684_100359223 | 3300005535 | Bacteria | 1340 |
| 172 | Ga0068853_100005553 | 3300005539 | Bacteria | 9895 |
| 173 | Ga0068853_100323476 | 3300005539 | Bacteria | 1430 |
| 174 | Ga0070672_100000011 | 3300005543 | Bacteria | 80761 |
| 175 | Ga0070672_100129130 | 3300005543 | Bacteria | 2076 |
| 176 | Ga0070672_100263855 | 3300005543 | Bacteria | 1453 |
| 177 | Ga0070672_100304859 | 3300005543 | Bacteria | 1351 |
| 178 | Ga0070686_100000076 | 3300005544 | Bacteria | 71207 |
| 179 | Ga0070686_100002194 | 3300005544 | Bacteria | 10784 |
| 180 | Ga0070686_100067747 | 3300005544 | Bacteria | 2327 |
| 181 | Ga0070686_100115683 | 3300005544 | Bacteria | 1834 |
| 182 | Ga0070695_100003381 | 3300005545 | Bacteria | 9327 |
| 183 | Ga0070695_100018163 | 3300005545 | Bacteria | 4269 |
| 184 | Ga0070695_100025754 | 3300005545 | Bacteria | 3634 |
| 185 | Ga0070695_100237271 | 3300005545 | Bacteria | 1321 |
| 186 | Ga0070696_100038461 | 3300005546 | Bacteria | 3302 |
| 187 | Ga0070693_100000122 | 3300005547 | Bacteria | 34819 |
| 188 | Ga0070693_100074358 | 3300005547 | Bacteria | 2010 |
| 189 | Ga0070665_100034452 | 3300005548 | Bacteria | 5092 |
| 190 | Ga0070704_100002018 | 3300005549 | Bacteria | 11242 |
| 191 | Ga0070704_100008020 | 3300005549 | Bacteria | 6307 |
| 192 | Ga0070704_100017468 | 3300005549 | Bacteria | 4562 |
| 193 | Ga0070704_100051139 | 3300005549 | Bacteria | 2908 |
| 194 | Ga0070704_100105130 | 3300005549 | Bacteria | 2137 |
| 195 | Ga0068855_100035734 | 3300005563 | Bacteria | 5918 |
| 196 | Ga0068855_100246086 | 3300005563 | Bacteria | 1996 |
| 197 | Ga0070664_100000112 | 3300005564 | Bacteria | 53506 |
| 198 | Ga0070664_100227925 | 3300005564 | Bacteria | 1669 |
| 199 | Ga0070664_100320227 | 3300005564 | Unclassified | 1405 |
| 200 | Ga0070664_100483617 | 3300005564 | Bacteria | 1139 |
| 201 | Ga0068857_100000023 | 3300005577 | Bacteria | 86999 |
| 202 | Ga0068854_100004158 | 3300005578 | Bacteria | 9099 |
| 203 | Ga0068856_100000099 | 3300005614 | Bacteria | 83061 |
| 204 | Ga0068856_100127057 | 3300005614 | Unclassified | 2553 |
| 205 | Ga0068856_100169702 | 3300005614 | Unclassified | 2194 |
| 206 | Ga0068856_100907814 | 3300005614 | Unclassified | 900 |
| 207 | Ga0070702_100000005 | 3300005615 | Bacteria | 70200 |
| 208 | Ga0070702_100021306 | 3300005615 | Plasmid | 3408 |
| 209 | Ga0068852_100004502 | 3300005616 | Bacteria | 9856 |
| 210 | Ga0068852_100085751 | 3300005616 | Bacteria | 2806 |
| 211 | Ga0068852_100262158 | 3300005616 | Bacteria | 1660 |
| 212 | Ga0068852_100283878 | 3300005616 | Bacteria | 1597 |
| 213 | Ga0068859_100000503 | 3300005617 | Bacteria | 38475 |
| 214 | Ga0068859_100039458 | 3300005617 | Plasmid | 4736 |
| 215 | Ga0068859_100040577 | 3300005617 | Bacteria | 4671 |
| 216 | Ga0068859_100611665 | 3300005617 | Bacteria | 1182 |
| 217 | Ga0068864_100000112 | 3300005618 | Bacteria | 79688 |
| 218 | Ga0068864_100018108 | 3300005618 | Bacteria | 5878 |
| 219 | Ga0068864_100308582 | 3300005618 | Bacteria | 1483 |
| 220 | Ga0068864_100574723 | 3300005618 | Unclassified | 1091 |
| 221 | Ga0068866_10000977 | 3300005718 | Bacteria | 12586 |
| 222 | Ga0068866_10008375 | 3300005718 | Bacteria | 4356 |
| 223 | Ga0068866_10106410 | 3300005718 | Bacteria | 1557 |
| 224 | Ga0068861_100002096 | 3300005719 | Bacteria | 12937 |
| 225 | Ga0068861_100118714 | 3300005719 | Bacteria | 2131 |
| 226 | Ga0068851_10097376 | 3300005834 | Bacteria | 1557 |
| 227 | Ga0068870_10000021 | 3300005840 | Bacteria | 56319 |
| 228 | Ga0068870_10087663 | 3300005840 | Bacteria | 1733 |
| 229 | Ga0068863_100000227 | 3300005841 | Bacteria | 59675 |
| 230 | Ga0068863_100076196 | 3300005841 | Unclassified | 3173 |
| 231 | Ga0068858_100120781 | 3300005842 | Unclassified | 2450 |
| 232 | Ga0068858_100353397 | 3300005842 | Bacteria | 1408 |
| 233 | Ga0068858_100495126 | 3300005842 | Bacteria | 1180 |
| 234 | Ga0068860_100000511 | 3300005843 | Bacteria | 47927 |
| 235 | Ga0068860_100201784 | 3300005843 | Bacteria | 1927 |
| 236 | Ga0068860_100345907 | 3300005843 | Bacteria | 1463 |
| 237 | Ga0068860_100577693 | 3300005843 | Bacteria | 1128 |
| 238 | Ga0068862_100001866 | 3300005844 | Bacteria | 19089 |
| 239 | Ga0068862_100340316 | 3300005844 | Bacteria | 1389 |
| 240 | Ga0068862_100437335 | 3300005844 | Bacteria | 1230 |
| 241 | Ga0081455_10000153 | 3300005937 | Bacteria | 83186 |
| 242 | Ga0081455_10002775 | 3300005937 | Bacteria | 20627 |
| 243 | Ga0081455_10192128 | 3300005937 | Bacteria | 1536 |
| 244 | Ga0081538_10047178 | 3300005981 | Bacteria | 2645 |
| 245 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 246 | Ga0081540_1001662 | 3300005983 | Bacteria | 18923 |
| 247 | Ga0081540_1012674 | 3300005983 | Bacteria | 5531 |
| 248 | Ga0081540_1052135 | 3300005983 | Bacteria | 2017 |
| 249 | Ga0081539_10000423 | 3300005985 | Bacteria | 89970 |
| 250 | Ga0070717_10349038 | 3300006028 | Bacteria | 1323 |
| 251 | Ga0075365_10004253 | 3300006038 | Bacteria | 7549 |
| 252 | Ga0075365_10054906 | 3300006038 | Bacteria | 2643 |
| 253 | Ga0075365_10230580 | 3300006038 | Bacteria | 1300 |
| 254 | Ga0075365_10234229 | 3300006038 | Bacteria | 1289 |
| 255 | Ga0075365_10247944 | 3300006038 | Bacteria | 1251 |
| 256 | Ga0075363_100010796 | 3300006048 | Bacteria | 4354 |
| 257 | Ga0075363_100115199 | 3300006048 | Bacteria | 1496 |
| 258 | Ga0075432_10004763 | 3300006058 | Bacteria | 4618 |
| 259 | Ga0070715_10012842 | 3300006163 | Unclassified | 3060 |
| 260 | Ga0070715_10071977 | 3300006163 | Bacteria | 1547 |
| 261 | Ga0070716_100015557 | 3300006173 | Bacteria | 3912 |
| 262 | Ga0070716_100054784 | 3300006173 | Unclassified | 2279 |
| 263 | Ga0070712_100054314 | 3300006175 | Unclassified | 2800 |
| 264 | Ga0070712_100205026 | 3300006175 | Bacteria | 1552 |
| 265 | Ga0075367_10003172 | 3300006178 | Bacteria | 7754 |
| 266 | Ga0075367_10003813 | 3300006178 | Bacteria | 7267 |
| 267 | Ga0075367_10045316 | 3300006178 | Bacteria | 2581 |
| 268 | Ga0075367_10052558 | 3300006178 | Bacteria | 2412 |
| 269 | Ga0075366_10185370 | 3300006195 | Bacteria | 1264 |
| 270 | Ga0097621_100000013 | 3300006237 | Bacteria | 103062 |
| 271 | Ga0097621_100001495 | 3300006237 | Bacteria | 16032 |
| 272 | Ga0097621_100038999 | 3300006237 | Bacteria | 3814 |
| 273 | Ga0075370_10036683 | 3300006353 | Bacteria | 2754 |
| 274 | Ga0075370_10038169 | 3300006353 | Bacteria | 2703 |
| 275 | Ga0068871_100000064 | 3300006358 | Bacteria | 58283 |
| 276 | Ga0068871_100023154 | 3300006358 | Bacteria | 4799 |
| 277 | Ga0068871_100035623 | 3300006358 | Bacteria | 3956 |
| 278 | Ga0075428_100067278 | 3300006844 | Bacteria | 3922 |
| 279 | Ga0075428_100435492 | 3300006844 | Bacteria | 1405 |
| 280 | Ga0075430_100000646 | 3300006846 | Bacteria | 26596 |
| 281 | Ga0075430_100040915 | 3300006846 | Bacteria | 3922 |
| 282 | Ga0075430_100300780 | 3300006846 | Bacteria | 1327 |
| 283 | Ga0075431_100096301 | 3300006847 | Bacteria | 3055 |
| 284 | Ga0075431_100189975 | 3300006847 | Bacteria | 2105 |
| 285 | Ga0075433_10003920 | 3300006852 | Bacteria | 11526 |
| 286 | Ga0075433_10209676 | 3300006852 | Bacteria | 1732 |
| 287 | Ga0075433_10245366 | 3300006852 | Unclassified | 1590 |
| 288 | Ga0075434_100000109 | 3300006871 | Bacteria | 46918 |
| 289 | Ga0075434_100043968 | 3300006871 | Bacteria | 4431 |
| 290 | Ga0075434_100068843 | 3300006871 | Bacteria | 3527 |
| 291 | Ga0075434_100095466 | 3300006871 | Bacteria | 2979 |
| 292 | Ga0075429_100041545 | 3300006880 | Bacteria | 4005 |
| 293 | Ga0068865_100000088 | 3300006881 | Bacteria | 48315 |
| 294 | Ga0068865_100010435 | 3300006881 | Bacteria | 5782 |
| 295 | Ga0068865_100097144 | 3300006881 | Bacteria | 2149 |
| 296 | Ga0068865_100337805 | 3300006881 | Bacteria | 1216 |
| 297 | Ga0075436_100021761 | 3300006914 | Bacteria | 4401 |
| 298 | Ga0075436_100162541 | 3300006914 | Bacteria | 1574 |
| 299 | Ga0075436_100206844 | 3300006914 | Bacteria | 1391 |
| 300 | Ga0097620_100000503 | 3300006931 | Bacteria | 38475 |
| 301 | Ga0097620_100039461 | 3300006931 | Plasmid | 4736 |
| 302 | Ga0097620_100040574 | 3300006931 | Bacteria | 4671 |
| 303 | Ga0097620_100611664 | 3300006931 | Bacteria | 1182 |
| 304 | Ga0075435_100072374 | 3300007076 | Bacteria | 2816 |
| 305 | Ga0075435_100093336 | 3300007076 | Bacteria | 2487 |
| 306 | Ga0075435_100119913 | 3300007076 | Bacteria | 2194 |
| 307 | Ga0105251_10010716 | 3300009011 | Bacteria | 5288 |
| 308 | Ga0105240_10017252 | 3300009093 | Bacteria | 9739 |
| 309 | Ga0105240_10296212 | 3300009093 | Bacteria | 1852 |
| 310 | Ga0111539_10000196 | 3300009094 | Bacteria | 70998 |
| 311 | Ga0111539_10000376 | 3300009094 | Bacteria | 55320 |
| 312 | Ga0111539_10001836 | 3300009094 | Bacteria | 28237 |
| 313 | Ga0111539_10168910 | 3300009094 | Bacteria | 2556 |
| 314 | Ga0111539_10413268 | 3300009094 | Bacteria | 1571 |
| 315 | Ga0105245_10001381 | 3300009098 | Bacteria | 21973 |
| 316 | Ga0105245_10150658 | 3300009098 | Bacteria | 2199 |
| 317 | Ga0105245_10182194 | 3300009098 | Unclassified | 2007 |
| 318 | Ga0105247_10010673 | 3300009101 | Bacteria | 5546 |
| 319 | Ga0105247_10057028 | 3300009101 | Bacteria | 2414 |
| 320 | Ga0114129_10029360 | 3300009147 | Bacteria | 7790 |
| 321 | Ga0114129_10157162 | 3300009147 | Bacteria | 3108 |
| 322 | Ga0114129_10179567 | 3300009147 | Bacteria | 2882 |
| 323 | Ga0105243_10002817 | 3300009148 | Bacteria | 14441 |
| 324 | Ga0105243_10200057 | 3300009148 | Bacteria | 1751 |
| 325 | Ga0105241_10007352 | 3300009174 | Bacteria | 8100 |
| 326 | Ga0105241_10007728 | 3300009174 | Bacteria | 7903 |
| 327 | Ga0105241_10049693 | 3300009174 | Bacteria | 3195 |
| 328 | Ga0105242_10009592 | 3300009176 | Bacteria | 7420 |
| 329 | Ga0105242_10046720 | 3300009176 | Unclassified | 3513 |
| 330 | Ga0105248_10001979 | 3300009177 | Bacteria | 22762 |
| 331 | Ga0105248_10048562 | 3300009177 | Bacteria | 4761 |
| 332 | Ga0105248_10170960 | 3300009177 | Bacteria | 2449 |
| 333 | Ga0105248_10261581 | 3300009177 | Unclassified | 1948 |
| 334 | Ga0105248_10303982 | 3300009177 | Bacteria | 1796 |
| 335 | Ga0105237_10014351 | 3300009545 | Bacteria | 8289 |
| 336 | Ga0105237_10281731 | 3300009545 | Bacteria | 1665 |
| 337 | Ga0105237_10366520 | 3300009545 | Bacteria | 1445 |
| 338 | Ga0105237_10394327 | 3300009545 | Bacteria | 1389 |
| 339 | Ga0105237_10559544 | 3300009545 | Bacteria | 1150 |
| 340 | Ga0105238_10018663 | 3300009551 | Bacteria | 7063 |
| 341 | Ga0105238_10078408 | 3300009551 | Bacteria | 3293 |
| 342 | Ga0105238_10082426 | 3300009551 | Bacteria | 3206 |
| 343 | Ga0105238_10731992 | 3300009551 | Unclassified | 1002 |
| 344 | Ga0105249_10002341 | 3300009553 | Bacteria | 16462 |
| 345 | Ga0105249_10002423 | 3300009553 | Bacteria | 16185 |
| 346 | Ga0105249_10168013 | 3300009553 | Bacteria | 2125 |
| 347 | Ga0105239_10009150 | 3300010375 | Bacteria | 11204 |
| 348 | Ga0105239_10097931 | 3300010375 | Bacteria | 3242 |
| 349 | Ga0105239_10173160 | 3300010375 | Bacteria | 2414 |
| 350 | Ga0105246_10000016 | 3300011119 | Bacteria | 65781 |
| 351 | Ga0105246_10029004 | 3300011119 | Bacteria | 3639 |
| 352 | Ga0105246_10059942 | 3300011119 | Unclassified | 2643 |
| 353 | Ga0105246_10060818 | 3300011119 | Bacteria | 2626 |
| 354 | Ga0105246_10243873 | 3300011119 | Bacteria | 1422 |
| 355 | Ga0157326_1007973 | 3300012513 | Bacteria | 1149 |
| 356 | Ga0157371_10073102 | 3300013102 | Unclassified | 2428 |
| 357 | Ga0157371_10098120 | 3300013102 | Bacteria | 2077 |
| 358 | Ga0157371_10183656 | 3300013102 | Bacteria | 1496 |
| 359 | Ga0157370_10194757 | 3300013104 | Bacteria | 1881 |
| 360 | Ga0157370_10198962 | 3300013104 | Bacteria | 1859 |
| 361 | Ga0157369_10001827 | 3300013105 | Bacteria | 25725 |
| 362 | Ga0157369_10242552 | 3300013105 | Bacteria | 1882 |
| 363 | Ga0171462_1045 | 3300013250 | Bacteria | 50984 |
| 364 | Ga0157374_10000092 | 3300013296 | Bacteria | 85738 |
| 365 | Ga0157374_10064745 | 3300013296 | Bacteria | 3432 |
| 366 | Ga0157374_10163775 | 3300013296 | Bacteria | 2167 |
| 367 | Ga0157378_10023667 | 3300013297 | Bacteria | 5402 |
| 368 | Ga0157378_10094379 | 3300013297 | Unclassified | 2724 |
| 369 | Ga0163162_10010092 | 3300013306 | Bacteria | 9182 |
| 370 | Ga0163162_10014928 | 3300013306 | Bacteria | 7586 |
| 371 | Ga0163162_10652125 | 3300013306 | Bacteria | 1176 |
| 372 | Ga0157372_10019004 | 3300013307 | Bacteria | 7396 |
| 373 | Ga0157372_10123167 | 3300013307 | Bacteria | 2980 |
| 374 | Ga0157372_10766573 | 3300013307 | Unclassified | 1122 |
| 375 | Ga0157375_10000124 | 3300013308 | Bacteria | 76003 |
