F490970

General Info

Members Datasets Scaffolds Average Seq Length
1158 624 1054 117

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0164273|Ga0495603_0164273_88_498
Length 136
Sequence MTNHHVPSMTCGIGEEADTTMTNLIDGLNSASLRTDVPAFRPGDTINVHVRVIEGNRSRVQQFKGVVIRRQGAGISETFTVRKVSFSVGVERTFPVHTPIVEKIEVVTRGDVRRAKLYYLRELRGKAAKIKEKRDN

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
4 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
8 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
9 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
10 2643221548 Streptomyces sp. Root55 Isolate Unclassified
11 2643221578 Streptomyces sp. Root63 Isolate Unclassified
12 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
13 2643221647 Streptomyces sp. Root369 Isolate Unclassified
14 2643221649 Leifsonia sp. Root4 Isolate Unclassified
15 2643221670 Streptomyces sp. Root431 Isolate Unclassified
16 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
17 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
18 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
19 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
20 2643221714 Streptomyces sp. Root264 Isolate Unclassified
21 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
22 2739367653 Kocuria sp. OV113 Isolate Unclassified
23 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
24 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
25 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
26 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
27 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
28 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
29 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
30 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
31 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
32 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
33 2808606448 Streptomyces sp. 193411 Isolate Unclassified
34 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
35 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
36 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
37 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
38 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
39 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
40 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
41 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
42 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
43 2857727296 Kocuria sp. R-72562 Isolate Unclassified
44 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
45 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
46 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
47 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
48 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
49 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
50 2867369537 Streptomyces sp. Z26 Isolate Unclassified
51 2867428634 Streptomyces sp. RP5T Isolate Unclassified
52 2867475112 Streptomyces sp. TM32 Isolate Unclassified
53 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
54 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
55 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
56 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
57 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
58 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
59 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
60 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
61 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
62 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
63 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
64 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
65 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
66 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
67 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
68 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
69 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
70 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
71 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
72 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
73 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
74 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
75 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
76 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
77 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
78 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
79 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
80 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
81 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
82 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
83 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
84 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
85 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
86 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
87 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
88 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
89 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
90 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
91 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
92 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
93 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
94 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
95 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
96 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
97 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
98 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
99 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
101 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
105 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
106 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
107 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
108 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
109 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
110 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
111 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
112 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
113 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
114 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
115 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
116 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
117 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
118 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
119 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
120 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
121 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
122 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
123 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
124 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
125 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
126 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
127 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
128 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
129 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
130 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
131 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
132 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
133 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
134 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
135 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
136 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
137 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
140 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
141 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
142 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
143 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
144 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
145 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
146 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
147 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
148 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
149 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
150 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
151 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
152 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
153 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
154 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
155 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
156 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
157 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
158 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
159 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
160 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
161 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
162 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
163 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
164 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
165 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
166 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
167 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
168 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
169 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
170 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
171 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
172 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
173 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
174 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
175 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
176 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
177 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
178 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
179 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
180 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
181 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
182 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
183 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
184 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
185 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
186 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
187 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
188 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
189 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
191 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
202 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
203 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
205 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
206 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
207 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
208 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
209 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
214 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
215 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
216 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
217 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
218 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
219 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
220 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
221 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
222 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
226 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
227 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
228 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
229 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
233 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
234 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
235 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
236 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
238 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
293 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
294 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
298 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
299 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
300 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
301 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
302 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
303 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
304 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
305 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
306 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
307 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
308 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
309 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
310 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
311 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
312 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
313 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
317 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
318 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
319 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
320 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
321 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
322 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
323 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
324 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
325 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
326 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
327 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
328 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
329 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
330 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
331 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
332 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
333 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
334 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
335 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
336 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
337 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
338 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
339 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
340 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
341 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
342 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
343 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
344 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
345 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
346 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
347 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
348 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
349 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
350 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
351 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
352 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
353 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
354 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
355 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
356 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
357 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
358 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
359 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
360 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
361 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
362 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
363 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
364 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
365 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
366 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
367 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
368 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
369 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
370 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
371 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
372 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
373 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
374 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
375 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
376 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
377 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
378 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
379 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
380 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
381 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
382 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
383 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
384 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
385 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
386 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
387 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
388 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
389 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
390 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
391 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
392 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
393 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
394 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
395 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
396 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
397 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
398 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
399 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
400 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
403 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
404 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
405 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
406 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
407 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
408 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
409 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
