F490970
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1158 | 624 | 1054 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300046455|Ga0495603_0164273|Ga0495603_0164273_88_498 |
| Length | 136 |
| Sequence | MTNHHVPSMTCGIGEEADTTMTNLIDGLNSASLRTDVPAFRPGDTINVHVRVIEGNRSRVQQFKGVVIRRQGAGISETFTVRKVSFSVGVERTFPVHTPIVEKIEVVTRGDVRRAKLYYLRELRGKAAKIKEKRDN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 3 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 4 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 5 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 8 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 9 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 10 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 11 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 12 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 13 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 14 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 15 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 16 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 17 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 18 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 19 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 20 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 21 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 22 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 23 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 24 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 25 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 26 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 27 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 28 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 29 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 30 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 31 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 32 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 33 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 34 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 35 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 36 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 37 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 38 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 39 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 40 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 41 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 42 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 43 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 44 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 45 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 46 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 47 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 48 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 49 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 50 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 51 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 52 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 53 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 54 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 55 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 56 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 57 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 58 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 59 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 60 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 61 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 62 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 63 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 64 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 65 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 66 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 67 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 68 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 69 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 70 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 71 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 72 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 73 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 74 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 75 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 76 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 77 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 78 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 79 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 80 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 81 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 82 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 83 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 84 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 85 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 86 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 87 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 88 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 89 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 90 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 91 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 92 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 93 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 94 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 95 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 96 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 97 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 98 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 99 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 101 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 107 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 109 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 113 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 115 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 124 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 136 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 137 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 138 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 142 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 146 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 148 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 149 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 150 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 152 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 153 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 154 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 155 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 156 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 157 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 158 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 159 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 160 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 161 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 162 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 163 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 164 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 166 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 167 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 168 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 169 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 170 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 171 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 172 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 173 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 174 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 176 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 177 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 178 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 179 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 180 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 181 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 182 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 183 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 185 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 186 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 202 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 203 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 214 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 218 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 219 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 220 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 221 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 223 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 224 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 225 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 226 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 227 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 228 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 229 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 230 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 231 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 233 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 234 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 235 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 236 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 293 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 294 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 298 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 299 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 300 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 301 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 302 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 303 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 304 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 305 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 306 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 307 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 308 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 309 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 310 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 311 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 312 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 313 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 314 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 315 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 316 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 317 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 318 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 319 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 320 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 321 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 322 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 323 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 324 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 325 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 326 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 327 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 328 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 329 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 330 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 331 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 332 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 333 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 334 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 335 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 336 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 337 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 338 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 339 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 340 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 342 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 343 | 3300041457 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT | Metatranscriptome | Rhizoplane |