| 376 | Ga0157375_10018849 | 3300013308 | Bacteria | 6264 |
| 377 | Ga0157375_10343210 | 3300013308 | Bacteria | 1659 |
| 378 | Ga0163163_10001343 | 3300014325 | Bacteria | 20762 |
| 379 | Ga0163163_10016562 | 3300014325 | Bacteria | 6855 |
| 380 | Ga0163163_10119365 | 3300014325 | Bacteria | 2670 |
| 381 | Ga0163163_10213341 | 3300014325 | Bacteria | 1979 |
| 382 | Ga0157380_10001027 | 3300014326 | Bacteria | 17807 |
| 383 | Ga0157380_10291143 | 3300014326 | Bacteria | 1499 |
| 384 | Ga0157380_10777937 | 3300014326 | Bacteria | 972 |
| 385 | Ga0157377_10000121 | 3300014745 | Bacteria | 51192 |
| 386 | Ga0157379_10000321 | 3300014968 | Bacteria | 38296 |
| 387 | Ga0157379_10030133 | 3300014968 | Bacteria | 4827 |
| 388 | Ga0157379_10277886 | 3300014968 | Bacteria | 1524 |
| 389 | Ga0157376_10000034 | 3300014969 | Bacteria | 161526 |
| 390 | Ga0157376_10205183 | 3300014969 | Bacteria | 1816 |
| 391 | Ga0163161_10000801 | 3300017792 | Bacteria | 24605 |
| 392 | Ga0163161_10012127 | 3300017792 | Bacteria | 5979 |
| 393 | Ga0163161_10299547 | 3300017792 | Bacteria | 1266 |
| 394 | Ga0213876_10017304 | 3300021384 | Bacteria | 3805 |
| 395 | Ga0224572_1006700 | 3300024225 | Bacteria | 2089 |
| 396 | Ga0207666_1000004 | 3300025271 | Bacteria | 56747 |
| 397 | Ga0209673_1024132 | 3300025273 | Bacteria | 2051 |
| 398 | Ga0209130_1000212 | 3300025284 | Bacteria | 76696 |
| 399 | Ga0207673_1000537 | 3300025290 | Bacteria | 4047 |
| 400 | Ga0209675_1012821 | 3300025291 | Bacteria | 2672 |
| 401 | Ga0209676_1021497 | 3300025292 | Bacteria | 2165 |
| 402 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 403 | Ga0209025_1001538 | 3300025294 | Bacteria | 29419 |
| 404 | Ga0209025_1026823 | 3300025294 | Bacteria | 2877 |
| 405 | Ga0209025_1028362 | 3300025294 | Bacteria | 2746 |
| 406 | Ga0209564_1000075 | 3300025295 | Bacteria | 285760 |
| 407 | Ga0209564_1000076 | 3300025295 | Bacteria | 283602 |
| 408 | Ga0209256_1000083 | 3300025299 | Bacteria | 221460 |
| 409 | Ga0209256_1002896 | 3300025299 | Bacteria | 13002 |
| 410 | Ga0207426_1006805 | 3300025302 | Bacteria | 4890 |
| 411 | Ga0207697_10001888 | 3300025315 | Bacteria | 11200 |
| 412 | Ga0207697_10016615 | 3300025315 | Bacteria | 3031 |
| 413 | Ga0207656_10052113 | 3300025321 | Bacteria | 1771 |
| 414 | Ga0207653_10016325 | 3300025885 | Bacteria | 2332 |
| 415 | Ga0207682_10000016 | 3300025893 | Bacteria | 78971 |
| 416 | Ga0207682_10001712 | 3300025893 | Bacteria | 10043 |
| 417 | Ga0207692_10025783 | 3300025898 | Unclassified | 2751 |
| 418 | Ga0207692_10036390 | 3300025898 | Bacteria | 2400 |
| 419 | Ga0207692_10105306 | 3300025898 | Bacteria | 1556 |
| 420 | Ga0207692_10127427 | 3300025898 | Bacteria | 1433 |
| 421 | Ga0207642_10000454 | 3300025899 | Bacteria | 12480 |
| 422 | Ga0207710_10000475 | 3300025900 | Bacteria | 25581 |
| 423 | Ga0207710_10006786 | 3300025900 | Bacteria | 4876 |
| 424 | Ga0207688_10000038 | 3300025901 | Bacteria | 45000 |
| 425 | Ga0207680_10026076 | 3300025903 | Bacteria | 3234 |
| 426 | Ga0207680_10098159 | 3300025903 | Bacteria | 1877 |
| 427 | Ga0207680_10426422 | 3300025903 | Bacteria | 940 |
| 428 | Ga0207647_10012357 | 3300025904 | Bacteria | 5944 |
| 429 | Ga0207647_10128683 | 3300025904 | Unclassified | 1489 |
| 430 | Ga0207685_10006686 | 3300025905 | Plasmid | 3161 |
| 431 | Ga0207699_10001265 | 3300025906 | Bacteria | 12020 |
| 432 | Ga0207699_10016301 | 3300025906 | Bacteria | 3884 |
| 433 | Ga0207699_10041260 | 3300025906 | Unclassified | 2664 |
| 434 | Ga0207699_10129922 | 3300025906 | Bacteria | 1642 |
| 435 | Ga0207645_10000138 | 3300025907 | Bacteria | 55917 |
| 436 | Ga0207645_10015193 | 3300025907 | Bacteria | 5126 |
| 437 | Ga0207645_10063855 | 3300025907 | Bacteria | 2353 |
| 438 | Ga0207643_10000075 | 3300025908 | Bacteria | 64981 |
| 439 | Ga0207654_10000985 | 3300025911 | Bacteria | 15621 |
| 440 | Ga0207707_10000809 | 3300025912 | Bacteria | 30640 |
| 441 | Ga0207707_10047322 | 3300025912 | Bacteria | 3745 |
| 442 | Ga0207707_10073592 | 3300025912 | Bacteria | 2979 |
| 443 | Ga0207707_10211104 | 3300025912 | Bacteria | 1691 |
| 444 | Ga0207707_10241502 | 3300025912 | Bacteria | 1570 |
| 445 | Ga0207695_10069458 | 3300025913 | Bacteria | 3604 |
| 446 | Ga0207695_10509378 | 3300025913 | Bacteria | 1085 |
| 447 | Ga0207671_10004109 | 3300025914 | Bacteria | 14077 |
| 448 | Ga0207671_10254704 | 3300025914 | Bacteria | 1380 |
| 449 | Ga0207693_10000975 | 3300025915 | Bacteria | 25758 |
| 450 | Ga0207693_10003947 | 3300025915 | Bacteria | 12607 |
| 451 | Ga0207693_10005875 | 3300025915 | Bacteria | 10184 |
| 452 | Ga0207693_10006027 | 3300025915 | Bacteria | 10049 |
| 453 | Ga0207693_10012124 | 3300025915 | Bacteria | 6967 |
| 454 | Ga0207693_10026173 | 3300025915 | Bacteria | 4619 |
| 455 | Ga0207693_10036273 | 3300025915 | Bacteria | 3886 |
| 456 | Ga0207663_10035307 | 3300025916 | Bacteria | 2998 |
| 457 | Ga0207663_10132999 | 3300025916 | Bacteria | 1722 |
| 458 | Ga0207663_10151500 | 3300025916 | Bacteria | 1627 |
| 459 | Ga0207663_10159114 | 3300025916 | Bacteria | 1592 |
| 460 | Ga0207663_10177367 | 3300025916 | Bacteria | 1519 |
| 461 | Ga0207663_10199742 | 3300025916 | Unclassified | 1442 |
| 462 | Ga0207660_10000023 | 3300025917 | Bacteria | 71712 |
| 463 | Ga0207660_10040536 | 3300025917 | Bacteria | 3261 |
| 464 | Ga0207660_10132052 | 3300025917 | Bacteria | 1902 |
| 465 | Ga0207660_10300450 | 3300025917 | Bacteria | 1278 |
| 466 | Ga0207662_10001542 | 3300025918 | Bacteria | 11239 |
| 467 | Ga0207657_10007478 | 3300025919 | Bacteria | 11195 |
| 468 | Ga0207657_10088330 | 3300025919 | Bacteria | 2591 |
| 469 | Ga0207657_10104542 | 3300025919 | Bacteria | 2345 |
| 470 | Ga0207657_10309910 | 3300025919 | Bacteria | 1250 |
| 471 | Ga0207649_10000122 | 3300025920 | Bacteria | 65841 |
| 472 | Ga0207649_10388455 | 3300025920 | Bacteria | 1042 |
| 473 | Ga0207652_10001146 | 3300025921 | Bacteria | 23846 |
| 474 | Ga0207652_10145121 | 3300025921 | Bacteria | 2123 |
| 475 | Ga0207652_10396905 | 3300025921 | Archaea | 1245 |
| 476 | Ga0207652_10412109 | 3300025921 | Bacteria | 1219 |
| 477 | Ga0207681_10000240 | 3300025923 | Bacteria | 42226 |
| 478 | Ga0207681_10043511 | 3300025923 | Bacteria | 3006 |
| 479 | Ga0207681_10216487 | 3300025923 | Bacteria | 1479 |
| 480 | Ga0207681_10224220 | 3300025923 | Bacteria | 1456 |
| 481 | Ga0207681_10301757 | 3300025923 | Unclassified | 1267 |
| 482 | Ga0207694_10020818 | 3300025924 | Bacteria | 4965 |
| 483 | Ga0207694_10078340 | 3300025924 | Bacteria | 2590 |
| 484 | Ga0207650_10005524 | 3300025925 | Bacteria | 8625 |
| 485 | Ga0207650_10124270 | 3300025925 | Bacteria | 2012 |
| 486 | Ga0207650_10161700 | 3300025925 | Bacteria | 1774 |
| 487 | Ga0207650_10450762 | 3300025925 | Bacteria | 1071 |
| 488 | Ga0207659_10000017 | 3300025926 | Bacteria | 159908 |
| 489 | Ga0207659_10047489 | 3300025926 | Plasmid | 3037 |
| 490 | Ga0207659_10071667 | 3300025926 | Bacteria | 2531 |
| 491 | Ga0207687_10000077 | 3300025927 | Bacteria | 71218 |
| 492 | Ga0207687_10017126 | 3300025927 | Plasmid | 4764 |
| 493 | Ga0207687_10100894 | 3300025927 | Bacteria | 2124 |
| 494 | Ga0207687_10354477 | 3300025927 | Bacteria | 1196 |
| 495 | Ga0207700_10004665 | 3300025928 | Bacteria | 8119 |
| 496 | Ga0207700_10024792 | 3300025928 | Bacteria | 4156 |
| 497 | Ga0207700_10106898 | 3300025928 | Bacteria | 2244 |
| 498 | Ga0207700_10174358 | 3300025928 | Bacteria | 1796 |
| 499 | Ga0207664_10095566 | 3300025929 | Unclassified | 2445 |
| 500 | Ga0207664_10184284 | 3300025929 | Bacteria | 1794 |
| 501 | Ga0207644_10001298 | 3300025931 | Bacteria | 16078 |
| 502 | Ga0207644_10004246 | 3300025931 | Bacteria | 9300 |
| 503 | Ga0207644_10009440 | 3300025931 | Bacteria | 6406 |
| 504 | Ga0207644_10102780 | 3300025931 | Bacteria | 2150 |
| 505 | Ga0207644_10113593 | 3300025931 | Bacteria | 2051 |
| 506 | Ga0207644_10200522 | 3300025931 | Bacteria | 1574 |
| 507 | Ga0207690_10003164 | 3300025932 | Bacteria | 9891 |
| 508 | Ga0207690_10237055 | 3300025932 | Bacteria | 1403 |
| 509 | Ga0207706_10004420 | 3300025933 | Bacteria | 13211 |
| 510 | Ga0207706_10021501 | 3300025933 | Bacteria | 5794 |
| 511 | Ga0207706_10047907 | 3300025933 | Bacteria | 3780 |
| 512 | Ga0207706_10165096 | 3300025933 | Bacteria | 1946 |
| 513 | Ga0207706_10202177 | 3300025933 | Bacteria | 1742 |
| 514 | Ga0207686_10000294 | 3300025934 | Bacteria | 36711 |
| 515 | Ga0207686_10021024 | 3300025934 | Bacteria | 3738 |
| 516 | Ga0207686_10100217 | 3300025934 | Bacteria | 1932 |
| 517 | Ga0207709_10000126 | 3300025935 | Bacteria | 114049 |
| 518 | Ga0207670_10000086 | 3300025936 | Bacteria | 63570 |
| 519 | Ga0207670_10010357 | 3300025936 | Bacteria | 5365 |
| 520 | Ga0207670_10022750 | 3300025936 | Bacteria | 3890 |
| 521 | Ga0207670_10073621 | 3300025936 | Bacteria | 2369 |
| 522 | Ga0207670_10102713 | 3300025936 | Unclassified | 2044 |
| 523 | Ga0207669_10000188 | 3300025937 | Bacteria | 28047 |
| 524 | Ga0207669_10022673 | 3300025937 | Unclassified | 3340 |
| 525 | Ga0207669_10090912 | 3300025937 | Bacteria | 1986 |
| 526 | Ga0207669_10255555 | 3300025937 | Bacteria | 1307 |
| 527 | Ga0207669_10349661 | 3300025937 | Unclassified | 1141 |
| 528 | Ga0207704_10002897 | 3300025938 | Bacteria | 7760 |
| 529 | Ga0207704_10024840 | 3300025938 | Bacteria | 3259 |
| 530 | Ga0207665_10001963 | 3300025939 | Bacteria | 13843 |
| 531 | Ga0207665_10093222 | 3300025939 | Bacteria | 2091 |
| 532 | Ga0207665_10098860 | 3300025939 | Bacteria | 2034 |
| 533 | Ga0207665_10378181 | 3300025939 | Unclassified | 1074 |
| 534 | Ga0207691_10000526 | 3300025940 | Bacteria | 38205 |
| 535 | Ga0207691_10147463 | 3300025940 | Bacteria | 2070 |
| 536 | Ga0207691_10513282 | 3300025940 | Bacteria | 1017 |
| 537 | Ga0207711_10007634 | 3300025941 | Bacteria | 9044 |
| 538 | Ga0207711_10018226 | 3300025941 | Bacteria | 5836 |
| 539 | Ga0207711_10094081 | 3300025941 | Bacteria | 2640 |
| 540 | Ga0207711_10297674 | 3300025941 | Bacteria | 1488 |
| 541 | Ga0207711_10490964 | 3300025941 | Bacteria | 1144 |
| 542 | Ga0207689_10000140 | 3300025942 | Bacteria | 62258 |
| 543 | Ga0207689_10025320 | 3300025942 | Bacteria | 4972 |
| 544 | Ga0207689_10157363 | 3300025942 | Bacteria | 1873 |
| 545 | Ga0207661_10000074 | 3300025944 | Bacteria | 68047 |
| 546 | Ga0207661_10157080 | 3300025944 | Bacteria | 1971 |
| 547 | Ga0207679_10000031 | 3300025945 | Bacteria | 165962 |
| 548 | Ga0207679_10287255 | 3300025945 | Bacteria | 1413 |
| 549 | Ga0207667_10033121 | 3300025949 | Bacteria | 5559 |
| 550 | Ga0207667_10035215 | 3300025949 | Bacteria | 5371 |
| 551 | Ga0207651_10001805 | 3300025960 | Bacteria | 9959 |
| 552 | Ga0207651_10054533 | 3300025960 | Bacteria | 2740 |
| 553 | Ga0207712_10000279 | 3300025961 | Bacteria | 48635 |
| 554 | Ga0207712_10004811 | 3300025961 | Bacteria | 8532 |
| 555 | Ga0207668_10613158 | 3300025972 | Bacteria | 949 |
| 556 | Ga0207640_10000105 | 3300025981 | Bacteria | 64812 |
| 557 | Ga0207640_10000216 | 3300025981 | Bacteria | 40557 |
| 558 | Ga0207658_10001907 | 3300025986 | Bacteria | 15607 |
| 559 | Ga0207658_10042886 | 3300025986 | Unclassified | 3285 |
| 560 | Ga0207658_10110243 | 3300025986 | Unclassified | 2174 |
| 561 | Ga0207658_10281385 | 3300025986 | Bacteria | 1426 |
| 562 | Ga0207658_10400945 | 3300025986 | Bacteria | 1206 |
| 563 | Ga0207677_10007306 | 3300026023 | Bacteria | 6101 |
| 564 | Ga0207677_10023683 | 3300026023 | Plasmid | 3798 |
| 565 | Ga0207677_10573746 | 3300026023 | Unclassified | 986 |
| 566 | Ga0207703_10000418 | 3300026035 | Bacteria | 45072 |
| 567 | Ga0207703_10152080 | 3300026035 | Bacteria | 2019 |
| 568 | Ga0207703_10343520 | 3300026035 | Bacteria | 1372 |
| 569 | Ga0207639_10000599 | 3300026041 | Bacteria | 24821 |
| 570 | Ga0207639_10121380 | 3300026041 | Unclassified | 2148 |
| 571 | Ga0207639_10228155 | 3300026041 | Bacteria | 1612 |
| 572 | Ga0207678_10003953 | 3300026067 | Bacteria | 13331 |
| 573 | Ga0207678_10022090 | 3300026067 | Bacteria | 5575 |
| 574 | Ga0207708_10010311 | 3300026075 | Bacteria | 6939 |
| 575 | Ga0207708_10449315 | 3300026075 | Bacteria | 1073 |
| 576 | Ga0207702_10000753 | 3300026078 | Bacteria | 34590 |
| 577 | Ga0207702_10146394 | 3300026078 | Unclassified | 2144 |
| 578 | Ga0207641_10001634 | 3300026088 | Bacteria | 21851 |
| 579 | Ga0207641_10019340 | 3300026088 | Bacteria | 5589 |
| 580 | Ga0207648_10006918 | 3300026089 | Bacteria | 11239 |
| 581 | Ga0207648_10053413 | 3300026089 | Bacteria | 3532 |
| 582 | Ga0207648_10106853 | 3300026089 | Bacteria | 2456 |