410 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
411 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
412 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
413 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
414 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
415 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
416 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
417 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
418 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
419 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
422 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
423 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
424 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
425 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
426 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
427 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
428 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
429 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
430 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
431 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
432 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
433 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
434 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
435 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
436 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
437 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
438 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
439 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
440 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
441 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
442 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
443 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
444 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
445 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
446 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
447 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
448 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
449 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
452 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
453 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
454 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
455 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
456 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
457 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
458 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
461 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
469 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
498 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
500 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
506 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
507 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
508 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
509 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
510 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
511 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
512 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
513 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
514 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
515 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
516 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
517 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
518 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
519 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
520 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
521 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
522 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
523 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
524 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
525 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
526 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
527 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
531 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
532 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
533 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
534 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
535 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
536 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
537 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
538 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
539 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
540 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
541 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
542 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
543 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
544 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
545 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
546 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
547 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
548 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
549 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
550 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
551 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
552 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
553 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
554 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
555 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
556 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
557 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
558 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
559 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
560 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
561 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
562 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
563 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
564 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
565 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
566 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
567 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
568 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
569 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
597 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
598 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
604 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
605 8002775197 Frankia nepalensis CN7 Isolate Nodule
606 8002784119 Frankia sp. AgB1.9 Isolate Nodule
607 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
608 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
609 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
610 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
611 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
612 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
613 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
614 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
615 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
616 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
617 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
618 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
619 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
620 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
621 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
622 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
623 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
624 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.2
Metatranscriptomes 13.82
Isolates 8.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.09
Nodule 0.6
Rhizoplane 4.49
Rhizosphere 82.64
Stem 0
Stem Tuber 0
Unclassified 7.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214637478 2209111006 Bacteria 517
2 LJQas_1021931 3300000549 Bacteria 743
3 JGI24741J21665_1048199 3300001915 Bacteria 627
4 JGI24752J21851_1029606 3300001976 Bacteria 721
5 JGI24739J22299_10068969 3300001989 Bacteria 1103
6 JGI24737J22298_10026270 3300001990 Bacteria 1839
7 JGI24735J21928_10195025 3300002067 Bacteria 587
8 JGI24738J21930_10007820 3300002075 Bacteria 2453
9 JGI24751J29686_10009512 3300002459 Bacteria 1999
10 rootH1_10010292 3300003316 Bacteria 5690
11 JGI25160J50197_1022002 3300003354 Bacteria 1878
12 Ga0007417J51691_1030618 3300003544 Bacteria 506
13 Ga0007429J51699_1022932 3300003579 Bacteria 506
14 Ga0058692_1024712 3300003856 Bacteria 1202
15 Ga0058861_11720119 3300004800 Bacteria 550
16 Ga0058861_11903156 3300004800 Bacteria 609
17 Ga0058860_11807479 3300004801 Bacteria 534
18 Ga0058862_12532545 3300004803 Bacteria 654
19 Ga0065714_10136409 3300005288 Bacteria 1205
20 Ga0070658_10291940 3300005327 Bacteria 1389
21 Ga0070658_10346223 3300005327 Bacteria 1272
22 Ga0070658_10678137 3300005327 Bacteria 894
23 Ga0070676_10376614 3300005328 Bacteria 982
24 Ga0070683_100353724 3300005329 Bacteria 1399
25 Ga0070690_100077167 3300005330 Bacteria 2174
26 Ga0070690_100358820 3300005330 Bacteria 1060
27 Ga0070670_100082464 3300005331 Bacteria 2763
28 Ga0068869_100085233 3300005334 Bacteria 2366
29 Ga0068869_100296181 3300005334 Bacteria 1305
30 Ga0070666_10507200 3300005335 Bacteria 875
31 Ga0070680_100011833 3300005336 Bacteria 6767
32 Ga0070680_101837984 3300005336 Bacteria 525
33 Ga0070682_100297170 3300005337 Bacteria 1183
34 Ga0070682_100452592 3300005337 Bacteria 983
35 Ga0070682_101231873 3300005337 Bacteria 633
36 Ga0068868_100016532 3300005338 Bacteria 5482
37 Ga0068868_100028070 3300005338 Bacteria 4298
38 Ga0070660_100086092 3300005339 Bacteria 2472
39 Ga0070689_100058921 3300005340 Bacteria 2983
40 Ga0070689_100169184 3300005340 Bacteria 1770
41 Ga0070691_10010771 3300005341 Bacteria 4172
42 Ga0070687_100006409 3300005343 Bacteria 4820
43 Ga0070687_100058468 3300005343 Bacteria 2026
44 Ga0070692_10046971 3300005345 Bacteria 2233
45 Ga0070669_100205901 3300005353 Bacteria 1550
46 Ga0070675_100181570 3300005354 Bacteria 1819
47 Ga0070675_100322909 3300005354 Bacteria 1364
48 Ga0070671_100015635 3300005355 Bacteria 6132
49 Ga0070671_100578447 3300005355 Bacteria 970
50 Ga0070674_100459064 3300005356 Bacteria 1053
51 Ga0070673_100042857 3300005364 Bacteria 3492
52 Ga0070673_100959849 3300005364 Bacteria 794
53 Ga0070688_100058109 3300005365 Bacteria 2434
54 Ga0070688_100071869 3300005365 Bacteria 2216
55 Ga0070659_100100673 3300005366 Bacteria 2325
56 Ga0070659_100213297 3300005366 Bacteria 1591
57 Ga0070659_100764322 3300005366 Bacteria 839
58 Ga0070667_100017825 3300005367 Bacteria 5885
59 Ga0070714_100000056 3300005435 Bacteria 103178
60 Ga0070713_101221205 3300005436 Bacteria 728
61 Ga0070701_10132059 3300005438 Bacteria 1420
62 Ga0070711_101357374 3300005439 Bacteria 618
63 Ga0070705_100173637 3300005440 Bacteria 1453
64 Ga0070700_100000019 3300005441 Bacteria 137133
65 Ga0070700_100104453 3300005441 Bacteria 1872
66 Ga0070663_100049416 3300005455 Bacteria 2986
67 Ga0070663_100879712 3300005455 Bacteria 773
68 Ga0070678_100002824 3300005456 Bacteria 9599
69 Ga0070678_100256100 3300005456 Bacteria 1470
70 Ga0070662_100370810 3300005457 Bacteria 1176
71 Ga0070681_10081618 3300005458 Bacteria 3189
72 Ga0070681_11713629 3300005458 Bacteria 555
73 Ga0068867_100001167 3300005459 Bacteria 17965
74 Ga0070685_10062633 3300005466 Bacteria 2181
75 Ga0070685_10219110 3300005466 Bacteria 1246
76 Ga0070685_10247598 3300005466 Bacteria 1179
77 Ga0070679_100204454 3300005530 Bacteria 1939
78 Ga0070679_100551235 3300005530 Bacteria 1097
79 Ga0070679_100592986 3300005530 Bacteria 1051
80 Ga0070684_100117326 3300005535 Bacteria 2392
81 Ga0070697_101858954 3300005536 Bacteria 539
82 Ga0068853_100051137 3300005539 Bacteria 3556
83 Ga0068853_100129928 3300005539 Bacteria 2254
84 Ga0068853_100336077 3300005539 Bacteria 1403
85 Ga0068853_100664384 3300005539 Bacteria 992
86 Ga0070672_100197169 3300005543 Bacteria 1683
87 Ga0070672_101547359 3300005543 Bacteria 594
88 Ga0070693_100023343 3300005547 Bacteria 3305
89 Ga0070665_100115915 3300005548 Bacteria 2682
90 Ga0068855_100018553 3300005563 Bacteria 8365
91 Ga0068855_100139154 3300005563 Bacteria 2769
92 Ga0068855_100336619 3300005563 Bacteria 1665
93 Ga0068855_100818276 3300005563 Bacteria 989
94 Ga0068855_102247951 3300005563 Bacteria 547
95 Ga0070664_100288265 3300005564 Bacteria 1482
96 Ga0068857_101642883 3300005577 Bacteria 628
97 Ga0068854_100120019 3300005578 Bacteria 1995
98 Ga0068854_100125574 3300005578 Bacteria 1953
99 Ga0068854_100172269 3300005578 Bacteria 1685
100 Ga0068856_100028485 3300005614 Bacteria 5455
101 Ga0068856_100038303 3300005614 Bacteria 4706
102 Ga0068856_100709988 3300005614 Bacteria 1026
103 Ga0068856_101145548 3300005614 Bacteria 795
104 Ga0070702_100001056 3300005615 Bacteria 10979
105 Ga0070702_100978694 3300005615 Bacteria 668
106 Ga0068852_100078990 3300005616 Bacteria 2913
107 Ga0068852_100475708 3300005616 Bacteria 1241
108 Ga0068852_100687585 3300005616 Bacteria 1032
109 Ga0068859_101108835 3300005617 Bacteria 870
110 Ga0068864_100363921 3300005618 Bacteria 1367
111 Ga0068864_100504153 3300005618 Bacteria 1165
112 Ga0068866_10181172 3300005718 Bacteria 1244
113 Ga0068861_100856007 3300005719 Bacteria 857
114 Ga0068851_10021643 3300005834 Bacteria 3122
115 Ga0068870_10001305 3300005840 Bacteria 10036
116 Ga0068863_100096892 3300005841 Bacteria 2800
117 Ga0068858_100270343 3300005842 Bacteria 1617
118 Ga0068860_101673940 3300005843 Bacteria 658
119 Ga0068860_101725611 3300005843 Bacteria 648
120 Ga0068862_100230623 3300005844 Bacteria 1679
121 Ga0081455_10000841 3300005937 Bacteria 39520
122 Ga0081540_1027281 3300005983 Bacteria 3240
123 Ga0070717_11276701 3300006028 Bacteria 668
124 Ga0075365_10154977 3300006038 Bacteria 1594
125 Ga0075365_10466118 3300006038 Bacteria 892
126 Ga0075368_10236793 3300006042 Bacteria 778
127 Ga0075363_100456622 3300006048 Bacteria 755
128 Ga0075364_10258523 3300006051 Bacteria 1184
129 Ga0075364_10313224 3300006051 Bacteria 1069
130 Ga0070716_100930570 3300006173 Bacteria 683
131 Ga0075362_10074798 3300006177 Bacteria 1553
132 Ga0075362_10410166 3300006177 Bacteria 684
133 Ga0075367_10065028 3300006178 Bacteria 2183
134 Ga0075367_10316855 3300006178 Bacteria 983
135 Ga0075367_10371127 3300006178 Bacteria 904
136 Ga0075369_10110603 3300006186 Bacteria 1238
137 Ga0075366_10184408 3300006195 Bacteria 1268
138 Ga0097621_100140819 3300006237 Bacteria 2061
139 Ga0075370_10114704 3300006353 Bacteria 1566
140 Ga0075370_10297319 3300006353 Bacteria 960
141 Ga0075370_10478030 3300006353 Bacteria 751
142 Ga0068871_100023101 3300006358 Bacteria 4803
143 Ga0075428_100924610 3300006844 Bacteria 925
144 Ga0075428_102576154 3300006844 Bacteria 520
145 Ga0075433_10012775 3300006852 Bacteria 6800
146 Ga0075434_100057081 3300006871 Bacteria 3880
147 Ga0075429_100244157 3300006880 Bacteria 1573
148 Ga0068865_100079231 3300006881 Bacteria 2352
149 Ga0075436_100123581 3300006914 Bacteria 1812
150 Ga0097620_101108851 3300006931 Bacteria 870
151 Ga0099826_10047403 3300006948 Bacteria 2920
152 Ga0075435_100058876 3300007076 Bacteria 3113
153 Ga0105251_10073292 3300009011 Bacteria 1591
154 Ga0105244_10166265 3300009036 Bacteria 1051
155 Ga0105240_10097773 3300009093 Bacteria 3576
156 Ga0105240_10123599 3300009093 Bacteria 3113
157 Ga0105240_10150035 3300009093 Bacteria 2777
158 Ga0105240_10968712 3300009093 Bacteria 911
159 Ga0105240_12361110 3300009093 Bacteria 551
160 Ga0111539_10107040 3300009094 Bacteria 3281
161 Ga0111539_11269307 3300009094 Bacteria 855
162 Ga0105245_10129375 3300009098 Bacteria 2367
163 Ga0105245_10141756 3300009098 Bacteria 2264
164 Ga0114129_10244432 3300009147 Bacteria 2411
165 Ga0114129_11687082 3300009147 Bacteria 773
166 Ga0105243_10033945 3300009148 Bacteria 3947
167 Ga0105243_10366479 3300009148 Bacteria 1328
168 Ga0105243_10616657 3300009148 Bacteria 1047
169 Ga0105241_10056976 3300009174 Bacteria 2997
170 Ga0105241_11033088 3300009174 Bacteria 770
171 Ga0105242_10031151 3300009176 Bacteria 4257
172 Ga0105242_10531799 3300009176 Bacteria 1124
173 Ga0105248_10049750 3300009177 Bacteria 4700
174 Ga0105248_10241619 3300009177 Bacteria 2033
175 Ga0105237_10024693 3300009545 Bacteria 6148
176 Ga0105237_10541052 3300009545 Bacteria 1171
177 Ga0105237_11217199 3300009545 Bacteria 760
178 Ga0105237_12364879 3300009545 Bacteria 541
179 Ga0105238_10288636 3300009551 Bacteria 1622
180 Ga0105238_10291505 3300009551 Bacteria 1614
181 Ga0105238_10757190 3300009551 Bacteria 985
182 Ga0105238_10841709 3300009551 Bacteria 934
183 Ga0105238_12620460 3300009551 Bacteria 540
184 Ga0105249_10439601 3300009553 Bacteria 1341
185 Ga0105239_10139390 3300010375 Bacteria 2702
186 Ga0105239_10378821 3300010375 Bacteria 1600
187 Ga0105239_10572903 3300010375 Bacteria 1287
188 Ga0105239_10921052 3300010375 Bacteria 1003
189 Ga0105239_11553082 3300010375 Bacteria 765
190 Ga0105246_10090848 3300011119 Bacteria 2200
191 Ga0105246_10137672 3300011119 Bacteria 1832
192 Ga0157313_1011741 3300012503 Bacteria 766
193 Ga0157327_1072430 3300012512 Bacteria 538
194 Ga0154010_142966 3300013062 Bacteria 555
195 Ga0157373_10916273 3300013100 Bacteria 651
196 Ga0157371_10016630 3300013102 Bacteria 5483
197 Ga0157370_10173785 3300013104 Bacteria 2002
198 Ga0157370_11463455 3300013104 Bacteria 614
199 Ga0157369_10068099 3300013105 Bacteria 3824
200 Ga0157369_10620518 3300013105 Bacteria 1116
201 Ga0157369_11344430 3300013105 Bacteria 728
202 Ga0157374_10571546 3300013296 Bacteria 1139
203 Ga0157374_11779034 3300013296 Bacteria 641
204 Ga0157374_12297389 3300013296 Bacteria 566
205 Ga0157378_10089571 3300013297 Bacteria 2795
206 Ga0157378_11835622 3300013297 Bacteria 655
207 Ga0163162_10184281 3300013306 Bacteria 2214
208 Ga0163162_11726437 3300013306 Bacteria 715
209 Ga0163162_12306768 3300013306 Bacteria 618
210 Ga0157372_10072973 3300013307 Bacteria 3868
211 Ga0157372_10154473 3300013307 Bacteria 2650
212 Ga0157372_10846462 3300013307 Bacteria 1062
213 Ga0157372_12488904 3300013307 Bacteria 594
214 Ga0157375_10077436 3300013308 Bacteria 3355
215 Ga0157375_10141200 3300013308 Bacteria 2536
216 Ga0182008_10000192 3300014497 Bacteria 48269
217 Ga0182008_10216701 3300014497 Bacteria 978
218 Ga0157377_10111160 3300014745 Bacteria 1647
219 Ga0157379_10023573 3300014968 Bacteria 5462
220 Ga0157379_10037476 3300014968 Bacteria 4324