| 344 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 345 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 346 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 347 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 348 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 349 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 350 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 351 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 352 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 353 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 354 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 355 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 356 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 357 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 358 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 359 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 360 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 361 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 362 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 363 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 364 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 365 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 366 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 367 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 368 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 369 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 370 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 371 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 372 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 373 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 374 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 375 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 376 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 377 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 378 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 379 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 380 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 381 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 382 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 383 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 384 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 385 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 386 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 387 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 443 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 444 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 445 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 446 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 447 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 448 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 451 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 452 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 453 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 454 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 455 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 456 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 457 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 458 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 459 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 460 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 461 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 469 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 517 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 518 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 519 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 520 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 521 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 522 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 527 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 531 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 532 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 533 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 534 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 535 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 536 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 537 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 538 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 539 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 547 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 549 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 550 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 551 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 552 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 553 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 554 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 555 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 556 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 557 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 558 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 559 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 560 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 561 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 562 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 563 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 564 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 565 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 566 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 567 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 568 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 569 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 579 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 580 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 581 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 582 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 586 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 594 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 595 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 596 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 597 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 598 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 599 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 600 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 601 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 602 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 603 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 605 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 606 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 607 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 608 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 609 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 610 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 611 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 612 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 613 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 614 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 615 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 616 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 617 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 618 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 619 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 620 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 621 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 622 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 623 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 624 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.2 |
| Metatranscriptomes | 13.82 |
| Isolates | 8.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.09 |
| Nodule | 0.6 |
| Rhizoplane | 4.49 |
| Rhizosphere | 82.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214637478 | 2209111006 | Bacteria | 517 |
| 2 | LJQas_1021931 | 3300000549 | Bacteria | 743 |
| 3 | JGI24741J21665_1048199 | 3300001915 | Bacteria | 627 |
| 4 | JGI24752J21851_1029606 | 3300001976 | Bacteria | 721 |
| 5 | JGI24739J22299_10068969 | 3300001989 | Bacteria | 1103 |
| 6 | JGI24737J22298_10026270 | 3300001990 | Bacteria | 1839 |
| 7 | JGI24735J21928_10195025 | 3300002067 | Bacteria | 587 |
| 8 | JGI24738J21930_10007820 | 3300002075 | Bacteria | 2453 |
| 9 | JGI24751J29686_10009512 | 3300002459 | Bacteria | 1999 |
| 10 | rootH1_10010292 | 3300003316 | Bacteria | 5690 |
| 11 | JGI25160J50197_1022002 | 3300003354 | Bacteria | 1878 |
| 12 | Ga0007417J51691_1030618 | 3300003544 | Bacteria | 506 |
| 13 | Ga0007429J51699_1022932 | 3300003579 | Bacteria | 506 |
| 14 | Ga0058692_1024712 | 3300003856 | Bacteria | 1202 |
| 15 | Ga0058861_11720119 | 3300004800 | Bacteria | 550 |
| 16 | Ga0058861_11903156 | 3300004800 | Bacteria | 609 |
| 17 | Ga0058860_11807479 | 3300004801 | Bacteria | 534 |
| 18 | Ga0058862_12532545 | 3300004803 | Bacteria | 654 |
| 19 | Ga0065714_10136409 | 3300005288 | Bacteria | 1205 |
| 20 | Ga0070658_10291940 | 3300005327 | Bacteria | 1389 |
| 21 | Ga0070658_10346223 | 3300005327 | Bacteria | 1272 |
| 22 | Ga0070658_10678137 | 3300005327 | Bacteria | 894 |
| 23 | Ga0070676_10376614 | 3300005328 | Bacteria | 982 |
| 24 | Ga0070683_100353724 | 3300005329 | Bacteria | 1399 |
| 25 | Ga0070690_100077167 | 3300005330 | Bacteria | 2174 |
| 26 | Ga0070690_100358820 | 3300005330 | Bacteria | 1060 |
| 27 | Ga0070670_100082464 | 3300005331 | Bacteria | 2763 |
| 28 | Ga0068869_100085233 | 3300005334 | Bacteria | 2366 |
| 29 | Ga0068869_100296181 | 3300005334 | Bacteria | 1305 |
| 30 | Ga0070666_10507200 | 3300005335 | Bacteria | 875 |
| 31 | Ga0070680_100011833 | 3300005336 | Bacteria | 6767 |
| 32 | Ga0070680_101837984 | 3300005336 | Bacteria | 525 |
| 33 | Ga0070682_100297170 | 3300005337 | Bacteria | 1183 |
| 34 | Ga0070682_100452592 | 3300005337 | Bacteria | 983 |
| 35 | Ga0070682_101231873 | 3300005337 | Bacteria | 633 |
| 36 | Ga0068868_100016532 | 3300005338 | Bacteria | 5482 |
| 37 | Ga0068868_100028070 | 3300005338 | Bacteria | 4298 |
| 38 | Ga0070660_100086092 | 3300005339 | Bacteria | 2472 |
| 39 | Ga0070689_100058921 | 3300005340 | Bacteria | 2983 |
| 40 | Ga0070689_100169184 | 3300005340 | Bacteria | 1770 |
| 41 | Ga0070691_10010771 | 3300005341 | Bacteria | 4172 |
| 42 | Ga0070687_100006409 | 3300005343 | Bacteria | 4820 |
| 43 | Ga0070687_100058468 | 3300005343 | Bacteria | 2026 |
| 44 | Ga0070692_10046971 | 3300005345 | Bacteria | 2233 |
| 45 | Ga0070669_100205901 | 3300005353 | Bacteria | 1550 |
| 46 | Ga0070675_100181570 | 3300005354 | Bacteria | 1819 |
| 47 | Ga0070675_100322909 | 3300005354 | Bacteria | 1364 |
| 48 | Ga0070671_100015635 | 3300005355 | Bacteria | 6132 |
| 49 | Ga0070671_100578447 | 3300005355 | Bacteria | 970 |
| 50 | Ga0070674_100459064 | 3300005356 | Bacteria | 1053 |
| 51 | Ga0070673_100042857 | 3300005364 | Bacteria | 3492 |
| 52 | Ga0070673_100959849 | 3300005364 | Bacteria | 794 |
| 53 | Ga0070688_100058109 | 3300005365 | Bacteria | 2434 |
| 54 | Ga0070688_100071869 | 3300005365 | Bacteria | 2216 |
| 55 | Ga0070659_100100673 | 3300005366 | Bacteria | 2325 |
| 56 | Ga0070659_100213297 | 3300005366 | Bacteria | 1591 |
| 57 | Ga0070659_100764322 | 3300005366 | Bacteria | 839 |
| 58 | Ga0070667_100017825 | 3300005367 | Bacteria | 5885 |
| 59 | Ga0070714_100000056 | 3300005435 | Bacteria | 103178 |
| 60 | Ga0070713_101221205 | 3300005436 | Bacteria | 728 |
| 61 | Ga0070701_10132059 | 3300005438 | Bacteria | 1420 |
| 62 | Ga0070711_101357374 | 3300005439 | Bacteria | 618 |
| 63 | Ga0070705_100173637 | 3300005440 | Bacteria | 1453 |
| 64 | Ga0070700_100000019 | 3300005441 | Bacteria | 137133 |
| 65 | Ga0070700_100104453 | 3300005441 | Bacteria | 1872 |
| 66 | Ga0070663_100049416 | 3300005455 | Bacteria | 2986 |
| 67 | Ga0070663_100879712 | 3300005455 | Bacteria | 773 |
| 68 | Ga0070678_100002824 | 3300005456 | Bacteria | 9599 |
| 69 | Ga0070678_100256100 | 3300005456 | Bacteria | 1470 |
| 70 | Ga0070662_100370810 | 3300005457 | Bacteria | 1176 |
| 71 | Ga0070681_10081618 | 3300005458 | Bacteria | 3189 |
| 72 | Ga0070681_11713629 | 3300005458 | Bacteria | 555 |
| 73 | Ga0068867_100001167 | 3300005459 | Bacteria | 17965 |
| 74 | Ga0070685_10062633 | 3300005466 | Bacteria | 2181 |
| 75 | Ga0070685_10219110 | 3300005466 | Bacteria | 1246 |
| 76 | Ga0070685_10247598 | 3300005466 | Bacteria | 1179 |
| 77 | Ga0070679_100204454 | 3300005530 | Bacteria | 1939 |
| 78 | Ga0070679_100551235 | 3300005530 | Bacteria | 1097 |
| 79 | Ga0070679_100592986 | 3300005530 | Bacteria | 1051 |
| 80 | Ga0070684_100117326 | 3300005535 | Bacteria | 2392 |
| 81 | Ga0070697_101858954 | 3300005536 | Bacteria | 539 |
| 82 | Ga0068853_100051137 | 3300005539 | Bacteria | 3556 |
| 83 | Ga0068853_100129928 | 3300005539 | Bacteria | 2254 |
| 84 | Ga0068853_100336077 | 3300005539 | Bacteria | 1403 |
| 85 | Ga0068853_100664384 | 3300005539 | Bacteria | 992 |
| 86 | Ga0070672_100197169 | 3300005543 | Bacteria | 1683 |