| 583 | Ga0207676_10000133 | 3300026095 | Bacteria | 65766 |
| 584 | Ga0207676_10087401 | 3300026095 | Bacteria | 2549 |
| 585 | Ga0207676_10089435 | 3300026095 | Bacteria | 2523 |
| 586 | Ga0207674_10001514 | 3300026116 | Bacteria | 29977 |
| 587 | Ga0207674_10030742 | 3300026116 | Bacteria | 5644 |
| 588 | Ga0207675_100000570 | 3300026118 | Bacteria | 36090 |
| 589 | Ga0207675_100185284 | 3300026118 | Bacteria | 1995 |
| 590 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 591 | Ga0207683_10011279 | 3300026121 | Bacteria | 7619 |
| 592 | Ga0207683_10020739 | 3300026121 | Bacteria | 5622 |
| 593 | Ga0207683_10043398 | 3300026121 | Bacteria | 3930 |
| 594 | Ga0207683_10505246 | 3300026121 | Bacteria | 1117 |
| 595 | Ga0207698_10007207 | 3300026142 | Bacteria | 6968 |
| 596 | Ga0207698_10260534 | 3300026142 | Bacteria | 1593 |
| 597 | Ga0207698_10304142 | 3300026142 | Bacteria | 1486 |
| 598 | Ga0210002_1000183 | 3300027617 | Bacteria | 9003 |
| 599 | Ga0209971_1003472 | 3300027682 | Bacteria | 3736 |
| 600 | Ga0209966_1001288 | 3300027695 | Bacteria | 4443 |
| 601 | Ga0209966_1030379 | 3300027695 | Bacteria | 1092 |
| 602 | Ga0209998_10001130 | 3300027717 | Bacteria | 6609 |
| 603 | Ga0209998_10001412 | 3300027717 | Bacteria | 5820 |
| 604 | Ga0209998_10002862 | 3300027717 | Bacteria | 3872 |
| 605 | Ga0209813_10015791 | 3300027866 | Bacteria | 2052 |
| 606 | Ga0209974_10002488 | 3300027876 | Bacteria | 6667 |
| 607 | Ga0209974_10038892 | 3300027876 | Bacteria | 1582 |
| 608 | Ga0207428_10000218 | 3300027907 | Bacteria | 79728 |
| 609 | Ga0207428_10000250 | 3300027907 | Bacteria | 73217 |
| 610 | Ga0207428_10000777 | 3300027907 | Bacteria | 36251 |
| 611 | Ga0265357_1003621 | 3300028023 | Bacteria | 1348 |
| 612 | Ga0268266_10013746 | 3300028379 | Bacteria | 6970 |
| 613 | Ga0268266_10037440 | 3300028379 | Bacteria | 4133 |
| 614 | Ga0268265_10000194 | 3300028380 | Bacteria | 70928 |
| 615 | Ga0268265_10063302 | 3300028380 | Bacteria | 2845 |
| 616 | Ga0268265_10121161 | 3300028380 | Unclassified | 2155 |
| 617 | Ga0268264_10000393 | 3300028381 | Bacteria | 63015 |
| 618 | Ga0268264_10206938 | 3300028381 | Bacteria | 1799 |
| 619 | Ga0268264_10375726 | 3300028381 | Bacteria | 1360 |
| 620 | Ga0265337_1003879 | 3300028556 | Bacteria | 6343 |
| 621 | Ga0265338_10006566 | 3300028800 | Bacteria | 14761 |
| 622 | Ga0265338_10269461 | 3300028800 | Bacteria | 1248 |
| 623 | Ga0265338_10269689 | 3300028800 | Bacteria | 1247 |
| 624 | Ga0265325_10000039 | 3300031241 | Bacteria | 93014 |
| 625 | Ga0265325_10005389 | 3300031241 | Bacteria | 7903 |
| 626 | Ga0265325_10006452 | 3300031241 | Bacteria | 7111 |
| 627 | Ga0265325_10013324 | 3300031241 | Bacteria | 4684 |
| 628 | Ga0265325_10089525 | 3300031241 | Bacteria | 1519 |
| 629 | Ga0265339_10000071 | 3300031249 | Bacteria | 88416 |
| 630 | Ga0265339_10011771 | 3300031249 | Bacteria | 5368 |
| 631 | Ga0265339_10096653 | 3300031249 | Bacteria | 1541 |
| 632 | Ga0265316_10060342 | 3300031344 | Bacteria | 2948 |
| 633 | Ga0265316_10106018 | 3300031344 | Bacteria | 2132 |
| 634 | Ga0265316_10119851 | 3300031344 | Bacteria | 1988 |
| 635 | Ga0265313_10000057 | 3300031595 | Bacteria | 108544 |
| 636 | Ga0265313_10000415 | 3300031595 | Bacteria | 45805 |
| 637 | Ga0265313_10001341 | 3300031595 | Bacteria | 23197 |
| 638 | Ga0265313_10001740 | 3300031595 | Bacteria | 20008 |
| 639 | Ga0265313_10039367 | 3300031595 | Bacteria | 2345 |
| 640 | Ga0265314_10003150 | 3300031711 | Bacteria | 16185 |
| 641 | Ga0265314_10024673 | 3300031711 | Bacteria | 4553 |
| 642 | Ga0265342_10010642 | 3300031712 | Bacteria | 6361 |
| 643 | Ga0307405_10008563 | 3300031731 | Bacteria | 5196 |
| 644 | Ga0307409_100381988 | 3300031995 | Bacteria | 1339 |
| 645 | Ga0307416_100216204 | 3300032002 | Bacteria | 1833 |
| 646 | Ga0307416_100276325 | 3300032002 | Bacteria | 1653 |
| 647 | Ga0316583_10000158 | 3300032133 | Bacteria | 16588 |
| 648 | Ga0373930_0001167 | 3300034816 | Bacteria | 3842 |
| 649 | Ga0373930_0015641 | 3300034816 | Bacteria | 1426 |
| 650 | Ga0373948_0000190 | 3300034817 | Bacteria | 7039 |
| 651 | Ga0373948_0007388 | 3300034817 | Bacteria | 1847 |
| 652 | Ga0373950_0000342 | 3300034818 | Bacteria | 5805 |
| 653 | Ga0373950_0003250 | 3300034818 | Bacteria | 2307 |
| 654 | Ga0373958_0000055 | 3300034819 | Bacteria | 11096 |
| 655 | Ga0373958_0002208 | 3300034819 | Bacteria | 2705 |
| 656 | Ga0373959_0005211 | 3300034820 | Bacteria | 2128 |
| 657 | Ga0373938_0003013 | 3300034957 | Bacteria | 2732 |
| 658 | Ga0373938_0004580 | 3300034957 | Bacteria | 2318 |
| 659 | Ga0373938_0027998 | 3300034957 | Bacteria | 1189 |
| 660 | Ga0373926_0049144 | 3300035083 | Bacteria | 1518 |
| 661 | Ga0373926_0099066 | 3300035083 | Bacteria | 1089 |
| 662 | Ga0373928_0000361 | 3300035084 | Bacteria | 9079 |
| 663 | Ga0373928_0003934 | 3300035084 | Bacteria | 2834 |
| 664 | Ga0373928_0037247 | 3300035084 | Unclassified | 1103 |
| 665 | Ga0373929_0000927 | 3300035085 | Bacteria | 5708 |
| 666 | Ga0373929_0005221 | 3300035085 | Bacteria | 2335 |
| 667 | Ga0373940_0000594 | 3300035088 | Bacteria | 5745 |
| 668 | Ga0373940_0019435 | 3300035088 | Unclassified | 1716 |
| 669 | Ga0373940_0027313 | 3300035088 | Unclassified | 1499 |
| 670 | Ga0373944_0026503 | 3300035089 | Bacteria | 1712 |
| 671 | Ga0373949_0000308 | 3300035090 | Bacteria | 17544 |
| 672 | Ga0373949_0001125 | 3300035090 | Bacteria | 8093 |
| 673 | Ga0373949_0003075 | 3300035090 | Bacteria | 4081 |
| 674 | Ga0373951_0000393 | 3300035091 | Bacteria | 12972 |
| 675 | Ga0373951_0005644 | 3300035091 | Bacteria | 2897 |
| 676 | Ga0373952_0000208 | 3300035092 | Bacteria | 9305 |
| 677 | Ga0373952_0003614 | 3300035092 | Bacteria | 2789 |
| 678 | Ga0373923_0040203 | 3300035111 | Unclassified | 1923 |
| 679 | Ga0373923_0054218 | 3300035111 | Bacteria | 1687 |
| 680 | Ga0373923_0067162 | 3300035111 | Bacteria | 1533 |
| 681 | Ga0373932_0000031 | 3300035112 | Bacteria | 38730 |
| 682 | Ga0373932_0001291 | 3300035112 | Bacteria | 7088 |
| 683 | Ga0373932_0002778 | 3300035112 | Bacteria | 4345 |
| 684 | Ga0373936_0041267 | 3300035113 | Bacteria | 1851 |
| 685 | Ga0373939_0000083 | 3300035114 | Bacteria | 30438 |
| 686 | Ga0373939_0002536 | 3300035114 | Bacteria | 4293 |
| 687 | Ga0373939_0006676 | 3300035114 | Bacteria | 2786 |
| 688 | Ga0373941_0000540 | 3300035115 | Bacteria | 7532 |
| 689 | Ga0373941_0003276 | 3300035115 | Bacteria | 3654 |
| 690 | Ga0373941_0006891 | 3300035115 | Bacteria | 2759 |
| 691 | Ga0373953_0038456 | 3300035117 | Bacteria | 1892 |
| 692 | Ga0373953_0087433 | 3300035117 | Unclassified | 1301 |
| 693 | Ga0373954_0002212 | 3300035118 | Bacteria | 8084 |
| 694 | Ga0373954_0014077 | 3300035118 | Bacteria | 3566 |
| 695 | Ga0373954_0017610 | 3300035118 | Bacteria | 3210 |
| 696 | Ga0373954_0063059 | 3300035118 | Bacteria | 1751 |
| 697 | Ga0373956_0036600 | 3300035119 | Bacteria | 2166 |
| 698 | Ga0373957_0004504 | 3300035120 | Bacteria | 4241 |
| 699 | Ga0373957_0004989 | 3300035120 | Bacteria | 4090 |
| 700 | Ga0373957_0010202 | 3300035120 | Bacteria | 3098 |
| 701 | Ga0373957_0051454 | 3300035120 | Unclassified | 1576 |
| 702 | Ga0373960_0000088 | 3300035121 | Bacteria | 13897 |
| 703 | Ga0373960_0016046 | 3300035121 | Bacteria | 1921 |
| 704 | Ga0373960_0020821 | 3300035121 | Bacteria | 1738 |
| 705 | Ga0373943_0036171 | 3300035170 | Bacteria | 2364 |
| 706 | Ga0373943_0169942 | 3300035170 | Bacteria | 1192 |
| 707 | Ga0373946_0015402 | 3300035171 | Bacteria | 2899 |
| 708 | Ga0373946_0017067 | 3300035171 | Bacteria | 2773 |
| 709 | Ga0373946_0018220 | 3300035171 | Bacteria | 2694 |
| 710 | Ga0373946_0181357 | 3300035171 | Unclassified | 999 |
| 711 | Ga0373955_0005908 | 3300035172 | Bacteria | 5537 |
| 712 | Ga0373955_0006095 | 3300035172 | Bacteria | 5476 |
| 713 | Ga0373955_0229157 | 3300035172 | Bacteria | 1111 |
| 714 | Ga0373942_0001977 | 3300035207 | Bacteria | 5119 |
| 715 | Ga0373942_0005072 | 3300035207 | Bacteria | 3054 |
| 716 | Ga0373942_0015853 | 3300035207 | Bacteria | 1842 |
| 717 | Ga0373961_0000539 | 3300035241 | Bacteria | 14412 |
| 718 | Ga0373961_0021041 | 3300035241 | Bacteria | 1731 |
| 719 | Ga0373962_0000715 | 3300035242 | Bacteria | 7504 |
| 720 | Ga0373962_0001826 | 3300035242 | Bacteria | 5069 |
| 721 | Ga0373924_0037005 | 3300035410 | Bacteria | 1985 |
| 722 | Ga0373924_0053076 | 3300035410 | Bacteria | 1683 |
| 723 | Ga0373924_0060690 | 3300035410 | Bacteria | 1581 |
| 724 | Ga0373931_0000034 | 3300035691 | Bacteria | 86665 |
| 725 | Ga0373931_0001752 | 3300035691 | Bacteria | 9420 |
| 726 | Ga0373931_0002007 | 3300035691 | Bacteria | 8956 |
| 727 | Ga0373931_0029793 | 3300035691 | Unclassified | 2805 |
| 728 | Ga0373935_0036652 | 3300035692 | Bacteria | 3067 |
| 729 | Ga0373935_0060269 | 3300035692 | Bacteria | 2427 |
| 730 | Ga0373927_0027484 | 3300035695 | Bacteria | 3714 |
| 731 | Ga0373927_0062736 | 3300035695 | Bacteria | 2403 |
| 732 | Ga0373927_0090003 | 3300035695 | Bacteria | 1993 |
| 733 | Ga0373927_0102664 | 3300035695 | Bacteria | 1860 |
| 734 | Ga0373933_0002026 | 3300035724 | Bacteria | 11656 |
| 735 | Ga0373933_0005149 | 3300035724 | Bacteria | 7132 |
| 736 | Ga0373933_0014886 | 3300035724 | Bacteria | 4330 |
| 737 | Ga0373933_0077918 | 3300035724 | Bacteria | 2027 |
| 738 | Ga0373933_0123954 | 3300035724 | Bacteria | 1620 |
| 739 | Ga0373947_0022290 | 3300035725 | Bacteria | 3671 |
| 740 | Ga0373947_0022926 | 3300035725 | Plasmid | 3626 |
| 741 | Ga0373947_0247239 | 3300035725 | Bacteria | 1178 |
| 742 | Ga0373937_0022992 | 3300036401 | Bacteria | 5606 |
| 743 | Ga0373937_0048237 | 3300036401 | Bacteria | 3898 |
| 744 | Ga0373937_0218789 | 3300036401 | Bacteria | 1792 |
| 745 | Ga0373937_0283598 | 3300036401 | Bacteria | 1564 |
| 746 | Ga0373937_0680185 | 3300036401 | Bacteria | 975 |
| 747 | Ga0373925_0008801 | 3300037068 | Bacteria | 7350 |
| 748 | Ga0373925_0038910 | 3300037068 | Bacteria | 3518 |
| 749 | Ga0373925_0085861 | 3300037068 | Bacteria | 2399 |
| 750 | Ga0373925_0183584 | 3300037068 | Bacteria | 1657 |
| 751 | Ga0373925_0318438 | 3300037068 | Bacteria | 1258 |
| 752 | Ga0395899_0021560 | 3300037312 | Bacteria | 4886 |
| 753 | Ga0395899_0023051 | 3300037312 | Bacteria | 4718 |
| 754 | Ga0395900_0075230 | 3300037418 | Bacteria | 3471 |
| 755 | Ga0395900_0080585 | 3300037418 | Bacteria | 3345 |
| 756 | Ga0395898_0004062 | 3300037466 | Bacteria | 16073 |
| 757 | Ga0395898_0198304 | 3300037466 | Bacteria | 1917 |
| 758 | Ga0395898_0274050 | 3300037466 | Bacteria | 1609 |
| 759 | Ga0395901_0005167 | 3300038443 | Bacteria | 13174 |
| 760 | Ga0395901_0412868 | 3300038443 | Bacteria | 1385 |
| 761 | Ga0436365_0014752 | 3300039437 | Bacteria | 19903 |
| 762 | Ga0436365_0360126 | 3300039437 | Bacteria | 4261 |
| 763 | Ga0436365_1470399 | 3300039437 | Bacteria | 2288 |
| 764 | Ga0436365_1671729 | 3300039437 | Bacteria | 6475 |
| 765 | Ga0436360_0147686 | 3300039438 | Bacteria | 984 |
| 766 | Ga0436361_0129874 | 3300039447 | Bacteria | 1093 |
| 767 | Ga0436363_1165521 | 3300039450 | Unclassified | 1313 |
| 768 | Ga0436362_0145276 | 3300039453 | Bacteria | 1240 |
| 769 | Ga0436362_0884639 | 3300039453 | Bacteria | 3007 |
| 770 | Ga0439441_010949 | 3300042001 | Bacteria | 1532 |
| 771 | Ga0439460_0028728 | 3300042461 | Bacteria | 1571 |
| 772 | Ga0466963_0276756 | 3300044694 | Bacteria | 1179 |
| 773 | Ga0466959_0150081 | 3300045049 | Bacteria | 1643 |
| 774 | Ga0451576_0012930 | 3300045051 | Bacteria | 9352 |
| 775 | Ga0466958_0162141 | 3300045836 | Bacteria | 1413 |
| 776 | Ga0466967_0461870 | 3300045976 | Bacteria | 1242 |
| 777 | Ga0495617_009118 | 3300046452 | Bacteria | 3413 |
| 778 | Ga0495592_0003774 | 3300046454 | Bacteria | 10932 |
| 779 | Ga0495592_0009503 | 3300046454 | Bacteria | 7314 |
| 780 | Ga0495592_0175787 | 3300046454 | Bacteria | 1462 |
| 781 | Ga0495592_0261722 | 3300046454 | Unclassified | 1139 |
| 782 | Ga0495603_0164686 | 3300046455 | Bacteria | 1285 |
| 783 | Ga0495629_0000690 | 3300046459 | Bacteria | 27325 |
| 784 | Ga0495629_0004882 | 3300046459 | Bacteria | 10064 |
| 785 | Ga0495629_0041679 | 3300046459 | Bacteria | 3229 |
| 786 | Ga0495641_0059768 | 3300046461 | Bacteria | 1722 |
| 787 | Ga0495651_0014052 | 3300046462 | Bacteria | 6193 |
| 788 | Ga0495651_0018759 | 3300046462 | Bacteria | 5359 |
| 789 | Ga0495651_0073846 | 3300046462 | Unclassified | 2588 |
| 790 | Ga0495651_0189868 | 3300046462 | Bacteria | 1447 |
| 791 | Ga0495653_0004104 | 3300046463 | Bacteria | 11776 |
| 792 | Ga0495653_0011137 | 3300046463 | Bacteria | 7355 |