221 Ga0157376_10863077 3300014969 Bacteria 921
222 Ga0157376_11449097 3300014969 Bacteria 719
223 Ga0182006_1008560 3300015261 Bacteria 4637
224 Ga0182007_10000165 3300015262 Bacteria 45550
225 Ga0182007_10198257 3300015262 Bacteria 701
226 Ga0182005_1014651 3300015265 Bacteria 2193
227 Ga0183367_1013 3300015688 Bacteria 334176
228 Ga0163161_10820407 3300017792 Bacteria 783
229 Ga0197907_10602326 3300020069 Bacteria 598
230 Ga0197907_11126863 3300020069 Bacteria 813
231 Ga0206356_10126309 3300020070 Bacteria 730
232 Ga0206356_11196099 3300020070 Bacteria 532
233 Ga0206356_11249890 3300020070 Bacteria 845
234 Ga0206356_11271281 3300020070 Bacteria 3272
235 Ga0206349_1321064 3300020075 Bacteria 570
236 Ga0206355_1281966 3300020076 Bacteria 943
237 Ga0206355_1292636 3300020076 Bacteria 642
238 Ga0206355_1459015 3300020076 Bacteria 655
239 Ga0206351_10048997 3300020077 Bacteria 1027
240 Ga0206352_10052420 3300020078 Bacteria 679
241 Ga0206352_10120208 3300020078 Bacteria 899
242 Ga0206352_10966106 3300020078 Bacteria 607
243 Ga0206352_10967525 3300020078 Bacteria 2388
244 Ga0206350_10420881 3300020080 Bacteria 502
245 Ga0206354_10046039 3300020081 Bacteria 593
246 Ga0206354_10084735 3300020081 Bacteria 2769
247 Ga0206354_10478325 3300020081 Bacteria 841
248 Ga0206353_10124804 3300020082 Bacteria 2109
249 Ga0206353_10148832 3300020082 Bacteria 1308
250 Ga0206353_10229974 3300020082 Bacteria 8444
251 Ga0206353_10644972 3300020082 Bacteria 729
252 Ga0206353_10996184 3300020082 Bacteria 1396
253 Ga0206353_11555357 3300020082 Bacteria 894
254 Ga0206353_11600473 3300020082 Bacteria 836
255 Ga0206353_12027566 3300020082 Bacteria 1276
256 Ga0154015_1211593 3300020610 Bacteria 622
257 Ga0213875_10006095 3300021388 Bacteria 6377
258 Ga0213875_10055171 3300021388 Bacteria 1861
259 Ga0224712_10071922 3300022467 Bacteria 1406
260 Ga0224712_10237984 3300022467 Bacteria 838
261 Ga0224712_10256245 3300022467 Bacteria 809
262 Ga0224712_10669228 3300022467 Bacteria 510
263 Ga0256743_110435 3300023436 Bacteria 560
264 Ga0209759_1010174 3300025256 Bacteria 2777
265 Ga0207666_1006476 3300025271 Bacteria 1521
266 Ga0207426_1006048 3300025302 Bacteria 5346
267 Ga0207426_1034672 3300025302 Bacteria 1618
268 Ga0207697_10045334 3300025315 Bacteria 1810
269 Ga0207656_10080193 3300025321 Bacteria 1465
270 Ga0207713_1148810 3300025735 Bacteria 758
271 Ga0207642_10078464 3300025899 Bacteria 1596
272 Ga0207710_10195016 3300025900 Bacteria 998
273 Ga0207688_10006789 3300025901 Bacteria 6228
274 Ga0207688_10037503 3300025901 Bacteria 2688
275 Ga0207680_10150777 3300025903 Bacteria 1550
276 Ga0207647_10005464 3300025904 Bacteria 9312
277 Ga0207647_10392352 3300025904 Bacteria 783
278 Ga0207645_10043563 3300025907 Bacteria 2873
279 Ga0207645_10339075 3300025907 Bacteria 1005
280 Ga0207643_10012956 3300025908 Bacteria 4509
281 Ga0207654_11031051 3300025911 Bacteria 599
282 Ga0207695_10098040 3300025913 Bacteria 2931
283 Ga0207695_10123739 3300025913 Bacteria 2551
284 Ga0207695_10214520 3300025913 Bacteria 1834
285 Ga0207671_10065836 3300025914 Bacteria 2696
286 Ga0207671_10390977 3300025914 Bacteria 1105
287 Ga0207671_10770275 3300025914 Bacteria 764
288 Ga0207660_10124976 3300025917 Bacteria 1953
289 Ga0207660_10199417 3300025917 Bacteria 1562
290 Ga0207660_11054154 3300025917 Bacteria 663
291 Ga0207662_10036297 3300025918 Bacteria 2880
292 Ga0207662_10042916 3300025918 Bacteria 2667
293 Ga0207657_10031777 3300025919 Bacteria 4776
294 Ga0207657_10440527 3300025919 Bacteria 1023
295 Ga0207649_10106206 3300025920 Bacteria 1867
296 Ga0207652_10060892 3300025921 Bacteria 3258
297 Ga0207681_10786564 3300025923 Bacteria 794
298 Ga0207694_10234848 3300025924 Bacteria 1498
299 Ga0207694_10819994 3300025924 Bacteria 786
300 Ga0207650_10003481 3300025925 Bacteria 10818
301 Ga0207659_10041151 3300025926 Bacteria 3235
302 Ga0207659_10083792 3300025926 Bacteria 2364
303 Ga0207664_10000074 3300025929 Bacteria 102862
304 Ga0207644_10027943 3300025931 Bacteria 3900
305 Ga0207644_10264749 3300025931 Bacteria 1376
306 Ga0207690_10092924 3300025932 Bacteria 2136
307 Ga0207690_10735476 3300025932 Bacteria 813
308 Ga0207706_10059914 3300025933 Bacteria 3352
309 Ga0207706_10500547 3300025933 Bacteria 1049
310 Ga0207706_10612862 3300025933 Bacteria 934
311 Ga0207686_10058976 3300025934 Bacteria 2423
312 Ga0207686_10689665 3300025934 Bacteria 811
313 Ga0207709_10148897 3300025935 Bacteria 1619
314 Ga0207709_10171834 3300025935 Bacteria 1522
315 Ga0207669_10052969 3300025937 Bacteria 2441
316 Ga0207669_10707120 3300025937 Bacteria 829
317 Ga0207704_10113671 3300025938 Bacteria 1836
318 Ga0207704_10694822 3300025938 Bacteria 842
319 Ga0207704_11090714 3300025938 Bacteria 678
320 Ga0207665_10277014 3300025939 Bacteria 1247
321 Ga0207691_10072212 3300025940 Bacteria 3113
322 Ga0207691_10142987 3300025940 Bacteria 2107
323 Ga0207711_10277548 3300025941 Bacteria 1543
324 Ga0207711_10795102 3300025941 Bacteria 881
325 Ga0207689_10008742 3300025942 Bacteria 8810
326 Ga0207689_10738895 3300025942 Bacteria 830
327 Ga0207689_11805296 3300025942 Bacteria 505
328 Ga0207661_10074429 3300025944 Bacteria 2783
329 Ga0207661_11153729 3300025944 Bacteria 713
330 Ga0207679_10175991 3300025945 Bacteria 1766
331 Ga0207679_11210917 3300025945 Bacteria 693
332 Ga0207667_10008347 3300025949 Bacteria 12310
333 Ga0207667_10961805 3300025949 Bacteria 843
334 Ga0207651_10552710 3300025960 Bacteria 1001
335 Ga0207712_10633744 3300025961 Bacteria 928
336 Ga0207712_11124983 3300025961 Bacteria 699
337 Ga0207640_10132995 3300025981 Bacteria 1801
338 Ga0207640_10144304 3300025981 Bacteria 1740
339 Ga0207658_10013733 3300025986 Bacteria 5540
340 Ga0207658_11242081 3300025986 Bacteria 681
341 Ga0207677_10015903 3300026023 Bacteria 4441
342 Ga0207703_10065103 3300026035 Bacteria 2994
343 Ga0207639_10013447 3300026041 Bacteria 5729
344 Ga0207639_10089629 3300026041 Bacteria 2458
345 Ga0207678_10032545 3300026067 Bacteria 4544
346 Ga0207678_10305489 3300026067 Bacteria 1368
347 Ga0207678_10705127 3300026067 Bacteria 888
348 Ga0207708_10000038 3300026075 Bacteria 137212
349 Ga0207708_10197219 3300026075 Bacteria 1605
350 Ga0207708_10954537 3300026075 Bacteria 744
351 Ga0207702_10016911 3300026078 Bacteria 6036
352 Ga0207702_10061015 3300026078 Bacteria 3215
353 Ga0207702_10429833 3300026078 Bacteria 1278
354 Ga0207702_10676833 3300026078 Bacteria 1016
355 Ga0207641_11353176 3300026088 Bacteria 713
356 Ga0207648_10000791 3300026089 Bacteria 35650
357 Ga0207648_10173261 3300026089 Bacteria 1908
358 Ga0207676_10004681 3300026095 Bacteria 9690
359 Ga0207676_11134984 3300026095 Bacteria 773
360 Ga0207674_10074232 3300026116 Bacteria 3413
361 Ga0207674_10485402 3300026116 Bacteria 1194
362 Ga0207674_10694103 3300026116 Bacteria 983
363 Ga0207675_100081690 3300026118 Bacteria 3031
364 Ga0207675_100212568 3300026118 Bacteria 1861
365 Ga0207683_10005295 3300026121 Bacteria 11063
366 Ga0207683_10254946 3300026121 Bacteria 1601
367 Ga0207698_10350739 3300026142 Bacteria 1394
368 Ga0207698_10489059 3300026142 Bacteria 1195
369 Ga0209282_1059004 3300027666 Bacteria 2148
370 Ga0207428_10045123 3300027907 Bacteria 3553
371 Ga0268266_10112928 3300028379 Bacteria 2409
372 Ga0268266_12271432 3300028379 Bacteria 514
373 Ga0268265_10983058 3300028380 Bacteria 833
374 Ga0268264_10874725 3300028381 Bacteria 901
375 Ga0268264_10993032 3300028381 Bacteria 846
376 Ga0307517_10006461 3300028786 Bacteria 17343
377 Ga0310981_1035178 3300029285 Bacteria 500
378 Ga0310981_1041595 3300029285 Bacteria 598
379 Ga0268256_1087008 3300030500 Bacteria 574
380 Ga0307512_10003420 3300030522 Bacteria 18521
381 Ga0265340_10019149 3300031247 Bacteria 3524
382 Ga0307513_10001645 3300031456 Bacteria 32008
383 Ga0307513_10040582 3300031456 Bacteria 5145
384 Ga0307509_10283304 3300031507 Bacteria 1417
385 Ga0307408_100068924 3300031548 Bacteria 2606
386 Ga0307408_100646044 3300031548 Bacteria 945
387 Ga0307408_102077793 3300031548 Bacteria 547
388 Ga0307508_10117044 3300031616 Bacteria 2266
389 Ga0307508_10209470 3300031616 Bacteria 1550
390 Ga0307508_10225626 3300031616 Bacteria 1472
391 Ga0316576_10053892 3300031727 Bacteria 2932
392 Ga0316578_10229605 3300031728 Bacteria 1115
393 Ga0307516_10069653 3300031730 Bacteria 3382
394 Ga0307405_10347368 3300031731 Bacteria 1143
395 Ga0307405_10978194 3300031731 Bacteria 721
396 Ga0307405_11450362 3300031731 Bacteria 601
397 Ga0307413_10094194 3300031824 Bacteria 1960
398 Ga0307413_10115416 3300031824 Bacteria 1807
399 Ga0307413_10168344 3300031824 Bacteria 1548
400 Ga0307413_10564963 3300031824 Bacteria 925
401 Ga0307410_10034538 3300031852 Bacteria 3276
402 Ga0307410_10061170 3300031852 Bacteria 2576
403 Ga0307410_10093844 3300031852 Bacteria 2136
404 Ga0307410_10159586 3300031852 Bacteria 1688
405 Ga0307410_10252713 3300031852 Bacteria 1371
406 Ga0307410_10308428 3300031852 Bacteria 1251
407 Ga0307410_10667714 3300031852 Bacteria 873
408 Ga0307410_11551088 3300031852 Bacteria 584
409 Ga0307410_11593889 3300031852 Bacteria 577
410 Ga0307406_10046861 3300031901 Bacteria 2721
411 Ga0307406_10054504 3300031901 Bacteria 2552
412 Ga0307406_10166696 3300031901 Bacteria 1590
413 Ga0307406_10252750 3300031901 Bacteria 1329
414 Ga0307406_10446659 3300031901 Bacteria 1036
415 Ga0307406_10461123 3300031901 Bacteria 1022
416 Ga0307406_11042925 3300031901 Bacteria 703
417 Ga0307407_10038070 3300031903 Bacteria 2662
418 Ga0307407_10110765 3300031903 Bacteria 1722
419 Ga0307407_10111440 3300031903 Bacteria 1718
420 Ga0307407_10685600 3300031903 Bacteria 770
421 Ga0307409_100021978 3300031995 Bacteria 4388
422 Ga0307409_100030729 3300031995 Bacteria 3864
423 Ga0307409_100113279 3300031995 Bacteria 2279
424 Ga0307409_100144899 3300031995 Bacteria 2052
425 Ga0307409_100233596 3300031995 Bacteria 1669
426 Ga0307409_100470610 3300031995 Bacteria 1217
427 Ga0307409_100555237 3300031995 Bacteria 1128
428 Ga0307409_100560076 3300031995 Bacteria 1123
429 Ga0307409_101229459 3300031995 Bacteria 773
430 Ga0307409_101637708 3300031995 Bacteria 672
431 Ga0307409_102107766 3300031995 Bacteria 593
432 Ga0307416_100019059 3300032002 Bacteria 4854
433 Ga0307416_100074220 3300032002 Bacteria 2840
434 Ga0307416_100134924 3300032002 Bacteria 2230
435 Ga0307416_100375603 3300032002 Bacteria 1449
436 Ga0307416_100405564 3300032002 Bacteria 1402
437 Ga0307416_100892800 3300032002 Bacteria 988
438 Ga0307416_101177373 3300032002 Bacteria 872
439 Ga0307416_103627619 3300032002 Bacteria 517
440 Ga0307414_10132521 3300032004 Bacteria 1937
441 Ga0307414_10255421 3300032004 Bacteria 1459
442 Ga0307414_10744643 3300032004 Bacteria 890
443 Ga0307411_10055052 3300032005 Bacteria 2616
444 Ga0307415_100150557 3300032126 Bacteria 1790
445 Ga0307415_100278278 3300032126 Bacteria 1374
446 Ga0307415_100439606 3300032126 Bacteria 1124
447 Ga0307415_100725307 3300032126 Bacteria 900
448 Ga0307415_101406780 3300032126 Bacteria 664
449 Ga0307415_101482482 3300032126 Bacteria 648
450 Ga0307507_10050576 3300033179 Bacteria 4010
451 Ga0373952_0150446 3300035092 Bacteria 653
452 Ga0373936_0115679 3300035113 Bacteria 1142
453 Ga0373939_0128482 3300035114 Bacteria 902
454 Ga0373941_0025167 3300035115 Bacteria 1717
455 Ga0373946_0364039 3300035171 Bacteria 725
456 Ga0373962_0170854 3300035242 Bacteria 722
457 Ga0316574_0015038 3300035398 Bacteria 4484
458 Ga0316574_0639734 3300035398 Bacteria 655
459 Ga0373931_0103926 3300035691 Bacteria 1602
460 Ga0373931_0116383 3300035691 Bacteria 1523
461 Ga0373927_0667869 3300035695 Bacteria 687
462 Ga0373947_0708730 3300035725 Bacteria 687
463 Ga0372808_059597 3300036459 Bacteria 548
464 Ga0395899_0069827 3300037312 Bacteria 2572
465 Ga0395900_0364943 3300037418 Bacteria 1415
466 Ga0395900_0544908 3300037418 Bacteria 1105
467 Ga0395900_1616007 3300037418 Bacteria 559
468 Ga0395898_0055976 3300037466 Bacteria 3846
469 Ga0395898_0197075 3300037466 Bacteria 1924
470 Ga0395898_0977710 3300037466 Bacteria 783
471 Ga0436364_0015698 3300037853 Bacteria 7166
472 Ga0436364_1240818 3300037853 Bacteria 15337
473 Ga0395901_0028124 3300038443 Bacteria 5783
474 Ga0395901_1163335 3300038443 Bacteria 739
475 Ga0436363_0419769 3300039450 Bacteria 699
476 Ga0439439_0107685 3300041406 Bacteria 771
477 Ga0451790_03754 3300041444 Bacteria 635
478 Ga0451794_27686 3300041446 Bacteria 561
479 Ga0451791_1298264 3300041451 Bacteria 1283
480 Ga0451793_1234677 3300041452 Bacteria 2002
481 Ga0451797_1390623 3300041453 Bacteria 1803
482 Ga0451797_1536272 3300041453 Bacteria 2005
483 Ga0451803_04285 3300041457 Bacteria 524
484 Ga0451833_0338502 3300041491 Bacteria 743
485 Ga0451835_1157284 3300041492 Bacteria 818
486 Ga0451837_0109316 3300041494 Bacteria 5288
487 Ga0451841_0812607 3300041498 Bacteria 4571
488 Ga0451845_0415626 3300041501 Bacteria 1557
489 Ga0451850_36237 3300041506 Bacteria 621
490 Ga0451851_0858940 3300041507 Bacteria 605
491 Ga0451843_1132984 3300041509 Bacteria 1511
492 Ga0451853_2602983 3300041512 Bacteria 1953
493 Ga0452268_01162 3300041907 Bacteria 508
494 Ga0439431_0257699 3300041997 Bacteria 519
495 Ga0439445_0027638 3300042004 Bacteria 1458
496 Ga0439448_0001321 3300042005 Bacteria 6339
497 Ga0439448_0017498 3300042005 Bacteria 2189
498 Ga0439450_078273 3300042008 Bacteria 819
499 Ga0439450_103098 3300042008 Bacteria 725
500 Ga0439455_0000697 3300042012 Bacteria 4971
501 Ga0439457_001462 3300042014 Bacteria 7085
502 Ga0439457_026183 3300042014 Bacteria 1291
503 Ga0439463_090544 3300042016 Bacteria 787
504 Ga0439463_130461 3300042016 Bacteria 650
505 Ga0450911_036247 3300042115 Bacteria 640
506 Ga0450894_000097 3300042131 Bacteria 14494
507 Ga0450899_001301 3300042135 Bacteria 2805
508 Ga0450900_020528 3300042136 Bacteria 918
509 Ga0450903_000108 3300042138 Bacteria 17669
510 Ga0450906_000741 3300042145 Bacteria 7052
511 Ga0439458_0001252 3300042157 Bacteria 6404
512 Ga0439458_0080796 3300042157 Bacteria 829
513 Ga0450908_004744 3300042184 Bacteria 2615
514 Ga0439459_0002037 3300042438 Bacteria 3073
515 Ga0439459_0226140 3300042438 Bacteria 520
516 Ga0450901_024484 3300042533 Bacteria 655
517 Ga0451577_1706676 3300042876 Bacteria 554
518 Ga0466969_0000702 3300044656 Bacteria 18133
519 Ga0466969_0003828 3300044656 Bacteria 7993
520 Ga0466969_0005495 3300044656 Bacteria 6739
521 Ga0466969_0446088 3300044656 Bacteria 589
522 Ga0466969_0503516 3300044656 Bacteria 553
523 Ga0466972_0002160 3300044658 Bacteria 9663
524 Ga0466972_0007644 3300044658 Bacteria 5426
525 Ga0466972_0113828 3300044658 Bacteria 1278
526 Ga0466972_0172134 3300044658 Bacteria 1016
527 Ga0466972_0240215 3300044658 Bacteria 847
528 Ga0466972_0360972 3300044658 Bacteria 680
529 Ga0466972_0446788 3300044658 Bacteria 607
530 Ga0466965_0000386 3300044683 Bacteria 15106
531 Ga0466965_0223347 3300044683 Bacteria 1004
532 Ga0466966_0001246 3300044684 Bacteria 16313
533 Ga0466966_0015896 3300044684 Bacteria 4974
534 Ga0466966_0171150 3300044684 Bacteria 1320
535 Ga0466966_0420282 3300044684 Bacteria 803
536 Ga0466966_0440904 3300044684 Bacteria 783
537 Ga0466966_0454419 3300044684 Bacteria 770
538 Ga0466966_0525201 3300044684 Bacteria 712
539 Ga0466966_0529490 3300044684 Bacteria 709
540 Ga0466966_0981930 3300044684 Bacteria 509
541 Ga0466961_0002056 3300044693 Bacteria 12531
542 Ga0466961_0039678 3300044693 Bacteria 3018
543 Ga0466961_0052078 3300044693 Bacteria 2612
544 Ga0466961_0143827 3300044693 Bacteria 1492
545 Ga0466961_0236849 3300044693 Bacteria 1122
546 Ga0466961_0364814 3300044693 Bacteria 878
547 Ga0466961_0430413 3300044693 Bacteria 799
548 Ga0466961_0911935 3300044693 Bacteria 523
549 Ga0466963_0000197 3300044694 Bacteria 25436
550 Ga0466963_0014526 3300044694 Bacteria 4857
551 Ga0466963_0020849 3300044694 Bacteria 4127
552 Ga0466963_0028931 3300044694 Bacteria 3562
553 Ga0466963_0098004 3300044694 Bacteria 2004
554 Ga0466963_0181518 3300044694 Bacteria 1469
555 Ga0466963_0228978 3300044694 Bacteria 1302
556 Ga0466963_0398320 3300044694 Bacteria 971
557 Ga0466963_0477357 3300044694 Bacteria 880
558 Ga0466963_0854537 3300044694 Bacteria 641
559 Ga0466964_0067739 3300044706 Bacteria 1501
560 Ga0466964_0345727 3300044706 Bacteria 763
561 Ga0466964_0472591 3300044706 Bacteria 669
562 Ga0466964_0499535 3300044706 Bacteria 653
563 Ga0466971_0000315 3300044719 Bacteria 18663
564 Ga0466971_0011648 3300044719 Bacteria 3851
565 Ga0466971_0028463 3300044719 Bacteria 2500
566 Ga0466971_0063406 3300044719 Bacteria 1673
567 Ga0466971_0146909 3300044719 Bacteria 1099
568 Ga0466971_0305531 3300044719 Bacteria 764
569 Ga0466971_0487446 3300044719 Bacteria 607
570 Ga0466968_0373528 3300044735 Bacteria 696
571 Ga0466968_0746118 3300044735 Bacteria 502
572 Ga0466970_0000309 3300044765 Bacteria 23769
573 Ga0466970_0010660 3300044765 Bacteria 4669
574 Ga0466970_0025462 3300044765 Bacteria 3098
575 Ga0466970_0064379 3300044765 Bacteria 1966
576 Ga0466970_0143955 3300044765 Bacteria 1314
577 Ga0466970_0460741 3300044765 Bacteria 729
578 Ga0466970_0905803 3300044765 Bacteria 519
579 Ga0466957_0002768 3300044842 Bacteria 9489
580 Ga0466957_0044337 3300044842 Bacteria 2695
581 Ga0466957_0074035 3300044842 Bacteria 2112
582 Ga0466957_0091115 3300044842 Bacteria 1910
583 Ga0466957_0109985 3300044842 Bacteria 1747
584 Ga0466957_0145874 3300044842 Bacteria 1528
585 Ga0466957_0247638 3300044842 Bacteria 1184
586 Ga0466957_0288429 3300044842 Bacteria 1100
587 Ga0466957_0607325 3300044842 Bacteria 766
588 Ga0466957_0760955 3300044842 Bacteria 686
589 Ga0466957_0801704 3300044842 Bacteria 669
590 Ga0466960_0085719 3300044901 Bacteria 1596
591 Ga0466960_0259110 3300044901 Bacteria 968
592 Ga0466960_0332823 3300044901 Bacteria 862
593 Ga0466960_0741557 3300044901 Bacteria 591
594 Ga0466960_0778339 3300044901 Bacteria 578
595 Ga0466959_0001433 3300045049 Bacteria 14589
596 Ga0466959_0038875 3300045049 Bacteria 3516
597 Ga0466959_0067574 3300045049 Bacteria 2591
598 Ga0466959_0090817 3300045049 Bacteria 2193
599 Ga0466959_0213082 3300045049 Bacteria 1342
600 Ga0466959_0247785 3300045049 Bacteria 1229
601 Ga0466959_0317905 3300045049 Bacteria 1064
602 Ga0466959_0764431 3300045049 Bacteria 646
603 Ga0466958_0002057 3300045836 Bacteria 9942
604 Ga0466958_0012760 3300045836 Bacteria 4765
605 Ga0466958_0056863 3300045836 Bacteria 2377
606 Ga0466958_0079976 3300045836 Bacteria 2010
607 Ga0466958_0234619 3300045836 Bacteria 1172
608 Ga0466958_0345485 3300045836 Bacteria 957
609 Ga0466958_0353209 3300045836 Bacteria 946
610 Ga0466958_0899937 3300045836 Bacteria 577