| 87 | Ga0070672_101547359 | 3300005543 | Bacteria | 594 |
| 88 | Ga0070693_100023343 | 3300005547 | Bacteria | 3305 |
| 89 | Ga0070665_100115915 | 3300005548 | Bacteria | 2682 |
| 90 | Ga0068855_100018553 | 3300005563 | Bacteria | 8365 |
| 91 | Ga0068855_100139154 | 3300005563 | Bacteria | 2769 |
| 92 | Ga0068855_100336619 | 3300005563 | Bacteria | 1665 |
| 93 | Ga0068855_100818276 | 3300005563 | Bacteria | 989 |
| 94 | Ga0068855_102247951 | 3300005563 | Bacteria | 547 |
| 95 | Ga0070664_100288265 | 3300005564 | Bacteria | 1482 |
| 96 | Ga0068857_101642883 | 3300005577 | Bacteria | 628 |
| 97 | Ga0068854_100120019 | 3300005578 | Bacteria | 1995 |
| 98 | Ga0068854_100125574 | 3300005578 | Bacteria | 1953 |
| 99 | Ga0068854_100172269 | 3300005578 | Bacteria | 1685 |
| 100 | Ga0068856_100028485 | 3300005614 | Bacteria | 5455 |
| 101 | Ga0068856_100038303 | 3300005614 | Bacteria | 4706 |
| 102 | Ga0068856_100709988 | 3300005614 | Bacteria | 1026 |
| 103 | Ga0068856_101145548 | 3300005614 | Bacteria | 795 |
| 104 | Ga0070702_100001056 | 3300005615 | Bacteria | 10979 |
| 105 | Ga0070702_100978694 | 3300005615 | Bacteria | 668 |
| 106 | Ga0068852_100078990 | 3300005616 | Bacteria | 2913 |
| 107 | Ga0068852_100475708 | 3300005616 | Bacteria | 1241 |
| 108 | Ga0068852_100687585 | 3300005616 | Bacteria | 1032 |
| 109 | Ga0068859_101108835 | 3300005617 | Bacteria | 870 |
| 110 | Ga0068864_100363921 | 3300005618 | Bacteria | 1367 |
| 111 | Ga0068864_100504153 | 3300005618 | Bacteria | 1165 |
| 112 | Ga0068866_10181172 | 3300005718 | Bacteria | 1244 |
| 113 | Ga0068861_100856007 | 3300005719 | Bacteria | 857 |
| 114 | Ga0068851_10021643 | 3300005834 | Bacteria | 3122 |
| 115 | Ga0068870_10001305 | 3300005840 | Bacteria | 10036 |
| 116 | Ga0068863_100096892 | 3300005841 | Bacteria | 2800 |
| 117 | Ga0068858_100270343 | 3300005842 | Bacteria | 1617 |
| 118 | Ga0068860_101673940 | 3300005843 | Bacteria | 658 |
| 119 | Ga0068860_101725611 | 3300005843 | Bacteria | 648 |
| 120 | Ga0068862_100230623 | 3300005844 | Bacteria | 1679 |
| 121 | Ga0081455_10000841 | 3300005937 | Bacteria | 39520 |
| 122 | Ga0081540_1027281 | 3300005983 | Bacteria | 3240 |
| 123 | Ga0070717_11276701 | 3300006028 | Bacteria | 668 |
| 124 | Ga0075365_10154977 | 3300006038 | Bacteria | 1594 |
| 125 | Ga0075365_10466118 | 3300006038 | Bacteria | 892 |
| 126 | Ga0075368_10236793 | 3300006042 | Bacteria | 778 |
| 127 | Ga0075363_100456622 | 3300006048 | Bacteria | 755 |
| 128 | Ga0075364_10258523 | 3300006051 | Bacteria | 1184 |
| 129 | Ga0075364_10313224 | 3300006051 | Bacteria | 1069 |
| 130 | Ga0070716_100930570 | 3300006173 | Bacteria | 683 |
| 131 | Ga0075362_10074798 | 3300006177 | Bacteria | 1553 |
| 132 | Ga0075362_10410166 | 3300006177 | Bacteria | 684 |
| 133 | Ga0075367_10065028 | 3300006178 | Bacteria | 2183 |
| 134 | Ga0075367_10316855 | 3300006178 | Bacteria | 983 |
| 135 | Ga0075367_10371127 | 3300006178 | Bacteria | 904 |
| 136 | Ga0075369_10110603 | 3300006186 | Bacteria | 1238 |
| 137 | Ga0075366_10184408 | 3300006195 | Bacteria | 1268 |
| 138 | Ga0097621_100140819 | 3300006237 | Bacteria | 2061 |
| 139 | Ga0075370_10114704 | 3300006353 | Bacteria | 1566 |
| 140 | Ga0075370_10297319 | 3300006353 | Bacteria | 960 |
| 141 | Ga0075370_10478030 | 3300006353 | Bacteria | 751 |
| 142 | Ga0068871_100023101 | 3300006358 | Bacteria | 4803 |
| 143 | Ga0075428_100924610 | 3300006844 | Bacteria | 925 |
| 144 | Ga0075428_102576154 | 3300006844 | Bacteria | 520 |
| 145 | Ga0075433_10012775 | 3300006852 | Bacteria | 6800 |
| 146 | Ga0075434_100057081 | 3300006871 | Bacteria | 3880 |
| 147 | Ga0075429_100244157 | 3300006880 | Bacteria | 1573 |
| 148 | Ga0068865_100079231 | 3300006881 | Bacteria | 2352 |
| 149 | Ga0075436_100123581 | 3300006914 | Bacteria | 1812 |
| 150 | Ga0097620_101108851 | 3300006931 | Bacteria | 870 |
| 151 | Ga0099826_10047403 | 3300006948 | Bacteria | 2920 |
| 152 | Ga0075435_100058876 | 3300007076 | Bacteria | 3113 |
| 153 | Ga0105251_10073292 | 3300009011 | Bacteria | 1591 |
| 154 | Ga0105244_10166265 | 3300009036 | Bacteria | 1051 |
| 155 | Ga0105240_10097773 | 3300009093 | Bacteria | 3576 |
| 156 | Ga0105240_10123599 | 3300009093 | Bacteria | 3113 |
| 157 | Ga0105240_10150035 | 3300009093 | Bacteria | 2777 |
| 158 | Ga0105240_10968712 | 3300009093 | Bacteria | 911 |
| 159 | Ga0105240_12361110 | 3300009093 | Bacteria | 551 |
| 160 | Ga0111539_10107040 | 3300009094 | Bacteria | 3281 |
| 161 | Ga0111539_11269307 | 3300009094 | Bacteria | 855 |
| 162 | Ga0105245_10129375 | 3300009098 | Bacteria | 2367 |
| 163 | Ga0105245_10141756 | 3300009098 | Bacteria | 2264 |
| 164 | Ga0114129_10244432 | 3300009147 | Bacteria | 2411 |
| 165 | Ga0114129_11687082 | 3300009147 | Bacteria | 773 |
| 166 | Ga0105243_10033945 | 3300009148 | Bacteria | 3947 |
| 167 | Ga0105243_10366479 | 3300009148 | Bacteria | 1328 |
| 168 | Ga0105243_10616657 | 3300009148 | Bacteria | 1047 |
| 169 | Ga0105241_10056976 | 3300009174 | Bacteria | 2997 |
| 170 | Ga0105241_11033088 | 3300009174 | Bacteria | 770 |
| 171 | Ga0105242_10031151 | 3300009176 | Bacteria | 4257 |
| 172 | Ga0105242_10531799 | 3300009176 | Bacteria | 1124 |
| 173 | Ga0105248_10049750 | 3300009177 | Bacteria | 4700 |
| 174 | Ga0105248_10241619 | 3300009177 | Bacteria | 2033 |
| 175 | Ga0105237_10024693 | 3300009545 | Bacteria | 6148 |
| 176 | Ga0105237_10541052 | 3300009545 | Bacteria | 1171 |
| 177 | Ga0105237_11217199 | 3300009545 | Bacteria | 760 |
| 178 | Ga0105237_12364879 | 3300009545 | Bacteria | 541 |
| 179 | Ga0105238_10288636 | 3300009551 | Bacteria | 1622 |
| 180 | Ga0105238_10291505 | 3300009551 | Bacteria | 1614 |
| 181 | Ga0105238_10757190 | 3300009551 | Bacteria | 985 |
| 182 | Ga0105238_10841709 | 3300009551 | Bacteria | 934 |
| 183 | Ga0105238_12620460 | 3300009551 | Bacteria | 540 |
| 184 | Ga0105249_10439601 | 3300009553 | Bacteria | 1341 |
| 185 | Ga0105239_10139390 | 3300010375 | Bacteria | 2702 |
| 186 | Ga0105239_10378821 | 3300010375 | Bacteria | 1600 |
| 187 | Ga0105239_10572903 | 3300010375 | Bacteria | 1287 |
| 188 | Ga0105239_10921052 | 3300010375 | Bacteria | 1003 |
| 189 | Ga0105239_11553082 | 3300010375 | Bacteria | 765 |
| 190 | Ga0105246_10090848 | 3300011119 | Bacteria | 2200 |
| 191 | Ga0105246_10137672 | 3300011119 | Bacteria | 1832 |
| 192 | Ga0157313_1011741 | 3300012503 | Bacteria | 766 |
| 193 | Ga0157327_1072430 | 3300012512 | Bacteria | 538 |
| 194 | Ga0154010_142966 | 3300013062 | Bacteria | 555 |
| 195 | Ga0157373_10916273 | 3300013100 | Bacteria | 651 |
| 196 | Ga0157371_10016630 | 3300013102 | Bacteria | 5483 |
| 197 | Ga0157370_10173785 | 3300013104 | Bacteria | 2002 |
| 198 | Ga0157370_11463455 | 3300013104 | Bacteria | 614 |
| 199 | Ga0157369_10068099 | 3300013105 | Bacteria | 3824 |
| 200 | Ga0157369_10620518 | 3300013105 | Bacteria | 1116 |
| 201 | Ga0157369_11344430 | 3300013105 | Bacteria | 728 |
| 202 | Ga0157374_10571546 | 3300013296 | Bacteria | 1139 |
| 203 | Ga0157374_11779034 | 3300013296 | Bacteria | 641 |
| 204 | Ga0157374_12297389 | 3300013296 | Bacteria | 566 |
| 205 | Ga0157378_10089571 | 3300013297 | Bacteria | 2795 |
| 206 | Ga0157378_11835622 | 3300013297 | Bacteria | 655 |
| 207 | Ga0163162_10184281 | 3300013306 | Bacteria | 2214 |
| 208 | Ga0163162_11726437 | 3300013306 | Bacteria | 715 |
| 209 | Ga0163162_12306768 | 3300013306 | Bacteria | 618 |
| 210 | Ga0157372_10072973 | 3300013307 | Bacteria | 3868 |
| 211 | Ga0157372_10154473 | 3300013307 | Bacteria | 2650 |
| 212 | Ga0157372_10846462 | 3300013307 | Bacteria | 1062 |
| 213 | Ga0157372_12488904 | 3300013307 | Bacteria | 594 |
| 214 | Ga0157375_10077436 | 3300013308 | Bacteria | 3355 |
| 215 | Ga0157375_10141200 | 3300013308 | Bacteria | 2536 |
| 216 | Ga0182008_10000192 | 3300014497 | Bacteria | 48269 |
| 217 | Ga0182008_10216701 | 3300014497 | Bacteria | 978 |
| 218 | Ga0157377_10111160 | 3300014745 | Bacteria | 1647 |
| 219 | Ga0157379_10023573 | 3300014968 | Bacteria | 5462 |
| 220 | Ga0157379_10037476 | 3300014968 | Bacteria | 4324 |
| 221 | Ga0157376_10863077 | 3300014969 | Bacteria | 921 |
| 222 | Ga0157376_11449097 | 3300014969 | Bacteria | 719 |
| 223 | Ga0182006_1008560 | 3300015261 | Bacteria | 4637 |
| 224 | Ga0182007_10000165 | 3300015262 | Bacteria | 45550 |
| 225 | Ga0182007_10198257 | 3300015262 | Bacteria | 701 |
| 226 | Ga0182005_1014651 | 3300015265 | Bacteria | 2193 |
| 227 | Ga0183367_1013 | 3300015688 | Bacteria | 334176 |
| 228 | Ga0163161_10820407 | 3300017792 | Bacteria | 783 |
| 229 | Ga0197907_10602326 | 3300020069 | Bacteria | 598 |
| 230 | Ga0197907_11126863 | 3300020069 | Bacteria | 813 |
| 231 | Ga0206356_10126309 | 3300020070 | Bacteria | 730 |
| 232 | Ga0206356_11196099 | 3300020070 | Bacteria | 532 |
| 233 | Ga0206356_11249890 | 3300020070 | Bacteria | 845 |
| 234 | Ga0206356_11271281 | 3300020070 | Bacteria | 3272 |
| 235 | Ga0206349_1321064 | 3300020075 | Bacteria | 570 |
| 236 | Ga0206355_1281966 | 3300020076 | Bacteria | 943 |
| 237 | Ga0206355_1292636 | 3300020076 | Bacteria | 642 |
| 238 | Ga0206355_1459015 | 3300020076 | Bacteria | 655 |
| 239 | Ga0206351_10048997 | 3300020077 | Bacteria | 1027 |
| 240 | Ga0206352_10052420 | 3300020078 | Bacteria | 679 |
| 241 | Ga0206352_10120208 | 3300020078 | Bacteria | 899 |
| 242 | Ga0206352_10966106 | 3300020078 | Bacteria | 607 |
| 243 | Ga0206352_10967525 | 3300020078 | Bacteria | 2388 |
| 244 | Ga0206350_10420881 | 3300020080 | Bacteria | 502 |
| 245 | Ga0206354_10046039 | 3300020081 | Bacteria | 593 |
| 246 | Ga0206354_10084735 | 3300020081 | Bacteria | 2769 |
| 247 | Ga0206354_10478325 | 3300020081 | Bacteria | 841 |
| 248 | Ga0206353_10124804 | 3300020082 | Bacteria | 2109 |
| 249 | Ga0206353_10148832 | 3300020082 | Bacteria | 1308 |
| 250 | Ga0206353_10229974 | 3300020082 | Bacteria | 8444 |
| 251 | Ga0206353_10644972 | 3300020082 | Bacteria | 729 |
| 252 | Ga0206353_10996184 | 3300020082 | Bacteria | 1396 |
| 253 | Ga0206353_11555357 | 3300020082 | Bacteria | 894 |
| 254 | Ga0206353_11600473 | 3300020082 | Bacteria | 836 |
| 255 | Ga0206353_12027566 | 3300020082 | Bacteria | 1276 |
| 256 | Ga0154015_1211593 | 3300020610 | Bacteria | 622 |
| 257 | Ga0213875_10006095 | 3300021388 | Bacteria | 6377 |
| 258 | Ga0213875_10055171 | 3300021388 | Bacteria | 1861 |
| 259 | Ga0224712_10071922 | 3300022467 | Bacteria | 1406 |
| 260 | Ga0224712_10237984 | 3300022467 | Bacteria | 838 |
| 261 | Ga0224712_10256245 | 3300022467 | Bacteria | 809 |
| 262 | Ga0224712_10669228 | 3300022467 | Bacteria | 510 |
| 263 | Ga0256743_110435 | 3300023436 | Bacteria | 560 |
| 264 | Ga0209759_1010174 | 3300025256 | Bacteria | 2777 |
| 265 | Ga0207666_1006476 | 3300025271 | Bacteria | 1521 |
| 266 | Ga0207426_1006048 | 3300025302 | Bacteria | 5346 |
| 267 | Ga0207426_1034672 | 3300025302 | Bacteria | 1618 |
| 268 | Ga0207697_10045334 | 3300025315 | Bacteria | 1810 |
| 269 | Ga0207656_10080193 | 3300025321 | Bacteria | 1465 |
| 270 | Ga0207713_1148810 | 3300025735 | Bacteria | 758 |
| 271 | Ga0207642_10078464 | 3300025899 | Bacteria | 1596 |
| 272 | Ga0207710_10195016 | 3300025900 | Bacteria | 998 |
| 273 | Ga0207688_10006789 | 3300025901 | Bacteria | 6228 |
| 274 | Ga0207688_10037503 | 3300025901 | Bacteria | 2688 |
| 275 | Ga0207680_10150777 | 3300025903 | Bacteria | 1550 |
| 276 | Ga0207647_10005464 | 3300025904 | Bacteria | 9312 |
| 277 | Ga0207647_10392352 | 3300025904 | Bacteria | 783 |
| 278 | Ga0207645_10043563 | 3300025907 | Bacteria | 2873 |
| 279 | Ga0207645_10339075 | 3300025907 | Bacteria | 1005 |
| 280 | Ga0207643_10012956 | 3300025908 | Bacteria | 4509 |
| 281 | Ga0207654_11031051 | 3300025911 | Bacteria | 599 |
| 282 | Ga0207695_10098040 | 3300025913 | Bacteria | 2931 |
| 283 | Ga0207695_10123739 | 3300025913 | Bacteria | 2551 |
| 284 | Ga0207695_10214520 | 3300025913 | Bacteria | 1834 |
| 285 | Ga0207671_10065836 | 3300025914 | Bacteria | 2696 |
| 286 | Ga0207671_10390977 | 3300025914 | Bacteria | 1105 |
| 287 | Ga0207671_10770275 | 3300025914 | Bacteria | 764 |
| 288 | Ga0207660_10124976 | 3300025917 | Bacteria | 1953 |
| 289 | Ga0207660_10199417 | 3300025917 | Bacteria | 1562 |
| 290 | Ga0207660_11054154 | 3300025917 | Bacteria | 663 |
| 291 | Ga0207662_10036297 | 3300025918 | Bacteria | 2880 |
| 292 | Ga0207662_10042916 | 3300025918 | Bacteria | 2667 |
| 293 | Ga0207657_10031777 | 3300025919 | Bacteria | 4776 |
| 294 | Ga0207657_10440527 | 3300025919 | Bacteria | 1023 |
| 295 | Ga0207649_10106206 | 3300025920 | Bacteria | 1867 |
| 296 | Ga0207652_10060892 | 3300025921 | Bacteria | 3258 |
| 297 | Ga0207681_10786564 | 3300025923 | Bacteria | 794 |
| 298 | Ga0207694_10234848 | 3300025924 | Bacteria | 1498 |
| 299 | Ga0207694_10819994 | 3300025924 | Bacteria | 786 |
| 300 | Ga0207650_10003481 | 3300025925 | Bacteria | 10818 |