| 793 | Ga0495653_0108867 | 3300046463 | Unclassified | 1995 |
| 794 | Ga0495653_0122163 | 3300046463 | Bacteria | 1854 |
| 795 | Ga0495580_0016533 | 3300046472 | Bacteria | 5533 |
| 796 | Ga0495582_0027132 | 3300046473 | Unclassified | 3138 |
| 797 | Ga0495582_0046935 | 3300046473 | Bacteria | 2378 |
| 798 | Ga0495605_0022132 | 3300046474 | Bacteria | 3361 |
| 799 | Ga0495639_0029813 | 3300046475 | Bacteria | 2422 |
| 800 | Ga0495639_0041470 | 3300046475 | Bacteria | 2073 |
| 801 | Ga0495664_0000935 | 3300046477 | Bacteria | 15082 |
| 802 | Ga0495664_0032161 | 3300046477 | Bacteria | 3077 |
| 803 | Ga0495584_0028985 | 3300046491 | Bacteria | 2806 |
| 804 | Ga0495585_0001893 | 3300046492 | Bacteria | 15772 |
| 805 | Ga0495594_0081117 | 3300046499 | Bacteria | 1811 |
| 806 | Ga0495607_0019327 | 3300046501 | Unclassified | 4329 |
| 807 | Ga0495608_0014494 | 3300046511 | Bacteria | 5467 |
| 808 | Ga0495608_0015397 | 3300046511 | Bacteria | 5304 |
| 809 | Ga0495608_0017107 | 3300046511 | Bacteria | 5019 |
| 810 | Ga0495608_0104192 | 3300046511 | Bacteria | 1827 |
| 811 | Ga0495610_0022484 | 3300046512 | Bacteria | 3449 |
| 812 | Ga0495618_0003011 | 3300046514 | Bacteria | 10648 |
| 813 | Ga0495618_0005170 | 3300046514 | Bacteria | 7973 |
| 814 | Ga0495628_0005583 | 3300046516 | Bacteria | 11013 |
| 815 | Ga0495628_0117214 | 3300046516 | Bacteria | 2045 |
| 816 | Ga0495628_0122395 | 3300046516 | Unclassified | 1995 |
| 817 | Ga0495630_0008623 | 3300046517 | Bacteria | 7317 |
| 818 | Ga0495630_0135201 | 3300046517 | Bacteria | 1873 |
| 819 | Ga0495643_0098844 | 3300046522 | Bacteria | 1498 |
| 820 | Ga0495643_0129308 | 3300046522 | Bacteria | 1269 |
| 821 | Ga0495644_0000609 | 3300046523 | Bacteria | 15027 |
| 822 | Ga0495652_0020631 | 3300046529 | Bacteria | 5857 |
| 823 | Ga0495652_0049073 | 3300046529 | Unclassified | 3615 |
| 824 | Ga0495652_0201207 | 3300046529 | Bacteria | 1511 |
| 825 | Ga0495665_0089355 | 3300046531 | Bacteria | 1618 |
| 826 | Ga0495640_0019188 | 3300046533 | Bacteria | 5051 |
| 827 | Ga0495640_0254059 | 3300046533 | Unclassified | 1100 |
| 828 | Ga0495640_0300195 | 3300046533 | Bacteria | 997 |
| 829 | Ga0495586_0031215 | 3300046535 | Bacteria | 2852 |
| 830 | Ga0495587_0001842 | 3300046536 | Bacteria | 14138 |
| 831 | Ga0495587_0014249 | 3300046536 | Bacteria | 4990 |
| 832 | Ga0495587_0040716 | 3300046536 | Bacteria | 2775 |
| 833 | Ga0495587_0132359 | 3300046536 | Bacteria | 1425 |
| 834 | Ga0495609_0114552 | 3300046538 | Unclassified | 1162 |
| 835 | Ga0495645_0000310 | 3300046543 | Bacteria | 35179 |
| 836 | Ga0495645_0008466 | 3300046543 | Bacteria | 7183 |
| 837 | Ga0495645_0313573 | 3300046543 | Bacteria | 1021 |
| 838 | Ga0495622_0013890 | 3300046557 | Bacteria | 3736 |
| 839 | Ga0495667_0000946 | 3300046559 | Bacteria | 18764 |
| 840 | Ga0495667_0020778 | 3300046559 | Bacteria | 4430 |
| 841 | Ga0495667_0078098 | 3300046559 | Bacteria | 2152 |
| 842 | Ga0495656_0000135 | 3300046615 | Bacteria | 27441 |
| 843 | Ga0495634_0007276 | 3300046642 | Bacteria | 8339 |
| 844 | Ga0495634_0007973 | 3300046642 | Bacteria | 7898 |
| 845 | Ga0495611_0089413 | 3300046648 | Bacteria | 1422 |
| 846 | Ga0495635_0002226 | 3300046663 | Bacteria | 13172 |
| 847 | Ga0495635_0010100 | 3300046663 | Bacteria | 6601 |
| 848 | Ga0495659_0001106 | 3300046664 | Bacteria | 9384 |
| 849 | Ga0495661_0057261 | 3300046665 | Bacteria | 2328 |
| 850 | Ga0495588_0024336 | 3300046674 | Bacteria | 3007 |
| 851 | Ga0495657_0009702 | 3300046675 | Bacteria | 7279 |
| 852 | Ga0495657_0018260 | 3300046675 | Bacteria | 5080 |
| 853 | Ga0495657_0091600 | 3300046675 | Bacteria | 1949 |
| 854 | Ga0495599_0014755 | 3300046678 | Bacteria | 4837 |
| 855 | Ga0495599_0082279 | 3300046678 | Bacteria | 2011 |
| 856 | Ga0495599_0088825 | 3300046678 | Bacteria | 1929 |
| 857 | Ga0495599_0118069 | 3300046678 | Bacteria | 1649 |
| 858 | Ga0495599_0196856 | 3300046678 | Bacteria | 1239 |
| 859 | Ga0495623_0047692 | 3300046679 | Unclassified | 2719 |
| 860 | Ga0495623_0183606 | 3300046679 | Bacteria | 1213 |
| 861 | Ga0495646_0000846 | 3300046680 | Bacteria | 17305 |
| 862 | Ga0495646_0005824 | 3300046680 | Bacteria | 7814 |
| 863 | Ga0495646_0186248 | 3300046680 | Bacteria | 1137 |
| 864 | Ga0495647_0017444 | 3300046681 | Bacteria | 2540 |
| 865 | Ga0495647_0057262 | 3300046681 | Bacteria | 1530 |
| 866 | Ga0495658_0003137 | 3300046683 | Bacteria | 8241 |
| 867 | Ga0495658_0007569 | 3300046683 | Bacteria | 5382 |
| 868 | Ga0495669_0026128 | 3300046684 | Bacteria | 2551 |
| 869 | Ga0495613_0061433 | 3300046689 | Bacteria | 2751 |
| 870 | Ga0495613_0077855 | 3300046689 | Bacteria | 2412 |
| 871 | Ga0495613_0326249 | 3300046689 | Bacteria | 1059 |
| 872 | Ga0495624_0009424 | 3300046690 | Bacteria | 6763 |
| 873 | Ga0495624_0095007 | 3300046690 | Bacteria | 1837 |
| 874 | Ga0495670_0000427 | 3300046691 | Bacteria | 20176 |
| 875 | Ga0495670_0137512 | 3300046691 | Bacteria | 1276 |
| 876 | Ga0495600_0000371 | 3300046809 | Bacteria | 23444 |
| 877 | Ga0495600_0002986 | 3300046809 | Bacteria | 9878 |
| 878 | Ga0495600_0144992 | 3300046809 | Unclassified | 1539 |
| 879 | Ga0495581_0073208 | 3300047315 | Bacteria | 1982 |
| 880 | Ga0495604_0008735 | 3300047317 | Bacteria | 8007 |
| 881 | Ga0495604_0018786 | 3300047317 | Bacteria | 5535 |
| 882 | Ga0495604_0026322 | 3300047317 | Bacteria | 4631 |
| 883 | Ga0495604_0064909 | 3300047317 | Bacteria | 2781 |
| 884 | Ga0495604_0392857 | 3300047317 | Bacteria | 914 |
| 885 | Ga0495674_0009124 | 3300047319 | Bacteria | 9424 |
| 886 | Ga0495674_0032652 | 3300047319 | Bacteria | 4720 |
| 887 | Ga0495674_0079445 | 3300047319 | Bacteria | 2817 |
| 888 | Ga0495674_0101085 | 3300047319 | Unclassified | 2453 |
| 889 | Ga0495672_0122671 | 3300047320 | Bacteria | 1379 |
| 890 | Ga0495676_0041026 | 3300047321 | Bacteria | 3814 |
| 891 | Ga0495680_0002891 | 3300047322 | Bacteria | 17259 |
| 892 | Ga0495680_0004911 | 3300047322 | Bacteria | 12666 |
| 893 | Ga0495680_0052511 | 3300047322 | Bacteria | 3177 |
| 894 | Ga0495680_0103218 | 3300047322 | Bacteria | 2122 |
| 895 | Ga0495680_0117477 | 3300047322 | Bacteria | 1966 |
| 896 | Ga0495675_0003232 | 3300047444 | Bacteria | 9803 |
| 897 | Ga0495675_0025771 | 3300047444 | Unclassified | 3747 |
| 898 | Ga0495675_0272805 | 3300047444 | Bacteria | 1010 |
| 899 | Ga0495685_011033 | 3300047447 | Bacteria | 3040 |
| 900 | Ga0495684_0001459 | 3300047471 | Bacteria | 18933 |
| 901 | Ga0495684_0097058 | 3300047471 | Bacteria | 2230 |
| 902 | Ga0495684_0115883 | 3300047471 | Bacteria | 2020 |
| 903 | Ga0495684_0124339 | 3300047471 | Bacteria | 1941 |
| 904 | Ga0495684_0166725 | 3300047471 | Bacteria | 1640 |
| 905 | Ga0495593_0005084 | 3300047673 | Bacteria | 7780 |
| 906 | Ga0495593_0017427 | 3300047673 | Bacteria | 4043 |
| 907 | Ga0495593_0045359 | 3300047673 | Bacteria | 2346 |
| 908 | Ga0495602_0035918 | 3300048088 | Bacteria | 4617 |
| 909 | Ga0495602_0059119 | 3300048088 | Bacteria | 3349 |
| 910 | Ga0495602_0091580 | 3300048088 | Bacteria | 2521 |
| 911 | Ga0495614_0013485 | 3300048089 | Bacteria | 3585 |
| 912 | Ga0496100_0000050 | 3300048903 | Bacteria | 75449 |
| 913 | Ga0496100_0077112 | 3300048903 | Bacteria | 2240 |
| 914 | Ga0496101_0000121 | 3300048904 | Bacteria | 76264 |
| 915 | Ga0496101_0000736 | 3300048904 | Bacteria | 19494 |
| 916 | Ga0496102_0003252 | 3300048905 | Bacteria | 13782 |
| 917 | Ga0496102_0085354 | 3300048905 | Bacteria | 2914 |
| 918 | Ga0496102_0088060 | 3300048905 | Bacteria | 2869 |
| 919 | Ga0496102_0117195 | 3300048905 | Bacteria | 2485 |
| 920 | Ga0496102_0327404 | 3300048905 | Bacteria | 1443 |
| 921 | Ga0496102_0409953 | 3300048905 | Unclassified | 1273 |
| 922 | Ga0496102_0466921 | 3300048905 | Unclassified | 1183 |
| 923 | Ga0496103_0000175 | 3300048906 | Bacteria | 65716 |
| 924 | Ga0496103_0115582 | 3300048906 | Bacteria | 1706 |
| 925 | Ga0496104_0000454 | 3300048907 | Bacteria | 35421 |
| 926 | Ga0496104_0107071 | 3300048907 | Bacteria | 2679 |
| 927 | Ga0496104_0128575 | 3300048907 | Bacteria | 2433 |
| 928 | Ga0496104_0143317 | 3300048907 | Bacteria | 2295 |
| 929 | Ga0496105_0027592 | 3300048908 | Bacteria | 4640 |
| 930 | Ga0496105_0072615 | 3300048908 | Bacteria | 2843 |
| 931 | Ga0496105_0121105 | 3300048908 | Bacteria | 2157 |
| 932 | Ga0496106_0000133 | 3300048909 | Bacteria | 55926 |
| 933 | Ga0496106_0014768 | 3300048909 | Bacteria | 5774 |
| 934 | Ga0496106_0024517 | 3300048909 | Bacteria | 4485 |
| 935 | Ga0496106_0025595 | 3300048909 | Unclassified | 4392 |
| 936 | Ga0496107_0000237 | 3300048910 | Bacteria | 29056 |
| 937 | Ga0496107_0018351 | 3300048910 | Bacteria | 4926 |
| 938 | Ga0496107_0046462 | 3300048910 | Bacteria | 3125 |
| 939 | Ga0496107_0106139 | 3300048910 | Unclassified | 2062 |
| 940 | Ga0496108_0017335 | 3300048911 | Bacteria | 5890 |
| 941 | Ga0496108_0036931 | 3300048911 | Bacteria | 4067 |
| 942 | Ga0496108_0124282 | 3300048911 | Unclassified | 2214 |
| 943 | Ga0496108_0164751 | 3300048911 | Bacteria | 1916 |
| 944 | Ga0496109_0007388 | 3300048912 | Bacteria | 9301 |
| 945 | Ga0496109_0026973 | 3300048912 | Bacteria | 5124 |
| 946 | Ga0496109_0431687 | 3300048912 | Bacteria | 1244 |
| 947 | Ga0496110_0009875 | 3300048913 | Bacteria | 7735 |
| 948 | Ga0496110_0074280 | 3300048913 | Bacteria | 3019 |
| 949 | Ga0496110_0103921 | 3300048913 | Plasmid | 2548 |
| 950 | Ga0496111_0066222 | 3300048914 | Bacteria | 2623 |
| 951 | Ga0496111_0160042 | 3300048914 | Unclassified | 1671 |
| 952 | Ga0496112_0229477 | 3300048915 | Bacteria | 1811 |
| 953 | Ga0496112_0247188 | 3300048915 | Unclassified | 1735 |
| 954 | Ga0496112_0593394 | 3300048915 | Bacteria | 1040 |
| 955 | Ga0496113_0190121 | 3300048916 | Bacteria | 1629 |
| 956 | Ga0496113_0227683 | 3300048916 | Bacteria | 1486 |
| 957 | Ga0496113_0265922 | 3300048916 | Bacteria | 1370 |
| 958 | Ga0496114_0002721 | 3300048917 | Bacteria | 13500 |
| 959 | Ga0496114_0012692 | 3300048917 | Bacteria | 6748 |
| 960 | Ga0496114_0032154 | 3300048917 | Bacteria | 4317 |
| 961 | Ga0496115_0066203 | 3300048918 | Bacteria | 2919 |
| 962 | Ga0496115_0081829 | 3300048918 | Bacteria | 2630 |
| 963 | Ga0496115_0084764 | 3300048918 | Bacteria | 2584 |
| 964 | Ga0496115_0129112 | 3300048918 | Bacteria | 2083 |
| 965 | Ga0496115_0212058 | 3300048918 | Unclassified | 1599 |
| 966 | Ga0496117_0036056 | 3300048920 | Bacteria | 3705 |
| 967 | Ga0496117_0052793 | 3300048920 | Bacteria | 2861 |
| 968 | Ga0496118_0134551 | 3300048921 | Bacteria | 1580 |
| 969 | Ga0496119_0188403 | 3300048922 | Bacteria | 1077 |
| 970 | Ga0496122_0022949 | 3300048925 | Bacteria | 5523 |
| 971 | Ga0496122_0081079 | 3300048925 | Bacteria | 2260 |
| 972 | Ga0501031_0086553 | 3300049568 | Bacteria | 2043 |
| 973 | Ga0501032_0028639 | 3300049569 | Bacteria | 3827 |
| 974 | Ga0501032_0090434 | 3300049569 | Bacteria | 2031 |
| 975 | Ga0501032_0126405 | 3300049569 | Bacteria | 1689 |
| 976 | Ga0501032_0150846 | 3300049569 | Bacteria | 1528 |
| 977 | Ga0501032_0194621 | 3300049569 | Bacteria | 1324 |
| 978 | Ga0501033_0014695 | 3300049570 | Bacteria | 5942 |
| 979 | Ga0501033_0022119 | 3300049570 | Bacteria | 4797 |
| 980 | Ga0501033_0054068 | 3300049570 | Bacteria | 2971 |
| 981 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 982 | Ga0501034_0042726 | 3300049571 | Bacteria | 4588 |
| 983 | Ga0501034_0060549 | 3300049571 | Bacteria | 3802 |
| 984 | Ga0501034_0060914 | 3300049571 | Bacteria | 3791 |
| 985 | Ga0501034_0090780 | 3300049571 | Bacteria | 3052 |
| 986 | Ga0501034_0151914 | 3300049571 | Bacteria | 2291 |
| 987 | Ga0501034_0167393 | 3300049571 | Bacteria | 2166 |
| 988 | Ga0501034_0264152 | 3300049571 | Bacteria | 1663 |
| 989 | Ga0501034_0387995 | 3300049571 | Bacteria | 1321 |
| 990 | Ga0501034_0468769 | 3300049571 | Bacteria | 1175 |
| 991 | Ga0501036_0003133 | 3300049572 | Bacteria | 13193 |
| 992 | Ga0501036_0026699 | 3300049572 | Bacteria | 4878 |
| 993 | Ga0501036_0059934 | 3300049572 | Bacteria | 3225 |
| 994 | Ga0501036_0133412 | 3300049572 | Bacteria | 2096 |
| 995 | Ga0501036_0503699 | 3300049572 | Bacteria | 1007 |
| 996 | Ga0501037_0014087 | 3300049573 | Bacteria | 5890 |
| 997 | Ga0501037_0034335 | 3300049573 | Bacteria | 3742 |
| 998 | Ga0501037_0074977 | 3300049573 | Bacteria | 2457 |
| 999 | Ga0501038_0012226 | 3300049574 | Bacteria | 7839 |
| 1000 | Ga0501038_0025621 | 3300049574 | Bacteria | 5255 |
| 1001 | Ga0501038_0064795 | 3300049574 | Bacteria | 3115 |
| 1002 | Ga0501038_0090496 | 3300049574 | Bacteria | 2564 |