611 Ga0466967_0018985 3300045976 Bacteria 5516
612 Ga0466967_0026295 3300045976 Bacteria 4818
613 Ga0466967_0044355 3300045976 Bacteria 3857
614 Ga0466967_0052834 3300045976 Bacteria 3569
615 Ga0466967_0069564 3300045976 Bacteria 3146
616 Ga0466967_0190583 3300045976 Bacteria 1937
617 Ga0466967_0194681 3300045976 Bacteria 1917
618 Ga0466967_0236855 3300045976 Bacteria 1740
619 Ga0466967_0997036 3300045976 Bacteria 834
620 Ga0495592_0008402 3300046454 Bacteria 7745
621 Ga0495603_0002384 3300046455 Bacteria 11046
622 Ga0495603_0005417 3300046455 Bacteria 7617
623 Ga0495603_0164273 3300046455 Bacteria 1287
624 Ga0495603_0714975 3300046455 Bacteria 573
625 Ga0495629_0003973 3300046459 Bacteria 11119
626 Ga0495629_0009899 3300046459 Bacteria 6958
627 Ga0495629_0010531 3300046459 Bacteria 6727
628 Ga0495629_0314225 3300046459 Bacteria 1071
629 Ga0495638_0021586 3300046460 Bacteria 4241
630 Ga0495638_0187882 3300046460 Bacteria 1174
631 Ga0495651_0040275 3300046462 Bacteria 3634
632 Ga0495582_0408510 3300046473 Bacteria 783
633 Ga0495582_0712604 3300046473 Bacteria 581
634 Ga0495662_0603838 3300046476 Bacteria 536
635 Ga0495662_0669106 3300046476 Bacteria 507
636 Ga0495664_0070825 3300046477 Bacteria 2082
637 Ga0495585_0023490 3300046492 Bacteria 3538
638 Ga0495594_0010888 3300046499 Bacteria 4723
639 Ga0495594_0106141 3300046499 Bacteria 1582
640 Ga0495594_0130657 3300046499 Bacteria 1422
641 Ga0495594_0666022 3300046499 Bacteria 589
642 Ga0495594_0814870 3300046499 Bacteria 526
643 Ga0495596_0314237 3300046500 Bacteria 609
644 Ga0495618_0158636 3300046514 Bacteria 1443
645 Ga0495628_0059390 3300046516 Bacteria 3002
646 Ga0495630_1116758 3300046517 Bacteria 597
647 Ga0495643_0004276 3300046522 Bacteria 10076
648 Ga0495652_0500645 3300046529 Bacteria 842
649 Ga0495654_0311109 3300046530 Bacteria 641
650 Ga0495640_0003660 3300046533 Bacteria 12354
651 Ga0495640_0722461 3300046533 Bacteria 597
652 Ga0495622_0043127 3300046557 Bacteria 2097
653 Ga0495622_0069186 3300046557 Bacteria 1630
654 Ga0495622_0094185 3300046557 Bacteria 1375
655 Ga0495633_0565983 3300046558 Bacteria 511
656 Ga0495667_0244862 3300046559 Bacteria 1141
657 Ga0495656_0048916 3300046615 Bacteria 1799
658 Ga0495634_0143012 3300046642 Bacteria 1517
659 Ga0495611_0021321 3300046648 Bacteria 2798
660 Ga0495611_0366612 3300046648 Bacteria 660
661 Ga0495625_0085695 3300046660 Bacteria 2186
662 Ga0495661_0193687 3300046665 Bacteria 1069
663 Ga0495588_0007531 3300046674 Bacteria 4958
664 Ga0495588_0056176 3300046674 Bacteria 2032
665 Ga0495657_0004911 3300046675 Bacteria 10639
666 Ga0495623_0472937 3300046679 Bacteria 664
667 Ga0495658_0015832 3300046683 Bacteria 3875
668 Ga0495613_0001297 3300046689 Bacteria 19104
669 Ga0495613_0010337 3300046689 Bacteria 6932
670 Ga0495613_0113088 3300046689 Bacteria 1955
671 Ga0495624_0136841 3300046690 Bacteria 1501
672 Ga0495670_0008008 3300046691 Bacteria 5194
673 Ga0495670_0212517 3300046691 Bacteria 1026
674 Ga0495670_0318576 3300046691 Bacteria 835
675 Ga0495671_0273064 3300046692 Bacteria 815
676 Ga0495589_0232165 3300046794 Bacteria 865
677 Ga0495600_0029385 3300046809 Bacteria 3559
678 Ga0495660_0022537 3300046810 Bacteria 3595
679 Ga0495581_0042190 3300047315 Bacteria 2641
680 Ga0495604_0005332 3300047317 Bacteria 10194
681 Ga0495604_0040078 3300047317 Bacteria 3678
682 Ga0495604_0116521 3300047317 Bacteria 1939
683 Ga0495636_0228364 3300047318 Bacteria 856
684 Ga0495674_1137700 3300047319 Bacteria 593
685 Ga0495676_0004096 3300047321 Bacteria 13285
686 Ga0495676_0005521 3300047321 Bacteria 11598
687 Ga0495676_0120101 3300047321 Bacteria 1913
688 Ga0495676_1078376 3300047321 Bacteria 511
689 Ga0495683_0281237 3300047323 Bacteria 720
690 Ga0495687_009794 3300047443 Bacteria 5322
691 Ga0495675_0002248 3300047444 Bacteria 11535
692 Ga0495675_0012460 3300047444 Bacteria 5353
693 Ga0495675_0148739 3300047444 Bacteria 1448
694 Ga0495679_116154 3300047446 Bacteria 734
695 Ga0495685_010235 3300047447 Bacteria 3143
696 Ga0495685_023335 3300047447 Bacteria 2130
697 Ga0495673_0185048 3300047469 Bacteria 787
698 Ga0495681_0001356 3300047470 Bacteria 18506
699 Ga0495684_0859343 3300047471 Bacteria 588
700 Ga0495593_0190175 3300047673 Bacteria 1033
701 Ga0495593_0497878 3300047673 Bacteria 611
702 Ga0495602_0318202 3300048088 Bacteria 1133
703 Ga0495602_1025220 3300048088 Bacteria 544
704 Ga0495614_0000128 3300048089 Bacteria 26462
705 Ga0496100_0027222 3300048903 Bacteria 3514
706 Ga0496100_0693152 3300048903 Bacteria 795
707 Ga0496100_1240605 3300048903 Bacteria 588
708 Ga0496101_0019706 3300048904 Bacteria 4610
709 Ga0496101_0074802 3300048904 Bacteria 2492
710 Ga0496101_0906214 3300048904 Bacteria 694
711 Ga0496102_0010594 3300048905 Bacteria 7942
712 Ga0496102_0029226 3300048905 Bacteria 4931
713 Ga0496102_0057858 3300048905 Bacteria 3541
714 Ga0496102_0062378 3300048905 Bacteria 3413
715 Ga0496102_0831254 3300048905 Bacteria 846
716 Ga0496102_1302104 3300048905 Bacteria 646
717 Ga0496102_1746672 3300048905 Bacteria 540
718 Ga0496103_0025995 3300048906 Bacteria 3541
719 Ga0496103_0071303 3300048906 Bacteria 2174
720 Ga0496103_0254815 3300048906 Bacteria 1129
721 Ga0496103_0962290 3300048906 Bacteria 533
722 Ga0496104_0014881 3300048907 Bacteria 7032
723 Ga0496104_0239789 3300048907 Bacteria 1725
724 Ga0496105_0002556 3300048908 Bacteria 13206
725 Ga0496105_0026209 3300048908 Bacteria 4753
726 Ga0496105_0825230 3300048908 Bacteria 703
727 Ga0496106_0027625 3300048909 Bacteria 4227
728 Ga0496106_0071319 3300048909 Bacteria 2655
729 Ga0496106_0179373 3300048909 Bacteria 1681
730 Ga0496107_0045567 3300048910 Bacteria 3155
731 Ga0496107_0081284 3300048910 Bacteria 2363
732 Ga0496107_1355052 3300048910 Bacteria 508
733 Ga0496108_0110189 3300048911 Bacteria 2353
734 Ga0496108_0508321 3300048911 Bacteria 1052
735 Ga0496109_0129313 3300048912 Bacteria 2356
736 Ga0496109_0628631 3300048912 Bacteria 1010
737 Ga0496110_0010215 3300048913 Bacteria 7628
738 Ga0496110_0055620 3300048913 Bacteria 3482
739 Ga0496111_0020293 3300048914 Bacteria 4624
740 Ga0496111_0192641 3300048914 Bacteria 1515
741 Ga0496112_0043364 3300048915 Bacteria 4404
742 Ga0496112_1099633 3300048915 Bacteria 713
743 Ga0496112_1470125 3300048915 Bacteria 595
744 Ga0496113_0464820 3300048916 Bacteria 1016
745 Ga0496113_0749279 3300048916 Bacteria 778
746 Ga0496113_0867380 3300048916 Bacteria 715
747 Ga0496114_0015303 3300048917 Bacteria 6167
748 Ga0496114_0596319 3300048917 Bacteria 974
749 Ga0496116_0000665 3300048919 Bacteria 44795
750 Ga0496117_0087380 3300048920 Bacteria 2021
751 Ga0496118_0000900 3300048921 Bacteria 46556
752 Ga0496119_0005788 3300048922 Bacteria 11702
753 Ga0496119_0478656 3300048922 Bacteria 582
754 Ga0496121_0107424 3300048924 Bacteria 2137
755 Ga0496121_0132116 3300048924 Bacteria 1866
756 Ga0496126_0092088 3300048929 Bacteria 2664
757 Ga0501306_002344 3300049127 Bacteria 1930
758 Ga0501306_048812 3300049127 Bacteria 674
759 Ga0501306_093945 3300049127 Bacteria 530
760 Ga0501306_108022 3300049127 Bacteria 503
761 Ga0501308_049542 3300049128 Bacteria 612
762 Ga0501308_050071 3300049128 Bacteria 609
763 Ga0501308_068801 3300049128 Bacteria 547
764 Ga0501308_069693 3300049128 Bacteria 544
765 Ga0501308_077349 3300049128 Bacteria 525
766 Ga0501309_004429 3300049129 Bacteria 1637
767 Ga0501309_051092 3300049129 Bacteria 649
768 Ga0501309_088084 3300049129 Bacteria 527
769 Ga0501310_037620 3300049130 Bacteria 664
770 Ga0501310_064137 3300049130 Bacteria 553
771 Ga0501341_16491 3300049131 Bacteria 525
772 Ga0501305_069521 3300049161 Bacteria 617
773 Ga0501305_076545 3300049161 Bacteria 595
774 Ga0501307_047922 3300049162 Bacteria 636
775 Ga0501307_056132 3300049162 Bacteria 602
776 Ga0501299_112720 3300049522 Bacteria 646
777 Ga0501311_060043 3300049527 Bacteria 613
778 Ga0501311_064537 3300049527 Bacteria 597
779 Ga0501311_094769 3300049527 Bacteria 522
780 Ga0501312_031431 3300049528 Bacteria 834
781 Ga0501312_091582 3300049528 Bacteria 561
782 Ga0501313_047613 3300049529 Bacteria 587
783 Ga0501313_065552 3300049529 Bacteria 520
784 Ga0501314_038247 3300049530 Bacteria 553
785 Ga0501315_055238 3300049531 Bacteria 632
786 Ga0501315_078598 3300049531 Bacteria 557
787 Ga0501316_024584 3300049532 Bacteria 779
788 Ga0501316_070175 3300049532 Bacteria 530
789 Ga0501317_033903 3300049533 Bacteria 754
790 Ga0501317_037960 3300049533 Bacteria 725
791 Ga0501317_068366 3300049533 Bacteria 595
792 Ga0501318_011984 3300049534 Bacteria 987
793 Ga0501318_013508 3300049534 Bacteria 951
794 Ga0501318_023663 3300049534 Bacteria 795
795 Ga0501318_034880 3300049534 Bacteria 699
796 Ga0501318_040620 3300049534 Bacteria 664
797 Ga0501318_075714 3300049534 Bacteria 538
798 Ga0501319_006849 3300049535 Bacteria 851
799 Ga0501319_007938 3300049535 Bacteria 809
800 Ga0501319_016168 3300049535 Bacteria 639
801 Ga0501320_012495 3300049536 Bacteria 894
802 Ga0501320_030467 3300049536 Bacteria 669
803 Ga0501321_007367 3300049537 Bacteria 1141
804 Ga0501321_030912 3300049537 Bacteria 715
805 Ga0501321_055598 3300049537 Bacteria 588
806 Ga0501321_085692 3300049537 Bacteria 508
807 Ga0501322_023909 3300049538 Bacteria 550
808 Ga0501323_000434 3300049539 Bacteria 3076
809 Ga0501323_001661 3300049539 Bacteria 2030
810 Ga0501323_082180 3300049539 Bacteria 528
811 Ga0501324_001570 3300049540 Bacteria 1545
812 Ga0501324_021226 3300049540 Bacteria 665
813 Ga0501324_021502 3300049540 Bacteria 662
814 Ga0501324_027495 3300049540 Bacteria 608
815 Ga0501325_025587 3300049541 Bacteria 649
816 Ga0501325_025892 3300049541 Bacteria 646
817 Ga0501326_10657 3300049542 Bacteria 553
818 Ga0501327_14382 3300049543 Bacteria 553
819 Ga0501328_08731 3300049544 Bacteria 555
820 Ga0501329_11672 3300049545 Bacteria 562
821 Ga0501336_019049 3300049552 Bacteria 613
822 Ga0501340_018995 3300049556 Bacteria 565
823 Ga0501031_0008502 3300049568 Bacteria 6680
824 Ga0501031_0117254 3300049568 Bacteria 1739
825 Ga0501031_0174279 3300049568 Bacteria 1405
826 Ga0501031_0242552 3300049568 Bacteria 1171
827 Ga0501032_0000992 3300049569 Bacteria 22851
828 Ga0501032_0022986 3300049569 Bacteria 4316
829 Ga0501032_0047631 3300049569 Bacteria 2894
830 Ga0501032_0588156 3300049569 Bacteria 708
831 Ga0501033_0001361 3300049570 Bacteria 21789
832 Ga0501033_0008908 3300049570 Bacteria 7752
833 Ga0501033_0019275 3300049570 Bacteria 5155
834 Ga0501033_0048689 3300049570 Bacteria 3147
835 Ga0501033_0112297 3300049570 Bacteria 1982
836 Ga0501033_0414052 3300049570 Bacteria 939
837 Ga0501034_0001415 3300049571 Bacteria 32122
838 Ga0501034_0022300 3300049571 Bacteria 6454
839 Ga0501034_0038129 3300049571 Bacteria 4867
840 Ga0501034_0098261 3300049571 Bacteria 2923
841 Ga0501034_0180396 3300049571 Bacteria 2076
842 Ga0501034_0219254 3300049571 Bacteria 1855
843 Ga0501034_0552434 3300049571 Bacteria 1061
844 Ga0501034_0632182 3300049571 Bacteria 973
845 Ga0501036_0003744 3300049572 Bacteria 12185
846 Ga0501036_0024929 3300049572 Bacteria 5044
847 Ga0501036_0080987 3300049572 Bacteria 2744
848 Ga0501036_0197018 3300049572 Bacteria 1694
849 Ga0501036_1681471 3300049572 Bacteria 512
850 Ga0501037_0021712 3300049573 Bacteria 4748
851 Ga0501037_0023501 3300049573 Bacteria 4558
852 Ga0501037_0031984 3300049573 Bacteria 3884
853 Ga0501037_0610816 3300049573 Bacteria 732
854 Ga0501038_0004040 3300049574 Bacteria 13633
855 Ga0501038_0010353 3300049574 Bacteria 8532
856 Ga0501038_0017612 3300049574 Bacteria 6455
857 Ga0501038_0086627 3300049574 Bacteria 2631
858 Ga0501038_0120122 3300049574 Bacteria 2168
859 Ga0501038_0132229 3300049574 Bacteria 2047
860 Ga0501038_0402854 3300049574 Bacteria 1058
861 Ga0501038_0780973 3300049574 Bacteria 711
862 Ga0501039_0017749 3300049575 Bacteria 5459
863 Ga0501039_0046879 3300049575 Bacteria 3339
864 Ga0501039_0731267 3300049575 Bacteria 773
865 Ga0501040_0026897 3300049576 Bacteria 3870
866 Ga0501040_0549096 3300049576 Bacteria 834
867 Ga0501041_0005651 3300049577 Bacteria 7307
868 Ga0501041_0461445 3300049577 Bacteria 807
869 Ga0501041_1113318 3300049577 Bacteria 509
870 Ga0501042_0045563 3300049578 Bacteria 3126
871 Ga0501042_0075939 3300049578 Bacteria 2404
872 Ga0501043_0029608 3300049579 Bacteria 4303
873 Ga0501043_0067586 3300049579 Bacteria 2806
874 Ga0501043_0119001 3300049579 Bacteria 2071
875 Ga0501043_0173366 3300049579 Bacteria 1682
876 Ga0501043_0844207 3300049579 Bacteria 660
877 Ga0501046_0012079 3300049580 Bacteria 7363
878 Ga0501046_0071099 3300049580 Bacteria 2704
879 Ga0501046_0117678 3300049580 Bacteria 2024
880 Ga0501046_0126295 3300049580 Bacteria 1943
881 Ga0501047_0000029 3300049581 Bacteria 218396
882 Ga0501047_0000826 3300049581 Bacteria 32127
883 Ga0501047_0061360 3300049581 Bacteria 3627
884 Ga0501047_0101093 3300049581 Bacteria 2763
885 Ga0501047_0115868 3300049581 Bacteria 2561
886 Ga0501047_0180078 3300049581 Bacteria 1980
887 Ga0501047_0258430 3300049581 Bacteria 1589
888 Ga0501047_0327202 3300049581 Bacteria 1371
889 Ga0501047_0338172 3300049581 Bacteria 1343
890 Ga0501047_0398005 3300049581 Bacteria 1210
891 Ga0501047_0407405 3300049581 Bacteria 1192
892 Ga0501048_0007462 3300049582 Bacteria 8288
893 Ga0501048_0475757 3300049582 Bacteria 895
894 Ga0501067_0004401 3300049583 Bacteria 7765
895 Ga0501068_0000050 3300049584 Bacteria 45608
896 Ga0501069_0001601 3300049585 Bacteria 11198
897 Ga0501069_0005973 3300049585 Bacteria 6351
898 Ga0501070_0018409 3300049586 Bacteria 5860
899 Ga0501070_0250874 3300049586 Bacteria 1447
900 Ga0501070_0330824 3300049586 Bacteria 1238
901 Ga0501070_0448206 3300049586 Bacteria 1041
902 Ga0501070_0568376 3300049586 Bacteria 906
903 Ga0501070_0822574 3300049586 Bacteria 728
904 Ga0501070_1029908 3300049586 Bacteria 637
905 Ga0501071_0003321 3300049587 Bacteria 10048
906 Ga0501071_0717463 3300049587 Bacteria 770
907 Ga0501072_0001327 3300049588 Bacteria 18557
908 Ga0501072_0816766 3300049588 Bacteria 730
909 Ga0501073_0014076 3300049589 Bacteria 5811
910 Ga0501074_0089493 3300049590 Bacteria 2204
911 Ga0501075_0366247 3300049591 Bacteria 1099
912 Ga0501076_0020533 3300049592 Bacteria 5056
913 Ga0501077_0016094 3300049593 Bacteria 4712
914 Ga0501077_0762965 3300049593 Bacteria 622
915 Ga0501202_004992 3300049652 Bacteria 2338
916 Ga0501206_071852 3300049653 Bacteria 587
917 Ga0501217_204226 3300049661 Bacteria 617
918 Ga0501217_329327 3300049661 Bacteria 510
919 Ga0501230_050159 3300049667 Bacteria 828
920 Ga0501233_174932 3300049668 Bacteria 612
921 Ga0501255_080427 3300049684 Bacteria 547
922 Ga0501079_0026015 3300049741 Bacteria 4487
923 Ga0501079_0790151 3300049741 Bacteria 747
924 Ga0501080_0125002 3300049742 Bacteria 2382
925 Ga0501080_1326177 3300049742 Bacteria 616
926 Ga0501081_0479308 3300049743 Bacteria 926
927 Ga0501083_0055973 3300049744 Bacteria 2643
928 Ga0501283_110602 3300049779 Bacteria 543
929 Ga0501035_0003339 3300049822 Bacteria 15375
930 Ga0501035_0046471 3300049822 Bacteria 3905
931 Ga0501035_0082627 3300049822 Bacteria 2834
932 Ga0501035_0108671 3300049822 Bacteria 2431
933 Ga0501035_0360751 3300049822 Bacteria 1214
934 Ga0501035_0368951 3300049822 Bacteria 1198
935 Ga0501044_0006353 3300049823 Bacteria 13066
936 Ga0501044_0008682 3300049823 Bacteria 11122
937 Ga0501044_0033956 3300049823 Bacteria 5355
938 Ga0501044_0052380 3300049823 Bacteria 4205
939 Ga0501044_0057740 3300049823 Bacteria 3982
940 Ga0501044_0219353 3300049823 Bacteria 1853
941 Ga0501044_0623099 3300049823 Bacteria 970
942 Ga0501044_1147674 3300049823 Bacteria 645
943 Ga0501044_1175936 3300049823 Bacteria 635
944 Ga0501045_0128892 3300049824 Bacteria 1880
945 Ga0501045_0365333 3300049824 Bacteria 1074
946 Ga0501045_0371387 3300049824 Bacteria 1064
947 Ga0501045_0502670 3300049824 Bacteria 900
948 Ga0501045_0940722 3300049824 Bacteria 634
949 Ga0501212_044926 3300049851 Bacteria 738
950 nmdc:mga03683_252544_c1 3300050489 Bacteria 819
951 nmdc:mga03683_374768_c1 3300050489 Bacteria 677
952 nmdc:mga03683_503981_c1 3300050489 Bacteria 586
953 nmdc:mga03n38_182969_c1 3300050490 Bacteria 1075
954 nmdc:mga03n38_365880_c1 3300050490 Bacteria 787
955 nmdc:mga03n38_556311_c1 3300050490 Bacteria 649
956 nmdc:mga00v17_283425_c1 3300050491 Bacteria 1076
957 nmdc:mga0yw44_655894_c1 3300050492 Bacteria 713
958 nmdc:mga0yw44_860984_c1 3300050492 Bacteria 615
959 nmdc:mga0k408_309561_c1 3300050493 Bacteria 943
960 nmdc:mga06z11_1569_c1 3300050494 Bacteria 8505
961 nmdc:mga06z11_194305_c1 3300050494 Bacteria 1176
962 nmdc:mga04h51_61093_c1 3300050495 Bacteria 1292
963 nmdc:mga07m45_282602_c1 3300050496 Bacteria 965
964 nmdc:mga07m45_386664_c1 3300050496 Bacteria 812
965 nmdc:mga05p37_168354_c1 3300050507 Bacteria 2673
966 nmdc:mga09592_242618_c1 3300050508 Bacteria 1561
967 nmdc:mga08y16_1776517_c1 3300050511 Bacteria 570
968 nmdc:mga08y16_8126_c1 3300050511 Bacteria 10973
969 nmdc:mga0n895_50638_c1 3300050512 Bacteria 4072
970 nmdc:mga0rr50_189702_c1 3300050513 Bacteria 1684
971 nmdc:mga08x19_3690_c1 3300050514 Bacteria 9116
972 nmdc:mga0a205_90473_c1 3300050515 Bacteria 2958
973 nmdc:mga0sz30_68414_c1 3300050516 Bacteria 1525
974 Ga0495619_0698039 3300053085 Bacteria 690
975 Ga0500578_0014126 3300053086 Bacteria 5138
976 Ga0500646_0085751 3300053090 Bacteria 968
977 Ga0500566_0001202 3300053094 Bacteria 15139
978 Ga0500654_008366 3300053099 Bacteria 7126
979 Ga0500553_125659 3300053101 Bacteria 1046
980 Ga0500558_132555 3300053106 Bacteria 950
981 Ga0500560_025525 3300053107 Bacteria 1736
982 Ga0500560_136483 3300053107 Bacteria 819
983 Ga0500569_004889 3300053109 Bacteria 2847
984 Ga0500580_203029 3300053113 Bacteria 646
985 Ga0500593_051396 3300053117 Bacteria 1829
986 Ga0500593_139492 3300053117 Bacteria 956
987 Ga0500614_076573 3300053123 Bacteria 928
988 Ga0500621_121448 3300053126 Bacteria 1011
989 Ga0500628_004632 3300053129 Bacteria 2279
990 Ga0500561_0000783 3300053137 Bacteria 5052
991 Ga0500573_0002621 3300053140 Bacteria 9054
992 Ga0500573_0292054 3300053140 Bacteria 819
993 Ga0500586_254671 3300053145 Bacteria 549
994 Ga0500600_0235850 3300053149 Bacteria 831
995 Ga0500616_0001526 3300053153 Bacteria 21817
996 Ga0500633_0008690 3300053160 Bacteria 2632
997 Ga0500587_009997 3300053739 Bacteria 1206
998 Ga0500587_059787 3300053739 Bacteria 581
999 Ga0501084_0018187 3300054114 Bacteria 5851
1000 Ga0501084_0984585 3300054114 Bacteria 709
1001 Ga0587084_124884 3300059477 Bacteria 545
1002 Ga0587073_0176173 3300059492 Bacteria 624
1003 Ga0587073_0200785 3300059492 Bacteria 598