| 301 | Ga0207659_10041151 | 3300025926 | Bacteria | 3235 |
| 302 | Ga0207659_10083792 | 3300025926 | Bacteria | 2364 |
| 303 | Ga0207664_10000074 | 3300025929 | Bacteria | 102862 |
| 304 | Ga0207644_10027943 | 3300025931 | Bacteria | 3900 |
| 305 | Ga0207644_10264749 | 3300025931 | Bacteria | 1376 |
| 306 | Ga0207690_10092924 | 3300025932 | Bacteria | 2136 |
| 307 | Ga0207690_10735476 | 3300025932 | Bacteria | 813 |
| 308 | Ga0207706_10059914 | 3300025933 | Bacteria | 3352 |
| 309 | Ga0207706_10500547 | 3300025933 | Bacteria | 1049 |
| 310 | Ga0207706_10612862 | 3300025933 | Bacteria | 934 |
| 311 | Ga0207686_10058976 | 3300025934 | Bacteria | 2423 |
| 312 | Ga0207686_10689665 | 3300025934 | Bacteria | 811 |
| 313 | Ga0207709_10148897 | 3300025935 | Bacteria | 1619 |
| 314 | Ga0207709_10171834 | 3300025935 | Bacteria | 1522 |
| 315 | Ga0207669_10052969 | 3300025937 | Bacteria | 2441 |
| 316 | Ga0207669_10707120 | 3300025937 | Bacteria | 829 |
| 317 | Ga0207704_10113671 | 3300025938 | Bacteria | 1836 |
| 318 | Ga0207704_10694822 | 3300025938 | Bacteria | 842 |
| 319 | Ga0207704_11090714 | 3300025938 | Bacteria | 678 |
| 320 | Ga0207665_10277014 | 3300025939 | Bacteria | 1247 |
| 321 | Ga0207691_10072212 | 3300025940 | Bacteria | 3113 |
| 322 | Ga0207691_10142987 | 3300025940 | Bacteria | 2107 |
| 323 | Ga0207711_10277548 | 3300025941 | Bacteria | 1543 |
| 324 | Ga0207711_10795102 | 3300025941 | Bacteria | 881 |
| 325 | Ga0207689_10008742 | 3300025942 | Bacteria | 8810 |
| 326 | Ga0207689_10738895 | 3300025942 | Bacteria | 830 |
| 327 | Ga0207689_11805296 | 3300025942 | Bacteria | 505 |
| 328 | Ga0207661_10074429 | 3300025944 | Bacteria | 2783 |
| 329 | Ga0207661_11153729 | 3300025944 | Bacteria | 713 |
| 330 | Ga0207679_10175991 | 3300025945 | Bacteria | 1766 |
| 331 | Ga0207679_11210917 | 3300025945 | Bacteria | 693 |
| 332 | Ga0207667_10008347 | 3300025949 | Bacteria | 12310 |
| 333 | Ga0207667_10961805 | 3300025949 | Bacteria | 843 |
| 334 | Ga0207651_10552710 | 3300025960 | Bacteria | 1001 |
| 335 | Ga0207712_10633744 | 3300025961 | Bacteria | 928 |
| 336 | Ga0207712_11124983 | 3300025961 | Bacteria | 699 |
| 337 | Ga0207640_10132995 | 3300025981 | Bacteria | 1801 |
| 338 | Ga0207640_10144304 | 3300025981 | Bacteria | 1740 |
| 339 | Ga0207658_10013733 | 3300025986 | Bacteria | 5540 |
| 340 | Ga0207658_11242081 | 3300025986 | Bacteria | 681 |
| 341 | Ga0207677_10015903 | 3300026023 | Bacteria | 4441 |
| 342 | Ga0207703_10065103 | 3300026035 | Bacteria | 2994 |
| 343 | Ga0207639_10013447 | 3300026041 | Bacteria | 5729 |
| 344 | Ga0207639_10089629 | 3300026041 | Bacteria | 2458 |
| 345 | Ga0207678_10032545 | 3300026067 | Bacteria | 4544 |
| 346 | Ga0207678_10305489 | 3300026067 | Bacteria | 1368 |
| 347 | Ga0207678_10705127 | 3300026067 | Bacteria | 888 |
| 348 | Ga0207708_10000038 | 3300026075 | Bacteria | 137212 |
| 349 | Ga0207708_10197219 | 3300026075 | Bacteria | 1605 |
| 350 | Ga0207708_10954537 | 3300026075 | Bacteria | 744 |
| 351 | Ga0207702_10016911 | 3300026078 | Bacteria | 6036 |
| 352 | Ga0207702_10061015 | 3300026078 | Bacteria | 3215 |
| 353 | Ga0207702_10429833 | 3300026078 | Bacteria | 1278 |
| 354 | Ga0207702_10676833 | 3300026078 | Bacteria | 1016 |
| 355 | Ga0207641_11353176 | 3300026088 | Bacteria | 713 |
| 356 | Ga0207648_10000791 | 3300026089 | Bacteria | 35650 |
| 357 | Ga0207648_10173261 | 3300026089 | Bacteria | 1908 |
| 358 | Ga0207676_10004681 | 3300026095 | Bacteria | 9690 |
| 359 | Ga0207676_11134984 | 3300026095 | Bacteria | 773 |
| 360 | Ga0207674_10074232 | 3300026116 | Bacteria | 3413 |
| 361 | Ga0207674_10485402 | 3300026116 | Bacteria | 1194 |
| 362 | Ga0207674_10694103 | 3300026116 | Bacteria | 983 |
| 363 | Ga0207675_100081690 | 3300026118 | Bacteria | 3031 |
| 364 | Ga0207675_100212568 | 3300026118 | Bacteria | 1861 |
| 365 | Ga0207683_10005295 | 3300026121 | Bacteria | 11063 |
| 366 | Ga0207683_10254946 | 3300026121 | Bacteria | 1601 |
| 367 | Ga0207698_10350739 | 3300026142 | Bacteria | 1394 |
| 368 | Ga0207698_10489059 | 3300026142 | Bacteria | 1195 |
| 369 | Ga0209282_1059004 | 3300027666 | Bacteria | 2148 |
| 370 | Ga0207428_10045123 | 3300027907 | Bacteria | 3553 |
| 371 | Ga0268266_10112928 | 3300028379 | Bacteria | 2409 |
| 372 | Ga0268266_12271432 | 3300028379 | Bacteria | 514 |
| 373 | Ga0268265_10983058 | 3300028380 | Bacteria | 833 |
| 374 | Ga0268264_10874725 | 3300028381 | Bacteria | 901 |
| 375 | Ga0268264_10993032 | 3300028381 | Bacteria | 846 |
| 376 | Ga0307517_10006461 | 3300028786 | Bacteria | 17343 |
| 377 | Ga0310981_1035178 | 3300029285 | Bacteria | 500 |
| 378 | Ga0310981_1041595 | 3300029285 | Bacteria | 598 |
| 379 | Ga0268256_1087008 | 3300030500 | Bacteria | 574 |
| 380 | Ga0307512_10003420 | 3300030522 | Bacteria | 18521 |
| 381 | Ga0265340_10019149 | 3300031247 | Bacteria | 3524 |
| 382 | Ga0307513_10001645 | 3300031456 | Bacteria | 32008 |
| 383 | Ga0307513_10040582 | 3300031456 | Bacteria | 5145 |
| 384 | Ga0307509_10283304 | 3300031507 | Bacteria | 1417 |
| 385 | Ga0307408_100068924 | 3300031548 | Bacteria | 2606 |
| 386 | Ga0307408_100646044 | 3300031548 | Bacteria | 945 |
| 387 | Ga0307408_102077793 | 3300031548 | Bacteria | 547 |
| 388 | Ga0307508_10117044 | 3300031616 | Bacteria | 2266 |
| 389 | Ga0307508_10209470 | 3300031616 | Bacteria | 1550 |
| 390 | Ga0307508_10225626 | 3300031616 | Bacteria | 1472 |
| 391 | Ga0316576_10053892 | 3300031727 | Bacteria | 2932 |
| 392 | Ga0316578_10229605 | 3300031728 | Bacteria | 1115 |
| 393 | Ga0307516_10069653 | 3300031730 | Bacteria | 3382 |
| 394 | Ga0307405_10347368 | 3300031731 | Bacteria | 1143 |
| 395 | Ga0307405_10978194 | 3300031731 | Bacteria | 721 |
| 396 | Ga0307405_11450362 | 3300031731 | Bacteria | 601 |
| 397 | Ga0307413_10094194 | 3300031824 | Bacteria | 1960 |
| 398 | Ga0307413_10115416 | 3300031824 | Bacteria | 1807 |
| 399 | Ga0307413_10168344 | 3300031824 | Bacteria | 1548 |
| 400 | Ga0307413_10564963 | 3300031824 | Bacteria | 925 |
| 401 | Ga0307410_10034538 | 3300031852 | Bacteria | 3276 |
| 402 | Ga0307410_10061170 | 3300031852 | Bacteria | 2576 |
| 403 | Ga0307410_10093844 | 3300031852 | Bacteria | 2136 |
| 404 | Ga0307410_10159586 | 3300031852 | Bacteria | 1688 |
| 405 | Ga0307410_10252713 | 3300031852 | Bacteria | 1371 |
| 406 | Ga0307410_10308428 | 3300031852 | Bacteria | 1251 |
| 407 | Ga0307410_10667714 | 3300031852 | Bacteria | 873 |
| 408 | Ga0307410_11551088 | 3300031852 | Bacteria | 584 |
| 409 | Ga0307410_11593889 | 3300031852 | Bacteria | 577 |
| 410 | Ga0307406_10046861 | 3300031901 | Bacteria | 2721 |
| 411 | Ga0307406_10054504 | 3300031901 | Bacteria | 2552 |
| 412 | Ga0307406_10166696 | 3300031901 | Bacteria | 1590 |
| 413 | Ga0307406_10252750 | 3300031901 | Bacteria | 1329 |
| 414 | Ga0307406_10446659 | 3300031901 | Bacteria | 1036 |
| 415 | Ga0307406_10461123 | 3300031901 | Bacteria | 1022 |
| 416 | Ga0307406_11042925 | 3300031901 | Bacteria | 703 |
| 417 | Ga0307407_10038070 | 3300031903 | Bacteria | 2662 |
| 418 | Ga0307407_10110765 | 3300031903 | Bacteria | 1722 |
| 419 | Ga0307407_10111440 | 3300031903 | Bacteria | 1718 |
| 420 | Ga0307407_10685600 | 3300031903 | Bacteria | 770 |
| 421 | Ga0307409_100021978 | 3300031995 | Bacteria | 4388 |
| 422 | Ga0307409_100030729 | 3300031995 | Bacteria | 3864 |
| 423 | Ga0307409_100113279 | 3300031995 | Bacteria | 2279 |
| 424 | Ga0307409_100144899 | 3300031995 | Bacteria | 2052 |
| 425 | Ga0307409_100233596 | 3300031995 | Bacteria | 1669 |
| 426 | Ga0307409_100470610 | 3300031995 | Bacteria | 1217 |
| 427 | Ga0307409_100555237 | 3300031995 | Bacteria | 1128 |
| 428 | Ga0307409_100560076 | 3300031995 | Bacteria | 1123 |
| 429 | Ga0307409_101229459 | 3300031995 | Bacteria | 773 |
| 430 | Ga0307409_101637708 | 3300031995 | Bacteria | 672 |
| 431 | Ga0307409_102107766 | 3300031995 | Bacteria | 593 |
| 432 | Ga0307416_100019059 | 3300032002 | Bacteria | 4854 |
| 433 | Ga0307416_100074220 | 3300032002 | Bacteria | 2840 |
| 434 | Ga0307416_100134924 | 3300032002 | Bacteria | 2230 |
| 435 | Ga0307416_100375603 | 3300032002 | Bacteria | 1449 |
| 436 | Ga0307416_100405564 | 3300032002 | Bacteria | 1402 |
| 437 | Ga0307416_100892800 | 3300032002 | Bacteria | 988 |
| 438 | Ga0307416_101177373 | 3300032002 | Bacteria | 872 |
| 439 | Ga0307416_103627619 | 3300032002 | Bacteria | 517 |
| 440 | Ga0307414_10132521 | 3300032004 | Bacteria | 1937 |
| 441 | Ga0307414_10255421 | 3300032004 | Bacteria | 1459 |
| 442 | Ga0307414_10744643 | 3300032004 | Bacteria | 890 |
| 443 | Ga0307411_10055052 | 3300032005 | Bacteria | 2616 |
| 444 | Ga0307415_100150557 | 3300032126 | Bacteria | 1790 |
| 445 | Ga0307415_100278278 | 3300032126 | Bacteria | 1374 |
| 446 | Ga0307415_100439606 | 3300032126 | Bacteria | 1124 |
| 447 | Ga0307415_100725307 | 3300032126 | Bacteria | 900 |
| 448 | Ga0307415_101406780 | 3300032126 | Bacteria | 664 |
| 449 | Ga0307415_101482482 | 3300032126 | Bacteria | 648 |
| 450 | Ga0307507_10050576 | 3300033179 | Bacteria | 4010 |
| 451 | Ga0373952_0150446 | 3300035092 | Bacteria | 653 |
| 452 | Ga0373936_0115679 | 3300035113 | Bacteria | 1142 |
| 453 | Ga0373939_0128482 | 3300035114 | Bacteria | 902 |
| 454 | Ga0373941_0025167 | 3300035115 | Bacteria | 1717 |
| 455 | Ga0373946_0364039 | 3300035171 | Bacteria | 725 |
| 456 | Ga0373962_0170854 | 3300035242 | Bacteria | 722 |
| 457 | Ga0316574_0015038 | 3300035398 | Bacteria | 4484 |
| 458 | Ga0316574_0639734 | 3300035398 | Bacteria | 655 |
| 459 | Ga0373931_0103926 | 3300035691 | Bacteria | 1602 |
| 460 | Ga0373931_0116383 | 3300035691 | Bacteria | 1523 |
| 461 | Ga0373927_0667869 | 3300035695 | Bacteria | 687 |
| 462 | Ga0373947_0708730 | 3300035725 | Bacteria | 687 |
| 463 | Ga0372808_059597 | 3300036459 | Bacteria | 548 |
| 464 | Ga0395899_0069827 | 3300037312 | Bacteria | 2572 |
| 465 | Ga0395900_0364943 | 3300037418 | Bacteria | 1415 |
| 466 | Ga0395900_0544908 | 3300037418 | Bacteria | 1105 |
| 467 | Ga0395900_1616007 | 3300037418 | Bacteria | 559 |
| 468 | Ga0395898_0055976 | 3300037466 | Bacteria | 3846 |
| 469 | Ga0395898_0197075 | 3300037466 | Bacteria | 1924 |
| 470 | Ga0395898_0977710 | 3300037466 | Bacteria | 783 |
| 471 | Ga0436364_0015698 | 3300037853 | Bacteria | 7166 |
| 472 | Ga0436364_1240818 | 3300037853 | Bacteria | 15337 |
| 473 | Ga0395901_0028124 | 3300038443 | Bacteria | 5783 |
| 474 | Ga0395901_1163335 | 3300038443 | Bacteria | 739 |
| 475 | Ga0436363_0419769 | 3300039450 | Bacteria | 699 |
| 476 | Ga0439439_0107685 | 3300041406 | Bacteria | 771 |
| 477 | Ga0451790_03754 | 3300041444 | Bacteria | 635 |
| 478 | Ga0451794_27686 | 3300041446 | Bacteria | 561 |
| 479 | Ga0451791_1298264 | 3300041451 | Bacteria | 1283 |
| 480 | Ga0451793_1234677 | 3300041452 | Bacteria | 2002 |
| 481 | Ga0451797_1390623 | 3300041453 | Bacteria | 1803 |
| 482 | Ga0451797_1536272 | 3300041453 | Bacteria | 2005 |
| 483 | Ga0451803_04285 | 3300041457 | Bacteria | 524 |
| 484 | Ga0451833_0338502 | 3300041491 | Bacteria | 743 |
| 485 | Ga0451835_1157284 | 3300041492 | Bacteria | 818 |
| 486 | Ga0451837_0109316 | 3300041494 | Bacteria | 5288 |
| 487 | Ga0451841_0812607 | 3300041498 | Bacteria | 4571 |
| 488 | Ga0451845_0415626 | 3300041501 | Bacteria | 1557 |
| 489 | Ga0451850_36237 | 3300041506 | Bacteria | 621 |
| 490 | Ga0451851_0858940 | 3300041507 | Bacteria | 605 |
| 491 | Ga0451843_1132984 | 3300041509 | Bacteria | 1511 |
| 492 | Ga0451853_2602983 | 3300041512 | Bacteria | 1953 |
| 493 | Ga0452268_01162 | 3300041907 | Bacteria | 508 |
| 494 | Ga0439431_0257699 | 3300041997 | Bacteria | 519 |
| 495 | Ga0439445_0027638 | 3300042004 | Bacteria | 1458 |
| 496 | Ga0439448_0001321 | 3300042005 | Bacteria | 6339 |
| 497 | Ga0439448_0017498 | 3300042005 | Bacteria | 2189 |
| 498 | Ga0439450_078273 | 3300042008 | Bacteria | 819 |
| 499 | Ga0439450_103098 | 3300042008 | Bacteria | 725 |
| 500 | Ga0439455_0000697 | 3300042012 | Bacteria | 4971 |
| 501 | Ga0439457_001462 | 3300042014 | Bacteria | 7085 |
| 502 | Ga0439457_026183 | 3300042014 | Bacteria | 1291 |
| 503 | Ga0439463_090544 | 3300042016 | Bacteria | 787 |
| 504 | Ga0439463_130461 | 3300042016 | Bacteria | 650 |
| 505 | Ga0450911_036247 | 3300042115 | Bacteria | 640 |
| 506 | Ga0450894_000097 | 3300042131 | Bacteria | 14494 |
| 507 | Ga0450899_001301 | 3300042135 | Bacteria | 2805 |
| 508 | Ga0450900_020528 | 3300042136 | Bacteria | 918 |
| 509 | Ga0450903_000108 | 3300042138 | Bacteria | 17669 |
| 510 | Ga0450906_000741 | 3300042145 | Bacteria | 7052 |
| 511 | Ga0439458_0001252 | 3300042157 | Bacteria | 6404 |
| 512 | Ga0439458_0080796 | 3300042157 | Bacteria | 829 |
| 513 | Ga0450908_004744 | 3300042184 | Bacteria | 2615 |
| 514 | Ga0439459_0002037 | 3300042438 | Bacteria | 3073 |
| 515 | Ga0439459_0226140 | 3300042438 | Bacteria | 520 |
| 516 | Ga0450901_024484 | 3300042533 | Bacteria | 655 |