| 1003 | Ga0501038_0125562 | 3300049574 | Bacteria | 2112 |
| 1004 | Ga0501038_0440615 | 3300049574 | Bacteria | 1003 |
| 1005 | Ga0501041_0296987 | 3300049577 | Bacteria | 1018 |
| 1006 | Ga0501042_0315851 | 3300049578 | Bacteria | 1129 |
| 1007 | Ga0501042_0420237 | 3300049578 | Bacteria | 969 |
| 1008 | Ga0501043_0002174 | 3300049579 | Bacteria | 16722 |
| 1009 | Ga0501043_0019813 | 3300049579 | Bacteria | 5282 |
| 1010 | Ga0501043_0141415 | 3300049579 | Bacteria | 1884 |
| 1011 | Ga0501046_0076410 | 3300049580 | Bacteria | 2594 |
| 1012 | Ga0501047_0019888 | 3300049581 | Bacteria | 6444 |
| 1013 | Ga0501047_0022348 | 3300049581 | Bacteria | 6075 |
| 1014 | Ga0501047_0030921 | 3300049581 | Bacteria | 5162 |
| 1015 | Ga0501047_0090599 | 3300049581 | Bacteria | 2935 |
| 1016 | Ga0501047_0192663 | 3300049581 | Bacteria | 1901 |
| 1017 | Ga0501047_0266501 | 3300049581 | Bacteria | 1560 |
| 1018 | Ga0501048_0116600 | 3300049582 | Bacteria | 1887 |
| 1019 | Ga0501048_0206530 | 3300049582 | Bacteria | 1393 |
| 1020 | Ga0501048_0248442 | 3300049582 | Bacteria | 1263 |
| 1021 | Ga0501067_0029026 | 3300049583 | Bacteria | 3066 |
| 1022 | Ga0501069_0018653 | 3300049585 | Bacteria | 3746 |
| 1023 | Ga0501069_0064447 | 3300049585 | Bacteria | 2048 |
| 1024 | Ga0501070_0000929 | 3300049586 | Bacteria | 26412 |
| 1025 | Ga0501070_0025114 | 3300049586 | Bacteria | 4995 |
| 1026 | Ga0501070_0047935 | 3300049586 | Bacteria | 3550 |
| 1027 | Ga0501070_0062238 | 3300049586 | Bacteria | 3092 |
| 1028 | Ga0501070_0152763 | 3300049586 | Bacteria | 1904 |
| 1029 | Ga0501070_0167154 | 3300049586 | Bacteria | 1812 |
| 1030 | Ga0501071_0065654 | 3300049587 | Bacteria | 2635 |
| 1031 | Ga0501071_0253519 | 3300049587 | Bacteria | 1328 |
| 1032 | Ga0501071_0347921 | 3300049587 | Bacteria | 1128 |
| 1033 | Ga0501072_0032679 | 3300049588 | Bacteria | 4075 |
| 1034 | Ga0501072_0038088 | 3300049588 | Bacteria | 3774 |
| 1035 | Ga0501072_0335628 | 3300049588 | Bacteria | 1201 |
| 1036 | Ga0501073_0007407 | 3300049589 | Bacteria | 8156 |
| 1037 | Ga0501073_0065786 | 3300049589 | Bacteria | 2527 |
| 1038 | Ga0501074_0090568 | 3300049590 | Bacteria | 2190 |
| 1039 | Ga0501074_0171499 | 3300049590 | Bacteria | 1548 |
| 1040 | Ga0501076_0029006 | 3300049592 | Bacteria | 4301 |
| 1041 | Ga0501076_0179356 | 3300049592 | Bacteria | 1727 |
| 1042 | Ga0501076_0280202 | 3300049592 | Bacteria | 1366 |
| 1043 | Ga0501080_0028616 | 3300049742 | Bacteria | 5186 |
| 1044 | Ga0501080_0098556 | 3300049742 | Bacteria | 2713 |
| 1045 | Ga0501080_0149856 | 3300049742 | Bacteria | 2156 |
| 1046 | Ga0501080_0217610 | 3300049742 | Bacteria | 1749 |
| 1047 | Ga0501080_0468059 | 3300049742 | Bacteria | 1128 |
| 1048 | Ga0501081_0030358 | 3300049743 | Bacteria | 3659 |
| 1049 | Ga0501083_0113235 | 3300049744 | Bacteria | 1782 |
| 1050 | Ga0501083_0186995 | 3300049744 | Bacteria | 1352 |
| 1051 | Ga0501035_0011391 | 3300049822 | Bacteria | 8243 |
| 1052 | Ga0501035_0039179 | 3300049822 | Bacteria | 4289 |
| 1053 | Ga0501035_0059429 | 3300049822 | Bacteria | 3404 |
| 1054 | Ga0501035_0060617 | 3300049822 | Bacteria | 3368 |
| 1055 | Ga0501035_0071320 | 3300049822 | Bacteria | 3076 |
| 1056 | Ga0501035_0111490 | 3300049822 | Bacteria | 2397 |
| 1057 | Ga0501044_0020829 | 3300049823 | Bacteria | 6999 |
| 1058 | Ga0501044_0023302 | 3300049823 | Bacteria | 6586 |
| 1059 | Ga0501044_0202853 | 3300049823 | Bacteria | 1941 |
| 1060 | Ga0501044_0232670 | 3300049823 | Bacteria | 1789 |
| 1061 | Ga0501044_0328200 | 3300049823 | Bacteria | 1453 |
| 1062 | Ga0501044_0506713 | 3300049823 | Bacteria | 1108 |
| 1063 | Ga0501044_0557423 | 3300049823 | Bacteria | 1042 |
| 1064 | nmdc:mga03n38_57442_c1 | 3300050490 | Bacteria | 1759 |
| 1065 | nmdc:mga03n38_95617_c1 | 3300050490 | Bacteria | 1423 |
| 1066 | nmdc:mga0yw44_189281_c1 | 3300050492 | Bacteria | 1357 |
| 1067 | nmdc:mga0yw44_279559_c1 | 3300050492 | Bacteria | 1115 |
| 1068 | nmdc:mga0k408_27170_c1 | 3300050493 | Bacteria | 3249 |
| 1069 | nmdc:mga06z11_28840_c1 | 3300050494 | Bacteria | 2667 |
| 1070 | nmdc:mga06z11_30793_c1 | 3300050494 | Bacteria | 2600 |
| 1071 | nmdc:mga06z11_32988_c1 | 3300050494 | Bacteria | 2529 |
| 1072 | nmdc:mga04h51_14127_c1 | 3300050495 | Bacteria | 2275 |
| 1073 | nmdc:mga07m45_194979_c1 | 3300050496 | Bacteria | 1178 |
| 1074 | nmdc:mga07m45_44118_c1 | 3300050496 | Bacteria | 2501 |
| 1075 | nmdc:mga07m45_47599_c1 | 3300050496 | Bacteria | 2411 |
| 1076 | nmdc:mga05p37_129131_c1 | 3300050507 | Bacteria | 3102 |
| 1077 | nmdc:mga05p37_34216_c1 | 3300050507 | Bacteria | 6223 |
| 1078 | nmdc:mga05p37_354_c1 | 3300050507 | Bacteria | 49188 |
| 1079 | nmdc:mga09592_1311_c1 | 3300050508 | Bacteria | 19973 |
| 1080 | nmdc:mga0qj67_167658_c1 | 3300050509 | Bacteria | 1783 |
| 1081 | nmdc:mga0qj67_1940_c1 | 3300050509 | Bacteria | 14712 |
| 1082 | nmdc:mga0qj67_452_c1 | 3300050509 | Bacteria | 28045 |
| 1083 | nmdc:mga06r32_147_c1 | 3300050510 | Bacteria | 53171 |
| 1084 | nmdc:mga06r32_166113_c1 | 3300050510 | Bacteria | 1578 |
| 1085 | nmdc:mga08y16_1264_c1 | 3300050511 | Bacteria | 25114 |
| 1086 | nmdc:mga08y16_463250_c1 | 3300050511 | Bacteria | 1291 |
| 1087 | nmdc:mga08y16_706_c1 | 3300050511 | Bacteria | 31784 |
| 1088 | nmdc:mga0n895_126_c1 | 3300050512 | Bacteria | 45284 |
| 1089 | nmdc:mga0n895_203244_c1 | 3300050512 | Bacteria | 2012 |
| 1090 | nmdc:mga0n895_3658_c1 | 3300050512 | Bacteria | 12435 |
| 1091 | nmdc:mga0n895_73852_c1 | 3300050512 | Bacteria | 3386 |
| 1092 | nmdc:mga0rr50_110564_c1 | 3300050513 | Bacteria | 2174 |
| 1093 | nmdc:mga0rr50_39348_c1 | 3300050513 | Bacteria | 3429 |
| 1094 | nmdc:mga0rr50_58565_c1 | 3300050513 | Bacteria | 2888 |
| 1095 | nmdc:mga08x19_21_c1 | 3300050514 | Bacteria | 302369 |
| 1096 | nmdc:mga08x19_34989_c1 | 3300050514 | Bacteria | 3177 |
| 1097 | nmdc:mga0a205_197_c1 | 3300050515 | Bacteria | 22634 |
| 1098 | nmdc:mga0a205_35258_c1 | 3300050515 | Bacteria | 4804 |
| 1099 | Ga0495601_0000068 | 3300053077 | Bacteria | 56524 |
| 1100 | Ga0495601_0008114 | 3300053077 | Bacteria | 6191 |
| 1101 | Ga0495601_0009067 | 3300053077 | Bacteria | 5875 |
| 1102 | Ga0495601_0023631 | 3300053077 | Bacteria | 3778 |
| 1103 | Ga0495601_0042090 | 3300053077 | Unclassified | 2864 |
| 1104 | Ga0495601_0050293 | 3300053077 | Bacteria | 2628 |
| 1105 | Ga0495601_0066779 | 3300053077 | Bacteria | 2290 |
| 1106 | Ga0495612_0001544 | 3300053078 | Bacteria | 9486 |
| 1107 | Ga0495612_0002142 | 3300053078 | Bacteria | 8121 |
| 1108 | Ga0495612_0014034 | 3300053078 | Bacteria | 3226 |
| 1109 | Ga0495612_0020815 | 3300053078 | Bacteria | 2629 |
| 1110 | Ga0495612_0103951 | 3300053078 | Unclassified | 1211 |
| 1111 | Ga0500610_0084049 | 3300053079 | Bacteria | 1658 |
| 1112 | Ga0495595_0001152 | 3300053084 | Bacteria | 10236 |
| 1113 | Ga0495595_0001627 | 3300053084 | Bacteria | 8780 |
| 1114 | Ga0495595_0029994 | 3300053084 | Bacteria | 2437 |
| 1115 | Ga0495595_0057613 | 3300053084 | Bacteria | 1812 |
| 1116 | Ga0495595_0125911 | 3300053084 | Bacteria | 1250 |
| 1117 | Ga0495619_0000136 | 3300053085 | Bacteria | 54722 |
| 1118 | Ga0495619_0000154 | 3300053085 | Bacteria | 50900 |
| 1119 | Ga0495619_0001079 | 3300053085 | Bacteria | 17901 |
| 1120 | Ga0495619_0010153 | 3300053085 | Bacteria | 5931 |
| 1121 | Ga0495619_0016781 | 3300053085 | Bacteria | 4636 |
| 1122 | Ga0495619_0022065 | 3300053085 | Bacteria | 4069 |
| 1123 | Ga0495619_0130927 | 3300053085 | Bacteria | 1724 |
| 1124 | Ga0500643_000833 | 3300053087 | Bacteria | 19793 |
| 1125 | Ga0500644_0000982 | 3300053088 | Bacteria | 8881 |
| 1126 | Ga0500651_0008832 | 3300053093 | Bacteria | 5957 |
| 1127 | Ga0500566_0038988 | 3300053094 | Bacteria | 2748 |
| 1128 | Ga0500641_0015946 | 3300053096 | Bacteria | 2794 |
| 1129 | Ga0500650_0030316 | 3300053098 | Bacteria | 2453 |
| 1130 | Ga0500569_066558 | 3300053109 | Bacteria | 1125 |
| 1131 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1132 | Ga0500608_128682 | 3300053122 | Bacteria | 1138 |
| 1133 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1134 | Ga0500616_0010066 | 3300053153 | Bacteria | 5682 |
| 1135 | Ga0500616_0013446 | 3300053153 | Bacteria | 4751 |
| 1136 | Ga0500622_0036280 | 3300053156 | Bacteria | 2577 |
| 1137 | Ga0500636_0045638 | 3300053177 | Bacteria | 2584 |
| 1138 | Ga0500645_000549 | 3300053730 | Bacteria | 24816 |
| 1139 | Ga0501084_0066272 | 3300054114 | Bacteria | 3021 |
| 1140 | Ga0501084_0320043 | 3300054114 | Bacteria | 1310 |
| 1141 | Ga0501082_0054918 | 3300060353 | Bacteria | 3433 |
| 1142 | Ga0501082_0102444 | 3300060353 | Bacteria | 2476 |
| 1143 | Ga0530510_0056915 | 3300061734 | Bacteria | 2825 |
| 1144 | 2513591808 | 2513237087 | Bacteria | 5817514 |
| 1145 | 2643756796 | 2643221547 | Bacteria | 4740017 |
| 1146 | 2644727631 | 2643221733 | Bacteria | 5690728 |
| 1147 | 2644733454 | 2643221734 | Bacteria | 5365412 |
| 1148 | 2644744676 | 2643221736 | Bacteria | 6608466 |
| 1149 | 2819717405 | 2818991467 | Bacteria | 5893227 |
| 1150 | 2841763021 | 2841760612 | Bacteria | 6454112 |
| 1151 | 2844109109 | 2844104063 | Bacteria | 6440972 |
| 1152 | 2851182304 | 2851182111 | Bacteria | 6047226 |
| 1153 | 2851251216 | 2851246043 | Bacteria | 6439203 |
| 1154 | 2917701039 | 2917699015 | Bacteria | 7043791 |
| 1155 | 2919454297 | 2919450847 | Bacteria | 5631160 |
| 1156 | 8001848233 | 8001845381 | Bacteria | 5804942 |
| 1157 | 8054568422 | 8054563764 | Bacteria | 5592885 |
| 1158 | 8057534968 | 8057529695 | Bacteria | 6306553 |
| 1159 | Ga0209025_1066093 | |||
| 1160 | 2214767425 | |||
| 1161 | ARcpr5oldR_c000015 | |||
| 1162 | ARSoilYngRDRAFT_c00006 | |||
| 1163 | ARcpr5yngRDRAFT_c000041 | |||
| 1164 | ARSoilOldRDRAFT_c000020 | |||
| 1165 | ARCol0oldRDRAFT_c00041 | |||
| 1166 | ARCol0yngRDRAFT_1000465 | |||
| 1167 | JGI24746J21847_1001428 | |||
| 1168 | JGI24747J21853_1002861 | |||
| 1169 | JGI24739J22299_10000344 | |||
| 1170 | JGI24737J22298_10000203 | |||
| 1171 | JGI24737J22298_10023970 | |||
| 1172 | JGI24750J21931_1000159 | |||
| 1173 | JGI24745J21846_1000003 | |||
| 1174 | JGI24748J21848_1000190 | |||
| 1175 | JGI24738J21930_10000042 | |||
| 1176 | JGI24749J21850_1000350 | |||
| 1177 | JGI24035J26624_1000010 | |||
| 1178 | JGI24742J22300_10000016 | |||
| 1179 | JGI25159J45721_1004563 | |||
| 1180 | JGI25151J46595_10000040 | |||
| 1181 | JGI25404J52841_10000207 | |||
| 1182 | Ga0055526_1000351 | |||
| 1183 | Ga0055526_1001693 | |||
| 1184 | Ga0055526_1003504 | |||
| 1185 | Ga0055524_1000023 | |||
| 1186 | JGI25405J52794_10003103 | |||
| 1187 | Ga0065165_1000218 | |||
| 1188 | Ga0065717_1002525 | |||
| 1189 | Ga0065716_1002178 | |||
| 1190 | Ga0065704_10073457 | |||
| 1191 | Ga0065712_10002616 | |||
| 1192 | Ga0065712_10068673 | |||
| 1193 | Ga0065712_10116506 | |||
| 1194 | Ga0065712_10119855 | |||
| 1195 | Ga0065715_10001423 | |||
| 1196 | Ga0065715_10088987 | |||
| 1197 | Ga0065715_10200234 | |||
| 1198 | Ga0065707_10107116 | |||
| 1199 | Ga0070658_10146191 | |||
| 1200 | Ga0070658_10344368 | |||
| 1201 | Ga0070676_10000784 | |||
| 1202 | Ga0070676_10016846 | |||
| 1203 | Ga0070683_100000114 | |||
| 1204 | Ga0070683_100088017 | |||
| 1205 | Ga0070683_100173151 | |||
| 1206 | Ga0070683_100232230 | |||
| 1207 | Ga0070683_100335950 | |||
| 1208 | Ga0070690_100000064 | |||
| 1209 | Ga0070690_100015359 | |||
| 1210 | Ga0070690_100056719 | |||
| 1211 | Ga0070670_100002373 | |||
| 1212 | Ga0070670_100005338 | |||
| 1213 | Ga0070670_100054895 | |||
| 1214 | Ga0070670_100509442 | |||
| 1215 | Ga0070670_100524850 | |||
| 1216 | Ga0070677_10000193 | |||
| 1217 | Ga0068869_100000020 | |||
| 1218 | Ga0070666_10005751 | |||
| 1219 | Ga0070680_100000242 | |||
| 1220 | Ga0070680_100049833 | |||
| 1221 | Ga0070680_100059770 | |||
| 1222 | Ga0070680_100192106 | |||
| 1223 | Ga0070680_100362109 | |||
| 1224 | Ga0070682_100000224 | |||
| 1225 | Ga0070682_100016367 | |||
| 1226 | Ga0070682_100075915 | |||
| 1227 | Ga0070682_100318486 | |||
| 1228 | Ga0068868_100003038 | |||
| 1229 | Ga0068868_100005421 | |||
| 1230 | Ga0068868_100327527 | |||
| 1231 | Ga0070660_100000123 | |||
| 1232 | Ga0070660_100075002 | |||
| 1233 | Ga0070660_100480214 | |||
| 1234 | Ga0070689_100000685 | |||
| 1235 | Ga0070689_100010928 | |||
| 1236 | Ga0070691_10001254 | |||
| 1237 | Ga0070691_10088293 | |||
| 1238 | Ga0070687_100000351 | |||
| 1239 | Ga0070687_100016686 | |||
| 1240 | Ga0070661_100000039 | |||
| 1241 | Ga0070661_100144629 | |||
| 1242 | Ga0070692_10062423 | |||
| 1243 | Ga0070668_100003586 | |||
| 1244 | Ga0070668_100128113 | |||