1004 Ga0587073_0257957 3300059492 Bacteria 550
1005 Ga0587073_0335136 3300059492 Bacteria 503
1006 Ga0587080_087681 3300059503 Bacteria 648
1007 Ga0587080_101174 3300059503 Bacteria 617
1008 Ga0587080_110456 3300059503 Bacteria 599
1009 Ga0587082_039895 3300059504 Bacteria 856
1010 Ga0587083_0076057 3300059505 Bacteria 790
1011 Ga0587083_0144242 3300059505 Bacteria 637
1012 Ga0587085_010526 3300059506 Bacteria 1229
1013 Ga0587085_159863 3300059506 Bacteria 526
1014 Ga0587088_127822 3300059508 Bacteria 595
1015 Ga0587090_129224 3300059510 Bacteria 555
1016 Ga0587091_008928 3300059511 Bacteria 1495
1017 Ga0587091_127304 3300059511 Bacteria 625
1018 Ga0587091_129478 3300059511 Bacteria 621
1019 Ga0587094_044011 3300059513 Bacteria 737
1020 Ga0587106_033627 3300059605 Bacteria 836
1021 Ga0587106_136977 3300059605 Bacteria 533
1022 Ga0587129_031918 3300059608 Bacteria 510
1023 Ga0587099_037994 3300059622 Bacteria 608
1024 Ga0587101_153575 3300059623 Bacteria 501
1025 Ga0587115_117682 3300059626 Bacteria 508
1026 Ga0587117_099500 3300059627 Bacteria 553
1027 Ga0587122_036320 3300059628 Bacteria 598
1028 Ga0587128_091779 3300059630 Bacteria 624
1029 Ga0587128_138908 3300059630 Bacteria 544
1030 Ga0587130_019187 3300059631 Bacteria 729
1031 Ga0587062_129071 3300059639 Bacteria 518
1032 Ga0587067_213509 3300059640 Bacteria 519
1033 Ga0587067_230846 3300059640 Bacteria 506
1034 Ga0587068_161250 3300059641 Bacteria 513
1035 Ga0587069_139332 3300059642 Bacteria 530
1036 Ga0587072_163732 3300059643 Bacteria 545
1037 Ga0587075_100706 3300059644 Bacteria 576
1038 Ga0587076_061984 3300059645 Bacteria 756
1039 Ga0587076_193782 3300059645 Bacteria 519
1040 Ga0587102_008941 3300059649 Bacteria 962
1041 Ga0587105_028109 3300059651 Bacteria 526
1042 Ga0587108_014746 3300059653 Bacteria 698
1043 Ga0587114_058829 3300059655 Bacteria 669
1044 Ga0587120_019907 3300059659 Bacteria 632
1045 Ga0587060_025524 3300060243 Bacteria 582
1046 Ga0587071_188374 3300060344 Bacteria 533
1047 Ga0587111_0149818 3300060346 Bacteria 626
1048 Ga0501082_0205256 3300060353 Bacteria 1714
1049 Ga0466962_0004974 3300061719 Bacteria 6391
1050 Ga0466962_0032558 3300061719 Bacteria 2495
1051 Ga0466962_0155377 3300061719 Bacteria 1111
1052 Ga0466962_0155536 3300061719 Bacteria 1110
1053 Ga0466962_0614769 3300061719 Bacteria 554
1054 Ga0466962_0687160 3300061719 Bacteria 524

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0814870 Ga0495594_0814870_17_379 105
2 iso_pu_bacteria 2517572101 2517760384 109
3 iso_pu_bacteria 2857710386 2857713007 109
4 iso_pu_bacteria 3006425503 3006426540 109
5 iso_pu_bacteria 8002775197 8002775993 109
6 iso_pu_bacteria 8002784119 8002790649 109
7 iso_pu_bacteria 2585428094 2587863301 111
8 iso_pu_bacteria 2622736605 2623502026 111
9 iso_pu_bacteria 2643221649 2644277108 111
10 iso_pu_bacteria 2654587600 2655032425 111
11 iso_pu_bacteria 2739367653 2739602526 111
12 iso_pu_bacteria 2767802112 2768647088 111
13 iso_pu_bacteria 2784132109 2784472620 111
14 iso_pu_bacteria 2837268691 2837272951 111
15 iso_pu_bacteria 2857727296 2857729586 111
16 iso_pu_bacteria 2862705112 2862710032 111
17 iso_pu_bacteria 2867346516 2867350886 111
18 iso_pu_bacteria 2867475112 2867480117 111
19 iso_pu_bacteria 2868088558 2868093846 111
20 iso_pu_bacteria 2945956166 2945959580 111
21 iso_pu_bacteria 2997451912 2997453101 111
22 iso_pu_bacteria 8004021418 8004023235 111
23 iso_pu_bacteria 8008485437 8008487218 111
24 iso_pu_bacteria 8025524527 8025526349 111
25 iso_pu_bacteria 8033684223 8033691173 111
26 iso_pu_bacteria 8054160619 8054165361 111
27 3300042014 Ga0439457_026183 Ga0439457_026183_724_1065 112
28 iso_pu_bacteria 2547132111 2547410472 112
29 iso_pu_bacteria 2554235005 2554256028 112
30 iso_pu_bacteria 2582581312 2585297451 112
31 iso_pu_bacteria 2582581313 2585307727 112
32 iso_pu_bacteria 2616644941 2616903778 112
33 iso_pu_bacteria 2643221548 2643761514 112
34 iso_pu_bacteria 2643221578 2643899403 112
35 iso_pu_bacteria 2643221587 2643943661 112
36 iso_pu_bacteria 2643221647 2644269575 112
37 iso_pu_bacteria 2643221670 2644387139 112
38 iso_pu_bacteria 2643221673 2644406861 112
39 iso_pu_bacteria 2643221677 2644434080 112
40 iso_pu_bacteria 2643221678 2644437781 112
41 iso_pu_bacteria 2643221682 2644458784 112
42 iso_pu_bacteria 2643221714 2644629833 112
43 iso_pu_bacteria 2784132148 2784590625 112
44 iso_pu_bacteria 2784746763 2785340962 112
45 iso_pu_bacteria 2784746768 2785371797 112
46 iso_pu_bacteria 2786546132 2786672904 112
47 iso_pu_bacteria 2791355406 2793977143 112
48 iso_pu_bacteria 2802429296 2804848160 112
49 iso_pu_bacteria 2808606359 2808844252 112
50 iso_pu_bacteria 2808606375 2808913872 112
51 iso_pu_bacteria 2808606448 2809234317 112
52 iso_pu_bacteria 2808606982 2811844140 112
53 iso_pu_bacteria 2811994879 2812355713 112
54 iso_pu_bacteria 2811994917 2812478532 112
55 iso_pu_bacteria 2816332119 2816428064 112
56 iso_pu_bacteria 2818991463 2819698957 112
57 iso_pu_bacteria 2818991472 2819740472 112
58 iso_pu_bacteria 2852635781 2852639710 112
59 iso_pu_bacteria 2862178590 2862181770 112
60 iso_pu_bacteria 2862281513 2862284355 112
61 iso_pu_bacteria 2862382967 2862384774 112
62 iso_pu_bacteria 2863404153 2863408873 112
63 iso_pu_bacteria 2867369537 2867374062 112
64 iso_pu_bacteria 2867428634 2867433961 112
65 iso_pu_bacteria 2873151551 2873153829 112
66 iso_pu_bacteria 2873314349 2873321543 112
67 iso_pu_bacteria 2875391855 2875396979 112
68 iso_pu_bacteria 2877676314 2877678802 112
69 iso_pu_bacteria 2912723979 2912729929 112
70 iso_pu_bacteria 2912757875 2912763039 112
71 iso_pu_bacteria 2919468124 2919472482 112
72 iso_pu_bacteria 2946045630 2946047578 112
73 iso_pu_bacteria 2946064051 2946070080 112
74 iso_pu_bacteria 2946072368 2946077969 112
75 iso_pu_bacteria 2947224130 2947226697 112
76 iso_pu_bacteria 2954002825 2954005785 112
77 iso_pu_bacteria 2954380949 2954383762 112
78 iso_pu_bacteria 2954673503 2954679210 112
79 iso_pu_bacteria 2954682443 2954684943 112
80 iso_pu_bacteria 2954691527 2954694557 112
81 iso_pu_bacteria 2954701450 2954709762 112
82 iso_pu_bacteria 2954711539 2954714062 112
83 iso_pu_bacteria 2954721474 2954724015 112
84 iso_pu_bacteria 2954731030 2954737825 112
85 iso_pu_bacteria 2954740390 2954742912 112
86 iso_pu_bacteria 2954749733 2954756661 112
87 iso_pu_bacteria 2954759201 2954761869 112
88 iso_pu_bacteria 2966598605 2966600613 112
89 iso_pu_bacteria 2990059506 2990061073 112
90 iso_pu_bacteria 2990088156 2990093919 112
91 iso_pu_bacteria 2997600082 2997604003 112
92 iso_pu_bacteria 3006486233 3006487970 112
93 iso_pu_bacteria 8008558824 8008563041 112
94 iso_pu_bacteria 8023623736 8023625725 112
95 iso_pu_bacteria 8025478263 8025484061 112
96 iso_pu_bacteria 8025530807 8025532657 112
97 iso_pu_bacteria 8047893842 8047895829 112
98 iso_pu_bacteria 8048127548 8048129088 112
99 iso_pu_bacteria 8048356638 8048363105 112
100 iso_pu_bacteria 8048369669 8048372853 112
101 iso_pu_bacteria 8048379754 8048381787 112
102 iso_pu_bacteria 8048406513 8048409777 112
103 iso_pu_bacteria 8055066027 8055073237 112
104 iso_pu_bacteria 8056447290 8056451981 112
105 iso_pu_bacteria 8056667051 8056670797 112
106 3300006038 Ga0075365_10154977 Ga0075365_101549772 113
107 3300006042 Ga0075368_10236793 Ga0075368_102367932 113
108 3300006177 Ga0075362_10074798 Ga0075362_100747983 113
109 3300006186 Ga0075369_10110603 Ga0075369_101106032 113
110 3300006353 Ga0075370_10297319 Ga0075370_102973192 113
111 3300020076 Ga0206355_1459015 Ga0206355_14590151 113
112 3300032002 Ga0307416_103627619 Ga0307416_1036276191 113
113 3300036459 Ga0372808_059597 Ga0372808_059597_106_447 113
114 3300048903 Ga0496100_1240605 Ga0496100_1240605_24_365 113
115 3300048904 Ga0496101_0906214 Ga0496101_0906214_128_469 113
116 3300048905 Ga0496102_0010594 Ga0496102_0010594_2745_3086 113
117 3300048908 Ga0496105_0825230 Ga0496105_0825230_317_658 113
118 3300048919 Ga0496116_0000665 Ga0496116_0000665_9373_9714 113
119 3300048920 Ga0496117_0087380 Ga0496117_0087380_1136_1477 113
120 3300048921 Ga0496118_0000900 Ga0496118_0000900_36838_37179 113
121 3300048922 Ga0496119_0005788 Ga0496119_0005788_5176_5517 113
122 3300048924 Ga0496121_0132116 Ga0496121_0132116_918_1259 113
123 3300049570 Ga0501033_0001361 Ga0501033_0001361_9600_9950 113
124 3300049570 Ga0501033_0414052 Ga0501033_0414052_113_463 113
125 3300049571 Ga0501034_0552434 Ga0501034_0552434_141_491 113
126 3300049572 Ga0501036_0080987 Ga0501036_0080987_288_638 113
127 3300049573 Ga0501037_0610816 Ga0501037_0610816_72_422 113
128 3300049574 Ga0501038_0402854 Ga0501038_0402854_665_1015 113
129 3300049579 Ga0501043_0844207 Ga0501043_0844207_220_570 113
130 3300049581 Ga0501047_0101093 Ga0501047_0101093_452_802 113
131 3300049585 Ga0501069_0005973 Ga0501069_0005973_4477_4827 113
132 3300049586 Ga0501070_0822574 Ga0501070_0822574_307_657 113
133 3300049742 Ga0501080_1326177 Ga0501080_1326177_50_391 113
134 3300049823 Ga0501044_0623099 Ga0501044_0623099_315_665 113
135 3300049823 Ga0501044_1175936 Ga0501044_1175936_119_469 113
136 3300050489 nmdc:mga03683_374768_c1 nmdc:mga03683_374768_c1_207_557 113
137 3300050490 nmdc:mga03n38_365880_c1 nmdc:mga03n38_365880_c1_128_478 113
138 3300050516 nmdc:mga0sz30_68414_c1 nmdc:mga0sz30_68414_c1_932_1282 113
139 3300053094 Ga0500566_0001202 Ga0500566_0001202_10935_11285 113
140 3300059642 Ga0587069_139332 Ga0587069_139332_64_405 113
141 3300006038 Ga0075365_10466118 Ga0075365_104661182 114
142 3300006051 Ga0075364_10313224 Ga0075364_103132243 114
143 3300006177 Ga0075362_10410166 Ga0075362_104101661 114
144 3300009147 Ga0114129_11687082 Ga0114129_116870822 114
145 3300020078 Ga0206352_10052420 Ga0206352_100524202 114
146 3300035113 Ga0373936_0115679 Ga0373936_0115679_94_441 114
147 3300035398 Ga0316574_0639734 Ga0316574_0639734_251_595 114
148 3300041512 Ga0451853_2602983 Ga0451853_2602983_1436_1780 114
149 3300046499 Ga0495594_0666022 Ga0495594_0666022_186_530 114
150 3300050489 nmdc:mga03683_252544_c1 nmdc:mga03683_252544_c1_235_579 114
151 3300050492 nmdc:mga0yw44_860984_c1 nmdc:mga0yw44_860984_c1_137_481 114
152 3300050494 nmdc:mga06z11_194305_c1 nmdc:mga06z11_194305_c1_418_762 114
153 3300000549 LJQas_1021931 LJQas_10219311 115
154 3300001915 JGI24741J21665_1048199 JGI24741J21665_10481991 115
155 3300001976 JGI24752J21851_1029606 JGI24752J21851_10296061 115
156 3300002459 JGI24751J29686_10009512 JGI24751J29686_100095122 115
157 3300003354 JGI25160J50197_1022002 JGI25160J50197_10220021 115
158 3300003544 Ga0007417J51691_1030618 Ga0007417J51691_10306181 115
159 3300003579 Ga0007429J51699_1022932 Ga0007429J51699_10229321 115
160 3300004800 Ga0058861_11720119 Ga0058861_117201191 115
161 3300004800 Ga0058861_11903156 Ga0058861_119031561 115
162 3300004801 Ga0058860_11807479 Ga0058860_118074791 115
163 3300004803 Ga0058862_12532545 Ga0058862_125325452 115
164 3300005288 Ga0065714_10136409 Ga0065714_101364092 115
165 3300005327 Ga0070658_10291940 Ga0070658_102919402 115
166 3300005327 Ga0070658_10346223 Ga0070658_103462232 115
167 3300005327 Ga0070658_10678137 Ga0070658_106781371 115
168 3300005328 Ga0070676_10376614 Ga0070676_103766142 115
169 3300005330 Ga0070690_100077167 Ga0070690_1000771672 115
170 3300005330 Ga0070690_100358820 Ga0070690_1003588202 115
171 3300005331 Ga0070670_100082464 Ga0070670_1000824641 115
172 3300005334 Ga0068869_100085233 Ga0068869_1000852332 115
173 3300005334 Ga0068869_100296181 Ga0068869_1002961812 115
174 3300005335 Ga0070666_10507200 Ga0070666_105072001 115
175 3300005336 Ga0070680_100011833 Ga0070680_1000118333 115
176 3300005336 Ga0070680_101837984 Ga0070680_1018379841 115
177 3300005337 Ga0070682_100297170 Ga0070682_1002971701 115
178 3300005337 Ga0070682_100452592 Ga0070682_1004525921 115
179 3300005337 Ga0070682_101231873 Ga0070682_1012318731 115
180 3300005338 Ga0068868_100016532 Ga0068868_1000165327 115
181 3300005338 Ga0068868_100028070 Ga0068868_1000280702 115
182 3300005339 Ga0070660_100086092 Ga0070660_1000860921 115
183 3300005340 Ga0070689_100058921 Ga0070689_1000589211 115
184 3300005340 Ga0070689_100169184 Ga0070689_1001691841 115
185 3300005341 Ga0070691_10010771 Ga0070691_100107715 115
186 3300005343 Ga0070687_100006409 Ga0070687_1000064094 115
187 3300005343 Ga0070687_100058468 Ga0070687_1000584683 115
188 3300005345 Ga0070692_10046971 Ga0070692_100469711 115
189 3300005353 Ga0070669_100205901 Ga0070669_1002059012 115
190 3300005354 Ga0070675_100181570 Ga0070675_1001815702 115
191 3300005354 Ga0070675_100322909 Ga0070675_1003229093 115
192 3300005355 Ga0070671_100015635 Ga0070671_1000156357 115
193 3300005355 Ga0070671_100578447 Ga0070671_1005784472 115
194 3300005356 Ga0070674_100459064 Ga0070674_1004590642 115
195 3300005364 Ga0070673_100042857 Ga0070673_1000428573 115
196 3300005364 Ga0070673_100959849 Ga0070673_1009598491 115
197 3300005365 Ga0070688_100058109 Ga0070688_1000581095 115
198 3300005365 Ga0070688_100071869 Ga0070688_1000718692 115
199 3300005366 Ga0070659_100100673 Ga0070659_1001006733 115
200 3300005366 Ga0070659_100213297 Ga0070659_1002132971 115
201 3300005366 Ga0070659_100764322 Ga0070659_1007643221 115
202 3300005367 Ga0070667_100017825 Ga0070667_1000178256 115
203 3300005435 Ga0070714_100000056 Ga0070714_10000005677 115
204 3300005436 Ga0070713_101221205 Ga0070713_1012212051 115
205 3300005438 Ga0070701_10132059 Ga0070701_101320591 115
206 3300005439 Ga0070711_101357374 Ga0070711_1013573741 115
207 3300005440 Ga0070705_100173637 Ga0070705_1001736371 115
208 3300005441 Ga0070700_100000019 Ga0070700_10000001918 115
209 3300005441 Ga0070700_100104453 Ga0070700_1001044533 115
210 3300005455 Ga0070663_100049416 Ga0070663_1000494161 115
211 3300005455 Ga0070663_100879712 Ga0070663_1008797121 115
212 3300005456 Ga0070678_100002824 Ga0070678_10000282411 115
213 3300005456 Ga0070678_100256100 Ga0070678_1002561003 115
214 3300005457 Ga0070662_100370810 Ga0070662_1003708103 115
215 3300005458 Ga0070681_10081618 Ga0070681_100816183 115
216 3300005458 Ga0070681_11713629 Ga0070681_117136291 115
217 3300005459 Ga0068867_100001167 Ga0068867_10000116715 115
218 3300005466 Ga0070685_10062633 Ga0070685_100626333 115
219 3300005466 Ga0070685_10219110 Ga0070685_102191103 115
220 3300005466 Ga0070685_10247598 Ga0070685_102475981 115
221 3300005530 Ga0070679_100204454 Ga0070679_1002044542 115
222 3300005530 Ga0070679_100551235 Ga0070679_1005512352 115
223 3300005530 Ga0070679_100592986 Ga0070679_1005929861 115
224 3300005535 Ga0070684_100117326 Ga0070684_1001173263 115
225 3300005539 Ga0068853_100129928 Ga0068853_1001299281 115
226 3300005539 Ga0068853_100336077 Ga0068853_1003360774 115
227 3300005539 Ga0068853_100664384 Ga0068853_1006643842 115
228 3300005543 Ga0070672_100197169 Ga0070672_1001971693 115
229 3300005547 Ga0070693_100023343 Ga0070693_1000233433 115
230 3300005563 Ga0068855_100018553 Ga0068855_1000185533 115
231 3300005563 Ga0068855_100139154 Ga0068855_1001391541 115
232 3300005563 Ga0068855_100336619 Ga0068855_1003366192 115
233 3300005563 Ga0068855_102247951 Ga0068855_1022479512 115
234 3300005564 Ga0070664_100288265 Ga0070664_1002882651 115
235 3300005578 Ga0068854_100120019 Ga0068854_1001200194 115
236 3300005578 Ga0068854_100125574 Ga0068854_1001255743 115
237 3300005614 Ga0068856_100028485 Ga0068856_1000284852 115
238 3300005614 Ga0068856_100038303 Ga0068856_1000383033 115
239 3300005614 Ga0068856_101145548 Ga0068856_1011455482 115
240 3300005615 Ga0070702_100001056 Ga0070702_10000105610 115
241 3300005616 Ga0068852_100078990 Ga0068852_1000789904 115
242 3300005616 Ga0068852_100475708 Ga0068852_1004757082 115
243 3300005616 Ga0068852_100687585 Ga0068852_1006875852 115
244 3300005617 Ga0068859_101108835 Ga0068859_1011088352 115
245 3300005618 Ga0068864_100363921 Ga0068864_1003639211 115
246 3300005618 Ga0068864_100504153 Ga0068864_1005041532 115
247 3300005718 Ga0068866_10181172 Ga0068866_101811723 115
248 3300005719 Ga0068861_100856007 Ga0068861_1008560072 115
249 3300005834 Ga0068851_10021643 Ga0068851_100216433 115
250 3300005840 Ga0068870_10001305 Ga0068870_1000130510 115
251 3300005841 Ga0068863_100096892 Ga0068863_1000968922 115
252 3300005842 Ga0068858_100270343 Ga0068858_1002703432 115
253 3300005843 Ga0068860_101725611 Ga0068860_1017256111 115
254 3300005844 Ga0068862_100230623 Ga0068862_1002306232 115
255 3300005983 Ga0081540_1027281 Ga0081540_10272815 115
256 3300006028 Ga0070717_11276701 Ga0070717_112767011 115
257 3300006048 Ga0075363_100456622 Ga0075363_1004566222 115
258 3300006051 Ga0075364_10258523 Ga0075364_102585232 115
259 3300006173 Ga0070716_100930570 Ga0070716_1009305701 115
260 3300006178 Ga0075367_10316855 Ga0075367_103168552 115
261 3300006178 Ga0075367_10371127 Ga0075367_103711272 115
262 3300006195 Ga0075366_10184408 Ga0075366_101844081 115
263 3300006237 Ga0097621_100140819 Ga0097621_1001408192 115
264 3300006353 Ga0075370_10478030 Ga0075370_104780302 115
265 3300006358 Ga0068871_100023101 Ga0068871_1000231015 115
266 3300006844 Ga0075428_100924610 Ga0075428_1009246102 115
267 3300006852 Ga0075433_10012775 Ga0075433_100127756 115
268 3300006871 Ga0075434_100057081 Ga0075434_1000570813 115
269 3300006880 Ga0075429_100244157 Ga0075429_1002441572 115
270 3300006881 Ga0068865_100079231 Ga0068865_1000792312 115
271 3300006914 Ga0075436_100123581 Ga0075436_1001235812 115
272 3300006931 Ga0097620_101108851 Ga0097620_1011088512 115
273 3300007076 Ga0075435_100058876 Ga0075435_1000588766 115
274 3300009093 Ga0105240_10097773 Ga0105240_100977733 115
275 3300009093 Ga0105240_10123599 Ga0105240_101235995 115
276 3300009093 Ga0105240_10150035 Ga0105240_101500352 115
277 3300009093 Ga0105240_10968712 Ga0105240_109687121 115
278 3300009093 Ga0105240_12361110 Ga0105240_123611101 115
279 3300009094 Ga0111539_10107040 Ga0111539_101070403 115
280 3300009098 Ga0105245_10129375 Ga0105245_101293754 115
281 3300009098 Ga0105245_10141756 Ga0105245_101417563 115
282 3300009147 Ga0114129_10244432 Ga0114129_102444323 115
283 3300009148 Ga0105243_10033945 Ga0105243_100339455 115
284 3300009148 Ga0105243_10366479 Ga0105243_103664792 115
285 3300009174 Ga0105241_10056976 Ga0105241_100569764 115
286 3300009174 Ga0105241_11033088 Ga0105241_110330881 115
287 3300009176 Ga0105242_10031151 Ga0105242_100311519 115
288 3300009177 Ga0105248_10049750 Ga0105248_100497503 115
289 3300009177 Ga0105248_10241619 Ga0105248_102416193 115
290 3300009545 Ga0105237_10024693 Ga0105237_100246938 115
291 3300009545 Ga0105237_10541052 Ga0105237_105410523 115