| 517 | Ga0451577_1706676 | 3300042876 | Bacteria | 554 |
| 518 | Ga0466969_0000702 | 3300044656 | Bacteria | 18133 |
| 519 | Ga0466969_0003828 | 3300044656 | Bacteria | 7993 |
| 520 | Ga0466969_0005495 | 3300044656 | Bacteria | 6739 |
| 521 | Ga0466969_0446088 | 3300044656 | Bacteria | 589 |
| 522 | Ga0466969_0503516 | 3300044656 | Bacteria | 553 |
| 523 | Ga0466972_0002160 | 3300044658 | Bacteria | 9663 |
| 524 | Ga0466972_0007644 | 3300044658 | Bacteria | 5426 |
| 525 | Ga0466972_0113828 | 3300044658 | Bacteria | 1278 |
| 526 | Ga0466972_0172134 | 3300044658 | Bacteria | 1016 |
| 527 | Ga0466972_0240215 | 3300044658 | Bacteria | 847 |
| 528 | Ga0466972_0360972 | 3300044658 | Bacteria | 680 |
| 529 | Ga0466972_0446788 | 3300044658 | Bacteria | 607 |
| 530 | Ga0466965_0000386 | 3300044683 | Bacteria | 15106 |
| 531 | Ga0466965_0223347 | 3300044683 | Bacteria | 1004 |
| 532 | Ga0466966_0001246 | 3300044684 | Bacteria | 16313 |
| 533 | Ga0466966_0015896 | 3300044684 | Bacteria | 4974 |
| 534 | Ga0466966_0171150 | 3300044684 | Bacteria | 1320 |
| 535 | Ga0466966_0420282 | 3300044684 | Bacteria | 803 |
| 536 | Ga0466966_0440904 | 3300044684 | Bacteria | 783 |
| 537 | Ga0466966_0454419 | 3300044684 | Bacteria | 770 |
| 538 | Ga0466966_0525201 | 3300044684 | Bacteria | 712 |
| 539 | Ga0466966_0529490 | 3300044684 | Bacteria | 709 |
| 540 | Ga0466966_0981930 | 3300044684 | Bacteria | 509 |
| 541 | Ga0466961_0002056 | 3300044693 | Bacteria | 12531 |
| 542 | Ga0466961_0039678 | 3300044693 | Bacteria | 3018 |
| 543 | Ga0466961_0052078 | 3300044693 | Bacteria | 2612 |
| 544 | Ga0466961_0143827 | 3300044693 | Bacteria | 1492 |
| 545 | Ga0466961_0236849 | 3300044693 | Bacteria | 1122 |
| 546 | Ga0466961_0364814 | 3300044693 | Bacteria | 878 |
| 547 | Ga0466961_0430413 | 3300044693 | Bacteria | 799 |
| 548 | Ga0466961_0911935 | 3300044693 | Bacteria | 523 |
| 549 | Ga0466963_0000197 | 3300044694 | Bacteria | 25436 |
| 550 | Ga0466963_0014526 | 3300044694 | Bacteria | 4857 |
| 551 | Ga0466963_0020849 | 3300044694 | Bacteria | 4127 |
| 552 | Ga0466963_0028931 | 3300044694 | Bacteria | 3562 |
| 553 | Ga0466963_0098004 | 3300044694 | Bacteria | 2004 |
| 554 | Ga0466963_0181518 | 3300044694 | Bacteria | 1469 |
| 555 | Ga0466963_0228978 | 3300044694 | Bacteria | 1302 |
| 556 | Ga0466963_0398320 | 3300044694 | Bacteria | 971 |
| 557 | Ga0466963_0477357 | 3300044694 | Bacteria | 880 |
| 558 | Ga0466963_0854537 | 3300044694 | Bacteria | 641 |
| 559 | Ga0466964_0067739 | 3300044706 | Bacteria | 1501 |
| 560 | Ga0466964_0345727 | 3300044706 | Bacteria | 763 |
| 561 | Ga0466964_0472591 | 3300044706 | Bacteria | 669 |
| 562 | Ga0466964_0499535 | 3300044706 | Bacteria | 653 |
| 563 | Ga0466971_0000315 | 3300044719 | Bacteria | 18663 |
| 564 | Ga0466971_0011648 | 3300044719 | Bacteria | 3851 |
| 565 | Ga0466971_0028463 | 3300044719 | Bacteria | 2500 |
| 566 | Ga0466971_0063406 | 3300044719 | Bacteria | 1673 |
| 567 | Ga0466971_0146909 | 3300044719 | Bacteria | 1099 |
| 568 | Ga0466971_0305531 | 3300044719 | Bacteria | 764 |
| 569 | Ga0466971_0487446 | 3300044719 | Bacteria | 607 |
| 570 | Ga0466968_0373528 | 3300044735 | Bacteria | 696 |
| 571 | Ga0466968_0746118 | 3300044735 | Bacteria | 502 |
| 572 | Ga0466970_0000309 | 3300044765 | Bacteria | 23769 |
| 573 | Ga0466970_0010660 | 3300044765 | Bacteria | 4669 |
| 574 | Ga0466970_0025462 | 3300044765 | Bacteria | 3098 |
| 575 | Ga0466970_0064379 | 3300044765 | Bacteria | 1966 |
| 576 | Ga0466970_0143955 | 3300044765 | Bacteria | 1314 |
| 577 | Ga0466970_0460741 | 3300044765 | Bacteria | 729 |
| 578 | Ga0466970_0905803 | 3300044765 | Bacteria | 519 |
| 579 | Ga0466957_0002768 | 3300044842 | Bacteria | 9489 |
| 580 | Ga0466957_0044337 | 3300044842 | Bacteria | 2695 |
| 581 | Ga0466957_0074035 | 3300044842 | Bacteria | 2112 |
| 582 | Ga0466957_0091115 | 3300044842 | Bacteria | 1910 |
| 583 | Ga0466957_0109985 | 3300044842 | Bacteria | 1747 |
| 584 | Ga0466957_0145874 | 3300044842 | Bacteria | 1528 |
| 585 | Ga0466957_0247638 | 3300044842 | Bacteria | 1184 |
| 586 | Ga0466957_0288429 | 3300044842 | Bacteria | 1100 |
| 587 | Ga0466957_0607325 | 3300044842 | Bacteria | 766 |
| 588 | Ga0466957_0760955 | 3300044842 | Bacteria | 686 |
| 589 | Ga0466957_0801704 | 3300044842 | Bacteria | 669 |
| 590 | Ga0466960_0085719 | 3300044901 | Bacteria | 1596 |
| 591 | Ga0466960_0259110 | 3300044901 | Bacteria | 968 |
| 592 | Ga0466960_0332823 | 3300044901 | Bacteria | 862 |
| 593 | Ga0466960_0741557 | 3300044901 | Bacteria | 591 |
| 594 | Ga0466960_0778339 | 3300044901 | Bacteria | 578 |
| 595 | Ga0466959_0001433 | 3300045049 | Bacteria | 14589 |
| 596 | Ga0466959_0038875 | 3300045049 | Bacteria | 3516 |
| 597 | Ga0466959_0067574 | 3300045049 | Bacteria | 2591 |
| 598 | Ga0466959_0090817 | 3300045049 | Bacteria | 2193 |
| 599 | Ga0466959_0213082 | 3300045049 | Bacteria | 1342 |
| 600 | Ga0466959_0247785 | 3300045049 | Bacteria | 1229 |
| 601 | Ga0466959_0317905 | 3300045049 | Bacteria | 1064 |
| 602 | Ga0466959_0764431 | 3300045049 | Bacteria | 646 |
| 603 | Ga0466958_0002057 | 3300045836 | Bacteria | 9942 |
| 604 | Ga0466958_0012760 | 3300045836 | Bacteria | 4765 |
| 605 | Ga0466958_0056863 | 3300045836 | Bacteria | 2377 |
| 606 | Ga0466958_0079976 | 3300045836 | Bacteria | 2010 |
| 607 | Ga0466958_0234619 | 3300045836 | Bacteria | 1172 |
| 608 | Ga0466958_0345485 | 3300045836 | Bacteria | 957 |
| 609 | Ga0466958_0353209 | 3300045836 | Bacteria | 946 |
| 610 | Ga0466958_0899937 | 3300045836 | Bacteria | 577 |
| 611 | Ga0466967_0018985 | 3300045976 | Bacteria | 5516 |
| 612 | Ga0466967_0026295 | 3300045976 | Bacteria | 4818 |
| 613 | Ga0466967_0044355 | 3300045976 | Bacteria | 3857 |
| 614 | Ga0466967_0052834 | 3300045976 | Bacteria | 3569 |
| 615 | Ga0466967_0069564 | 3300045976 | Bacteria | 3146 |
| 616 | Ga0466967_0190583 | 3300045976 | Bacteria | 1937 |
| 617 | Ga0466967_0194681 | 3300045976 | Bacteria | 1917 |
| 618 | Ga0466967_0236855 | 3300045976 | Bacteria | 1740 |
| 619 | Ga0466967_0997036 | 3300045976 | Bacteria | 834 |
| 620 | Ga0495592_0008402 | 3300046454 | Bacteria | 7745 |
| 621 | Ga0495603_0002384 | 3300046455 | Bacteria | 11046 |
| 622 | Ga0495603_0005417 | 3300046455 | Bacteria | 7617 |
| 623 | Ga0495603_0164273 | 3300046455 | Bacteria | 1287 |
| 624 | Ga0495603_0714975 | 3300046455 | Bacteria | 573 |
| 625 | Ga0495629_0003973 | 3300046459 | Bacteria | 11119 |
| 626 | Ga0495629_0009899 | 3300046459 | Bacteria | 6958 |
| 627 | Ga0495629_0010531 | 3300046459 | Bacteria | 6727 |
| 628 | Ga0495629_0314225 | 3300046459 | Bacteria | 1071 |
| 629 | Ga0495638_0021586 | 3300046460 | Bacteria | 4241 |
| 630 | Ga0495638_0187882 | 3300046460 | Bacteria | 1174 |
| 631 | Ga0495651_0040275 | 3300046462 | Bacteria | 3634 |
| 632 | Ga0495582_0408510 | 3300046473 | Bacteria | 783 |
| 633 | Ga0495582_0712604 | 3300046473 | Bacteria | 581 |
| 634 | Ga0495662_0603838 | 3300046476 | Bacteria | 536 |
| 635 | Ga0495662_0669106 | 3300046476 | Bacteria | 507 |
| 636 | Ga0495664_0070825 | 3300046477 | Bacteria | 2082 |
| 637 | Ga0495585_0023490 | 3300046492 | Bacteria | 3538 |
| 638 | Ga0495594_0010888 | 3300046499 | Bacteria | 4723 |
| 639 | Ga0495594_0106141 | 3300046499 | Bacteria | 1582 |
| 640 | Ga0495594_0130657 | 3300046499 | Bacteria | 1422 |
| 641 | Ga0495594_0666022 | 3300046499 | Bacteria | 589 |
| 642 | Ga0495594_0814870 | 3300046499 | Bacteria | 526 |
| 643 | Ga0495596_0314237 | 3300046500 | Bacteria | 609 |
| 644 | Ga0495618_0158636 | 3300046514 | Bacteria | 1443 |
| 645 | Ga0495628_0059390 | 3300046516 | Bacteria | 3002 |
| 646 | Ga0495630_1116758 | 3300046517 | Bacteria | 597 |
| 647 | Ga0495643_0004276 | 3300046522 | Bacteria | 10076 |
| 648 | Ga0495652_0500645 | 3300046529 | Bacteria | 842 |
| 649 | Ga0495654_0311109 | 3300046530 | Bacteria | 641 |
| 650 | Ga0495640_0003660 | 3300046533 | Bacteria | 12354 |
| 651 | Ga0495640_0722461 | 3300046533 | Bacteria | 597 |
| 652 | Ga0495622_0043127 | 3300046557 | Bacteria | 2097 |
| 653 | Ga0495622_0069186 | 3300046557 | Bacteria | 1630 |
| 654 | Ga0495622_0094185 | 3300046557 | Bacteria | 1375 |
| 655 | Ga0495633_0565983 | 3300046558 | Bacteria | 511 |
| 656 | Ga0495667_0244862 | 3300046559 | Bacteria | 1141 |
| 657 | Ga0495656_0048916 | 3300046615 | Bacteria | 1799 |
| 658 | Ga0495634_0143012 | 3300046642 | Bacteria | 1517 |
| 659 | Ga0495611_0021321 | 3300046648 | Bacteria | 2798 |
| 660 | Ga0495611_0366612 | 3300046648 | Bacteria | 660 |
| 661 | Ga0495625_0085695 | 3300046660 | Bacteria | 2186 |
| 662 | Ga0495661_0193687 | 3300046665 | Bacteria | 1069 |
| 663 | Ga0495588_0007531 | 3300046674 | Bacteria | 4958 |
| 664 | Ga0495588_0056176 | 3300046674 | Bacteria | 2032 |
| 665 | Ga0495657_0004911 | 3300046675 | Bacteria | 10639 |
| 666 | Ga0495623_0472937 | 3300046679 | Bacteria | 664 |
| 667 | Ga0495658_0015832 | 3300046683 | Bacteria | 3875 |
| 668 | Ga0495613_0001297 | 3300046689 | Bacteria | 19104 |
| 669 | Ga0495613_0010337 | 3300046689 | Bacteria | 6932 |
| 670 | Ga0495613_0113088 | 3300046689 | Bacteria | 1955 |
| 671 | Ga0495624_0136841 | 3300046690 | Bacteria | 1501 |
| 672 | Ga0495670_0008008 | 3300046691 | Bacteria | 5194 |
| 673 | Ga0495670_0212517 | 3300046691 | Bacteria | 1026 |
| 674 | Ga0495670_0318576 | 3300046691 | Bacteria | 835 |
| 675 | Ga0495671_0273064 | 3300046692 | Bacteria | 815 |
| 676 | Ga0495589_0232165 | 3300046794 | Bacteria | 865 |
| 677 | Ga0495600_0029385 | 3300046809 | Bacteria | 3559 |
| 678 | Ga0495660_0022537 | 3300046810 | Bacteria | 3595 |
| 679 | Ga0495581_0042190 | 3300047315 | Bacteria | 2641 |
| 680 | Ga0495604_0005332 | 3300047317 | Bacteria | 10194 |
| 681 | Ga0495604_0040078 | 3300047317 | Bacteria | 3678 |
| 682 | Ga0495604_0116521 | 3300047317 | Bacteria | 1939 |
| 683 | Ga0495636_0228364 | 3300047318 | Bacteria | 856 |
| 684 | Ga0495674_1137700 | 3300047319 | Bacteria | 593 |
| 685 | Ga0495676_0004096 | 3300047321 | Bacteria | 13285 |
| 686 | Ga0495676_0005521 | 3300047321 | Bacteria | 11598 |
| 687 | Ga0495676_0120101 | 3300047321 | Bacteria | 1913 |
| 688 | Ga0495676_1078376 | 3300047321 | Bacteria | 511 |
| 689 | Ga0495683_0281237 | 3300047323 | Bacteria | 720 |
| 690 | Ga0495687_009794 | 3300047443 | Bacteria | 5322 |
| 691 | Ga0495675_0002248 | 3300047444 | Bacteria | 11535 |
| 692 | Ga0495675_0012460 | 3300047444 | Bacteria | 5353 |
| 693 | Ga0495675_0148739 | 3300047444 | Bacteria | 1448 |
| 694 | Ga0495679_116154 | 3300047446 | Bacteria | 734 |
| 695 | Ga0495685_010235 | 3300047447 | Bacteria | 3143 |
| 696 | Ga0495685_023335 | 3300047447 | Bacteria | 2130 |
| 697 | Ga0495673_0185048 | 3300047469 | Bacteria | 787 |
| 698 | Ga0495681_0001356 | 3300047470 | Bacteria | 18506 |
| 699 | Ga0495684_0859343 | 3300047471 | Bacteria | 588 |
| 700 | Ga0495593_0190175 | 3300047673 | Bacteria | 1033 |
| 701 | Ga0495593_0497878 | 3300047673 | Bacteria | 611 |
| 702 | Ga0495602_0318202 | 3300048088 | Bacteria | 1133 |
| 703 | Ga0495602_1025220 | 3300048088 | Bacteria | 544 |
| 704 | Ga0495614_0000128 | 3300048089 | Bacteria | 26462 |
| 705 | Ga0496100_0027222 | 3300048903 | Bacteria | 3514 |
| 706 | Ga0496100_0693152 | 3300048903 | Bacteria | 795 |
| 707 | Ga0496100_1240605 | 3300048903 | Bacteria | 588 |
| 708 | Ga0496101_0019706 | 3300048904 | Bacteria | 4610 |
| 709 | Ga0496101_0074802 | 3300048904 | Bacteria | 2492 |
| 710 | Ga0496101_0906214 | 3300048904 | Bacteria | 694 |
| 711 | Ga0496102_0010594 | 3300048905 | Bacteria | 7942 |
| 712 | Ga0496102_0029226 | 3300048905 | Bacteria | 4931 |
| 713 | Ga0496102_0057858 | 3300048905 | Bacteria | 3541 |
| 714 | Ga0496102_0062378 | 3300048905 | Bacteria | 3413 |
| 715 | Ga0496102_0831254 | 3300048905 | Bacteria | 846 |
| 716 | Ga0496102_1302104 | 3300048905 | Bacteria | 646 |
| 717 | Ga0496102_1746672 | 3300048905 | Bacteria | 540 |
| 718 | Ga0496103_0025995 | 3300048906 | Bacteria | 3541 |
| 719 | Ga0496103_0071303 | 3300048906 | Bacteria | 2174 |
| 720 | Ga0496103_0254815 | 3300048906 | Bacteria | 1129 |
| 721 | Ga0496103_0962290 | 3300048906 | Bacteria | 533 |
| 722 | Ga0496104_0014881 | 3300048907 | Bacteria | 7032 |
| 723 | Ga0496104_0239789 | 3300048907 | Bacteria | 1725 |
| 724 | Ga0496105_0002556 | 3300048908 | Bacteria | 13206 |
| 725 | Ga0496105_0026209 | 3300048908 | Bacteria | 4753 |
| 726 | Ga0496105_0825230 | 3300048908 | Bacteria | 703 |
| 727 | Ga0496106_0027625 | 3300048909 | Bacteria | 4227 |
| 728 | Ga0496106_0071319 | 3300048909 | Bacteria | 2655 |
| 729 | Ga0496106_0179373 | 3300048909 | Bacteria | 1681 |
| 730 | Ga0496107_0045567 | 3300048910 | Bacteria | 3155 |
| 731 | Ga0496107_0081284 | 3300048910 | Bacteria | 2363 |
| 732 | Ga0496107_1355052 | 3300048910 | Bacteria | 508 |
| 733 | Ga0496108_0110189 | 3300048911 | Bacteria | 2353 |
| 734 | Ga0496108_0508321 | 3300048911 | Bacteria | 1052 |