| 1245 | Ga0070669_100000176 | |||
| 1246 | Ga0070669_100073632 | |||
| 1247 | Ga0070669_100204124 | |||
| 1248 | Ga0070675_100000259 | |||
| 1249 | Ga0070675_100254869 | |||
| 1250 | Ga0070671_100005757 | |||
| 1251 | Ga0070674_100000099 | |||
| 1252 | Ga0070674_100018430 | |||
| 1253 | Ga0070674_100193057 | |||
| 1254 | Ga0070673_100018362 | |||
| 1255 | Ga0070673_100359816 | |||
| 1256 | Ga0070688_100000329 | |||
| 1257 | Ga0070688_100050563 | |||
| 1258 | Ga0070688_100207204 | |||
| 1259 | Ga0070688_100368481 | |||
| 1260 | Ga0070659_100005453 | |||
| 1261 | Ga0070659_100094545 | |||
| 1262 | Ga0070659_100323349 | |||
| 1263 | Ga0070667_100001075 | |||
| 1264 | Ga0070667_100021496 | |||
| 1265 | Ga0070667_100267163 | |||
| 1266 | Ga0070709_10002443 | |||
| 1267 | Ga0070709_10029823 | |||
| 1268 | Ga0070709_10205339 | |||
| 1269 | Ga0070709_10221187 | |||
| 1270 | Ga0070714_100015432 | |||
| 1271 | Ga0070714_100015694 | |||
| 1272 | Ga0070714_100035280 | |||
| 1273 | Ga0070714_100043358 | |||
| 1274 | Ga0070714_100138726 | |||
| 1275 | Ga0070714_100311042 | |||
| 1276 | Ga0070714_100543000 | |||
| 1277 | Ga0070713_100000654 | |||
| 1278 | Ga0070713_100001555 | |||
| 1279 | Ga0070713_100014148 | |||
| 1280 | Ga0070713_100060404 | |||
| 1281 | Ga0070713_100066169 | |||
| 1282 | Ga0070710_10000619 | |||
| 1283 | Ga0070710_10003937 | |||
| 1284 | Ga0070710_10025993 | |||
| 1285 | Ga0070710_10044111 | |||
| 1286 | Ga0070701_10000025 | |||
| 1287 | Ga0070711_100010734 | |||
| 1288 | Ga0070711_100024053 | |||
| 1289 | Ga0070711_100041441 | |||
| 1290 | Ga0070711_100058358 | |||
| 1291 | Ga0070711_100073806 | |||
| 1292 | Ga0070711_100090065 | |||
| 1293 | Ga0070711_100138772 | |||
| 1294 | Ga0070705_100037650 | |||
| 1295 | Ga0070705_100130307 | |||
| 1296 | Ga0070700_100002215 | |||
| 1297 | Ga0070694_100006957 | |||
| 1298 | Ga0070708_100023192 | |||
| 1299 | Ga0070663_100000064 | |||
| 1300 | Ga0070663_100014208 | |||
| 1301 | Ga0070663_100060234 | |||
| 1302 | Ga0070678_100001526 | |||
| 1303 | Ga0070678_100043310 | |||
| 1304 | Ga0070678_100043991 | |||
| 1305 | Ga0070662_100023064 | |||
| 1306 | Ga0070662_100025880 | |||
| 1307 | Ga0070662_100051625 | |||
| 1308 | Ga0070662_100141585 | |||
| 1309 | Ga0070662_100271400 | |||
| 1310 | Ga0070662_100448009 | |||
| 1311 | Ga0070681_10000435 | |||
| 1312 | Ga0070681_10032023 | |||
| 1313 | Ga0070681_10051421 | |||
| 1314 | Ga0070681_10063320 | |||
| 1315 | Ga0070681_10074981 | |||
| 1316 | Ga0070681_10125790 | |||
| 1317 | Ga0068867_100002108 | |||
| 1318 | Ga0068867_100025717 | |||
| 1319 | Ga0070685_10003445 | |||
| 1320 | Ga0070685_10012156 | |||
| 1321 | Ga0074259_10047191 | |||
| 1322 | Ga0070699_100361940 | |||
| 1323 | Ga0070679_100002876 | |||
| 1324 | Ga0070679_100117245 | |||
| 1325 | Ga0070684_100001610 | |||
| 1326 | Ga0070684_100142642 | |||
| 1327 | Ga0070684_100178374 | |||
| 1328 | Ga0070684_100207569 | |||
| 1329 | Ga0070684_100359223 | |||
| 1330 | Ga0068853_100005553 | |||
| 1331 | Ga0068853_100323476 | |||
| 1332 | Ga0070672_100000011 | |||
| 1333 | Ga0070672_100129130 | |||
| 1334 | Ga0070672_100263855 | |||
| 1335 | Ga0070672_100304859 | |||
| 1336 | Ga0070686_100000076 | |||
| 1337 | Ga0070686_100002194 | |||
| 1338 | Ga0070686_100067747 | |||
| 1339 | Ga0070686_100115683 | |||
| 1340 | Ga0070695_100003381 | |||
| 1341 | Ga0070695_100018163 | |||
| 1342 | Ga0070695_100025754 | |||
| 1343 | Ga0070695_100237271 | |||
| 1344 | Ga0070696_100038461 | |||
| 1345 | Ga0070693_100000122 | |||
| 1346 | Ga0070693_100074358 | |||
| 1347 | Ga0070665_100034452 | |||
| 1348 | Ga0070704_100002018 | |||
| 1349 | Ga0070704_100008020 | |||
| 1350 | Ga0070704_100017468 | |||
| 1351 | Ga0070704_100051139 | |||
| 1352 | Ga0070704_100105130 | |||
| 1353 | Ga0068855_100035734 | |||
| 1354 | Ga0068855_100246086 | |||
| 1355 | Ga0070664_100000112 | |||
| 1356 | Ga0070664_100227925 | |||
| 1357 | Ga0070664_100320227 | |||
| 1358 | Ga0070664_100483617 | |||
| 1359 | Ga0068857_100000023 | |||
| 1360 | Ga0068854_100004158 | |||
| 1361 | Ga0068856_100000099 | |||
| 1362 | Ga0068856_100127057 | |||
| 1363 | Ga0068856_100169702 | |||
| 1364 | Ga0068856_100907814 | |||
| 1365 | Ga0070702_100000005 | |||
| 1366 | Ga0070702_100021306 | |||
| 1367 | Ga0068852_100004502 | |||
| 1368 | Ga0068852_100085751 | |||
| 1369 | Ga0068852_100262158 | |||
| 1370 | Ga0068852_100283878 | |||
| 1371 | Ga0068859_100000503 | |||
| 1372 | Ga0068859_100039458 | |||
| 1373 | Ga0068859_100040577 | |||
| 1374 | Ga0068859_100611665 | |||
| 1375 | Ga0068864_100000112 | |||
| 1376 | Ga0068864_100018108 | |||
| 1377 | Ga0068864_100308582 | |||
| 1378 | Ga0068864_100574723 | |||
| 1379 | Ga0068866_10000977 | |||
| 1380 | Ga0068866_10008375 | |||
| 1381 | Ga0068866_10106410 | |||
| 1382 | Ga0068861_100002096 | |||
| 1383 | Ga0068861_100118714 | |||
| 1384 | Ga0068851_10097376 | |||
| 1385 | Ga0068870_10000021 | |||
| 1386 | Ga0068870_10087663 | |||
| 1387 | Ga0068863_100000227 | |||
| 1388 | Ga0068863_100076196 | |||
| 1389 | Ga0068858_100120781 | |||
| 1390 | Ga0068858_100353397 | |||
| 1391 | Ga0068858_100495126 | |||
| 1392 | Ga0068860_100000511 | |||
| 1393 | Ga0068860_100201784 | |||
| 1394 | Ga0068860_100345907 | |||
| 1395 | Ga0068860_100577693 | |||
| 1396 | Ga0068862_100001866 | |||
| 1397 | Ga0068862_100340316 | |||
| 1398 | Ga0068862_100437335 | |||
| 1399 | Ga0081455_10000153 | |||
| 1400 | Ga0081455_10002775 | |||
| 1401 | Ga0081455_10192128 | |||
| 1402 | Ga0081538_10047178 | |||
| 1403 | Ga0081540_1000008 | |||
| 1404 | Ga0081540_1001662 | |||
| 1405 | Ga0081540_1012674 | |||
| 1406 | Ga0081540_1052135 | |||
| 1407 | Ga0081539_10000423 | |||
| 1408 | Ga0070717_10349038 | |||
| 1409 | Ga0075365_10004253 | |||
| 1410 | Ga0075365_10054906 | |||
| 1411 | Ga0075365_10230580 | |||
| 1412 | Ga0075365_10234229 | |||
| 1413 | Ga0075365_10247944 | |||
| 1414 | Ga0075363_100010796 | |||
| 1415 | Ga0075363_100115199 | |||
| 1416 | Ga0075432_10004763 | |||
| 1417 | Ga0070715_10012842 | |||
| 1418 | Ga0070715_10071977 | |||
| 1419 | Ga0070716_100015557 | |||
| 1420 | Ga0070716_100054784 | |||
| 1421 | Ga0070712_100054314 | |||
| 1422 | Ga0070712_100205026 | |||
| 1423 | Ga0075367_10003172 | |||
| 1424 | Ga0075367_10003813 | |||
| 1425 | Ga0075367_10045316 | |||
| 1426 | Ga0075367_10052558 | |||
| 1427 | Ga0075366_10185370 | |||
| 1428 | Ga0097621_100000013 | |||
| 1429 | Ga0097621_100001495 | |||
| 1430 | Ga0097621_100038999 | |||
| 1431 | Ga0075370_10036683 | |||
| 1432 | Ga0075370_10038169 | |||
| 1433 | Ga0068871_100000064 | |||
| 1434 | Ga0068871_100023154 | |||
| 1435 | Ga0068871_100035623 | |||
| 1436 | Ga0075428_100067278 | |||
| 1437 | Ga0075428_100435492 | |||
| 1438 | Ga0075430_100000646 | |||
| 1439 | Ga0075430_100040915 | |||
| 1440 | Ga0075430_100300780 | |||
| 1441 | Ga0075431_100096301 | |||
| 1442 | Ga0075431_100189975 | |||
| 1443 | Ga0075433_10003920 | |||
| 1444 | Ga0075433_10209676 | |||
| 1445 | Ga0075433_10245366 | |||
| 1446 | Ga0075434_100000109 | |||
| 1447 | Ga0075434_100043968 | |||
| 1448 | Ga0075434_100068843 | |||
| 1449 | Ga0075434_100095466 | |||
| 1450 | Ga0075429_100041545 | |||
| 1451 | Ga0068865_100000088 | |||
| 1452 | Ga0068865_100010435 | |||
| 1453 | Ga0068865_100097144 | |||
| 1454 | Ga0068865_100337805 | |||
| 1455 | Ga0075436_100021761 | |||
| 1456 | Ga0075436_100162541 | |||
| 1457 | Ga0075436_100206844 | |||
| 1458 | Ga0097620_100000503 | |||
| 1459 | Ga0097620_100039461 | |||
| 1460 | Ga0097620_100040574 | |||
| 1461 | Ga0097620_100611664 | |||
| 1462 | Ga0075435_100072374 | |||
| 1463 | Ga0075435_100093336 | |||
| 1464 | Ga0075435_100119913 | |||
| 1465 | Ga0105251_10010716 | |||
| 1466 | Ga0105240_10017252 | |||
| 1467 | Ga0105240_10296212 | |||
| 1468 | Ga0111539_10000196 | |||
| 1469 | Ga0111539_10000376 | |||
| 1470 | Ga0111539_10001836 | |||
| 1471 | Ga0111539_10168910 | |||
| 1472 | Ga0111539_10413268 | |||
| 1473 | Ga0105245_10001381 | |||
| 1474 | Ga0105245_10150658 | |||
| 1475 | Ga0105245_10182194 | |||
| 1476 | Ga0105247_10010673 | |||
| 1477 | Ga0105247_10057028 | |||
| 1478 | Ga0114129_10029360 | |||
| 1479 | Ga0114129_10157162 | |||
| 1480 | Ga0114129_10179567 | |||
| 1481 | Ga0105243_10002817 | |||
| 1482 | Ga0105243_10200057 | |||
| 1483 | Ga0105241_10007352 | |||
| 1484 | Ga0105241_10007728 | |||
| 1485 | Ga0105241_10049693 | |||
| 1486 | Ga0105242_10009592 | |||
| 1487 | Ga0105242_10046720 | |||
| 1488 | Ga0105248_10001979 | |||
| 1489 | Ga0105248_10048562 | |||
| 1490 | Ga0105248_10170960 | |||
| 1491 | Ga0105248_10261581 | |||
| 1492 | Ga0105248_10303982 | |||
| 1493 | Ga0105237_10014351 | |||
| 1494 | Ga0105237_10281731 | |||
| 1495 | Ga0105237_10366520 | |||
| 1496 | Ga0105237_10394327 | |||
| 1497 | Ga0105237_10559544 | |||
| 1498 | Ga0105238_10018663 | |||
| 1499 | Ga0105238_10078408 | |||
| 1500 | Ga0105238_10082426 | |||
| 1501 | Ga0105238_10731992 | |||
| 1502 | Ga0105249_10002341 | |||
| 1503 | Ga0105249_10002423 | |||
| 1504 | Ga0105249_10168013 | |||
| 1505 | Ga0105239_10009150 | |||
| 1506 | Ga0105239_10097931 | |||
| 1507 | Ga0105239_10173160 | |||
| 1508 | Ga0105246_10000016 | |||
| 1509 | Ga0105246_10029004 | |||
| 1510 | Ga0105246_10059942 | |||
| 1511 | Ga0105246_10060818 | |||
| 1512 | Ga0105246_10243873 | |||
| 1513 | Ga0157326_1007973 | |||
| 1514 | Ga0157371_10073102 | |||
| 1515 | Ga0157371_10098120 | |||
| 1516 | Ga0157371_10183656 | |||
| 1517 | Ga0157370_10194757 | |||
| 1518 | Ga0157370_10198962 | |||
| 1519 | Ga0157369_10001827 | |||
| 1520 | Ga0157369_10242552 | |||
| 1521 | Ga0171462_1045 | |||
| 1522 | Ga0157374_10000092 | |||
| 1523 | Ga0157374_10064745 | |||
| 1524 | Ga0157374_10163775 | |||
| 1525 | Ga0157378_10023667 | |||
| 1526 | Ga0157378_10094379 | |||
| 1527 | Ga0163162_10010092 | |||
| 1528 | Ga0163162_10014928 | |||
| 1529 | Ga0163162_10652125 | |||
| 1530 | Ga0157372_10019004 | |||
| 1531 | Ga0157372_10123167 | |||
| 1532 | Ga0157372_10766573 | |||
| 1533 | Ga0157375_10000124 | |||
| 1534 | Ga0157375_10018849 | |||
| 1535 | Ga0157375_10343210 | |||
| 1536 | Ga0163163_10001343 | |||
| 1537 | Ga0163163_10016562 | |||
| 1538 | Ga0163163_10119365 | |||
| 1539 | Ga0163163_10213341 | |||
| 1540 | Ga0157380_10001027 | |||
| 1541 | Ga0157380_10291143 | |||
| 1542 | Ga0157380_10777937 | |||
| 1543 | Ga0157377_10000121 | |||
| 1544 | Ga0157379_10000321 | |||
| 1545 | Ga0157379_10030133 | |||
| 1546 | Ga0157379_10277886 | |||
| 1547 | Ga0157376_10000034 | |||
| 1548 | Ga0157376_10205183 | |||
| 1549 | Ga0163161_10000801 | |||
| 1550 | Ga0163161_10012127 | |||
| 1551 | Ga0163161_10299547 | |||
| 1552 | Ga0213876_10017304 | |||
| 1553 | Ga0224572_1006700 | |||
| 1554 | Ga0207666_1000004 | |||
| 1555 | Ga0209673_1024132 | |||
| 1556 | Ga0209130_1000212 | |||
| 1557 | Ga0207673_1000537 | |||
| 1558 | Ga0209675_1012821 | |||
| 1559 | Ga0209676_1021497 | |||
| 1560 | Ga0209025_1000016 | |||
| 1561 | Ga0209025_1001538 | |||
| 1562 | Ga0209025_1026823 | |||
| 1563 | Ga0209025_1028362 | |||
| 1564 | Ga0209564_1000075 | |||
| 1565 | Ga0209564_1000076 | |||
| 1566 | Ga0209256_1000083 | |||
| 1567 | Ga0209256_1002896 | |||
| 1568 | Ga0207426_1006805 | |||
| 1569 | Ga0207697_10001888 | |||
| 1570 | Ga0207697_10016615 | |||
| 1571 | Ga0207656_10052113 | |||
| 1572 | Ga0207653_10016325 | |||
| 1573 | Ga0207682_10000016 | |||
| 1574 | Ga0207682_10001712 | |||
| 1575 | Ga0207692_10025783 | |||
| 1576 | Ga0207692_10036390 | |||
| 1577 | Ga0207692_10105306 | |||
| 1578 | Ga0207692_10127427 | |||
| 1579 | Ga0207642_10000454 | |||
| 1580 | Ga0207710_10000475 | |||
| 1581 | Ga0207710_10006786 | |||
| 1582 | Ga0207688_10000038 | |||
| 1583 | Ga0207680_10026076 | |||
| 1584 | Ga0207680_10098159 | |||
| 1585 | Ga0207680_10426422 | |||
| 1586 | Ga0207647_10012357 | |||
| 1587 | Ga0207647_10128683 | |||
| 1588 | Ga0207685_10006686 | |||
| 1589 | Ga0207699_10001265 | |||
| 1590 | Ga0207699_10016301 | |||
| 1591 | Ga0207699_10041260 | |||
| 1592 | Ga0207699_10129922 | |||
| 1593 | Ga0207645_10000138 | |||
| 1594 | Ga0207645_10015193 | |||
| 1595 | Ga0207645_10063855 | |||
| 1596 | Ga0207643_10000075 | |||
| 1597 | Ga0207654_10000985 | |||
| 1598 | Ga0207707_10000809 | |||
| 1599 | Ga0207707_10047322 | |||
| 1600 | Ga0207707_10073592 | |||
| 1601 | Ga0207707_10211104 | |||
| 1602 | Ga0207707_10241502 | |||
| 1603 | Ga0207695_10069458 | |||
| 1604 | Ga0207695_10509378 | |||
| 1605 | Ga0207671_10004109 | |||
| 1606 | Ga0207671_10254704 | |||
| 1607 | Ga0207693_10000975 | |||
| 1608 | Ga0207693_10003947 | |||