292 3300009545 Ga0105237_11217199 Ga0105237_112171991 115
293 3300009545 Ga0105237_12364879 Ga0105237_123648791 115
294 3300009551 Ga0105238_10288636 Ga0105238_102886363 115
295 3300009551 Ga0105238_10757190 Ga0105238_107571902 115
296 3300009551 Ga0105238_10841709 Ga0105238_108417092 115
297 3300009553 Ga0105249_10439601 Ga0105249_104396012 115
298 3300010375 Ga0105239_10139390 Ga0105239_101393902 115
299 3300010375 Ga0105239_10378821 Ga0105239_103788213 115
300 3300010375 Ga0105239_10572903 Ga0105239_105729032 115
301 3300010375 Ga0105239_11553082 Ga0105239_115530821 115
302 3300011119 Ga0105246_10090848 Ga0105246_100908485 115
303 3300012503 Ga0157313_1011741 Ga0157313_10117412 115
304 3300013100 Ga0157373_10916273 Ga0157373_109162731 115
305 3300013102 Ga0157371_10016630 Ga0157371_100166301 115
306 3300013104 Ga0157370_10173785 Ga0157370_101737852 115
307 3300013104 Ga0157370_11463455 Ga0157370_114634552 115
308 3300013105 Ga0157369_10620518 Ga0157369_106205182 115
309 3300013105 Ga0157369_11344430 Ga0157369_113444301 115
310 3300013296 Ga0157374_10571546 Ga0157374_105715462 115
311 3300013296 Ga0157374_11779034 Ga0157374_117790342 115
312 3300013296 Ga0157374_12297389 Ga0157374_122973892 115
313 3300013297 Ga0157378_10089571 Ga0157378_100895712 115
314 3300013297 Ga0157378_11835622 Ga0157378_118356221 115
315 3300013306 Ga0163162_10184281 Ga0163162_101842815 115
316 3300013306 Ga0163162_12306768 Ga0163162_123067682 115
317 3300013307 Ga0157372_10154473 Ga0157372_101544734 115
318 3300013307 Ga0157372_12488904 Ga0157372_124889041 115
319 3300013308 Ga0157375_10077436 Ga0157375_100774363 115
320 3300013308 Ga0157375_10141200 Ga0157375_101412006 115
321 3300014497 Ga0182008_10216701 Ga0182008_102167012 115
322 3300014745 Ga0157377_10111160 Ga0157377_101111602 115
323 3300014968 Ga0157379_10023573 Ga0157379_100235733 115
324 3300014968 Ga0157379_10037476 Ga0157379_100374763 115
325 3300014969 Ga0157376_10863077 Ga0157376_108630772 115
326 3300015262 Ga0182007_10198257 Ga0182007_101982571 115
327 3300017792 Ga0163161_10820407 Ga0163161_108204072 115
328 3300020069 Ga0197907_10602326 Ga0197907_106023261 115
329 3300020069 Ga0197907_11126863 Ga0197907_111268631 115
330 3300020070 Ga0206356_10126309 Ga0206356_101263091 115
331 3300020070 Ga0206356_11271281 Ga0206356_112712812 115
332 3300020076 Ga0206355_1281966 Ga0206355_12819662 115
333 3300020077 Ga0206351_10048997 Ga0206351_100489972 115
334 3300020078 Ga0206352_10966106 Ga0206352_109661061 115
335 3300020078 Ga0206352_10967525 Ga0206352_109675253 115
336 3300020081 Ga0206354_10046039 Ga0206354_100460391 115
337 3300020081 Ga0206354_10084735 Ga0206354_100847353 115
338 3300020081 Ga0206354_10478325 Ga0206354_104783252 115
339 3300020082 Ga0206353_10124804 Ga0206353_101248042 115
340 3300020082 Ga0206353_10148832 Ga0206353_101488321 115
341 3300020082 Ga0206353_10229974 Ga0206353_102299746 115
342 3300020082 Ga0206353_10644972 Ga0206353_106449721 115
343 3300020082 Ga0206353_10996184 Ga0206353_109961842 115
344 3300020082 Ga0206353_11555357 Ga0206353_115553572 115
345 3300020082 Ga0206353_11600473 Ga0206353_116004731 115
346 3300020082 Ga0206353_12027566 Ga0206353_120275662 115
347 3300020610 Ga0154015_1211593 Ga0154015_12115931 115
348 3300021388 Ga0213875_10006095 Ga0213875_100060954 115
349 3300021388 Ga0213875_10055171 Ga0213875_100551712 115
350 3300022467 Ga0224712_10071922 Ga0224712_100719221 115
351 3300022467 Ga0224712_10256245 Ga0224712_102562451 115
352 3300022467 Ga0224712_10669228 Ga0224712_106692281 115
353 3300023436 Ga0256743_110435 Ga0256743_1104351 115
354 3300025256 Ga0209759_1010174 Ga0209759_10101745 115
355 3300025271 Ga0207666_1006476 Ga0207666_10064763 115
356 3300025302 Ga0207426_1006048 Ga0207426_10060486 115
357 3300025302 Ga0207426_1034672 Ga0207426_10346722 115
358 3300025315 Ga0207697_10045334 Ga0207697_100453343 115
359 3300025321 Ga0207656_10080193 Ga0207656_100801933 115
360 3300025735 Ga0207713_1148810 Ga0207713_11488102 115
361 3300025899 Ga0207642_10078464 Ga0207642_100784645 115
362 3300025900 Ga0207710_10195016 Ga0207710_101950162 115
363 3300025901 Ga0207688_10006789 Ga0207688_100067896 115
364 3300025901 Ga0207688_10037503 Ga0207688_100375032 115
365 3300025903 Ga0207680_10150777 Ga0207680_101507772 115
366 3300025904 Ga0207647_10392352 Ga0207647_103923521 115
367 3300025907 Ga0207645_10043563 Ga0207645_100435632 115
368 3300025907 Ga0207645_10339075 Ga0207645_103390752 115
369 3300025908 Ga0207643_10012956 Ga0207643_100129566 115
370 3300025911 Ga0207654_11031051 Ga0207654_110310511 115
371 3300025913 Ga0207695_10098040 Ga0207695_100980402 115
372 3300025913 Ga0207695_10123739 Ga0207695_101237393 115
373 3300025913 Ga0207695_10214520 Ga0207695_102145203 115
374 3300025914 Ga0207671_10065836 Ga0207671_100658365 115
375 3300025914 Ga0207671_10390977 Ga0207671_103909771 115
376 3300025914 Ga0207671_10770275 Ga0207671_107702752 115
377 3300025917 Ga0207660_10124976 Ga0207660_101249762 115
378 3300025917 Ga0207660_10199417 Ga0207660_101994173 115
379 3300025917 Ga0207660_11054154 Ga0207660_110541541 115
380 3300025918 Ga0207662_10036297 Ga0207662_100362972 115
381 3300025918 Ga0207662_10042916 Ga0207662_100429164 115
382 3300025919 Ga0207657_10031777 Ga0207657_100317775 115
383 3300025919 Ga0207657_10440527 Ga0207657_104405272 115
384 3300025920 Ga0207649_10106206 Ga0207649_101062062 115
385 3300025921 Ga0207652_10060892 Ga0207652_100608922 115
386 3300025923 Ga0207681_10786564 Ga0207681_107865642 115
387 3300025924 Ga0207694_10819994 Ga0207694_108199942 115
388 3300025925 Ga0207650_10003481 Ga0207650_1000348110 115
389 3300025926 Ga0207659_10041151 Ga0207659_100411513 115
390 3300025926 Ga0207659_10083792 Ga0207659_100837923 115
391 3300025929 Ga0207664_10000074 Ga0207664_1000007426 115
392 3300025931 Ga0207644_10027943 Ga0207644_100279437 115
393 3300025931 Ga0207644_10264749 Ga0207644_102647491 115
394 3300025932 Ga0207690_10092924 Ga0207690_100929244 115
395 3300025932 Ga0207690_10735476 Ga0207690_107354762 115
396 3300025933 Ga0207706_10059914 Ga0207706_100599142 115
397 3300025933 Ga0207706_10500547 Ga0207706_105005472 115
398 3300025934 Ga0207686_10058976 Ga0207686_100589762 115
399 3300025934 Ga0207686_10689665 Ga0207686_106896652 115
400 3300025935 Ga0207709_10148897 Ga0207709_101488972 115
401 3300025937 Ga0207669_10052969 Ga0207669_100529692 115
402 3300025938 Ga0207704_10113671 Ga0207704_101136712 115
403 3300025938 Ga0207704_10694822 Ga0207704_106948222 115
404 3300025939 Ga0207665_10277014 Ga0207665_102770142 115
405 3300025940 Ga0207691_10072212 Ga0207691_100722122 115
406 3300025940 Ga0207691_10142987 Ga0207691_101429872 115
407 3300025941 Ga0207711_10277548 Ga0207711_102775482 115
408 3300025941 Ga0207711_10795102 Ga0207711_107951022 115
409 3300025942 Ga0207689_10008742 Ga0207689_1000874210 115
410 3300025942 Ga0207689_10738895 Ga0207689_107388951 115
411 3300025944 Ga0207661_10074429 Ga0207661_100744292 115
412 3300025944 Ga0207661_11153729 Ga0207661_111537291 115
413 3300025945 Ga0207679_10175991 Ga0207679_101759913 115
414 3300025945 Ga0207679_11210917 Ga0207679_112109172 115
415 3300025949 Ga0207667_10008347 Ga0207667_100083475 115
416 3300025960 Ga0207651_10552710 Ga0207651_105527101 115
417 3300025961 Ga0207712_10633744 Ga0207712_106337442 115
418 3300025981 Ga0207640_10144304 Ga0207640_101443042 115
419 3300025986 Ga0207658_10013733 Ga0207658_100137336 115
420 3300025986 Ga0207658_11242081 Ga0207658_112420812 115
421 3300026023 Ga0207677_10015903 Ga0207677_100159033 115
422 3300026035 Ga0207703_10065103 Ga0207703_100651033 115
423 3300026041 Ga0207639_10089629 Ga0207639_100896292 115
424 3300026067 Ga0207678_10032545 Ga0207678_100325453 115
425 3300026067 Ga0207678_10305489 Ga0207678_103054892 115
426 3300026075 Ga0207708_10000038 Ga0207708_1000003818 115
427 3300026075 Ga0207708_10197219 Ga0207708_101972192 115
428 3300026075 Ga0207708_10954537 Ga0207708_109545371 115
429 3300026078 Ga0207702_10016911 Ga0207702_100169117 115
430 3300026078 Ga0207702_10061015 Ga0207702_100610155 115
431 3300026078 Ga0207702_10429833 Ga0207702_104298332 115
432 3300026088 Ga0207641_11353176 Ga0207641_113531762 115
433 3300026089 Ga0207648_10000791 Ga0207648_100007915 115
434 3300026089 Ga0207648_10173261 Ga0207648_101732611 115
435 3300026095 Ga0207676_10004681 Ga0207676_1000468110 115
436 3300026095 Ga0207676_11134984 Ga0207676_111349842 115
437 3300026116 Ga0207674_10074232 Ga0207674_100742323 115
438 3300026116 Ga0207674_10485402 Ga0207674_104854022 115
439 3300026118 Ga0207675_100081690 Ga0207675_1000816902 115
440 3300026121 Ga0207683_10005295 Ga0207683_100052956 115
441 3300026121 Ga0207683_10254946 Ga0207683_102549463 115
442 3300026142 Ga0207698_10350739 Ga0207698_103507392 115
443 3300026142 Ga0207698_10489059 Ga0207698_104890592 115
444 3300027907 Ga0207428_10045123 Ga0207428_100451235 115
445 3300028379 Ga0268266_12271432 Ga0268266_122714321 115
446 3300028380 Ga0268265_10983058 Ga0268265_109830582 115
447 3300028381 Ga0268264_10874725 Ga0268264_108747252 115
448 3300029285 Ga0310981_1035178 Ga0310981_10351781 115
449 3300031247 Ga0265340_10019149 Ga0265340_100191492 115
450 3300031456 Ga0307513_10001645 Ga0307513_1000164518 115
451 3300031548 Ga0307408_100068924 Ga0307408_1000689243 115
452 3300031548 Ga0307408_100646044 Ga0307408_1006460442 115
453 3300031727 Ga0316576_10053892 Ga0316576_100538923 115
454 3300031728 Ga0316578_10229605 Ga0316578_102296051 115
455 3300031731 Ga0307405_10347368 Ga0307405_103473682 115
456 3300031731 Ga0307405_11450362 Ga0307405_114503621 115
457 3300031824 Ga0307413_10094194 Ga0307413_100941941 115
458 3300031824 Ga0307413_10115416 Ga0307413_101154162 115
459 3300031824 Ga0307413_10168344 Ga0307413_101683442 115
460 3300031824 Ga0307413_10564963 Ga0307413_105649632 115
461 3300031852 Ga0307410_10061170 Ga0307410_100611702 115
462 3300031852 Ga0307410_10093844 Ga0307410_100938442 115
463 3300031852 Ga0307410_10159586 Ga0307410_101595861 115
464 3300031852 Ga0307410_10252713 Ga0307410_102527131 115
465 3300031852 Ga0307410_10308428 Ga0307410_103084282 115
466 3300031852 Ga0307410_10667714 Ga0307410_106677141 115
467 3300031852 Ga0307410_11593889 Ga0307410_115938891 115
468 3300031901 Ga0307406_10046861 Ga0307406_100468612 115
469 3300031901 Ga0307406_10054504 Ga0307406_100545042 115
470 3300031901 Ga0307406_10166696 Ga0307406_101666962 115
471 3300031901 Ga0307406_10252750 Ga0307406_102527501 115
472 3300031901 Ga0307406_10446659 Ga0307406_104466592 115
473 3300031901 Ga0307406_10461123 Ga0307406_104611232 115
474 3300031901 Ga0307406_11042925 Ga0307406_110429252 115
475 3300031903 Ga0307407_10038070 Ga0307407_100380702 115
476 3300031903 Ga0307407_10110765 Ga0307407_101107652 115
477 3300031903 Ga0307407_10111440 Ga0307407_101114401 115
478 3300031903 Ga0307407_10685600 Ga0307407_106856002 115
479 3300031995 Ga0307409_100021978 Ga0307409_1000219784 115
480 3300031995 Ga0307409_100030729 Ga0307409_1000307292 115
481 3300031995 Ga0307409_100113279 Ga0307409_1001132792 115
482 3300031995 Ga0307409_100144899 Ga0307409_1001448993 115
483 3300031995 Ga0307409_100233596 Ga0307409_1002335962 115
484 3300031995 Ga0307409_100470610 Ga0307409_1004706101 115
485 3300031995 Ga0307409_100555237 Ga0307409_1005552373 115
486 3300031995 Ga0307409_100560076 Ga0307409_1005600762 115
487 3300031995 Ga0307409_101637708 Ga0307409_1016377081 115
488 3300031995 Ga0307409_102107766 Ga0307409_1021077661 115
489 3300032002 Ga0307416_100019059 Ga0307416_1000190593 115
490 3300032002 Ga0307416_100074220 Ga0307416_1000742205 115
491 3300032002 Ga0307416_100134924 Ga0307416_1001349242 115
492 3300032002 Ga0307416_100375603 Ga0307416_1003756033 115
493 3300032002 Ga0307416_100892800 Ga0307416_1008928002 115
494 3300032004 Ga0307414_10132521 Ga0307414_101325213 115
495 3300032004 Ga0307414_10255421 Ga0307414_102554212 115
496 3300032004 Ga0307414_10744643 Ga0307414_107446432 115
497 3300032005 Ga0307411_10055052 Ga0307411_100550523 115
498 3300032126 Ga0307415_100150557 Ga0307415_1001505571 115
499 3300032126 Ga0307415_100278278 Ga0307415_1002782783 115
500 3300032126 Ga0307415_100439606 Ga0307415_1004396062 115
501 3300032126 Ga0307415_100725307 Ga0307415_1007253072 115
502 3300032126 Ga0307415_101406780 Ga0307415_1014067801 115
503 3300032126 Ga0307415_101482482 Ga0307415_1014824822 115
504 3300035092 Ga0373952_0150446 Ga0373952_0150446_263_610 115
505 3300035114 Ga0373939_0128482 Ga0373939_0128482_117_464 115
506 3300035115 Ga0373941_0025167 Ga0373941_0025167_608_964 115
507 3300035171 Ga0373946_0364039 Ga0373946_0364039_145_501 115
508 3300035242 Ga0373962_0170854 Ga0373962_0170854_47_394 115
509 3300035691 Ga0373931_0103926 Ga0373931_0103926_799_1146 115
510 3300035691 Ga0373931_0116383 Ga0373931_0116383_278_634 115
511 3300035695 Ga0373927_0667869 Ga0373927_0667869_300_656 115
512 3300035725 Ga0373947_0708730 Ga0373947_0708730_163_519 115
513 3300037312 Ga0395899_0069827 Ga0395899_0069827_2006_2362 115
514 3300037418 Ga0395900_0364943 Ga0395900_0364943_773_1129 115
515 3300037418 Ga0395900_0544908 Ga0395900_0544908_720_1076 115
516 3300037418 Ga0395900_1616007 Ga0395900_1616007_172_528 115
517 3300037466 Ga0395898_0055976 Ga0395898_0055976_570_926 115
518 3300037466 Ga0395898_0197075 Ga0395898_0197075_465_821 115
519 3300037466 Ga0395898_0977710 Ga0395898_0977710_97_456 115
520 3300037853 Ga0436364_0015698 Ga0436364_0015698_2938_3294 115
521 3300037853 Ga0436364_1240818 Ga0436364_1240818_12967_13314 115
522 3300038443 Ga0395901_0028124 Ga0395901_0028124_2575_2931 115
523 3300038443 Ga0395901_1163335 Ga0395901_1163335_182_538 115
524 3300039450 Ga0436363_0419769 Ga0436363_0419769_272_631 115
525 3300041444 Ga0451790_03754 Ga0451790_03754_264_623 115
526 3300041446 Ga0451794_27686 Ga0451794_27686_66_425 115
527 3300041451 Ga0451791_1298264 Ga0451791_1298264_583_942 115
528 3300041452 Ga0451793_1234677 Ga0451793_1234677_1316_1675 115
529 3300041453 Ga0451797_1536272 Ga0451797_1536272_1377_1724 115
530 3300041498 Ga0451841_0812607 Ga0451841_0812607_493_852 115
531 3300041507 Ga0451851_0858940 Ga0451851_0858940_207_554 115
532 3300041509 Ga0451843_1132984 Ga0451843_1132984_268_615 115
533 3300042005 Ga0439448_0017498 Ga0439448_0017498_1753_2109 115
534 3300042008 Ga0439450_103098 Ga0439450_103098_241_597 115
535 3300042016 Ga0439463_090544 Ga0439463_090544_99_455 115
536 3300042016 Ga0439463_130461 Ga0439463_130461_52_408 115
537 3300042157 Ga0439458_0080796 Ga0439458_0080796_23_379 115
538 3300042438 Ga0439459_0002037 Ga0439459_0002037_958_1314 115
539 3300042438 Ga0439459_0226140 Ga0439459_0226140_39_395 115
540 3300042533 Ga0450901_024484 Ga0450901_024484_50_406 115
541 3300042876 Ga0451577_1706676 Ga0451577_1706676_182_541 115
542 3300044656 Ga0466969_0446088 Ga0466969_0446088_205_561 115
543 3300044656 Ga0466969_0503516 Ga0466969_0503516_22_378 115
544 3300044658 Ga0466972_0113828 Ga0466972_0113828_512_868 115
545 3300044658 Ga0466972_0172134 Ga0466972_0172134_425_781 115
546 3300044658 Ga0466972_0360972 Ga0466972_0360972_44_403 115
547 3300044658 Ga0466972_0446788 Ga0466972_0446788_177_533 115
548 3300044683 Ga0466965_0223347 Ga0466965_0223347_79_435 115
549 3300044684 Ga0466966_0171150 Ga0466966_0171150_20_376 115
550 3300044684 Ga0466966_0420282 Ga0466966_0420282_290_646 115
551 3300044684 Ga0466966_0440904 Ga0466966_0440904_317_673 115
552 3300044684 Ga0466966_0454419 Ga0466966_0454419_341_697 115
553 3300044684 Ga0466966_0525201 Ga0466966_0525201_185_541 115
554 3300044684 Ga0466966_0529490 Ga0466966_0529490_167_523 115
555 3300044684 Ga0466966_0981930 Ga0466966_0981930_129_485 115
556 3300044693 Ga0466961_0052078 Ga0466961_0052078_1873_2229 115
557 3300044693 Ga0466961_0143827 Ga0466961_0143827_1079_1435 115
558 3300044693 Ga0466961_0430413 Ga0466961_0430413_363_719 115
559 3300044693 Ga0466961_0911935 Ga0466961_0911935_114_470 115
560 3300044694 Ga0466963_0014526 Ga0466963_0014526_2975_3331 115
561 3300044694 Ga0466963_0028931 Ga0466963_0028931_2214_2570 115
562 3300044694 Ga0466963_0098004 Ga0466963_0098004_627_983 115
563 3300044694 Ga0466963_0181518 Ga0466963_0181518_261_617 115
564 3300044694 Ga0466963_0228978 Ga0466963_0228978_167_523 115
565 3300044694 Ga0466963_0398320 Ga0466963_0398320_425_781 115
566 3300044694 Ga0466963_0477357 Ga0466963_0477357_436_792 115
567 3300044694 Ga0466963_0854537 Ga0466963_0854537_80_436 115
568 3300044706 Ga0466964_0345727 Ga0466964_0345727_325_681 115
569 3300044706 Ga0466964_0472591 Ga0466964_0472591_184_540 115
570 3300044706 Ga0466964_0499535 Ga0466964_0499535_228_584 115
571 3300044719 Ga0466971_0011648 Ga0466971_0011648_1282_1638 115
572 3300044719 Ga0466971_0063406 Ga0466971_0063406_1124_1480 115
573 3300044719 Ga0466971_0305531 Ga0466971_0305531_314_670 115
574 3300044719 Ga0466971_0487446 Ga0466971_0487446_203_559 115
575 3300044735 Ga0466968_0373528 Ga0466968_0373528_18_374 115
576 3300044735 Ga0466968_0746118 Ga0466968_0746118_76_432 115
577 3300044765 Ga0466970_0025462 Ga0466970_0025462_111_467 115
578 3300044765 Ga0466970_0064379 Ga0466970_0064379_1356_1715 115
579 3300044765 Ga0466970_0143955 Ga0466970_0143955_294_650 115
580 3300044765 Ga0466970_0460741 Ga0466970_0460741_337_693 115
581 3300044765 Ga0466970_0905803 Ga0466970_0905803_133_489 115
582 3300044842 Ga0466957_0044337 Ga0466957_0044337_1972_2328 115
583 3300044842 Ga0466957_0074035 Ga0466957_0074035_135_491 115
584 3300044842 Ga0466957_0091115 Ga0466957_0091115_133_489 115
585 3300044842 Ga0466957_0109985 Ga0466957_0109985_809_1165 115
586 3300044842 Ga0466957_0145874 Ga0466957_0145874_310_666 115
587 3300044842 Ga0466957_0247638 Ga0466957_0247638_683_1039 115
588 3300044842 Ga0466957_0288429 Ga0466957_0288429_676_1032 115
589 3300044842 Ga0466957_0760955 Ga0466957_0760955_192_548 115
590 3300044842 Ga0466957_0801704 Ga0466957_0801704_175_531 115
591 3300044901 Ga0466960_0085719 Ga0466960_0085719_1180_1536 115
592 3300044901 Ga0466960_0259110 Ga0466960_0259110_602_958 115
593 3300044901 Ga0466960_0332823 Ga0466960_0332823_450_806 115
594 3300044901 Ga0466960_0741557 Ga0466960_0741557_34_390 115
595 3300044901 Ga0466960_0778339 Ga0466960_0778339_142_498 115
596 3300045049 Ga0466959_0038875 Ga0466959_0038875_3117_3473 115
597 3300045049 Ga0466959_0067574 Ga0466959_0067574_1518_1874 115
598 3300045049 Ga0466959_0213082 Ga0466959_0213082_966_1322 115
599 3300045049 Ga0466959_0247785 Ga0466959_0247785_357_713 115