| 735 | Ga0496109_0129313 | 3300048912 | Bacteria | 2356 |
| 736 | Ga0496109_0628631 | 3300048912 | Bacteria | 1010 |
| 737 | Ga0496110_0010215 | 3300048913 | Bacteria | 7628 |
| 738 | Ga0496110_0055620 | 3300048913 | Bacteria | 3482 |
| 739 | Ga0496111_0020293 | 3300048914 | Bacteria | 4624 |
| 740 | Ga0496111_0192641 | 3300048914 | Bacteria | 1515 |
| 741 | Ga0496112_0043364 | 3300048915 | Bacteria | 4404 |
| 742 | Ga0496112_1099633 | 3300048915 | Bacteria | 713 |
| 743 | Ga0496112_1470125 | 3300048915 | Bacteria | 595 |
| 744 | Ga0496113_0464820 | 3300048916 | Bacteria | 1016 |
| 745 | Ga0496113_0749279 | 3300048916 | Bacteria | 778 |
| 746 | Ga0496113_0867380 | 3300048916 | Bacteria | 715 |
| 747 | Ga0496114_0015303 | 3300048917 | Bacteria | 6167 |
| 748 | Ga0496114_0596319 | 3300048917 | Bacteria | 974 |
| 749 | Ga0496116_0000665 | 3300048919 | Bacteria | 44795 |
| 750 | Ga0496117_0087380 | 3300048920 | Bacteria | 2021 |
| 751 | Ga0496118_0000900 | 3300048921 | Bacteria | 46556 |
| 752 | Ga0496119_0005788 | 3300048922 | Bacteria | 11702 |
| 753 | Ga0496119_0478656 | 3300048922 | Bacteria | 582 |
| 754 | Ga0496121_0107424 | 3300048924 | Bacteria | 2137 |
| 755 | Ga0496121_0132116 | 3300048924 | Bacteria | 1866 |
| 756 | Ga0496126_0092088 | 3300048929 | Bacteria | 2664 |
| 757 | Ga0501306_002344 | 3300049127 | Bacteria | 1930 |
| 758 | Ga0501306_048812 | 3300049127 | Bacteria | 674 |
| 759 | Ga0501306_093945 | 3300049127 | Bacteria | 530 |
| 760 | Ga0501306_108022 | 3300049127 | Bacteria | 503 |
| 761 | Ga0501308_049542 | 3300049128 | Bacteria | 612 |
| 762 | Ga0501308_050071 | 3300049128 | Bacteria | 609 |
| 763 | Ga0501308_068801 | 3300049128 | Bacteria | 547 |
| 764 | Ga0501308_069693 | 3300049128 | Bacteria | 544 |
| 765 | Ga0501308_077349 | 3300049128 | Bacteria | 525 |
| 766 | Ga0501309_004429 | 3300049129 | Bacteria | 1637 |
| 767 | Ga0501309_051092 | 3300049129 | Bacteria | 649 |
| 768 | Ga0501309_088084 | 3300049129 | Bacteria | 527 |
| 769 | Ga0501310_037620 | 3300049130 | Bacteria | 664 |
| 770 | Ga0501310_064137 | 3300049130 | Bacteria | 553 |
| 771 | Ga0501341_16491 | 3300049131 | Bacteria | 525 |
| 772 | Ga0501305_069521 | 3300049161 | Bacteria | 617 |
| 773 | Ga0501305_076545 | 3300049161 | Bacteria | 595 |
| 774 | Ga0501307_047922 | 3300049162 | Bacteria | 636 |
| 775 | Ga0501307_056132 | 3300049162 | Bacteria | 602 |
| 776 | Ga0501299_112720 | 3300049522 | Bacteria | 646 |
| 777 | Ga0501311_060043 | 3300049527 | Bacteria | 613 |
| 778 | Ga0501311_064537 | 3300049527 | Bacteria | 597 |
| 779 | Ga0501311_094769 | 3300049527 | Bacteria | 522 |
| 780 | Ga0501312_031431 | 3300049528 | Bacteria | 834 |
| 781 | Ga0501312_091582 | 3300049528 | Bacteria | 561 |
| 782 | Ga0501313_047613 | 3300049529 | Bacteria | 587 |
| 783 | Ga0501313_065552 | 3300049529 | Bacteria | 520 |
| 784 | Ga0501314_038247 | 3300049530 | Bacteria | 553 |
| 785 | Ga0501315_055238 | 3300049531 | Bacteria | 632 |
| 786 | Ga0501315_078598 | 3300049531 | Bacteria | 557 |
| 787 | Ga0501316_024584 | 3300049532 | Bacteria | 779 |
| 788 | Ga0501316_070175 | 3300049532 | Bacteria | 530 |
| 789 | Ga0501317_033903 | 3300049533 | Bacteria | 754 |
| 790 | Ga0501317_037960 | 3300049533 | Bacteria | 725 |
| 791 | Ga0501317_068366 | 3300049533 | Bacteria | 595 |
| 792 | Ga0501318_011984 | 3300049534 | Bacteria | 987 |
| 793 | Ga0501318_013508 | 3300049534 | Bacteria | 951 |
| 794 | Ga0501318_023663 | 3300049534 | Bacteria | 795 |
| 795 | Ga0501318_034880 | 3300049534 | Bacteria | 699 |
| 796 | Ga0501318_040620 | 3300049534 | Bacteria | 664 |
| 797 | Ga0501318_075714 | 3300049534 | Bacteria | 538 |
| 798 | Ga0501319_006849 | 3300049535 | Bacteria | 851 |
| 799 | Ga0501319_007938 | 3300049535 | Bacteria | 809 |
| 800 | Ga0501319_016168 | 3300049535 | Bacteria | 639 |
| 801 | Ga0501320_012495 | 3300049536 | Bacteria | 894 |
| 802 | Ga0501320_030467 | 3300049536 | Bacteria | 669 |
| 803 | Ga0501321_007367 | 3300049537 | Bacteria | 1141 |
| 804 | Ga0501321_030912 | 3300049537 | Bacteria | 715 |
| 805 | Ga0501321_055598 | 3300049537 | Bacteria | 588 |
| 806 | Ga0501321_085692 | 3300049537 | Bacteria | 508 |
| 807 | Ga0501322_023909 | 3300049538 | Bacteria | 550 |
| 808 | Ga0501323_000434 | 3300049539 | Bacteria | 3076 |
| 809 | Ga0501323_001661 | 3300049539 | Bacteria | 2030 |
| 810 | Ga0501323_082180 | 3300049539 | Bacteria | 528 |
| 811 | Ga0501324_001570 | 3300049540 | Bacteria | 1545 |
| 812 | Ga0501324_021226 | 3300049540 | Bacteria | 665 |
| 813 | Ga0501324_021502 | 3300049540 | Bacteria | 662 |
| 814 | Ga0501324_027495 | 3300049540 | Bacteria | 608 |
| 815 | Ga0501325_025587 | 3300049541 | Bacteria | 649 |
| 816 | Ga0501325_025892 | 3300049541 | Bacteria | 646 |
| 817 | Ga0501326_10657 | 3300049542 | Bacteria | 553 |
| 818 | Ga0501327_14382 | 3300049543 | Bacteria | 553 |
| 819 | Ga0501328_08731 | 3300049544 | Bacteria | 555 |
| 820 | Ga0501329_11672 | 3300049545 | Bacteria | 562 |
| 821 | Ga0501336_019049 | 3300049552 | Bacteria | 613 |
| 822 | Ga0501340_018995 | 3300049556 | Bacteria | 565 |
| 823 | Ga0501031_0008502 | 3300049568 | Bacteria | 6680 |
| 824 | Ga0501031_0117254 | 3300049568 | Bacteria | 1739 |
| 825 | Ga0501031_0174279 | 3300049568 | Bacteria | 1405 |
| 826 | Ga0501031_0242552 | 3300049568 | Bacteria | 1171 |
| 827 | Ga0501032_0000992 | 3300049569 | Bacteria | 22851 |
| 828 | Ga0501032_0022986 | 3300049569 | Bacteria | 4316 |
| 829 | Ga0501032_0047631 | 3300049569 | Bacteria | 2894 |
| 830 | Ga0501032_0588156 | 3300049569 | Bacteria | 708 |
| 831 | Ga0501033_0001361 | 3300049570 | Bacteria | 21789 |
| 832 | Ga0501033_0008908 | 3300049570 | Bacteria | 7752 |
| 833 | Ga0501033_0019275 | 3300049570 | Bacteria | 5155 |
| 834 | Ga0501033_0048689 | 3300049570 | Bacteria | 3147 |
| 835 | Ga0501033_0112297 | 3300049570 | Bacteria | 1982 |
| 836 | Ga0501033_0414052 | 3300049570 | Bacteria | 939 |
| 837 | Ga0501034_0001415 | 3300049571 | Bacteria | 32122 |
| 838 | Ga0501034_0022300 | 3300049571 | Bacteria | 6454 |
| 839 | Ga0501034_0038129 | 3300049571 | Bacteria | 4867 |
| 840 | Ga0501034_0098261 | 3300049571 | Bacteria | 2923 |
| 841 | Ga0501034_0180396 | 3300049571 | Bacteria | 2076 |
| 842 | Ga0501034_0219254 | 3300049571 | Bacteria | 1855 |
| 843 | Ga0501034_0552434 | 3300049571 | Bacteria | 1061 |
| 844 | Ga0501034_0632182 | 3300049571 | Bacteria | 973 |
| 845 | Ga0501036_0003744 | 3300049572 | Bacteria | 12185 |
| 846 | Ga0501036_0024929 | 3300049572 | Bacteria | 5044 |
| 847 | Ga0501036_0080987 | 3300049572 | Bacteria | 2744 |
| 848 | Ga0501036_0197018 | 3300049572 | Bacteria | 1694 |
| 849 | Ga0501036_1681471 | 3300049572 | Bacteria | 512 |
| 850 | Ga0501037_0021712 | 3300049573 | Bacteria | 4748 |
| 851 | Ga0501037_0023501 | 3300049573 | Bacteria | 4558 |
| 852 | Ga0501037_0031984 | 3300049573 | Bacteria | 3884 |
| 853 | Ga0501037_0610816 | 3300049573 | Bacteria | 732 |
| 854 | Ga0501038_0004040 | 3300049574 | Bacteria | 13633 |
| 855 | Ga0501038_0010353 | 3300049574 | Bacteria | 8532 |
| 856 | Ga0501038_0017612 | 3300049574 | Bacteria | 6455 |
| 857 | Ga0501038_0086627 | 3300049574 | Bacteria | 2631 |
| 858 | Ga0501038_0120122 | 3300049574 | Bacteria | 2168 |
| 859 | Ga0501038_0132229 | 3300049574 | Bacteria | 2047 |
| 860 | Ga0501038_0402854 | 3300049574 | Bacteria | 1058 |
| 861 | Ga0501038_0780973 | 3300049574 | Bacteria | 711 |
| 862 | Ga0501039_0017749 | 3300049575 | Bacteria | 5459 |
| 863 | Ga0501039_0046879 | 3300049575 | Bacteria | 3339 |
| 864 | Ga0501039_0731267 | 3300049575 | Bacteria | 773 |
| 865 | Ga0501040_0026897 | 3300049576 | Bacteria | 3870 |
| 866 | Ga0501040_0549096 | 3300049576 | Bacteria | 834 |
| 867 | Ga0501041_0005651 | 3300049577 | Bacteria | 7307 |
| 868 | Ga0501041_0461445 | 3300049577 | Bacteria | 807 |
| 869 | Ga0501041_1113318 | 3300049577 | Bacteria | 509 |
| 870 | Ga0501042_0045563 | 3300049578 | Bacteria | 3126 |
| 871 | Ga0501042_0075939 | 3300049578 | Bacteria | 2404 |
| 872 | Ga0501043_0029608 | 3300049579 | Bacteria | 4303 |
| 873 | Ga0501043_0067586 | 3300049579 | Bacteria | 2806 |
| 874 | Ga0501043_0119001 | 3300049579 | Bacteria | 2071 |
| 875 | Ga0501043_0173366 | 3300049579 | Bacteria | 1682 |
| 876 | Ga0501043_0844207 | 3300049579 | Bacteria | 660 |
| 877 | Ga0501046_0012079 | 3300049580 | Bacteria | 7363 |
| 878 | Ga0501046_0071099 | 3300049580 | Bacteria | 2704 |
| 879 | Ga0501046_0117678 | 3300049580 | Bacteria | 2024 |
| 880 | Ga0501046_0126295 | 3300049580 | Bacteria | 1943 |
| 881 | Ga0501047_0000029 | 3300049581 | Bacteria | 218396 |
| 882 | Ga0501047_0000826 | 3300049581 | Bacteria | 32127 |
| 883 | Ga0501047_0061360 | 3300049581 | Bacteria | 3627 |
| 884 | Ga0501047_0101093 | 3300049581 | Bacteria | 2763 |
| 885 | Ga0501047_0115868 | 3300049581 | Bacteria | 2561 |
| 886 | Ga0501047_0180078 | 3300049581 | Bacteria | 1980 |
| 887 | Ga0501047_0258430 | 3300049581 | Bacteria | 1589 |
| 888 | Ga0501047_0327202 | 3300049581 | Bacteria | 1371 |
| 889 | Ga0501047_0338172 | 3300049581 | Bacteria | 1343 |
| 890 | Ga0501047_0398005 | 3300049581 | Bacteria | 1210 |
| 891 | Ga0501047_0407405 | 3300049581 | Bacteria | 1192 |
| 892 | Ga0501048_0007462 | 3300049582 | Bacteria | 8288 |
| 893 | Ga0501048_0475757 | 3300049582 | Bacteria | 895 |
| 894 | Ga0501067_0004401 | 3300049583 | Bacteria | 7765 |
| 895 | Ga0501068_0000050 | 3300049584 | Bacteria | 45608 |
| 896 | Ga0501069_0001601 | 3300049585 | Bacteria | 11198 |
| 897 | Ga0501069_0005973 | 3300049585 | Bacteria | 6351 |
| 898 | Ga0501070_0018409 | 3300049586 | Bacteria | 5860 |
| 899 | Ga0501070_0250874 | 3300049586 | Bacteria | 1447 |
| 900 | Ga0501070_0330824 | 3300049586 | Bacteria | 1238 |
| 901 | Ga0501070_0448206 | 3300049586 | Bacteria | 1041 |
| 902 | Ga0501070_0568376 | 3300049586 | Bacteria | 906 |
| 903 | Ga0501070_0822574 | 3300049586 | Bacteria | 728 |
| 904 | Ga0501070_1029908 | 3300049586 | Bacteria | 637 |
| 905 | Ga0501071_0003321 | 3300049587 | Bacteria | 10048 |
| 906 | Ga0501071_0717463 | 3300049587 | Bacteria | 770 |
| 907 | Ga0501072_0001327 | 3300049588 | Bacteria | 18557 |
| 908 | Ga0501072_0816766 | 3300049588 | Bacteria | 730 |
| 909 | Ga0501073_0014076 | 3300049589 | Bacteria | 5811 |
| 910 | Ga0501074_0089493 | 3300049590 | Bacteria | 2204 |
| 911 | Ga0501075_0366247 | 3300049591 | Bacteria | 1099 |
| 912 | Ga0501076_0020533 | 3300049592 | Bacteria | 5056 |
| 913 | Ga0501077_0016094 | 3300049593 | Bacteria | 4712 |
| 914 | Ga0501077_0762965 | 3300049593 | Bacteria | 622 |
| 915 | Ga0501202_004992 | 3300049652 | Bacteria | 2338 |
| 916 | Ga0501206_071852 | 3300049653 | Bacteria | 587 |
| 917 | Ga0501217_204226 | 3300049661 | Bacteria | 617 |
| 918 | Ga0501217_329327 | 3300049661 | Bacteria | 510 |
| 919 | Ga0501230_050159 | 3300049667 | Bacteria | 828 |
| 920 | Ga0501233_174932 | 3300049668 | Bacteria | 612 |
| 921 | Ga0501255_080427 | 3300049684 | Bacteria | 547 |
| 922 | Ga0501079_0026015 | 3300049741 | Bacteria | 4487 |
| 923 | Ga0501079_0790151 | 3300049741 | Bacteria | 747 |
| 924 | Ga0501080_0125002 | 3300049742 | Bacteria | 2382 |
| 925 | Ga0501080_1326177 | 3300049742 | Bacteria | 616 |
| 926 | Ga0501081_0479308 | 3300049743 | Bacteria | 926 |
| 927 | Ga0501083_0055973 | 3300049744 | Bacteria | 2643 |
| 928 | Ga0501283_110602 | 3300049779 | Bacteria | 543 |
| 929 | Ga0501035_0003339 | 3300049822 | Bacteria | 15375 |
| 930 | Ga0501035_0046471 | 3300049822 | Bacteria | 3905 |
| 931 | Ga0501035_0082627 | 3300049822 | Bacteria | 2834 |
| 932 | Ga0501035_0108671 | 3300049822 | Bacteria | 2431 |
| 933 | Ga0501035_0360751 | 3300049822 | Bacteria | 1214 |
| 934 | Ga0501035_0368951 | 3300049822 | Bacteria | 1198 |
| 935 | Ga0501044_0006353 | 3300049823 | Bacteria | 13066 |
| 936 | Ga0501044_0008682 | 3300049823 | Bacteria | 11122 |
| 937 | Ga0501044_0033956 | 3300049823 | Bacteria | 5355 |
| 938 | Ga0501044_0052380 | 3300049823 | Bacteria | 4205 |
| 939 | Ga0501044_0057740 | 3300049823 | Bacteria | 3982 |
| 940 | Ga0501044_0219353 | 3300049823 | Bacteria | 1853 |
| 941 | Ga0501044_0623099 | 3300049823 | Bacteria | 970 |
| 942 | Ga0501044_1147674 | 3300049823 | Bacteria | 645 |
| 943 | Ga0501044_1175936 | 3300049823 | Bacteria | 635 |
| 944 | Ga0501045_0128892 | 3300049824 | Bacteria | 1880 |
| 945 | Ga0501045_0365333 | 3300049824 | Bacteria | 1074 |
| 946 | Ga0501045_0371387 | 3300049824 | Bacteria | 1064 |
| 947 | Ga0501045_0502670 | 3300049824 | Bacteria | 900 |
| 948 | Ga0501045_0940722 | 3300049824 | Bacteria | 634 |
| 949 | Ga0501212_044926 | 3300049851 | Bacteria | 738 |
| 950 | nmdc:mga03683_252544_c1 | 3300050489 | Bacteria | 819 |
| 951 | nmdc:mga03683_374768_c1 | 3300050489 | Bacteria | 677 |
| 952 | nmdc:mga03683_503981_c1 | 3300050489 | Bacteria | 586 |
| 953 | nmdc:mga03n38_182969_c1 | 3300050490 | Bacteria | 1075 |