| 1609 | Ga0207693_10005875 | |||
| 1610 | Ga0207693_10006027 | |||
| 1611 | Ga0207693_10012124 | |||
| 1612 | Ga0207693_10026173 | |||
| 1613 | Ga0207693_10036273 | |||
| 1614 | Ga0207663_10035307 | |||
| 1615 | Ga0207663_10132999 | |||
| 1616 | Ga0207663_10151500 | |||
| 1617 | Ga0207663_10159114 | |||
| 1618 | Ga0207663_10177367 | |||
| 1619 | Ga0207663_10199742 | |||
| 1620 | Ga0207660_10000023 | |||
| 1621 | Ga0207660_10040536 | |||
| 1622 | Ga0207660_10132052 | |||
| 1623 | Ga0207660_10300450 | |||
| 1624 | Ga0207662_10001542 | |||
| 1625 | Ga0207657_10007478 | |||
| 1626 | Ga0207657_10088330 | |||
| 1627 | Ga0207657_10104542 | |||
| 1628 | Ga0207657_10309910 | |||
| 1629 | Ga0207649_10000122 | |||
| 1630 | Ga0207649_10388455 | |||
| 1631 | Ga0207652_10001146 | |||
| 1632 | Ga0207652_10145121 | |||
| 1633 | Ga0207652_10396905 | |||
| 1634 | Ga0207652_10412109 | |||
| 1635 | Ga0207681_10000240 | |||
| 1636 | Ga0207681_10043511 | |||
| 1637 | Ga0207681_10216487 | |||
| 1638 | Ga0207681_10224220 | |||
| 1639 | Ga0207681_10301757 | |||
| 1640 | Ga0207694_10020818 | |||
| 1641 | Ga0207694_10078340 | |||
| 1642 | Ga0207650_10005524 | |||
| 1643 | Ga0207650_10124270 | |||
| 1644 | Ga0207650_10161700 | |||
| 1645 | Ga0207650_10450762 | |||
| 1646 | Ga0207659_10000017 | |||
| 1647 | Ga0207659_10047489 | |||
| 1648 | Ga0207659_10071667 | |||
| 1649 | Ga0207687_10000077 | |||
| 1650 | Ga0207687_10017126 | |||
| 1651 | Ga0207687_10100894 | |||
| 1652 | Ga0207687_10354477 | |||
| 1653 | Ga0207700_10004665 | |||
| 1654 | Ga0207700_10024792 | |||
| 1655 | Ga0207700_10106898 | |||
| 1656 | Ga0207700_10174358 | |||
| 1657 | Ga0207664_10095566 | |||
| 1658 | Ga0207664_10184284 | |||
| 1659 | Ga0207644_10001298 | |||
| 1660 | Ga0207644_10004246 | |||
| 1661 | Ga0207644_10009440 | |||
| 1662 | Ga0207644_10102780 | |||
| 1663 | Ga0207644_10113593 | |||
| 1664 | Ga0207644_10200522 | |||
| 1665 | Ga0207690_10003164 | |||
| 1666 | Ga0207690_10237055 | |||
| 1667 | Ga0207706_10004420 | |||
| 1668 | Ga0207706_10021501 | |||
| 1669 | Ga0207706_10047907 | |||
| 1670 | Ga0207706_10165096 | |||
| 1671 | Ga0207706_10202177 | |||
| 1672 | Ga0207686_10000294 | |||
| 1673 | Ga0207686_10021024 | |||
| 1674 | Ga0207686_10100217 | |||
| 1675 | Ga0207709_10000126 | |||
| 1676 | Ga0207670_10000086 | |||
| 1677 | Ga0207670_10010357 | |||
| 1678 | Ga0207670_10022750 | |||
| 1679 | Ga0207670_10073621 | |||
| 1680 | Ga0207670_10102713 | |||
| 1681 | Ga0207669_10000188 | |||
| 1682 | Ga0207669_10022673 | |||
| 1683 | Ga0207669_10090912 | |||
| 1684 | Ga0207669_10255555 | |||
| 1685 | Ga0207669_10349661 | |||
| 1686 | Ga0207704_10002897 | |||
| 1687 | Ga0207704_10024840 | |||
| 1688 | Ga0207665_10001963 | |||
| 1689 | Ga0207665_10093222 | |||
| 1690 | Ga0207665_10098860 | |||
| 1691 | Ga0207665_10378181 | |||
| 1692 | Ga0207691_10000526 | |||
| 1693 | Ga0207691_10147463 | |||
| 1694 | Ga0207691_10513282 | |||
| 1695 | Ga0207711_10007634 | |||
| 1696 | Ga0207711_10018226 | |||
| 1697 | Ga0207711_10094081 | |||
| 1698 | Ga0207711_10297674 | |||
| 1699 | Ga0207711_10490964 | |||
| 1700 | Ga0207689_10000140 | |||
| 1701 | Ga0207689_10025320 | |||
| 1702 | Ga0207689_10157363 | |||
| 1703 | Ga0207661_10000074 | |||
| 1704 | Ga0207661_10157080 | |||
| 1705 | Ga0207679_10000031 | |||
| 1706 | Ga0207679_10287255 | |||
| 1707 | Ga0207667_10033121 | |||
| 1708 | Ga0207667_10035215 | |||
| 1709 | Ga0207651_10001805 | |||
| 1710 | Ga0207651_10054533 | |||
| 1711 | Ga0207712_10000279 | |||
| 1712 | Ga0207712_10004811 | |||
| 1713 | Ga0207668_10613158 | |||
| 1714 | Ga0207640_10000105 | |||
| 1715 | Ga0207640_10000216 | |||
| 1716 | Ga0207658_10001907 | |||
| 1717 | Ga0207658_10042886 | |||
| 1718 | Ga0207658_10110243 | |||
| 1719 | Ga0207658_10281385 | |||
| 1720 | Ga0207658_10400945 | |||
| 1721 | Ga0207677_10007306 | |||
| 1722 | Ga0207677_10023683 | |||
| 1723 | Ga0207677_10573746 | |||
| 1724 | Ga0207703_10000418 | |||
| 1725 | Ga0207703_10152080 | |||
| 1726 | Ga0207703_10343520 | |||
| 1727 | Ga0207639_10000599 | |||
| 1728 | Ga0207639_10121380 | |||
| 1729 | Ga0207639_10228155 | |||
| 1730 | Ga0207678_10003953 | |||
| 1731 | Ga0207678_10022090 | |||
| 1732 | Ga0207708_10010311 | |||
| 1733 | Ga0207708_10449315 | |||
| 1734 | Ga0207702_10000753 | |||
| 1735 | Ga0207702_10146394 | |||
| 1736 | Ga0207641_10001634 | |||
| 1737 | Ga0207641_10019340 | |||
| 1738 | Ga0207648_10006918 | |||
| 1739 | Ga0207648_10053413 | |||
| 1740 | Ga0207648_10106853 | |||
| 1741 | Ga0207676_10000133 | |||
| 1742 | Ga0207676_10087401 | |||
| 1743 | Ga0207676_10089435 | |||
| 1744 | Ga0207674_10001514 | |||
| 1745 | Ga0207674_10030742 | |||
| 1746 | Ga0207675_100000570 | |||
| 1747 | Ga0207675_100185284 | |||
| 1748 | Ga0207683_10000004 | |||
| 1749 | Ga0207683_10011279 | |||
| 1750 | Ga0207683_10020739 | |||
| 1751 | Ga0207683_10043398 | |||
| 1752 | Ga0207683_10505246 | |||
| 1753 | Ga0207698_10007207 | |||
| 1754 | Ga0207698_10260534 | |||
| 1755 | Ga0207698_10304142 | |||
| 1756 | Ga0210002_1000183 | |||
| 1757 | Ga0209971_1003472 | |||
| 1758 | Ga0209966_1001288 | |||
| 1759 | Ga0209966_1030379 | |||
| 1760 | Ga0209998_10001130 | |||
| 1761 | Ga0209998_10001412 | |||
| 1762 | Ga0209998_10002862 | |||
| 1763 | Ga0209813_10015791 | |||
| 1764 | Ga0209974_10002488 | |||
| 1765 | Ga0209974_10038892 | |||
| 1766 | Ga0207428_10000218 | |||
| 1767 | Ga0207428_10000250 | |||
| 1768 | Ga0207428_10000777 | |||
| 1769 | Ga0265357_1003621 | |||
| 1770 | Ga0268266_10013746 | |||
| 1771 | Ga0268266_10037440 | |||
| 1772 | Ga0268265_10000194 | |||
| 1773 | Ga0268265_10063302 | |||
| 1774 | Ga0268265_10121161 | |||
| 1775 | Ga0268264_10000393 | |||
| 1776 | Ga0268264_10206938 | |||
| 1777 | Ga0268264_10375726 | |||
| 1778 | Ga0265337_1003879 | |||
| 1779 | Ga0265338_10006566 | |||
| 1780 | Ga0265338_10269461 | |||
| 1781 | Ga0265338_10269689 | |||
| 1782 | Ga0265325_10000039 | |||
| 1783 | Ga0265325_10005389 | |||
| 1784 | Ga0265325_10006452 | |||
| 1785 | Ga0265325_10013324 | |||
| 1786 | Ga0265325_10089525 | |||
| 1787 | Ga0265339_10000071 | |||
| 1788 | Ga0265339_10011771 | |||
| 1789 | Ga0265339_10096653 | |||
| 1790 | Ga0265316_10060342 | |||
| 1791 | Ga0265316_10106018 | |||
| 1792 | Ga0265316_10119851 | |||
| 1793 | Ga0265313_10000057 | |||
| 1794 | Ga0265313_10000415 | |||
| 1795 | Ga0265313_10001341 | |||
| 1796 | Ga0265313_10001740 | |||
| 1797 | Ga0265313_10039367 | |||
| 1798 | Ga0265314_10003150 | |||
| 1799 | Ga0265314_10024673 | |||
| 1800 | Ga0265342_10010642 | |||
| 1801 | Ga0307405_10008563 | |||
| 1802 | Ga0307409_100381988 | |||
| 1803 | Ga0307416_100216204 | |||
| 1804 | Ga0307416_100276325 | |||
| 1805 | Ga0316583_10000158 | |||
| 1806 | Ga0373930_0001167 | |||
| 1807 | Ga0373930_0015641 | |||
| 1808 | Ga0373948_0000190 | |||
| 1809 | Ga0373948_0007388 | |||
| 1810 | Ga0373950_0000342 | |||
| 1811 | Ga0373950_0003250 | |||
| 1812 | Ga0373958_0000055 | |||
| 1813 | Ga0373958_0002208 | |||
| 1814 | Ga0373959_0005211 | |||
| 1815 | Ga0373938_0003013 | |||
| 1816 | Ga0373938_0004580 | |||
| 1817 | Ga0373938_0027998 | |||
| 1818 | Ga0373926_0049144 | |||
| 1819 | Ga0373926_0099066 | |||
| 1820 | Ga0373928_0000361 | |||
| 1821 | Ga0373928_0003934 | |||
| 1822 | Ga0373928_0037247 | |||
| 1823 | Ga0373929_0000927 | |||
| 1824 | Ga0373929_0005221 | |||
| 1825 | Ga0373940_0000594 | |||
| 1826 | Ga0373940_0019435 | |||
| 1827 | Ga0373940_0027313 | |||
| 1828 | Ga0373944_0026503 | |||
| 1829 | Ga0373949_0000308 | |||
| 1830 | Ga0373949_0001125 | |||
| 1831 | Ga0373949_0003075 | |||
| 1832 | Ga0373951_0000393 | |||
| 1833 | Ga0373951_0005644 | |||
| 1834 | Ga0373952_0000208 | |||
| 1835 | Ga0373952_0003614 | |||
| 1836 | Ga0373923_0040203 | |||
| 1837 | Ga0373923_0054218 | |||
| 1838 | Ga0373923_0067162 | |||
| 1839 | Ga0373932_0000031 | |||
| 1840 | Ga0373932_0001291 | |||
| 1841 | Ga0373932_0002778 | |||
| 1842 | Ga0373936_0041267 | |||
| 1843 | Ga0373939_0000083 | |||
| 1844 | Ga0373939_0002536 | |||
| 1845 | Ga0373939_0006676 | |||
| 1846 | Ga0373941_0000540 | |||
| 1847 | Ga0373941_0003276 | |||
| 1848 | Ga0373941_0006891 | |||
| 1849 | Ga0373953_0038456 | |||
| 1850 | Ga0373953_0087433 | |||
| 1851 | Ga0373954_0002212 | |||
| 1852 | Ga0373954_0014077 | |||
| 1853 | Ga0373954_0017610 | |||
| 1854 | Ga0373954_0063059 | |||
| 1855 | Ga0373956_0036600 | |||
| 1856 | Ga0373957_0004504 | |||
| 1857 | Ga0373957_0004989 | |||
| 1858 | Ga0373957_0010202 | |||
| 1859 | Ga0373957_0051454 | |||
| 1860 | Ga0373960_0000088 | |||
| 1861 | Ga0373960_0016046 | |||
| 1862 | Ga0373960_0020821 | |||
| 1863 | Ga0373943_0036171 | |||
| 1864 | Ga0373943_0169942 | |||
| 1865 | Ga0373946_0015402 | |||
| 1866 | Ga0373946_0017067 | |||
| 1867 | Ga0373946_0018220 | |||
| 1868 | Ga0373946_0181357 | |||
| 1869 | Ga0373955_0005908 | |||
| 1870 | Ga0373955_0006095 | |||
| 1871 | Ga0373955_0229157 | |||
| 1872 | Ga0373942_0001977 | |||
| 1873 | Ga0373942_0005072 | |||
| 1874 | Ga0373942_0015853 | |||
| 1875 | Ga0373961_0000539 | |||
| 1876 | Ga0373961_0021041 | |||
| 1877 | Ga0373962_0000715 | |||
| 1878 | Ga0373962_0001826 | |||
| 1879 | Ga0373924_0037005 | |||
| 1880 | Ga0373924_0053076 | |||
| 1881 | Ga0373924_0060690 | |||
| 1882 | Ga0373931_0000034 | |||
| 1883 | Ga0373931_0001752 | |||
| 1884 | Ga0373931_0002007 | |||
| 1885 | Ga0373931_0029793 | |||
| 1886 | Ga0373935_0036652 | |||
| 1887 | Ga0373935_0060269 | |||
| 1888 | Ga0373927_0027484 | |||
| 1889 | Ga0373927_0062736 | |||
| 1890 | Ga0373927_0090003 | |||
| 1891 | Ga0373927_0102664 | |||
| 1892 | Ga0373933_0002026 | |||
| 1893 | Ga0373933_0005149 | |||
| 1894 | Ga0373933_0014886 | |||
| 1895 | Ga0373933_0077918 | |||
| 1896 | Ga0373933_0123954 | |||
| 1897 | Ga0373947_0022290 | |||
| 1898 | Ga0373947_0022926 | |||
| 1899 | Ga0373947_0247239 | |||
| 1900 | Ga0373937_0022992 | |||
| 1901 | Ga0373937_0048237 | |||
| 1902 | Ga0373937_0218789 | |||
| 1903 | Ga0373937_0283598 | |||
| 1904 | Ga0373937_0680185 | |||
| 1905 | Ga0373925_0008801 | |||
| 1906 | Ga0373925_0038910 | |||
| 1907 | Ga0373925_0085861 | |||
| 1908 | Ga0373925_0183584 | |||
| 1909 | Ga0373925_0318438 | |||
| 1910 | Ga0395899_0021560 | |||
| 1911 | Ga0395899_0023051 | |||
| 1912 | Ga0395900_0075230 | |||
| 1913 | Ga0395900_0080585 | |||
| 1914 | Ga0395898_0004062 | |||
| 1915 | Ga0395898_0198304 | |||
| 1916 | Ga0395898_0274050 | |||
| 1917 | Ga0395901_0005167 | |||
| 1918 | Ga0395901_0412868 | |||
| 1919 | Ga0436365_0014752 | |||
| 1920 | Ga0436365_0360126 | |||
| 1921 | Ga0436365_1470399 | |||
| 1922 | Ga0436365_1671729 | |||
| 1923 | Ga0436360_0147686 | |||
| 1924 | Ga0436361_0129874 | |||
| 1925 | Ga0436363_1165521 | |||
| 1926 | Ga0436362_0145276 | |||
| 1927 | Ga0436362_0884639 | |||
| 1928 | Ga0439441_010949 | |||
| 1929 | Ga0439460_0028728 | |||
| 1930 | Ga0466963_0276756 | |||
| 1931 | Ga0466959_0150081 | |||
| 1932 | Ga0451576_0012930 | |||
| 1933 | Ga0466958_0162141 | |||
| 1934 | Ga0466967_0461870 | |||
| 1935 | Ga0495617_009118 | |||
| 1936 | Ga0495592_0003774 | |||
| 1937 | Ga0495592_0009503 | |||
| 1938 | Ga0495592_0175787 | |||
| 1939 | Ga0495592_0261722 | |||
| 1940 | Ga0495603_0164686 | |||
| 1941 | Ga0495629_0000690 | |||
| 1942 | Ga0495629_0004882 | |||
| 1943 | Ga0495629_0041679 | |||
| 1944 | Ga0495641_0059768 | |||
| 1945 | Ga0495651_0014052 | |||
| 1946 | Ga0495651_0018759 | |||
| 1947 | Ga0495651_0073846 | |||
| 1948 | Ga0495651_0189868 | |||
| 1949 | Ga0495653_0004104 | |||
| 1950 | Ga0495653_0011137 | |||
| 1951 | Ga0495653_0108867 | |||
| 1952 | Ga0495653_0122163 | |||
| 1953 | Ga0495580_0016533 | |||
| 1954 | Ga0495582_0027132 | |||
| 1955 | Ga0495582_0046935 | |||
| 1956 | Ga0495605_0022132 | |||
| 1957 | Ga0495639_0029813 | |||
| 1958 | Ga0495639_0041470 | |||
| 1959 | Ga0495664_0000935 | |||
| 1960 | Ga0495664_0032161 | |||
| 1961 | Ga0495584_0028985 | |||
| 1962 | Ga0495585_0001893 | |||
| 1963 | Ga0495594_0081117 | |||
| 1964 | Ga0495607_0019327 | |||
| 1965 | Ga0495608_0014494 | |||
| 1966 | Ga0495608_0015397 | |||
| 1967 | Ga0495608_0017107 | |||
| 1968 | Ga0495608_0104192 | |||
| 1969 | Ga0495610_0022484 | |||
| 1970 | Ga0495618_0003011 | |||
| 1971 | Ga0495618_0005170 | |||
| 1972 | Ga0495628_0005583 | |||
| 1973 | Ga0495628_0117214 | |||
| 1974 | Ga0495628_0122395 | |||
| 1975 | Ga0495630_0008623 | |||
| 1976 | Ga0495630_0135201 | |||
| 1977 | Ga0495643_0098844 | |||
| 1978 | Ga0495643_0129308 | |||
| 1979 | Ga0495644_0000609 | |||
| 1980 | Ga0495652_0020631 | |||
| 1981 | Ga0495652_0049073 | |||