600 3300045049 Ga0466959_0764431 Ga0466959_0764431_33_389 115
601 3300045836 Ga0466958_0012760 Ga0466958_0012760_2700_3056 115
602 3300045836 Ga0466958_0056863 Ga0466958_0056863_1177_1533 115
603 3300045836 Ga0466958_0079976 Ga0466958_0079976_943_1299 115
604 3300045836 Ga0466958_0345485 Ga0466958_0345485_23_379 115
605 3300045836 Ga0466958_0353209 Ga0466958_0353209_533_889 115
606 3300045976 Ga0466967_0018985 Ga0466967_0018985_4943_5299 115
607 3300045976 Ga0466967_0044355 Ga0466967_0044355_2184_2540 115
608 3300045976 Ga0466967_0052834 Ga0466967_0052834_1702_2058 115
609 3300045976 Ga0466967_0190583 Ga0466967_0190583_18_374 115
610 3300045976 Ga0466967_0236855 Ga0466967_0236855_481_837 115
611 3300045976 Ga0466967_0997036 Ga0466967_0997036_339_695 115
612 3300046460 Ga0495638_0021586 Ga0495638_0021586_1435_1794 115
613 3300046473 Ga0495582_0712604 Ga0495582_0712604_137_493 115
614 3300046500 Ga0495596_0314237 Ga0495596_0314237_19_375 115
615 3300046530 Ga0495654_0311109 Ga0495654_0311109_68_424 115
616 3300046533 Ga0495640_0722461 Ga0495640_0722461_107_463 115
617 3300046615 Ga0495656_0048916 Ga0495656_0048916_438_794 115
618 3300046648 Ga0495611_0366612 Ga0495611_0366612_105_461 115
619 3300046665 Ga0495661_0193687 Ga0495661_0193687_394_750 115
620 3300046691 Ga0495670_0318576 Ga0495670_0318576_160_516 115
621 3300047318 Ga0495636_0228364 Ga0495636_0228364_83_439 115
622 3300047319 Ga0495674_1137700 Ga0495674_1137700_89_445 115
623 3300047321 Ga0495676_1078376 Ga0495676_1078376_56_412 115
624 3300047471 Ga0495684_0859343 Ga0495684_0859343_179_535 115
625 3300047673 Ga0495593_0497878 Ga0495593_0497878_133_489 115
626 3300048903 Ga0496100_0027222 Ga0496100_0027222_965_1312 115
627 3300048903 Ga0496100_0693152 Ga0496100_0693152_38_394 115
628 3300048904 Ga0496101_0019706 Ga0496101_0019706_2218_2565 115
629 3300048904 Ga0496101_0074802 Ga0496101_0074802_1886_2242 115
630 3300048905 Ga0496102_0029226 Ga0496102_0029226_2160_2519 115
631 3300048905 Ga0496102_0057858 Ga0496102_0057858_677_1033 115
632 3300048905 Ga0496102_0062378 Ga0496102_0062378_377_733 115
633 3300048905 Ga0496102_0831254 Ga0496102_0831254_182_538 115
634 3300048906 Ga0496103_0025995 Ga0496103_0025995_2558_2914 115
635 3300048906 Ga0496103_0071303 Ga0496103_0071303_1011_1370 115
636 3300048906 Ga0496103_0254815 Ga0496103_0254815_489_845 115
637 3300048906 Ga0496103_0962290 Ga0496103_0962290_82_438 115
638 3300048907 Ga0496104_0014881 Ga0496104_0014881_2284_2640 115
639 3300048907 Ga0496104_0239789 Ga0496104_0239789_248_595 115
640 3300048908 Ga0496105_0002556 Ga0496105_0002556_118_474 115
641 3300048908 Ga0496105_0026209 Ga0496105_0026209_3375_3722 115
642 3300048909 Ga0496106_0027625 Ga0496106_0027625_170_526 115
643 3300048909 Ga0496106_0179373 Ga0496106_0179373_278_625 115
644 3300048910 Ga0496107_0045567 Ga0496107_0045567_358_714 115
645 3300048910 Ga0496107_0081284 Ga0496107_0081284_1538_1885 115
646 3300048910 Ga0496107_1355052 Ga0496107_1355052_107_463 115
647 3300048911 Ga0496108_0110189 Ga0496108_0110189_1070_1426 115
648 3300048911 Ga0496108_0508321 Ga0496108_0508321_467_814 115
649 3300048912 Ga0496109_0129313 Ga0496109_0129313_1073_1429 115
650 3300048912 Ga0496109_0628631 Ga0496109_0628631_464_820 115
651 3300048913 Ga0496110_0010215 Ga0496110_0010215_161_517 115
652 3300048913 Ga0496110_0055620 Ga0496110_0055620_2174_2521 115
653 3300048914 Ga0496111_0020293 Ga0496111_0020293_423_779 115
654 3300048914 Ga0496111_0192641 Ga0496111_0192641_753_1100 115
655 3300048915 Ga0496112_0043364 Ga0496112_0043364_3771_4130 115
656 3300048915 Ga0496112_1099633 Ga0496112_1099633_291_647 115
657 3300048915 Ga0496112_1470125 Ga0496112_1470125_48_404 115
658 3300048916 Ga0496113_0464820 Ga0496113_0464820_620_976 115
659 3300048916 Ga0496113_0749279 Ga0496113_0749279_412_768 115
660 3300048916 Ga0496113_0867380 Ga0496113_0867380_197_544 115
661 3300048917 Ga0496114_0015303 Ga0496114_0015303_567_914 115
662 3300048917 Ga0496114_0596319 Ga0496114_0596319_549_908 115
663 3300048922 Ga0496119_0478656 Ga0496119_0478656_202_558 115
664 3300048924 Ga0496121_0107424 Ga0496121_0107424_1300_1656 115
665 3300049127 Ga0501306_108022 Ga0501306_108022_107_463 115
666 3300049128 Ga0501308_068801 Ga0501308_068801_63_410 115
667 3300049128 Ga0501308_077349 Ga0501308_077349_120_467 115
668 3300049129 Ga0501309_051092 Ga0501309_051092_125_481 115
669 3300049161 Ga0501305_069521 Ga0501305_069521_117_473 115
670 3300049522 Ga0501299_112720 Ga0501299_112720_134_490 115
671 3300049534 Ga0501318_013508 Ga0501318_013508_271_627 115
672 3300049534 Ga0501318_034880 Ga0501318_034880_210_566 115
673 3300049537 Ga0501321_030912 Ga0501321_030912_217_573 115
674 3300049537 Ga0501321_085692 Ga0501321_085692_23_379 115
675 3300049540 Ga0501324_021226 Ga0501324_021226_38_394 115
676 3300049571 Ga0501034_0219254 Ga0501034_0219254_745_1092 115
677 3300049572 Ga0501036_1681471 Ga0501036_1681471_62_409 115
678 3300049574 Ga0501038_0780973 Ga0501038_0780973_20_424 115
679 3300049575 Ga0501039_0731267 Ga0501039_0731267_307_663 115
680 3300049576 Ga0501040_0549096 Ga0501040_0549096_336_692 115
681 3300049577 Ga0501041_0461445 Ga0501041_0461445_214_570 115
682 3300049577 Ga0501041_1113318 Ga0501041_1113318_89_448 115
683 3300049582 Ga0501048_0475757 Ga0501048_0475757_168_524 115
684 3300049587 Ga0501071_0717463 Ga0501071_0717463_153_509 115
685 3300049593 Ga0501077_0762965 Ga0501077_0762965_102_458 115
686 3300049653 Ga0501206_071852 Ga0501206_071852_209_565 115
687 3300049661 Ga0501217_329327 Ga0501217_329327_71_427 115
688 3300049667 Ga0501230_050159 Ga0501230_050159_344_691 115
689 3300049741 Ga0501079_0790151 Ga0501079_0790151_183_539 115
690 3300049779 Ga0501283_110602 Ga0501283_110602_145_501 115
691 3300049824 Ga0501045_0940722 Ga0501045_0940722_52_408 115
692 3300049851 Ga0501212_044926 Ga0501212_044926_253_609 115
693 3300050490 nmdc:mga03n38_556311_c1 nmdc:mga03n38_556311_c1_291_638 115
694 3300050491 nmdc:mga00v17_283425_c1 nmdc:mga00v17_283425_c1_234_581 115
695 3300050492 nmdc:mga0yw44_655894_c1 nmdc:mga0yw44_655894_c1_102_449 115
696 3300050493 nmdc:mga0k408_309561_c1 nmdc:mga0k408_309561_c1_394_741 115
697 3300050496 nmdc:mga07m45_386664_c1 nmdc:mga07m45_386664_c1_402_749 115
698 3300050507 nmdc:mga05p37_168354_c1 nmdc:mga05p37_168354_c1_88_444 115
699 3300050508 nmdc:mga09592_242618_c1 nmdc:mga09592_242618_c1_24_380 115
700 3300050511 nmdc:mga08y16_8126_c1 nmdc:mga08y16_8126_c1_2392_2748 115
701 3300050512 nmdc:mga0n895_50638_c1 nmdc:mga0n895_50638_c1_3416_3772 115
702 3300050513 nmdc:mga0rr50_189702_c1 nmdc:mga0rr50_189702_c1_928_1284 115
703 3300050514 nmdc:mga08x19_3690_c1 nmdc:mga08x19_3690_c1_564_920 115
704 3300050515 nmdc:mga0a205_90473_c1 nmdc:mga0a205_90473_c1_114_470 115
705 3300053085 Ga0495619_0698039 Ga0495619_0698039_260_619 115
706 3300053090 Ga0500646_0085751 Ga0500646_0085751_98_445 115
707 3300053117 Ga0500593_051396 Ga0500593_051396_162_509 115
708 3300053117 Ga0500593_139492 Ga0500593_139492_156_515 115
709 3300053153 Ga0500616_0001526 Ga0500616_0001526_18712_19071 115
710 3300053739 Ga0500587_059787 Ga0500587_059787_45_401 115
711 3300054114 Ga0501084_0984585 Ga0501084_0984585_277_633 115
712 3300059477 Ga0587084_124884 Ga0587084_124884_136_492 115
713 3300059492 Ga0587073_0176173 Ga0587073_0176173_181_534 115
714 3300059492 Ga0587073_0335136 Ga0587073_0335136_136_492 115
715 3300059503 Ga0587080_110456 Ga0587080_110456_14_370 115
716 3300059505 Ga0587083_0076057 Ga0587083_0076057_134_481 115
717 3300059506 Ga0587085_010526 Ga0587085_010526_193_546 115
718 3300059508 Ga0587088_127822 Ga0587088_127822_143_499 115
719 3300059511 Ga0587091_008928 Ga0587091_008928_385_744 115
720 3300059511 Ga0587091_127304 Ga0587091_127304_50_409 115
721 3300059511 Ga0587091_129478 Ga0587091_129478_138_494 115
722 3300059513 Ga0587094_044011 Ga0587094_044011_160_513 115
723 3300059605 Ga0587106_136977 Ga0587106_136977_62_421 115
724 3300059622 Ga0587099_037994 Ga0587099_037994_170_523 115
725 3300059623 Ga0587101_153575 Ga0587101_153575_14_370 115
726 3300059626 Ga0587115_117682 Ga0587115_117682_117_476 115
727 3300059628 Ga0587122_036320 Ga0587122_036320_74_427 115
728 3300059630 Ga0587128_091779 Ga0587128_091779_107_463 115
729 3300059631 Ga0587130_019187 Ga0587130_019187_196_549 115
730 3300059640 Ga0587067_213509 Ga0587067_213509_134_490 115
731 3300059640 Ga0587067_230846 Ga0587067_230846_132_488 115
732 3300059641 Ga0587068_161250 Ga0587068_161250_106_465 115
733 3300059643 Ga0587072_163732 Ga0587072_163732_78_437 115
734 3300059645 Ga0587076_193782 Ga0587076_193782_100_456 115
735 3300059653 Ga0587108_014746 Ga0587108_014746_89_448 115
736 3300059655 Ga0587114_058829 Ga0587114_058829_211_567 115
737 3300060243 Ga0587060_025524 Ga0587060_025524_170_523 115
738 3300060346 Ga0587111_0149818 Ga0587111_0149818_180_536 115
739 3300061719 Ga0466962_0155377 Ga0466962_0155377_535_891 115
740 3300061719 Ga0466962_0155536 Ga0466962_0155536_704_1060 115
741 3300061719 Ga0466962_0614769 Ga0466962_0614769_57_413 115
742 3300061719 Ga0466962_0687160 Ga0466962_0687160_84_440 115
743 2209111006 2214637478 2213666977 116
744 3300001989 JGI24739J22299_10068969 JGI24739J22299_100689692 116
745 3300001990 JGI24737J22298_10026270 JGI24737J22298_100262702 116
746 3300002067 JGI24735J21928_10195025 JGI24735J21928_101950251 116
747 3300002075 JGI24738J21930_10007820 JGI24738J21930_100078203 116
748 3300003316 rootH1_10010292 rootH1_100102925 116
749 3300003856 Ga0058692_1024712 Ga0058692_10247121 116
750 3300005329 Ga0070683_100353724 Ga0070683_1003537242 116
751 3300005536 Ga0070697_101858954 Ga0070697_1018589541 116
752 3300005539 Ga0068853_100051137 Ga0068853_1000511373 116
753 3300005543 Ga0070672_101547359 Ga0070672_1015473592 116
754 3300005548 Ga0070665_100115915 Ga0070665_1001159153 116
755 3300005563 Ga0068855_100818276 Ga0068855_1008182761 116
756 3300005577 Ga0068857_101642883 Ga0068857_1016428831 116
757 3300005578 Ga0068854_100172269 Ga0068854_1001722692 116
758 3300005614 Ga0068856_100709988 Ga0068856_1007099882 116
759 3300005615 Ga0070702_100978694 Ga0070702_1009786941 116
760 3300005843 Ga0068860_101673940 Ga0068860_1016739401 116
761 3300005937 Ga0081455_10000841 Ga0081455_1000084137 116
762 3300006178 Ga0075367_10065028 Ga0075367_100650283 116
763 3300006353 Ga0075370_10114704 Ga0075370_101147042 116
764 3300006844 Ga0075428_102576154 Ga0075428_1025761541 116
765 3300006948 Ga0099826_10047403 Ga0099826_100474034 116
766 3300009011 Ga0105251_10073292 Ga0105251_100732922 116
767 3300009036 Ga0105244_10166265 Ga0105244_101662652 116
768 3300009094 Ga0111539_11269307 Ga0111539_112693072 116
769 3300009148 Ga0105243_10616657 Ga0105243_106166572 116
770 3300009176 Ga0105242_10531799 Ga0105242_105317992 116
771 3300009551 Ga0105238_10291505 Ga0105238_102915052 116
772 3300009551 Ga0105238_12620460 Ga0105238_126204601 116
773 3300010375 Ga0105239_10921052 Ga0105239_109210521 116
774 3300011119 Ga0105246_10137672 Ga0105246_101376721 116
775 3300012512 Ga0157327_1072430 Ga0157327_10724301 116
776 3300013062 Ga0154010_142966 Ga0154010_1429661 116
777 3300013105 Ga0157369_10068099 Ga0157369_100680994 116
778 3300013306 Ga0163162_11726437 Ga0163162_117264371 116
779 3300013307 Ga0157372_10072973 Ga0157372_100729734 116
780 3300013307 Ga0157372_10846462 Ga0157372_108464622 116
781 3300014497 Ga0182008_10000192 Ga0182008_1000019228 116
782 3300014969 Ga0157376_11449097 Ga0157376_114490972 116
783 3300015261 Ga0182006_1008560 Ga0182006_10085606 116
784 3300015262 Ga0182007_10000165 Ga0182007_1000016538 116
785 3300015265 Ga0182005_1014651 Ga0182005_10146512 116
786 3300015688 Ga0183367_1013 Ga0183367_1013109 116
787 3300020070 Ga0206356_11196099 Ga0206356_111960991 116
788 3300020070 Ga0206356_11249890 Ga0206356_112498901 116
789 3300020075 Ga0206349_1321064 Ga0206349_13210641 116
790 3300020076 Ga0206355_1292636 Ga0206355_12926361 116
791 3300020078 Ga0206352_10120208 Ga0206352_101202081 116
792 3300020080 Ga0206350_10420881 Ga0206350_104208811 116
793 3300022467 Ga0224712_10237984 Ga0224712_102379842 116
794 3300025904 Ga0207647_10005464 Ga0207647_100054643 116
795 3300025924 Ga0207694_10234848 Ga0207694_102348483 116
796 3300025933 Ga0207706_10612862 Ga0207706_106128621 116
797 3300025935 Ga0207709_10171834 Ga0207709_101718341 116
798 3300025937 Ga0207669_10707120 Ga0207669_107071202 116
799 3300025938 Ga0207704_11090714 Ga0207704_110907142 116
800 3300025942 Ga0207689_11805296 Ga0207689_118052961 116
801 3300025949 Ga0207667_10961805 Ga0207667_109618052 116
802 3300025961 Ga0207712_11124983 Ga0207712_111249831 116
803 3300025981 Ga0207640_10132995 Ga0207640_101329952 116
804 3300026041 Ga0207639_10013447 Ga0207639_100134473 116
805 3300026067 Ga0207678_10705127 Ga0207678_107051272 116
806 3300026078 Ga0207702_10676833 Ga0207702_106768332 116
807 3300026116 Ga0207674_10694103 Ga0207674_106941031 116
808 3300026118 Ga0207675_100212568 Ga0207675_1002125682 116
809 3300027666 Ga0209282_1059004 Ga0209282_10590042 116
810 3300028379 Ga0268266_10112928 Ga0268266_101129283 116
811 3300028381 Ga0268264_10993032 Ga0268264_109930322 116
812 3300028786 Ga0307517_10006461 Ga0307517_100064617 116
813 3300029285 Ga0310981_1041595 Ga0310981_10415952 116
814 3300030500 Ga0268256_1087008 Ga0268256_10870081 116
815 3300030522 Ga0307512_10003420 Ga0307512_1000342014 116
816 3300031456 Ga0307513_10040582 Ga0307513_100405821 116
817 3300031507 Ga0307509_10283304 Ga0307509_102833041 116
818 3300031548 Ga0307408_102077793 Ga0307408_1020777931 116
819 3300031616 Ga0307508_10117044 Ga0307508_101170443 116
820 3300031616 Ga0307508_10209470 Ga0307508_102094702 116
821 3300031616 Ga0307508_10225626 Ga0307508_102256262 116
822 3300031730 Ga0307516_10069653 Ga0307516_100696533 116
823 3300031731 Ga0307405_10978194 Ga0307405_109781942 116
824 3300031852 Ga0307410_10034538 Ga0307410_100345384 116
825 3300031852 Ga0307410_11551088 Ga0307410_115510881 116
826 3300031995 Ga0307409_101229459 Ga0307409_1012294592 116
827 3300032002 Ga0307416_100405564 Ga0307416_1004055642 116
828 3300032002 Ga0307416_101177373 Ga0307416_1011773732 116
829 3300033179 Ga0307507_10050576 Ga0307507_100505763 116
830 3300035398 Ga0316574_0015038 Ga0316574_0015038_2424_2804 116
831 3300041406 Ga0439439_0107685 Ga0439439_0107685_88_468 116
832 3300041453 Ga0451797_1390623 Ga0451797_1390623_740_1090 116
833 3300041457 Ga0451803_04285 Ga0451803_04285_91_441 116
834 3300041491 Ga0451833_0338502 Ga0451833_0338502_134_484 116
835 3300041492 Ga0451835_1157284 Ga0451835_1157284_185_535 116
836 3300041494 Ga0451837_0109316 Ga0451837_0109316_649_999 116
837 3300041501 Ga0451845_0415626 Ga0451845_0415626_731_1081 116
838 3300041506 Ga0451850_36237 Ga0451850_36237_67_417 116
839 3300041907 Ga0452268_01162 Ga0452268_01162_94_444 116
840 3300041997 Ga0439431_0257699 Ga0439431_0257699_81_431 116
841 3300042004 Ga0439445_0027638 Ga0439445_0027638_49_429 116
842 3300042005 Ga0439448_0001321 Ga0439448_0001321_5283_5633 116
843 3300042008 Ga0439450_078273 Ga0439450_078273_231_581 116
844 3300042012 Ga0439455_0000697 Ga0439455_0000697_2707_3057 116
845 3300042014 Ga0439457_001462 Ga0439457_001462_6213_6563 116
846 3300042115 Ga0450911_036247 Ga0450911_036247_216_566 116
847 3300042131 Ga0450894_000097 Ga0450894_000097_8020_8370 116
848 3300042135 Ga0450899_001301 Ga0450899_001301_1900_2250 116
849 3300042136 Ga0450900_020528 Ga0450900_020528_438_812 116
850 3300042138 Ga0450903_000108 Ga0450903_000108_6651_7001 116
851 3300042145 Ga0450906_000741 Ga0450906_000741_2197_2547 116
852 3300042157 Ga0439458_0001252 Ga0439458_0001252_2344_2694 116
853 3300042184 Ga0450908_004744 Ga0450908_004744_2041_2391 116
854 3300044656 Ga0466969_0000702 Ga0466969_0000702_1314_1664 116
855 3300044656 Ga0466969_0003828 Ga0466969_0003828_3137_3487 116
856 3300044656 Ga0466969_0005495 Ga0466969_0005495_4099_4449 116
857 3300044658 Ga0466972_0002160 Ga0466972_0002160_8122_8472 116
858 3300044658 Ga0466972_0007644 Ga0466972_0007644_2294_2644 116
859 3300044658 Ga0466972_0240215 Ga0466972_0240215_59_409 116
860 3300044683 Ga0466965_0000386 Ga0466965_0000386_11123_11473 116
861 3300044684 Ga0466966_0001246 Ga0466966_0001246_4707_5057 116
862 3300044684 Ga0466966_0015896 Ga0466966_0015896_1615_1965 116
863 3300044693 Ga0466961_0002056 Ga0466961_0002056_7997_8347 116
864 3300044693 Ga0466961_0039678 Ga0466961_0039678_1080_1430 116
865 3300044693 Ga0466961_0236849 Ga0466961_0236849_755_1105 116
866 3300044693 Ga0466961_0364814 Ga0466961_0364814_12_362 116
867 3300044694 Ga0466963_0000197 Ga0466963_0000197_18408_18758 116
868 3300044694 Ga0466963_0020849 Ga0466963_0020849_3062_3412 116
869 3300044706 Ga0466964_0067739 Ga0466964_0067739_270_620 116
870 3300044719 Ga0466971_0000315 Ga0466971_0000315_16010_16360 116
871 3300044719 Ga0466971_0028463 Ga0466971_0028463_558_908 116
872 3300044719 Ga0466971_0146909 Ga0466971_0146909_665_1015 116
873 3300044765 Ga0466970_0000309 Ga0466970_0000309_13617_13967 116
874 3300044765 Ga0466970_0010660 Ga0466970_0010660_1897_2247 116
875 3300044842 Ga0466957_0002768 Ga0466957_0002768_4827_5177 116
876 3300044842 Ga0466957_0607325 Ga0466957_0607325_288_638 116
877 3300045049 Ga0466959_0001433 Ga0466959_0001433_9869_10219 116
878 3300045049 Ga0466959_0090817 Ga0466959_0090817_1722_2072 116
879 3300045049 Ga0466959_0317905 Ga0466959_0317905_438_788 116
880 3300045836 Ga0466958_0002057 Ga0466958_0002057_5059_5409 116
881 3300045836 Ga0466958_0234619 Ga0466958_0234619_72_422 116
882 3300045836 Ga0466958_0899937 Ga0466958_0899937_70_420 116
883 3300045976 Ga0466967_0026295 Ga0466967_0026295_1198_1548 116
884 3300045976 Ga0466967_0069564 Ga0466967_0069564_501_851 116
885 3300045976 Ga0466967_0194681 Ga0466967_0194681_12_362 116
886 3300046454 Ga0495592_0008402 Ga0495592_0008402_4186_4563 116
887 3300046455 Ga0495603_0002384 Ga0495603_0002384_10266_10643 116
888 3300046455 Ga0495603_0005417 Ga0495603_0005417_235_612 116
889 3300046455 Ga0495603_0164273 Ga0495603_0164273_88_498 116
890 3300046455 Ga0495603_0714975 Ga0495603_0714975_73_450 116
891 3300046459 Ga0495629_0003973 Ga0495629_0003973_8540_8917 116
892 3300046459 Ga0495629_0009899 Ga0495629_0009899_1381_1758 116
893 3300046459 Ga0495629_0010531 Ga0495629_0010531_4878_5255 116
894 3300046459 Ga0495629_0314225 Ga0495629_0314225_229_579 116
895 3300046460 Ga0495638_0187882 Ga0495638_0187882_118_468 116
896 3300046462 Ga0495651_0040275 Ga0495651_0040275_973_1350 116