| 954 | nmdc:mga03n38_365880_c1 | 3300050490 | Bacteria | 787 |
| 955 | nmdc:mga03n38_556311_c1 | 3300050490 | Bacteria | 649 |
| 956 | nmdc:mga00v17_283425_c1 | 3300050491 | Bacteria | 1076 |
| 957 | nmdc:mga0yw44_655894_c1 | 3300050492 | Bacteria | 713 |
| 958 | nmdc:mga0yw44_860984_c1 | 3300050492 | Bacteria | 615 |
| 959 | nmdc:mga0k408_309561_c1 | 3300050493 | Bacteria | 943 |
| 960 | nmdc:mga06z11_1569_c1 | 3300050494 | Bacteria | 8505 |
| 961 | nmdc:mga06z11_194305_c1 | 3300050494 | Bacteria | 1176 |
| 962 | nmdc:mga04h51_61093_c1 | 3300050495 | Bacteria | 1292 |
| 963 | nmdc:mga07m45_282602_c1 | 3300050496 | Bacteria | 965 |
| 964 | nmdc:mga07m45_386664_c1 | 3300050496 | Bacteria | 812 |
| 965 | nmdc:mga05p37_168354_c1 | 3300050507 | Bacteria | 2673 |
| 966 | nmdc:mga09592_242618_c1 | 3300050508 | Bacteria | 1561 |
| 967 | nmdc:mga08y16_1776517_c1 | 3300050511 | Bacteria | 570 |
| 968 | nmdc:mga08y16_8126_c1 | 3300050511 | Bacteria | 10973 |
| 969 | nmdc:mga0n895_50638_c1 | 3300050512 | Bacteria | 4072 |
| 970 | nmdc:mga0rr50_189702_c1 | 3300050513 | Bacteria | 1684 |
| 971 | nmdc:mga08x19_3690_c1 | 3300050514 | Bacteria | 9116 |
| 972 | nmdc:mga0a205_90473_c1 | 3300050515 | Bacteria | 2958 |
| 973 | nmdc:mga0sz30_68414_c1 | 3300050516 | Bacteria | 1525 |
| 974 | Ga0495619_0698039 | 3300053085 | Bacteria | 690 |
| 975 | Ga0500578_0014126 | 3300053086 | Bacteria | 5138 |
| 976 | Ga0500646_0085751 | 3300053090 | Bacteria | 968 |
| 977 | Ga0500566_0001202 | 3300053094 | Bacteria | 15139 |
| 978 | Ga0500654_008366 | 3300053099 | Bacteria | 7126 |
| 979 | Ga0500553_125659 | 3300053101 | Bacteria | 1046 |
| 980 | Ga0500558_132555 | 3300053106 | Bacteria | 950 |
| 981 | Ga0500560_025525 | 3300053107 | Bacteria | 1736 |
| 982 | Ga0500560_136483 | 3300053107 | Bacteria | 819 |
| 983 | Ga0500569_004889 | 3300053109 | Bacteria | 2847 |
| 984 | Ga0500580_203029 | 3300053113 | Bacteria | 646 |
| 985 | Ga0500593_051396 | 3300053117 | Bacteria | 1829 |
| 986 | Ga0500593_139492 | 3300053117 | Bacteria | 956 |
| 987 | Ga0500614_076573 | 3300053123 | Bacteria | 928 |
| 988 | Ga0500621_121448 | 3300053126 | Bacteria | 1011 |
| 989 | Ga0500628_004632 | 3300053129 | Bacteria | 2279 |
| 990 | Ga0500561_0000783 | 3300053137 | Bacteria | 5052 |
| 991 | Ga0500573_0002621 | 3300053140 | Bacteria | 9054 |
| 992 | Ga0500573_0292054 | 3300053140 | Bacteria | 819 |
| 993 | Ga0500586_254671 | 3300053145 | Bacteria | 549 |
| 994 | Ga0500600_0235850 | 3300053149 | Bacteria | 831 |
| 995 | Ga0500616_0001526 | 3300053153 | Bacteria | 21817 |
| 996 | Ga0500633_0008690 | 3300053160 | Bacteria | 2632 |
| 997 | Ga0500587_009997 | 3300053739 | Bacteria | 1206 |
| 998 | Ga0500587_059787 | 3300053739 | Bacteria | 581 |
| 999 | Ga0501084_0018187 | 3300054114 | Bacteria | 5851 |
| 1000 | Ga0501084_0984585 | 3300054114 | Bacteria | 709 |
| 1001 | Ga0587084_124884 | 3300059477 | Bacteria | 545 |
| 1002 | Ga0587073_0176173 | 3300059492 | Bacteria | 624 |
| 1003 | Ga0587073_0200785 | 3300059492 | Bacteria | 598 |
| 1004 | Ga0587073_0257957 | 3300059492 | Bacteria | 550 |
| 1005 | Ga0587073_0335136 | 3300059492 | Bacteria | 503 |
| 1006 | Ga0587080_087681 | 3300059503 | Bacteria | 648 |
| 1007 | Ga0587080_101174 | 3300059503 | Bacteria | 617 |
| 1008 | Ga0587080_110456 | 3300059503 | Bacteria | 599 |
| 1009 | Ga0587082_039895 | 3300059504 | Bacteria | 856 |
| 1010 | Ga0587083_0076057 | 3300059505 | Bacteria | 790 |
| 1011 | Ga0587083_0144242 | 3300059505 | Bacteria | 637 |
| 1012 | Ga0587085_010526 | 3300059506 | Bacteria | 1229 |
| 1013 | Ga0587085_159863 | 3300059506 | Bacteria | 526 |
| 1014 | Ga0587088_127822 | 3300059508 | Bacteria | 595 |
| 1015 | Ga0587090_129224 | 3300059510 | Bacteria | 555 |
| 1016 | Ga0587091_008928 | 3300059511 | Bacteria | 1495 |
| 1017 | Ga0587091_127304 | 3300059511 | Bacteria | 625 |
| 1018 | Ga0587091_129478 | 3300059511 | Bacteria | 621 |
| 1019 | Ga0587094_044011 | 3300059513 | Bacteria | 737 |
| 1020 | Ga0587106_033627 | 3300059605 | Bacteria | 836 |
| 1021 | Ga0587106_136977 | 3300059605 | Bacteria | 533 |
| 1022 | Ga0587129_031918 | 3300059608 | Bacteria | 510 |
| 1023 | Ga0587099_037994 | 3300059622 | Bacteria | 608 |
| 1024 | Ga0587101_153575 | 3300059623 | Bacteria | 501 |
| 1025 | Ga0587115_117682 | 3300059626 | Bacteria | 508 |
| 1026 | Ga0587117_099500 | 3300059627 | Bacteria | 553 |
| 1027 | Ga0587122_036320 | 3300059628 | Bacteria | 598 |
| 1028 | Ga0587128_091779 | 3300059630 | Bacteria | 624 |
| 1029 | Ga0587128_138908 | 3300059630 | Bacteria | 544 |
| 1030 | Ga0587130_019187 | 3300059631 | Bacteria | 729 |
| 1031 | Ga0587062_129071 | 3300059639 | Bacteria | 518 |
| 1032 | Ga0587067_213509 | 3300059640 | Bacteria | 519 |
| 1033 | Ga0587067_230846 | 3300059640 | Bacteria | 506 |
| 1034 | Ga0587068_161250 | 3300059641 | Bacteria | 513 |
| 1035 | Ga0587069_139332 | 3300059642 | Bacteria | 530 |
| 1036 | Ga0587072_163732 | 3300059643 | Bacteria | 545 |
| 1037 | Ga0587075_100706 | 3300059644 | Bacteria | 576 |
| 1038 | Ga0587076_061984 | 3300059645 | Bacteria | 756 |
| 1039 | Ga0587076_193782 | 3300059645 | Bacteria | 519 |
| 1040 | Ga0587102_008941 | 3300059649 | Bacteria | 962 |
| 1041 | Ga0587105_028109 | 3300059651 | Bacteria | 526 |
| 1042 | Ga0587108_014746 | 3300059653 | Bacteria | 698 |
| 1043 | Ga0587114_058829 | 3300059655 | Bacteria | 669 |
| 1044 | Ga0587120_019907 | 3300059659 | Bacteria | 632 |
| 1045 | Ga0587060_025524 | 3300060243 | Bacteria | 582 |
| 1046 | Ga0587071_188374 | 3300060344 | Bacteria | 533 |
| 1047 | Ga0587111_0149818 | 3300060346 | Bacteria | 626 |
| 1048 | Ga0501082_0205256 | 3300060353 | Bacteria | 1714 |
| 1049 | Ga0466962_0004974 | 3300061719 | Bacteria | 6391 |
| 1050 | Ga0466962_0032558 | 3300061719 | Bacteria | 2495 |
| 1051 | Ga0466962_0155377 | 3300061719 | Bacteria | 1111 |
| 1052 | Ga0466962_0155536 | 3300061719 | Bacteria | 1110 |
| 1053 | Ga0466962_0614769 | 3300061719 | Bacteria | 554 |
| 1054 | Ga0466962_0687160 | 3300061719 | Bacteria | 524 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046499 | Ga0495594_0814870 | Ga0495594_0814870_17_379 | 105 |
| 2 | iso_pu_bacteria | 2517572101 | 2517760384 | 109 |
| 3 | iso_pu_bacteria | 2857710386 | 2857713007 | 109 |
| 4 | iso_pu_bacteria | 3006425503 | 3006426540 | 109 |
| 5 | iso_pu_bacteria | 8002775197 | 8002775993 | 109 |
| 6 | iso_pu_bacteria | 8002784119 | 8002790649 | 109 |
| 7 | iso_pu_bacteria | 2585428094 | 2587863301 | 111 |
| 8 | iso_pu_bacteria | 2622736605 | 2623502026 | 111 |
| 9 | iso_pu_bacteria | 2643221649 | 2644277108 | 111 |
| 10 | iso_pu_bacteria | 2654587600 | 2655032425 | 111 |
| 11 | iso_pu_bacteria | 2739367653 | 2739602526 | 111 |
| 12 | iso_pu_bacteria | 2767802112 | 2768647088 | 111 |
| 13 | iso_pu_bacteria | 2784132109 | 2784472620 | 111 |
| 14 | iso_pu_bacteria | 2837268691 | 2837272951 | 111 |
| 15 | iso_pu_bacteria | 2857727296 | 2857729586 | 111 |
| 16 | iso_pu_bacteria | 2862705112 | 2862710032 | 111 |
| 17 | iso_pu_bacteria | 2867346516 | 2867350886 | 111 |
| 18 | iso_pu_bacteria | 2867475112 | 2867480117 | 111 |
| 19 | iso_pu_bacteria | 2868088558 | 2868093846 | 111 |
| 20 | iso_pu_bacteria | 2945956166 | 2945959580 | 111 |
| 21 | iso_pu_bacteria | 2997451912 | 2997453101 | 111 |
| 22 | iso_pu_bacteria | 8004021418 | 8004023235 | 111 |
| 23 | iso_pu_bacteria | 8008485437 | 8008487218 | 111 |
| 24 | iso_pu_bacteria | 8025524527 | 8025526349 | 111 |
| 25 | iso_pu_bacteria | 8033684223 | 8033691173 | 111 |
| 26 | iso_pu_bacteria | 8054160619 | 8054165361 | 111 |
| 27 | 3300042014 | Ga0439457_026183 | Ga0439457_026183_724_1065 | 112 |
| 28 | iso_pu_bacteria | 2547132111 | 2547410472 | 112 |
| 29 | iso_pu_bacteria | 2554235005 | 2554256028 | 112 |
| 30 | iso_pu_bacteria | 2582581312 | 2585297451 | 112 |
| 31 | iso_pu_bacteria | 2582581313 | 2585307727 | 112 |
| 32 | iso_pu_bacteria | 2616644941 | 2616903778 | 112 |
| 33 | iso_pu_bacteria | 2643221548 | 2643761514 | 112 |
| 34 | iso_pu_bacteria | 2643221578 | 2643899403 | 112 |
| 35 | iso_pu_bacteria | 2643221587 | 2643943661 | 112 |
| 36 | iso_pu_bacteria | 2643221647 | 2644269575 | 112 |
| 37 | iso_pu_bacteria | 2643221670 | 2644387139 | 112 |
| 38 | iso_pu_bacteria | 2643221673 | 2644406861 | 112 |
| 39 | iso_pu_bacteria | 2643221677 | 2644434080 | 112 |
| 40 | iso_pu_bacteria | 2643221678 | 2644437781 | 112 |
| 41 | iso_pu_bacteria | 2643221682 | 2644458784 | 112 |
| 42 | iso_pu_bacteria | 2643221714 | 2644629833 | 112 |
| 43 | iso_pu_bacteria | 2784132148 | 2784590625 | 112 |
| 44 | iso_pu_bacteria | 2784746763 | 2785340962 | 112 |
| 45 | iso_pu_bacteria | 2784746768 | 2785371797 | 112 |
| 46 | iso_pu_bacteria | 2786546132 | 2786672904 | 112 |
| 47 | iso_pu_bacteria | 2791355406 | 2793977143 | 112 |
| 48 | iso_pu_bacteria | 2802429296 | 2804848160 | 112 |
| 49 | iso_pu_bacteria | 2808606359 | 2808844252 | 112 |
| 50 | iso_pu_bacteria | 2808606375 | 2808913872 | 112 |
| 51 | iso_pu_bacteria | 2808606448 | 2809234317 | 112 |
| 52 | iso_pu_bacteria | 2808606982 | 2811844140 | 112 |
| 53 | iso_pu_bacteria | 2811994879 | 2812355713 | 112 |
| 54 | iso_pu_bacteria | 2811994917 | 2812478532 | 112 |
| 55 | iso_pu_bacteria | 2816332119 | 2816428064 | 112 |
| 56 | iso_pu_bacteria | 2818991463 | 2819698957 | 112 |
| 57 | iso_pu_bacteria | 2818991472 | 2819740472 | 112 |
| 58 | iso_pu_bacteria | 2852635781 | 2852639710 | 112 |
| 59 | iso_pu_bacteria | 2862178590 | 2862181770 | 112 |
| 60 | iso_pu_bacteria | 2862281513 | 2862284355 | 112 |
| 61 | iso_pu_bacteria | 2862382967 | 2862384774 | 112 |
| 62 | iso_pu_bacteria | 2863404153 | 2863408873 | 112 |
| 63 | iso_pu_bacteria | 2867369537 | 2867374062 | 112 |
| 64 | iso_pu_bacteria | 2867428634 | 2867433961 | 112 |
| 65 | iso_pu_bacteria | 2873151551 | 2873153829 | 112 |
| 66 | iso_pu_bacteria | 2873314349 | 2873321543 | 112 |
| 67 | iso_pu_bacteria | 2875391855 | 2875396979 | 112 |
| 68 | iso_pu_bacteria | 2877676314 | 2877678802 | 112 |
| 69 | iso_pu_bacteria | 2912723979 | 2912729929 | 112 |
| 70 | iso_pu_bacteria | 2912757875 | 2912763039 | 112 |
| 71 | iso_pu_bacteria | 2919468124 | 2919472482 | 112 |
| 72 | iso_pu_bacteria | 2946045630 | 2946047578 | 112 |
| 73 | iso_pu_bacteria | 2946064051 | 2946070080 | 112 |
| 74 | iso_pu_bacteria | 2946072368 | 2946077969 | 112 |
| 75 | iso_pu_bacteria | 2947224130 | 2947226697 | 112 |
| 76 | iso_pu_bacteria | 2954002825 | 2954005785 | 112 |
| 77 | iso_pu_bacteria | 2954380949 | 2954383762 | 112 |
| 78 | iso_pu_bacteria | 2954673503 | 2954679210 | 112 |
| 79 | iso_pu_bacteria | 2954682443 | 2954684943 | 112 |
| 80 | iso_pu_bacteria | 2954691527 | 2954694557 | 112 |
| 81 | iso_pu_bacteria | 2954701450 | 2954709762 | 112 |
| 82 | iso_pu_bacteria | 2954711539 | 2954714062 | 112 |
| 83 | iso_pu_bacteria | 2954721474 | 2954724015 | 112 |
| 84 | iso_pu_bacteria | 2954731030 | 2954737825 | 112 |
| 85 | iso_pu_bacteria | 2954740390 | 2954742912 | 112 |
| 86 | iso_pu_bacteria | 2954749733 | 2954756661 | 112 |
| 87 | iso_pu_bacteria | 2954759201 | 2954761869 | 112 |
| 88 | iso_pu_bacteria | 2966598605 | 2966600613 | 112 |
| 89 | iso_pu_bacteria | 2990059506 | 2990061073 | 112 |
| 90 | iso_pu_bacteria | 2990088156 | 2990093919 | 112 |
| 91 | iso_pu_bacteria | 2997600082 | 2997604003 | 112 |
| 92 | iso_pu_bacteria | 3006486233 | 3006487970 | 112 |
| 93 | iso_pu_bacteria | 8008558824 | 8008563041 | 112 |
| 94 | iso_pu_bacteria | 8023623736 | 8023625725 | 112 |
| 95 | iso_pu_bacteria | 8025478263 | 8025484061 | 112 |
| 96 | iso_pu_bacteria | 8025530807 | 8025532657 | 112 |
| 97 | iso_pu_bacteria | 8047893842 | 8047895829 | 112 |
| 98 | iso_pu_bacteria | 8048127548 | 8048129088 | 112 |
| 99 | iso_pu_bacteria | 8048356638 | 8048363105 | 112 |
| 100 | iso_pu_bacteria | 8048369669 | 8048372853 | 112 |
| 101 | iso_pu_bacteria | 8048379754 | 8048381787 | 112 |
| 102 | iso_pu_bacteria | 8048406513 | 8048409777 | 112 |
| 103 | iso_pu_bacteria | 8055066027 | 8055073237 | 112 |
| 104 | iso_pu_bacteria | 8056447290 | 8056451981 | 112 |
| 105 | iso_pu_bacteria | 8056667051 | 8056670797 | 112 |
| 106 | 3300006038 | Ga0075365_10154977 | Ga0075365_101549772 | 113 |
| 107 | 3300006042 | Ga0075368_10236793 | Ga0075368_102367932 | 113 |
| 108 | 3300006177 | Ga0075362_10074798 | Ga0075362_100747983 | 113 |
| 109 | 3300006186 | Ga0075369_10110603 | Ga0075369_101106032 | 113 |
| 110 | 3300006353 | Ga0075370_10297319 | Ga0075370_102973192 | 113 |
| 111 | 3300020076 | Ga0206355_1459015 | Ga0206355_14590151 | 113 |
| 112 | 3300032002 | Ga0307416_103627619 | Ga0307416_1036276191 | 113 |
| 113 | 3300036459 | Ga0372808_059597 | Ga0372808_059597_106_447 | 113 |
| 114 | 3300048903 | Ga0496100_1240605 | Ga0496100_1240605_24_365 | 113 |
| 115 | 3300048904 | Ga0496101_0906214 | Ga0496101_0906214_128_469 | 113 |