| 1982 | Ga0495652_0201207 | |||
| 1983 | Ga0495665_0089355 | |||
| 1984 | Ga0495640_0019188 | |||
| 1985 | Ga0495640_0254059 | |||
| 1986 | Ga0495640_0300195 | |||
| 1987 | Ga0495586_0031215 | |||
| 1988 | Ga0495587_0001842 | |||
| 1989 | Ga0495587_0014249 | |||
| 1990 | Ga0495587_0040716 | |||
| 1991 | Ga0495587_0132359 | |||
| 1992 | Ga0495609_0114552 | |||
| 1993 | Ga0495645_0000310 | |||
| 1994 | Ga0495645_0008466 | |||
| 1995 | Ga0495645_0313573 | |||
| 1996 | Ga0495622_0013890 | |||
| 1997 | Ga0495667_0000946 | |||
| 1998 | Ga0495667_0020778 | |||
| 1999 | Ga0495667_0078098 | |||
| 2000 | Ga0495656_0000135 | |||
| 2001 | Ga0495634_0007276 | |||
| 2002 | Ga0495634_0007973 | |||
| 2003 | Ga0495611_0089413 | |||
| 2004 | Ga0495635_0002226 | |||
| 2005 | Ga0495635_0010100 | |||
| 2006 | Ga0495659_0001106 | |||
| 2007 | Ga0495661_0057261 | |||
| 2008 | Ga0495588_0024336 | |||
| 2009 | Ga0495657_0009702 | |||
| 2010 | Ga0495657_0018260 | |||
| 2011 | Ga0495657_0091600 | |||
| 2012 | Ga0495599_0014755 | |||
| 2013 | Ga0495599_0082279 | |||
| 2014 | Ga0495599_0088825 | |||
| 2015 | Ga0495599_0118069 | |||
| 2016 | Ga0495599_0196856 | |||
| 2017 | Ga0495623_0047692 | |||
| 2018 | Ga0495623_0183606 | |||
| 2019 | Ga0495646_0000846 | |||
| 2020 | Ga0495646_0005824 | |||
| 2021 | Ga0495646_0186248 | |||
| 2022 | Ga0495647_0017444 | |||
| 2023 | Ga0495647_0057262 | |||
| 2024 | Ga0495658_0003137 | |||
| 2025 | Ga0495658_0007569 | |||
| 2026 | Ga0495669_0026128 | |||
| 2027 | Ga0495613_0061433 | |||
| 2028 | Ga0495613_0077855 | |||
| 2029 | Ga0495613_0326249 | |||
| 2030 | Ga0495624_0009424 | |||
| 2031 | Ga0495624_0095007 | |||
| 2032 | Ga0495670_0000427 | |||
| 2033 | Ga0495670_0137512 | |||
| 2034 | Ga0495600_0000371 | |||
| 2035 | Ga0495600_0002986 | |||
| 2036 | Ga0495600_0144992 | |||
| 2037 | Ga0495581_0073208 | |||
| 2038 | Ga0495604_0008735 | |||
| 2039 | Ga0495604_0018786 | |||
| 2040 | Ga0495604_0026322 | |||
| 2041 | Ga0495604_0064909 | |||
| 2042 | Ga0495604_0392857 | |||
| 2043 | Ga0495674_0009124 | |||
| 2044 | Ga0495674_0032652 | |||
| 2045 | Ga0495674_0079445 | |||
| 2046 | Ga0495674_0101085 | |||
| 2047 | Ga0495672_0122671 | |||
| 2048 | Ga0495676_0041026 | |||
| 2049 | Ga0495680_0002891 | |||
| 2050 | Ga0495680_0004911 | |||
| 2051 | Ga0495680_0052511 | |||
| 2052 | Ga0495680_0103218 | |||
| 2053 | Ga0495680_0117477 | |||
| 2054 | Ga0495675_0003232 | |||
| 2055 | Ga0495675_0025771 | |||
| 2056 | Ga0495675_0272805 | |||
| 2057 | Ga0495685_011033 | |||
| 2058 | Ga0495684_0001459 | |||
| 2059 | Ga0495684_0097058 | |||
| 2060 | Ga0495684_0115883 | |||
| 2061 | Ga0495684_0124339 | |||
| 2062 | Ga0495684_0166725 | |||
| 2063 | Ga0495593_0005084 | |||
| 2064 | Ga0495593_0017427 | |||
| 2065 | Ga0495593_0045359 | |||
| 2066 | Ga0495602_0035918 | |||
| 2067 | Ga0495602_0059119 | |||
| 2068 | Ga0495602_0091580 | |||
| 2069 | Ga0495614_0013485 | |||
| 2070 | Ga0496100_0000050 | |||
| 2071 | Ga0496100_0077112 | |||
| 2072 | Ga0496101_0000121 | |||
| 2073 | Ga0496101_0000736 | |||
| 2074 | Ga0496102_0003252 | |||
| 2075 | Ga0496102_0085354 | |||
| 2076 | Ga0496102_0088060 | |||
| 2077 | Ga0496102_0117195 | |||
| 2078 | Ga0496102_0327404 | |||
| 2079 | Ga0496102_0409953 | |||
| 2080 | Ga0496102_0466921 | |||
| 2081 | Ga0496103_0000175 | |||
| 2082 | Ga0496103_0115582 | |||
| 2083 | Ga0496104_0000454 | |||
| 2084 | Ga0496104_0107071 | |||
| 2085 | Ga0496104_0128575 | |||
| 2086 | Ga0496104_0143317 | |||
| 2087 | Ga0496105_0027592 | |||
| 2088 | Ga0496105_0072615 | |||
| 2089 | Ga0496105_0121105 | |||
| 2090 | Ga0496106_0000133 | |||
| 2091 | Ga0496106_0014768 | |||
| 2092 | Ga0496106_0024517 | |||
| 2093 | Ga0496106_0025595 | |||
| 2094 | Ga0496107_0000237 | |||
| 2095 | Ga0496107_0018351 | |||
| 2096 | Ga0496107_0046462 | |||
| 2097 | Ga0496107_0106139 | |||
| 2098 | Ga0496108_0017335 | |||
| 2099 | Ga0496108_0036931 | |||
| 2100 | Ga0496108_0124282 | |||
| 2101 | Ga0496108_0164751 | |||
| 2102 | Ga0496109_0007388 | |||
| 2103 | Ga0496109_0026973 | |||
| 2104 | Ga0496109_0431687 | |||
| 2105 | Ga0496110_0009875 | |||
| 2106 | Ga0496110_0074280 | |||
| 2107 | Ga0496110_0103921 | |||
| 2108 | Ga0496111_0066222 | |||
| 2109 | Ga0496111_0160042 | |||
| 2110 | Ga0496112_0229477 | |||
| 2111 | Ga0496112_0247188 | |||
| 2112 | Ga0496112_0593394 | |||
| 2113 | Ga0496113_0190121 | |||
| 2114 | Ga0496113_0227683 | |||
| 2115 | Ga0496113_0265922 | |||
| 2116 | Ga0496114_0002721 | |||
| 2117 | Ga0496114_0012692 | |||
| 2118 | Ga0496114_0032154 | |||
| 2119 | Ga0496115_0066203 | |||
| 2120 | Ga0496115_0081829 | |||
| 2121 | Ga0496115_0084764 | |||
| 2122 | Ga0496115_0129112 | |||
| 2123 | Ga0496115_0212058 | |||
| 2124 | Ga0496117_0036056 | |||
| 2125 | Ga0496117_0052793 | |||
| 2126 | Ga0496118_0134551 | |||
| 2127 | Ga0496119_0188403 | |||
| 2128 | Ga0496122_0022949 | |||
| 2129 | Ga0496122_0081079 | |||
| 2130 | Ga0501031_0086553 | |||
| 2131 | Ga0501032_0028639 | |||
| 2132 | Ga0501032_0090434 | |||
| 2133 | Ga0501032_0126405 | |||
| 2134 | Ga0501032_0150846 | |||
| 2135 | Ga0501032_0194621 | |||
| 2136 | Ga0501033_0014695 | |||
| 2137 | Ga0501033_0022119 | |||
| 2138 | Ga0501033_0054068 | |||
| 2139 | Ga0501034_0000032 | |||
| 2140 | Ga0501034_0042726 | |||
| 2141 | Ga0501034_0060549 | |||
| 2142 | Ga0501034_0060914 | |||
| 2143 | Ga0501034_0090780 | |||
| 2144 | Ga0501034_0151914 | |||
| 2145 | Ga0501034_0167393 | |||
| 2146 | Ga0501034_0264152 | |||
| 2147 | Ga0501034_0387995 | |||
| 2148 | Ga0501034_0468769 | |||
| 2149 | Ga0501036_0003133 | |||
| 2150 | Ga0501036_0026699 | |||
| 2151 | Ga0501036_0059934 | |||
| 2152 | Ga0501036_0133412 | |||
| 2153 | Ga0501036_0503699 | |||
| 2154 | Ga0501037_0014087 | |||
| 2155 | Ga0501037_0034335 | |||
| 2156 | Ga0501037_0074977 | |||
| 2157 | Ga0501038_0012226 | |||
| 2158 | Ga0501038_0025621 | |||
| 2159 | Ga0501038_0064795 | |||
| 2160 | Ga0501038_0090496 | |||
| 2161 | Ga0501038_0125562 | |||
| 2162 | Ga0501038_0440615 | |||
| 2163 | Ga0501041_0296987 | |||
| 2164 | Ga0501042_0315851 | |||
| 2165 | Ga0501042_0420237 | |||
| 2166 | Ga0501043_0002174 | |||
| 2167 | Ga0501043_0019813 | |||
| 2168 | Ga0501043_0141415 | |||
| 2169 | Ga0501046_0076410 | |||
| 2170 | Ga0501047_0019888 | |||
| 2171 | Ga0501047_0022348 | |||
| 2172 | Ga0501047_0030921 | |||
| 2173 | Ga0501047_0090599 | |||
| 2174 | Ga0501047_0192663 | |||
| 2175 | Ga0501047_0266501 | |||
| 2176 | Ga0501048_0116600 | |||
| 2177 | Ga0501048_0206530 | |||
| 2178 | Ga0501048_0248442 | |||
| 2179 | Ga0501067_0029026 | |||
| 2180 | Ga0501069_0018653 | |||
| 2181 | Ga0501069_0064447 | |||
| 2182 | Ga0501070_0000929 | |||
| 2183 | Ga0501070_0025114 | |||
| 2184 | Ga0501070_0047935 | |||
| 2185 | Ga0501070_0062238 | |||
| 2186 | Ga0501070_0152763 | |||
| 2187 | Ga0501070_0167154 | |||
| 2188 | Ga0501071_0065654 | |||
| 2189 | Ga0501071_0253519 | |||
| 2190 | Ga0501071_0347921 | |||
| 2191 | Ga0501072_0032679 | |||
| 2192 | Ga0501072_0038088 | |||
| 2193 | Ga0501072_0335628 | |||
| 2194 | Ga0501073_0007407 | |||
| 2195 | Ga0501073_0065786 | |||
| 2196 | Ga0501074_0090568 | |||
| 2197 | Ga0501074_0171499 | |||
| 2198 | Ga0501076_0029006 | |||
| 2199 | Ga0501076_0179356 | |||
| 2200 | Ga0501076_0280202 | |||
| 2201 | Ga0501080_0028616 | |||
| 2202 | Ga0501080_0098556 | |||
| 2203 | Ga0501080_0149856 | |||
| 2204 | Ga0501080_0217610 | |||
| 2205 | Ga0501080_0468059 | |||
| 2206 | Ga0501081_0030358 | |||
| 2207 | Ga0501083_0113235 | |||
| 2208 | Ga0501083_0186995 | |||
| 2209 | Ga0501035_0011391 | |||
| 2210 | Ga0501035_0039179 | |||
| 2211 | Ga0501035_0059429 | |||
| 2212 | Ga0501035_0060617 | |||
| 2213 | Ga0501035_0071320 | |||
| 2214 | Ga0501035_0111490 | |||
| 2215 | Ga0501044_0020829 | |||
| 2216 | Ga0501044_0023302 | |||
| 2217 | Ga0501044_0202853 | |||
| 2218 | Ga0501044_0232670 | |||
| 2219 | Ga0501044_0328200 | |||
| 2220 | Ga0501044_0506713 | |||
| 2221 | Ga0501044_0557423 | |||
| 2222 | nmdc:mga03n38_57442_c1 | |||
| 2223 | nmdc:mga03n38_95617_c1 | |||
| 2224 | nmdc:mga0yw44_189281_c1 | |||
| 2225 | nmdc:mga0yw44_279559_c1 | |||
| 2226 | nmdc:mga0k408_27170_c1 | |||
| 2227 | nmdc:mga06z11_28840_c1 | |||
| 2228 | nmdc:mga06z11_30793_c1 | |||
| 2229 | nmdc:mga06z11_32988_c1 | |||
| 2230 | nmdc:mga04h51_14127_c1 | |||
| 2231 | nmdc:mga07m45_194979_c1 | |||
| 2232 | nmdc:mga07m45_44118_c1 | |||
| 2233 | nmdc:mga07m45_47599_c1 | |||
| 2234 | nmdc:mga05p37_129131_c1 | |||
| 2235 | nmdc:mga05p37_34216_c1 | |||
| 2236 | nmdc:mga05p37_354_c1 | |||
| 2237 | nmdc:mga09592_1311_c1 | |||
| 2238 | nmdc:mga0qj67_167658_c1 | |||
| 2239 | nmdc:mga0qj67_1940_c1 | |||
| 2240 | nmdc:mga0qj67_452_c1 | |||
| 2241 | nmdc:mga06r32_147_c1 | |||
| 2242 | nmdc:mga06r32_166113_c1 | |||
| 2243 | nmdc:mga08y16_1264_c1 | |||
| 2244 | nmdc:mga08y16_463250_c1 | |||
| 2245 | nmdc:mga08y16_706_c1 | |||
| 2246 | nmdc:mga0n895_126_c1 | |||
| 2247 | nmdc:mga0n895_203244_c1 | |||
| 2248 | nmdc:mga0n895_3658_c1 | |||
| 2249 | nmdc:mga0n895_73852_c1 | |||
| 2250 | nmdc:mga0rr50_110564_c1 | |||
| 2251 | nmdc:mga0rr50_39348_c1 | |||
| 2252 | nmdc:mga0rr50_58565_c1 | |||
| 2253 | nmdc:mga08x19_21_c1 | |||
| 2254 | nmdc:mga08x19_34989_c1 | |||
| 2255 | nmdc:mga0a205_197_c1 | |||
| 2256 | nmdc:mga0a205_35258_c1 | |||
| 2257 | Ga0495601_0000068 | |||
| 2258 | Ga0495601_0008114 | |||
| 2259 | Ga0495601_0009067 | |||
| 2260 | Ga0495601_0023631 | |||
| 2261 | Ga0495601_0042090 | |||
| 2262 | Ga0495601_0050293 | |||
| 2263 | Ga0495601_0066779 | |||
| 2264 | Ga0495612_0001544 | |||
| 2265 | Ga0495612_0002142 | |||
| 2266 | Ga0495612_0014034 | |||
| 2267 | Ga0495612_0020815 | |||
| 2268 | Ga0495612_0103951 | |||
| 2269 | Ga0500610_0084049 | |||
| 2270 | Ga0495595_0001152 | |||
| 2271 | Ga0495595_0001627 | |||
| 2272 | Ga0495595_0029994 | |||
| 2273 | Ga0495595_0057613 | |||
| 2274 | Ga0495595_0125911 | |||
| 2275 | Ga0495619_0000136 | |||
| 2276 | Ga0495619_0000154 | |||
| 2277 | Ga0495619_0001079 | |||
| 2278 | Ga0495619_0010153 | |||
| 2279 | Ga0495619_0016781 | |||
| 2280 | Ga0495619_0022065 | |||
| 2281 | Ga0495619_0130927 | |||
| 2282 | Ga0500643_000833 | |||
| 2283 | Ga0500644_0000982 | |||
| 2284 | Ga0500651_0008832 | |||
| 2285 | Ga0500566_0038988 | |||
| 2286 | Ga0500641_0015946 | |||
| 2287 | Ga0500650_0030316 | |||
| 2288 | Ga0500569_066558 | |||
| 2289 | Ga0500595_000002 | |||
| 2290 | Ga0500608_128682 | |||
| 2291 | Ga0500616_0000002 | |||
| 2292 | Ga0500616_0010066 | |||
| 2293 | Ga0500616_0013446 | |||
| 2294 | Ga0500622_0036280 | |||
| 2295 | Ga0500636_0045638 | |||
| 2296 | Ga0500645_000549 | |||
| 2297 | Ga0501084_0066272 | |||
| 2298 | Ga0501084_0320043 | |||
| 2299 | Ga0501082_0054918 | |||
| 2300 | Ga0501082_0102444 | |||
| 2301 | Ga0530510_0056915 | |||
| 2302 | 2513591808 | |||
| 2303 | 2643756796 | |||
| 2304 | 2644727631 | |||
| 2305 | 2644733454 | |||
| 2306 | 2644744676 | |||
| 2307 | 2819717405 | |||
| 2308 | 2841763021 | |||
| 2309 | 2844109109 | |||
| 2310 | 2851182304 | |||
| 2311 | 2851251216 | |||
| 2312 | 2917701039 | |||
| 2313 | 2919454297 | |||
| 2314 | 8001848233 | |||
| 2315 | 8054568422 | |||
| 2316 | 8057534968 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5922 | 13 | 276 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5865 | 13 | 276 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5507 | 17 | 276 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5321 | 17 | 276 |
| 4lds-assembly1.cif.gz_B | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.3586 | 17 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0XLR0_202_437_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4527 | 48 | 249 | 1.20.1250.20 |
| af_Q54E67_237_417_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4459 | 58 | 274 | 1.20.1250.20 |
| af_Q54E67_237_417_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.427 | 58 | 274 | 1.20.1250.20 |
| af_A0A1D6FKK2_52_340_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4055 | 12 | 271 | 1.20.1250.20 |
| af_O07730_221_402_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4012 | 59 | 274 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A800M742-F1-model_v4 | Probable membrane transporter protein | 0.9738 | 11 | 274 |
GO:0005886
|
| AF-A0A2U1V8W1-F1-model_v4 | Probable membrane transporter protein | 0.9707 | 10 | 274 |
GO:0005886
|
| AF-A0A2W5BL51-F1-model_v4 | deleted | 0.9706 | 5 | 221 |
|
| AF-A0A7U3E1W1-F1-model_v4 | deleted | 0.9698 | 1 | 274 |
|
| AF-A0A3D2W4T4-F1-model_v4 | Probable membrane transporter protein | 0.9683 | 9 | 206 |
GO:0005886
|