897 3300046473 Ga0495582_0408510 Ga0495582_0408510_118_480 116
898 3300046476 Ga0495662_0603838 Ga0495662_0603838_83_460 116
899 3300046476 Ga0495662_0669106 Ga0495662_0669106_12_374 116
900 3300046477 Ga0495664_0070825 Ga0495664_0070825_1384_1761 116
901 3300046492 Ga0495585_0023490 Ga0495585_0023490_3078_3455 116
902 3300046499 Ga0495594_0010888 Ga0495594_0010888_2115_2492 116
903 3300046499 Ga0495594_0106141 Ga0495594_0106141_533_910 116
904 3300046499 Ga0495594_0130657 Ga0495594_0130657_816_1166 116
905 3300046514 Ga0495618_0158636 Ga0495618_0158636_76_453 116
906 3300046516 Ga0495628_0059390 Ga0495628_0059390_1390_1767 116
907 3300046517 Ga0495630_1116758 Ga0495630_1116758_95_457 116
908 3300046522 Ga0495643_0004276 Ga0495643_0004276_2868_3218 116
909 3300046529 Ga0495652_0500645 Ga0495652_0500645_98_475 116
910 3300046533 Ga0495640_0003660 Ga0495640_0003660_2658_3035 116
911 3300046557 Ga0495622_0043127 Ga0495622_0043127_104_481 116
912 3300046557 Ga0495622_0069186 Ga0495622_0069186_159_509 116
913 3300046557 Ga0495622_0094185 Ga0495622_0094185_535_885 116
914 3300046558 Ga0495633_0565983 Ga0495633_0565983_52_402 116
915 3300046559 Ga0495667_0244862 Ga0495667_0244862_746_1123 116
916 3300046642 Ga0495634_0143012 Ga0495634_0143012_1033_1410 116
917 3300046648 Ga0495611_0021321 Ga0495611_0021321_857_1234 116
918 3300046660 Ga0495625_0085695 Ga0495625_0085695_1204_1554 116
919 3300046674 Ga0495588_0007531 Ga0495588_0007531_1839_2216 116
920 3300046674 Ga0495588_0056176 Ga0495588_0056176_171_533 116
921 3300046675 Ga0495657_0004911 Ga0495657_0004911_1410_1787 116
922 3300046679 Ga0495623_0472937 Ga0495623_0472937_111_473 116
923 3300046683 Ga0495658_0015832 Ga0495658_0015832_104_454 116
924 3300046689 Ga0495613_0001297 Ga0495613_0001297_6750_7127 116
925 3300046689 Ga0495613_0010337 Ga0495613_0010337_5667_6044 116
926 3300046689 Ga0495613_0113088 Ga0495613_0113088_1212_1589 116
927 3300046690 Ga0495624_0136841 Ga0495624_0136841_775_1152 116
928 3300046691 Ga0495670_0008008 Ga0495670_0008008_4793_5143 116
929 3300046691 Ga0495670_0212517 Ga0495670_0212517_553_930 116
930 3300046692 Ga0495671_0273064 Ga0495671_0273064_372_722 116
931 3300046794 Ga0495589_0232165 Ga0495589_0232165_255_632 116
932 3300046809 Ga0495600_0029385 Ga0495600_0029385_2261_2638 116
933 3300046810 Ga0495660_0022537 Ga0495660_0022537_1799_2149 116
934 3300047315 Ga0495581_0042190 Ga0495581_0042190_13_390 116
935 3300047317 Ga0495604_0005332 Ga0495604_0005332_1890_2252 116
936 3300047317 Ga0495604_0040078 Ga0495604_0040078_2269_2646 116
937 3300047317 Ga0495604_0116521 Ga0495604_0116521_633_1043 116
938 3300047321 Ga0495676_0004096 Ga0495676_0004096_1570_1947 116
939 3300047321 Ga0495676_0005521 Ga0495676_0005521_8969_9346 116
940 3300047321 Ga0495676_0120101 Ga0495676_0120101_618_980 116
941 3300047323 Ga0495683_0281237 Ga0495683_0281237_292_669 116
942 3300047443 Ga0495687_009794 Ga0495687_009794_4273_4623 116
943 3300047444 Ga0495675_0002248 Ga0495675_0002248_9653_10015 116
944 3300047444 Ga0495675_0012460 Ga0495675_0012460_420_797 116
945 3300047444 Ga0495675_0148739 Ga0495675_0148739_981_1331 116
946 3300047446 Ga0495679_116154 Ga0495679_116154_337_687 116
947 3300047447 Ga0495685_010235 Ga0495685_010235_1891_2241 116
948 3300047447 Ga0495685_023335 Ga0495685_023335_735_1097 116
949 3300047469 Ga0495673_0185048 Ga0495673_0185048_271_648 116
950 3300047470 Ga0495681_0001356 Ga0495681_0001356_9803_10153 116
951 3300047673 Ga0495593_0190175 Ga0495593_0190175_75_425 116
952 3300048088 Ga0495602_0318202 Ga0495602_0318202_657_1034 116
953 3300048088 Ga0495602_1025220 Ga0495602_1025220_172_522 116
954 3300048089 Ga0495614_0000128 Ga0495614_0000128_9418_9795 116
955 3300048905 Ga0496102_1302104 Ga0496102_1302104_197_574 116
956 3300048905 Ga0496102_1746672 Ga0496102_1746672_53_424 116
957 3300048909 Ga0496106_0071319 Ga0496106_0071319_1268_1645 116
958 3300048929 Ga0496126_0092088 Ga0496126_0092088_1398_1757 116
959 3300049127 Ga0501306_002344 Ga0501306_002344_1384_1734 116
960 3300049127 Ga0501306_048812 Ga0501306_048812_221_571 116
961 3300049127 Ga0501306_093945 Ga0501306_093945_91_465 116
962 3300049128 Ga0501308_049542 Ga0501308_049542_171_521 116
963 3300049128 Ga0501308_050071 Ga0501308_050071_69_419 116
964 3300049128 Ga0501308_069693 Ga0501308_069693_97_447 116
965 3300049129 Ga0501309_004429 Ga0501309_004429_388_738 116
966 3300049129 Ga0501309_088084 Ga0501309_088084_68_418 116
967 3300049130 Ga0501310_037620 Ga0501310_037620_197_547 116
968 3300049130 Ga0501310_064137 Ga0501310_064137_87_464 116
969 3300049131 Ga0501341_16491 Ga0501341_16491_118_468 116
970 3300049161 Ga0501305_076545 Ga0501305_076545_154_504 116
971 3300049162 Ga0501307_047922 Ga0501307_047922_91_441 116
972 3300049162 Ga0501307_056132 Ga0501307_056132_135_485 116
973 3300049527 Ga0501311_060043 Ga0501311_060043_92_442 116
974 3300049527 Ga0501311_064537 Ga0501311_064537_179_556 116
975 3300049527 Ga0501311_094769 Ga0501311_094769_40_411 116
976 3300049528 Ga0501312_031431 Ga0501312_031431_388_738 116
977 3300049528 Ga0501312_091582 Ga0501312_091582_89_451 116
978 3300049529 Ga0501313_047613 Ga0501313_047613_146_496 116
979 3300049529 Ga0501313_065552 Ga0501313_065552_78_452 116
980 3300049530 Ga0501314_038247 Ga0501314_038247_109_459 116
981 3300049531 Ga0501315_055238 Ga0501315_055238_196_546 116
982 3300049531 Ga0501315_078598 Ga0501315_078598_91_441 116
983 3300049532 Ga0501316_024584 Ga0501316_024584_240_590 116
984 3300049532 Ga0501316_070175 Ga0501316_070175_67_444 116
985 3300049533 Ga0501317_033903 Ga0501317_033903_238_588 116
986 3300049533 Ga0501317_037960 Ga0501317_037960_283_633 116
987 3300049533 Ga0501317_068366 Ga0501317_068366_67_444 116
988 3300049534 Ga0501318_011984 Ga0501318_011984_290_640 116
989 3300049534 Ga0501318_023663 Ga0501318_023663_346_723 116
990 3300049534 Ga0501318_040620 Ga0501318_040620_197_547 116
991 3300049534 Ga0501318_075714 Ga0501318_075714_108_458 116
992 3300049535 Ga0501319_006849 Ga0501319_006849_68_445 116
993 3300049535 Ga0501319_007938 Ga0501319_007938_342_692 116
994 3300049535 Ga0501319_016168 Ga0501319_016168_190_564 116
995 3300049536 Ga0501320_012495 Ga0501320_012495_171_521 116
996 3300049536 Ga0501320_030467 Ga0501320_030467_228_602 116
997 3300049537 Ga0501321_007367 Ga0501321_007367_84_434 116
998 3300049537 Ga0501321_055598 Ga0501321_055598_67_417 116
999 3300049538 Ga0501322_023909 Ga0501322_023909_132_482 116
1000 3300049539 Ga0501323_000434 Ga0501323_000434_37_387 116
1001 3300049539 Ga0501323_001661 Ga0501323_001661_11_361 116
1002 3300049539 Ga0501323_082180 Ga0501323_082180_168_518 116
1003 3300049540 Ga0501324_001570 Ga0501324_001570_207_557 116
1004 3300049540 Ga0501324_021502 Ga0501324_021502_32_406 116
1005 3300049540 Ga0501324_027495 Ga0501324_027495_32_382 116
1006 3300049541 Ga0501325_025587 Ga0501325_025587_227_604 116
1007 3300049541 Ga0501325_025892 Ga0501325_025892_105_455 116
1008 3300049542 Ga0501326_10657 Ga0501326_10657_116_466 116
1009 3300049543 Ga0501327_14382 Ga0501327_14382_85_435 116
1010 3300049544 Ga0501328_08731 Ga0501328_08731_74_424 116
1011 3300049545 Ga0501329_11672 Ga0501329_11672_95_445 116
1012 3300049552 Ga0501336_019049 Ga0501336_019049_198_548 116
1013 3300049556 Ga0501340_018995 Ga0501340_018995_98_448 116
1014 3300049568 Ga0501031_0008502 Ga0501031_0008502_5204_5554 116
1015 3300049568 Ga0501031_0117254 Ga0501031_0117254_370_720 116
1016 3300049568 Ga0501031_0174279 Ga0501031_0174279_687_1037 116
1017 3300049568 Ga0501031_0242552 Ga0501031_0242552_377_727 116
1018 3300049569 Ga0501032_0000992 Ga0501032_0000992_76_426 116
1019 3300049569 Ga0501032_0022986 Ga0501032_0022986_2141_2491 116
1020 3300049569 Ga0501032_0047631 Ga0501032_0047631_830_1180 116
1021 3300049569 Ga0501032_0588156 Ga0501032_0588156_298_648 116
1022 3300049570 Ga0501033_0008908 Ga0501033_0008908_6952_7302 116
1023 3300049570 Ga0501033_0019275 Ga0501033_0019275_804_1154 116
1024 3300049570 Ga0501033_0048689 Ga0501033_0048689_643_993 116
1025 3300049570 Ga0501033_0112297 Ga0501033_0112297_1040_1390 116
1026 3300049571 Ga0501034_0001415 Ga0501034_0001415_30762_31112 116
1027 3300049571 Ga0501034_0022300 Ga0501034_0022300_4165_4515 116
1028 3300049571 Ga0501034_0038129 Ga0501034_0038129_3499_3849 116
1029 3300049571 Ga0501034_0098261 Ga0501034_0098261_1210_1560 116
1030 3300049571 Ga0501034_0180396 Ga0501034_0180396_129_506 116
1031 3300049571 Ga0501034_0632182 Ga0501034_0632182_262_612 116
1032 3300049572 Ga0501036_0003744 Ga0501036_0003744_6663_7013 116
1033 3300049572 Ga0501036_0024929 Ga0501036_0024929_3064_3414 116
1034 3300049572 Ga0501036_0197018 Ga0501036_0197018_323_673 116
1035 3300049573 Ga0501037_0021712 Ga0501037_0021712_1259_1609 116
1036 3300049573 Ga0501037_0023501 Ga0501037_0023501_3198_3548 116
1037 3300049573 Ga0501037_0031984 Ga0501037_0031984_486_875 116
1038 3300049574 Ga0501038_0004040 Ga0501038_0004040_7730_8080 116
1039 3300049574 Ga0501038_0010353 Ga0501038_0010353_1127_1477 116
1040 3300049574 Ga0501038_0017612 Ga0501038_0017612_1327_1677 116
1041 3300049574 Ga0501038_0086627 Ga0501038_0086627_570_947 116
1042 3300049574 Ga0501038_0120122 Ga0501038_0120122_425_775 116
1043 3300049574 Ga0501038_0132229 Ga0501038_0132229_1662_2012 116
1044 3300049575 Ga0501039_0017749 Ga0501039_0017749_1576_1926 116
1045 3300049575 Ga0501039_0046879 Ga0501039_0046879_1979_2329 116
1046 3300049576 Ga0501040_0026897 Ga0501040_0026897_323_673 116
1047 3300049577 Ga0501041_0005651 Ga0501041_0005651_4167_4517 116
1048 3300049578 Ga0501042_0045563 Ga0501042_0045563_2142_2531 116
1049 3300049578 Ga0501042_0075939 Ga0501042_0075939_76_426 116
1050 3300049579 Ga0501043_0029608 Ga0501043_0029608_2943_3293 116
1051 3300049579 Ga0501043_0067586 Ga0501043_0067586_2374_2724 116
1052 3300049579 Ga0501043_0119001 Ga0501043_0119001_1251_1601 116
1053 3300049579 Ga0501043_0173366 Ga0501043_0173366_1275_1625 116
1054 3300049580 Ga0501046_0012079 Ga0501046_0012079_1115_1465 116
1055 3300049580 Ga0501046_0071099 Ga0501046_0071099_1373_1759 116
1056 3300049580 Ga0501046_0117678 Ga0501046_0117678_743_1105 116
1057 3300049580 Ga0501046_0126295 Ga0501046_0126295_65_415 116
1058 3300049581 Ga0501047_0000029 Ga0501047_0000029_11238_11627 116
1059 3300049581 Ga0501047_0000826 Ga0501047_0000826_1011_1415 116
1060 3300049581 Ga0501047_0061360 Ga0501047_0061360_71_421 116
1061 3300049581 Ga0501047_0115868 Ga0501047_0115868_1054_1404 116
1062 3300049581 Ga0501047_0180078 Ga0501047_0180078_1615_1965 116
1063 3300049581 Ga0501047_0258430 Ga0501047_0258430_179_556 116
1064 3300049581 Ga0501047_0327202 Ga0501047_0327202_864_1214 116
1065 3300049581 Ga0501047_0338172 Ga0501047_0338172_870_1220 116
1066 3300049581 Ga0501047_0398005 Ga0501047_0398005_43_429 116
1067 3300049581 Ga0501047_0407405 Ga0501047_0407405_237_587 116
1068 3300049582 Ga0501048_0007462 Ga0501048_0007462_1011_1361 116
1069 3300049583 Ga0501067_0004401 Ga0501067_0004401_4624_4974 116
1070 3300049584 Ga0501068_0000050 Ga0501068_0000050_35296_35646 116
1071 3300049585 Ga0501069_0001601 Ga0501069_0001601_1337_1687 116
1072 3300049586 Ga0501070_0018409 Ga0501070_0018409_3883_4233 116
1073 3300049586 Ga0501070_0250874 Ga0501070_0250874_76_426 116
1074 3300049586 Ga0501070_0330824 Ga0501070_0330824_149_499 116
1075 3300049586 Ga0501070_0448206 Ga0501070_0448206_462_839 116
1076 3300049586 Ga0501070_0568376 Ga0501070_0568376_456_806 116
1077 3300049586 Ga0501070_1029908 Ga0501070_1029908_274_624 116
1078 3300049587 Ga0501071_0003321 Ga0501071_0003321_5654_6004 116
1079 3300049588 Ga0501072_0001327 Ga0501072_0001327_2981_3331 116
1080 3300049588 Ga0501072_0816766 Ga0501072_0816766_69_446 116
1081 3300049589 Ga0501073_0014076 Ga0501073_0014076_76_426 116
1082 3300049590 Ga0501074_0089493 Ga0501074_0089493_323_673 116
1083 3300049591 Ga0501075_0366247 Ga0501075_0366247_714_1064 116
1084 3300049592 Ga0501076_0020533 Ga0501076_0020533_1483_1833 116
1085 3300049593 Ga0501077_0016094 Ga0501077_0016094_3283_3633 116
1086 3300049652 Ga0501202_004992 Ga0501202_004992_98_448 116
1087 3300049661 Ga0501217_204226 Ga0501217_204226_234_584 116
1088 3300049668 Ga0501233_174932 Ga0501233_174932_157_519 116
1089 3300049684 Ga0501255_080427 Ga0501255_080427_129_479 116
1090 3300049741 Ga0501079_0026015 Ga0501079_0026015_3549_3899 116
1091 3300049742 Ga0501080_0125002 Ga0501080_0125002_1022_1372 116
1092 3300049743 Ga0501081_0479308 Ga0501081_0479308_129_479 116
1093 3300049744 Ga0501083_0055973 Ga0501083_0055973_1881_2231 116
1094 3300049822 Ga0501035_0003339 Ga0501035_0003339_14015_14365 116
1095 3300049822 Ga0501035_0046471 Ga0501035_0046471_1813_2163 116
1096 3300049822 Ga0501035_0082627 Ga0501035_0082627_661_1011 116
1097 3300049822 Ga0501035_0108671 Ga0501035_0108671_1028_1378 116
1098 3300049822 Ga0501035_0360751 Ga0501035_0360751_167_544 116
1099 3300049822 Ga0501035_0368951 Ga0501035_0368951_477_827 116
1100 3300049823 Ga0501044_0006353 Ga0501044_0006353_2341_2691 116
1101 3300049823 Ga0501044_0008682 Ga0501044_0008682_1011_1361 116
1102 3300049823 Ga0501044_0033956 Ga0501044_0033956_3182_3532 116
1103 3300049823 Ga0501044_0052380 Ga0501044_0052380_2415_2765 116
1104 3300049823 Ga0501044_0057740 Ga0501044_0057740_1890_2240 116
1105 3300049823 Ga0501044_0219353 Ga0501044_0219353_1451_1840 116
1106 3300049823 Ga0501044_1147674 Ga0501044_1147674_20_370 116
1107 3300049824 Ga0501045_0128892 Ga0501045_0128892_307_657 116
1108 3300049824 Ga0501045_0365333 Ga0501045_0365333_253_603 116
1109 3300049824 Ga0501045_0371387 Ga0501045_0371387_76_426 116
1110 3300049824 Ga0501045_0502670 Ga0501045_0502670_512_889 116
1111 3300050489 nmdc:mga03683_503981_c1 nmdc:mga03683_503981_c1_199_549 116
1112 3300050490 nmdc:mga03n38_182969_c1 nmdc:mga03n38_182969_c1_664_1014 116
1113 3300050494 nmdc:mga06z11_1569_c1 nmdc:mga06z11_1569_c1_1127_1477 116
1114 3300050495 nmdc:mga04h51_61093_c1 nmdc:mga04h51_61093_c1_910_1260 116
1115 3300050496 nmdc:mga07m45_282602_c1 nmdc:mga07m45_282602_c1_507_857 116
1116 3300050511 nmdc:mga08y16_1776517_c1 nmdc:mga08y16_1776517_c1_55_405 116
1117 3300053086 Ga0500578_0014126 Ga0500578_0014126_3411_3761 116
1118 3300053099 Ga0500654_008366 Ga0500654_008366_4256_4606 116
1119 3300053101 Ga0500553_125659 Ga0500553_125659_465_815 116
1120 3300053106 Ga0500558_132555 Ga0500558_132555_317_667 116
1121 3300053107 Ga0500560_025525 Ga0500560_025525_427_777 116
1122 3300053107 Ga0500560_136483 Ga0500560_136483_389_739 116
1123 3300053109 Ga0500569_004889 Ga0500569_004889_2487_2837 116
1124 3300053113 Ga0500580_203029 Ga0500580_203029_211_561 116
1125 3300053123 Ga0500614_076573 Ga0500614_076573_503_853 116
1126 3300053126 Ga0500621_121448 Ga0500621_121448_50_400 116
1127 3300053129 Ga0500628_004632 Ga0500628_004632_218_568 116
1128 3300053137 Ga0500561_0000783 Ga0500561_0000783_415_765 116
1129 3300053140 Ga0500573_0002621 Ga0500573_0002621_7139_7489 116
1130 3300053140 Ga0500573_0292054 Ga0500573_0292054_407_757 116
1131 3300053145 Ga0500586_254671 Ga0500586_254671_49_399 116
1132 3300053149 Ga0500600_0235850 Ga0500600_0235850_401_751 116
1133 3300053160 Ga0500633_0008690 Ga0500633_0008690_2017_2367 116
1134 3300053739 Ga0500587_009997 Ga0500587_009997_758_1108 116
1135 3300054114 Ga0501084_0018187 Ga0501084_0018187_5426_5776 116
1136 3300059492 Ga0587073_0200785 Ga0587073_0200785_48_398 116
1137 3300059492 Ga0587073_0257957 Ga0587073_0257957_115_465 116
1138 3300059503 Ga0587080_087681 Ga0587080_087681_230_580 116
1139 3300059503 Ga0587080_101174 Ga0587080_101174_119_469 116
1140 3300059504 Ga0587082_039895 Ga0587082_039895_392_742 116
1141 3300059505 Ga0587083_0144242 Ga0587083_0144242_221_571 116
1142 3300059506 Ga0587085_159863 Ga0587085_159863_124_483 116
1143 3300059510 Ga0587090_129224 Ga0587090_129224_119_469 116
1144 3300059605 Ga0587106_033627 Ga0587106_033627_91_441 116
1145 3300059608 Ga0587129_031918 Ga0587129_031918_42_392 116
1146 3300059627 Ga0587117_099500 Ga0587117_099500_84_434 116
1147 3300059630 Ga0587128_138908 Ga0587128_138908_96_455 116
1148 3300059639 Ga0587062_129071 Ga0587062_129071_104_454 116
1149 3300059644 Ga0587075_100706 Ga0587075_100706_162_512 116
1150 3300059645 Ga0587076_061984 Ga0587076_061984_62_412 116
1151 3300059649 Ga0587102_008941 Ga0587102_008941_141_491 116
1152 3300059651 Ga0587105_028109 Ga0587105_028109_112_462 116
1153 3300059659 Ga0587120_019907 Ga0587120_019907_199_549 116
1154 3300060344 Ga0587071_188374 Ga0587071_188374_67_444 116
1155 3300060353 Ga0501082_0205256 Ga0501082_0205256_1224_1574 116
1156 3300061719 Ga0466962_0004974 Ga0466962_0004974_4185_4535 116
1157 3300061719 Ga0466962_0032558 Ga0466962_0032558_1114_1464 116
1158 iso_pu_bacteria 3006321560 3006324775 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01245

Ribosomal_L19

Ribosomal protein L19

23

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e4v-assembly1.cif.gz_A crystal structure of mosquito staufen dsrna binding domain 4 0.8459 46 76
6sj6-assembly1.cif.gz_S cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.8376 2 100
3j7y-assembly1.cif.gz_Q structure of the large ribosomal subunit from human mitochondria 0.8324 2 89
7nsh-assembly1.cif.gz_BT 39s mammalian mitochondrial large ribosomal subunit with mtrrf (post) and mtefg2 0.8317 2 89
7nqh-assembly1.cif.gz_BT 55s mammalian mitochondrial ribosome with mtrf1a and p-site trnamet 0.8249 2 89
ID Description Score Start End Superfamily
af_Q9VRL8_239_320_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9102 46 75 3.30.160.20
af_P97473_17_105_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8732 47 75 3.30.160.20
af_A0A2R8Q731_63_142_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8431 47 74 3.30.160.20
af_Q9VHN6_73_196_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.776 2 89 2.30.30.790
af_P9WHC9_4_113_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7644 6 114 2.30.30.790
ID Description Score Start End GO Terms
AF-A0A1Q7S5A4-F1-model_v4 50S ribosomal protein L19 0.9753 3 90 GO:0003735
GO:0006412
GO:0022625
AF-A0A496TPK9-F1-model_v4 50S ribosomal protein L19 0.9688 5 87 GO:0003735
GO:0006412
GO:0022625
AF-A0A7X7G057-F1-model_v4 50S ribosomal protein L19 0.9633 2 90 GO:0003735
GO:0006412
GO:0022625
AF-A0A2V6KAW7-F1-model_v4 50S ribosomal protein L19 0.9564 1 90 GO:0003735
GO:0006412
GO:0022625
AF-A0A354LU83-F1-model_v4 deleted 0.9554 2 90

Feature Viewer

pLDDT pTM Quality
83.06 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map