| 116 | 3300048905 | Ga0496102_0010594 | Ga0496102_0010594_2745_3086 | 113 |
| 117 | 3300048908 | Ga0496105_0825230 | Ga0496105_0825230_317_658 | 113 |
| 118 | 3300048919 | Ga0496116_0000665 | Ga0496116_0000665_9373_9714 | 113 |
| 119 | 3300048920 | Ga0496117_0087380 | Ga0496117_0087380_1136_1477 | 113 |
| 120 | 3300048921 | Ga0496118_0000900 | Ga0496118_0000900_36838_37179 | 113 |
| 121 | 3300048922 | Ga0496119_0005788 | Ga0496119_0005788_5176_5517 | 113 |
| 122 | 3300048924 | Ga0496121_0132116 | Ga0496121_0132116_918_1259 | 113 |
| 123 | 3300049570 | Ga0501033_0001361 | Ga0501033_0001361_9600_9950 | 113 |
| 124 | 3300049570 | Ga0501033_0414052 | Ga0501033_0414052_113_463 | 113 |
| 125 | 3300049571 | Ga0501034_0552434 | Ga0501034_0552434_141_491 | 113 |
| 126 | 3300049572 | Ga0501036_0080987 | Ga0501036_0080987_288_638 | 113 |
| 127 | 3300049573 | Ga0501037_0610816 | Ga0501037_0610816_72_422 | 113 |
| 128 | 3300049574 | Ga0501038_0402854 | Ga0501038_0402854_665_1015 | 113 |
| 129 | 3300049579 | Ga0501043_0844207 | Ga0501043_0844207_220_570 | 113 |
| 130 | 3300049581 | Ga0501047_0101093 | Ga0501047_0101093_452_802 | 113 |
| 131 | 3300049585 | Ga0501069_0005973 | Ga0501069_0005973_4477_4827 | 113 |
| 132 | 3300049586 | Ga0501070_0822574 | Ga0501070_0822574_307_657 | 113 |
| 133 | 3300049742 | Ga0501080_1326177 | Ga0501080_1326177_50_391 | 113 |
| 134 | 3300049823 | Ga0501044_0623099 | Ga0501044_0623099_315_665 | 113 |
| 135 | 3300049823 | Ga0501044_1175936 | Ga0501044_1175936_119_469 | 113 |
| 136 | 3300050489 | nmdc:mga03683_374768_c1 | nmdc:mga03683_374768_c1_207_557 | 113 |
| 137 | 3300050490 | nmdc:mga03n38_365880_c1 | nmdc:mga03n38_365880_c1_128_478 | 113 |
| 138 | 3300050516 | nmdc:mga0sz30_68414_c1 | nmdc:mga0sz30_68414_c1_932_1282 | 113 |
| 139 | 3300053094 | Ga0500566_0001202 | Ga0500566_0001202_10935_11285 | 113 |
| 140 | 3300059642 | Ga0587069_139332 | Ga0587069_139332_64_405 | 113 |
| 141 | 3300006038 | Ga0075365_10466118 | Ga0075365_104661182 | 114 |
| 142 | 3300006051 | Ga0075364_10313224 | Ga0075364_103132243 | 114 |
| 143 | 3300006177 | Ga0075362_10410166 | Ga0075362_104101661 | 114 |
| 144 | 3300009147 | Ga0114129_11687082 | Ga0114129_116870822 | 114 |
| 145 | 3300020078 | Ga0206352_10052420 | Ga0206352_100524202 | 114 |
| 146 | 3300035113 | Ga0373936_0115679 | Ga0373936_0115679_94_441 | 114 |
| 147 | 3300035398 | Ga0316574_0639734 | Ga0316574_0639734_251_595 | 114 |
| 148 | 3300041512 | Ga0451853_2602983 | Ga0451853_2602983_1436_1780 | 114 |
| 149 | 3300046499 | Ga0495594_0666022 | Ga0495594_0666022_186_530 | 114 |
| 150 | 3300050489 | nmdc:mga03683_252544_c1 | nmdc:mga03683_252544_c1_235_579 | 114 |
| 151 | 3300050492 | nmdc:mga0yw44_860984_c1 | nmdc:mga0yw44_860984_c1_137_481 | 114 |
| 152 | 3300050494 | nmdc:mga06z11_194305_c1 | nmdc:mga06z11_194305_c1_418_762 | 114 |
| 153 | 3300000549 | LJQas_1021931 | LJQas_10219311 | 115 |
| 154 | 3300001915 | JGI24741J21665_1048199 | JGI24741J21665_10481991 | 115 |
| 155 | 3300001976 | JGI24752J21851_1029606 | JGI24752J21851_10296061 | 115 |
| 156 | 3300002459 | JGI24751J29686_10009512 | JGI24751J29686_100095122 | 115 |
| 157 | 3300003354 | JGI25160J50197_1022002 | JGI25160J50197_10220021 | 115 |
| 158 | 3300003544 | Ga0007417J51691_1030618 | Ga0007417J51691_10306181 | 115 |
| 159 | 3300003579 | Ga0007429J51699_1022932 | Ga0007429J51699_10229321 | 115 |
| 160 | 3300004800 | Ga0058861_11720119 | Ga0058861_117201191 | 115 |
| 161 | 3300004800 | Ga0058861_11903156 | Ga0058861_119031561 | 115 |
| 162 | 3300004801 | Ga0058860_11807479 | Ga0058860_118074791 | 115 |
| 163 | 3300004803 | Ga0058862_12532545 | Ga0058862_125325452 | 115 |
| 164 | 3300005288 | Ga0065714_10136409 | Ga0065714_101364092 | 115 |
| 165 | 3300005327 | Ga0070658_10291940 | Ga0070658_102919402 | 115 |
| 166 | 3300005327 | Ga0070658_10346223 | Ga0070658_103462232 | 115 |
| 167 | 3300005327 | Ga0070658_10678137 | Ga0070658_106781371 | 115 |
| 168 | 3300005328 | Ga0070676_10376614 | Ga0070676_103766142 | 115 |
| 169 | 3300005330 | Ga0070690_100077167 | Ga0070690_1000771672 | 115 |
| 170 | 3300005330 | Ga0070690_100358820 | Ga0070690_1003588202 | 115 |
| 171 | 3300005331 | Ga0070670_100082464 | Ga0070670_1000824641 | 115 |
| 172 | 3300005334 | Ga0068869_100085233 | Ga0068869_1000852332 | 115 |
| 173 | 3300005334 | Ga0068869_100296181 | Ga0068869_1002961812 | 115 |
| 174 | 3300005335 | Ga0070666_10507200 | Ga0070666_105072001 | 115 |
| 175 | 3300005336 | Ga0070680_100011833 | Ga0070680_1000118333 | 115 |
| 176 | 3300005336 | Ga0070680_101837984 | Ga0070680_1018379841 | 115 |
| 177 | 3300005337 | Ga0070682_100297170 | Ga0070682_1002971701 | 115 |
| 178 | 3300005337 | Ga0070682_100452592 | Ga0070682_1004525921 | 115 |
| 179 | 3300005337 | Ga0070682_101231873 | Ga0070682_1012318731 | 115 |
| 180 | 3300005338 | Ga0068868_100016532 | Ga0068868_1000165327 | 115 |
| 181 | 3300005338 | Ga0068868_100028070 | Ga0068868_1000280702 | 115 |
| 182 | 3300005339 | Ga0070660_100086092 | Ga0070660_1000860921 | 115 |
| 183 | 3300005340 | Ga0070689_100058921 | Ga0070689_1000589211 | 115 |
| 184 | 3300005340 | Ga0070689_100169184 | Ga0070689_1001691841 | 115 |
| 185 | 3300005341 | Ga0070691_10010771 | Ga0070691_100107715 | 115 |
| 186 | 3300005343 | Ga0070687_100006409 | Ga0070687_1000064094 | 115 |
| 187 | 3300005343 | Ga0070687_100058468 | Ga0070687_1000584683 | 115 |
| 188 | 3300005345 | Ga0070692_10046971 | Ga0070692_100469711 | 115 |
| 189 | 3300005353 | Ga0070669_100205901 | Ga0070669_1002059012 | 115 |
| 190 | 3300005354 | Ga0070675_100181570 | Ga0070675_1001815702 | 115 |
| 191 | 3300005354 | Ga0070675_100322909 | Ga0070675_1003229093 | 115 |
| 192 | 3300005355 | Ga0070671_100015635 | Ga0070671_1000156357 | 115 |
| 193 | 3300005355 | Ga0070671_100578447 | Ga0070671_1005784472 | 115 |
| 194 | 3300005356 | Ga0070674_100459064 | Ga0070674_1004590642 | 115 |
| 195 | 3300005364 | Ga0070673_100042857 | Ga0070673_1000428573 | 115 |
| 196 | 3300005364 | Ga0070673_100959849 | Ga0070673_1009598491 | 115 |
| 197 | 3300005365 | Ga0070688_100058109 | Ga0070688_1000581095 | 115 |
| 198 | 3300005365 | Ga0070688_100071869 | Ga0070688_1000718692 | 115 |
| 199 | 3300005366 | Ga0070659_100100673 | Ga0070659_1001006733 | 115 |
| 200 | 3300005366 | Ga0070659_100213297 | Ga0070659_1002132971 | 115 |
| 201 | 3300005366 | Ga0070659_100764322 | Ga0070659_1007643221 | 115 |
| 202 | 3300005367 | Ga0070667_100017825 | Ga0070667_1000178256 | 115 |
| 203 | 3300005435 | Ga0070714_100000056 | Ga0070714_10000005677 | 115 |
| 204 | 3300005436 | Ga0070713_101221205 | Ga0070713_1012212051 | 115 |
| 205 | 3300005438 | Ga0070701_10132059 | Ga0070701_101320591 | 115 |
| 206 | 3300005439 | Ga0070711_101357374 | Ga0070711_1013573741 | 115 |
| 207 | 3300005440 | Ga0070705_100173637 | Ga0070705_1001736371 | 115 |
| 208 | 3300005441 | Ga0070700_100000019 | Ga0070700_10000001918 | 115 |
| 209 | 3300005441 | Ga0070700_100104453 | Ga0070700_1001044533 | 115 |
| 210 | 3300005455 | Ga0070663_100049416 | Ga0070663_1000494161 | 115 |
| 211 | 3300005455 | Ga0070663_100879712 | Ga0070663_1008797121 | 115 |
| 212 | 3300005456 | Ga0070678_100002824 | Ga0070678_10000282411 | 115 |
| 213 | 3300005456 | Ga0070678_100256100 | Ga0070678_1002561003 | 115 |
| 214 | 3300005457 | Ga0070662_100370810 | Ga0070662_1003708103 | 115 |
| 215 | 3300005458 | Ga0070681_10081618 | Ga0070681_100816183 | 115 |
| 216 | 3300005458 | Ga0070681_11713629 | Ga0070681_117136291 | 115 |
| 217 | 3300005459 | Ga0068867_100001167 | Ga0068867_10000116715 | 115 |
| 218 | 3300005466 | Ga0070685_10062633 | Ga0070685_100626333 | 115 |
| 219 | 3300005466 | Ga0070685_10219110 | Ga0070685_102191103 | 115 |
| 220 | 3300005466 | Ga0070685_10247598 | Ga0070685_102475981 | 115 |
| 221 | 3300005530 | Ga0070679_100204454 | Ga0070679_1002044542 | 115 |
| 222 | 3300005530 | Ga0070679_100551235 | Ga0070679_1005512352 | 115 |
| 223 | 3300005530 | Ga0070679_100592986 | Ga0070679_1005929861 | 115 |
| 224 | 3300005535 | Ga0070684_100117326 | Ga0070684_1001173263 | 115 |
| 225 | 3300005539 | Ga0068853_100129928 | Ga0068853_1001299281 | 115 |
| 226 | 3300005539 | Ga0068853_100336077 | Ga0068853_1003360774 | 115 |
| 227 | 3300005539 | Ga0068853_100664384 | Ga0068853_1006643842 | 115 |
| 228 | 3300005543 | Ga0070672_100197169 | Ga0070672_1001971693 | 115 |
| 229 | 3300005547 | Ga0070693_100023343 | Ga0070693_1000233433 | 115 |
| 230 | 3300005563 | Ga0068855_100018553 | Ga0068855_1000185533 | 115 |
| 231 | 3300005563 | Ga0068855_100139154 | Ga0068855_1001391541 | 115 |
| 232 | 3300005563 | Ga0068855_100336619 | Ga0068855_1003366192 | 115 |
| 233 | 3300005563 | Ga0068855_102247951 | Ga0068855_1022479512 | 115 |
| 234 | 3300005564 | Ga0070664_100288265 | Ga0070664_1002882651 | 115 |
| 235 | 3300005578 | Ga0068854_100120019 | Ga0068854_1001200194 | 115 |
| 236 | 3300005578 | Ga0068854_100125574 | Ga0068854_1001255743 | 115 |
| 237 | 3300005614 | Ga0068856_100028485 | Ga0068856_1000284852 | 115 |
| 238 | 3300005614 | Ga0068856_100038303 | Ga0068856_1000383033 | 115 |
| 239 | 3300005614 | Ga0068856_101145548 | Ga0068856_1011455482 | 115 |
| 240 | 3300005615 | Ga0070702_100001056 | Ga0070702_10000105610 | 115 |
| 241 | 3300005616 | Ga0068852_100078990 | Ga0068852_1000789904 | 115 |
| 242 | 3300005616 | Ga0068852_100475708 | Ga0068852_1004757082 | 115 |
| 243 | 3300005616 | Ga0068852_100687585 | Ga0068852_1006875852 | 115 |
| 244 | 3300005617 | Ga0068859_101108835 | Ga0068859_1011088352 | 115 |
| 245 | 3300005618 | Ga0068864_100363921 | Ga0068864_1003639211 | 115 |
| 246 | 3300005618 | Ga0068864_100504153 | Ga0068864_1005041532 | 115 |
| 247 | 3300005718 | Ga0068866_10181172 | Ga0068866_101811723 | 115 |
| 248 | 3300005719 | Ga0068861_100856007 | Ga0068861_1008560072 | 115 |
| 249 | 3300005834 | Ga0068851_10021643 | Ga0068851_100216433 | 115 |
| 250 | 3300005840 | Ga0068870_10001305 | Ga0068870_1000130510 | 115 |
| 251 | 3300005841 | Ga0068863_100096892 | Ga0068863_1000968922 | 115 |
| 252 | 3300005842 | Ga0068858_100270343 | Ga0068858_1002703432 | 115 |
| 253 | 3300005843 | Ga0068860_101725611 | Ga0068860_1017256111 | 115 |
| 254 | 3300005844 | Ga0068862_100230623 | Ga0068862_1002306232 | 115 |
| 255 | 3300005983 | Ga0081540_1027281 | Ga0081540_10272815 | 115 |
| 256 | 3300006028 | Ga0070717_11276701 | Ga0070717_112767011 | 115 |
| 257 | 3300006048 | Ga0075363_100456622 | Ga0075363_1004566222 | 115 |
| 258 | 3300006051 | Ga0075364_10258523 | Ga0075364_102585232 | 115 |
| 259 | 3300006173 | Ga0070716_100930570 | Ga0070716_1009305701 | 115 |
| 260 | 3300006178 | Ga0075367_10316855 | Ga0075367_103168552 | 115 |
| 261 | 3300006178 | Ga0075367_10371127 | Ga0075367_103711272 | 115 |
| 262 | 3300006195 | Ga0075366_10184408 | Ga0075366_101844081 | 115 |
| 263 | 3300006237 | Ga0097621_100140819 | Ga0097621_1001408192 | 115 |
| 264 | 3300006353 | Ga0075370_10478030 | Ga0075370_104780302 | 115 |
| 265 | 3300006358 | Ga0068871_100023101 | Ga0068871_1000231015 | 115 |
| 266 | 3300006844 | Ga0075428_100924610 | Ga0075428_1009246102 | 115 |
| 267 | 3300006852 | Ga0075433_10012775 | Ga0075433_100127756 | 115 |
| 268 | 3300006871 | Ga0075434_100057081 | Ga0075434_1000570813 | 115 |
| 269 | 3300006880 | Ga0075429_100244157 | Ga0075429_1002441572 | 115 |
| 270 | 3300006881 | Ga0068865_100079231 | Ga0068865_1000792312 | 115 |
| 271 | 3300006914 | Ga0075436_100123581 | Ga0075436_1001235812 | 115 |
| 272 | 3300006931 | Ga0097620_101108851 | Ga0097620_1011088512 | 115 |
| 273 | 3300007076 | Ga0075435_100058876 | Ga0075435_1000588766 | 115 |
| 274 | 3300009093 | Ga0105240_10097773 | Ga0105240_100977733 | 115 |
| 275 | 3300009093 | Ga0105240_10123599 | Ga0105240_101235995 | 115 |
| 276 | 3300009093 | Ga0105240_10150035 | Ga0105240_101500352 | 115 |
| 277 | 3300009093 | Ga0105240_10968712 | Ga0105240_109687121 | 115 |
| 278 | 3300009093 | Ga0105240_12361110 | Ga0105240_123611101 | 115 |
| 279 | 3300009094 | Ga0111539_10107040 | Ga0111539_101070403 | 115 |
| 280 | 3300009098 | Ga0105245_10129375 | Ga0105245_101293754 | 115 |
| 281 | 3300009098 | Ga0105245_10141756 | Ga0105245_101417563 | 115 |
| 282 | 3300009147 | Ga0114129_10244432 | Ga0114129_102444323 | 115 |
| 283 | 3300009148 | Ga0105243_10033945 | Ga0105243_100339455 | 115 |
| 284 | 3300009148 | Ga0105243_10366479 | Ga0105243_103664792 | 115 |
| 285 | 3300009174 | Ga0105241_10056976 | Ga0105241_100569764 | 115 |
| 286 | 3300009174 | Ga0105241_11033088 | Ga0105241_110330881 | 115 |
| 287 | 3300009176 | Ga0105242_10031151 | Ga0105242_100311519 | 115 |
| 288 | 3300009177 | Ga0105248_10049750 | Ga0105248_100497503 | 115 |
| 289 | 3300009177 | Ga0105248_10241619 | Ga0105248_102416193 | 115 |
| 290 | 3300009545 | Ga0105237_10024693 | Ga0105237_100246938 | 115 |
| 291 | 3300009545 | Ga0105237_10541052 | Ga0105237_105410523 | 115 |
| 292 | 3300009545 | Ga0105237_11217199 | Ga0105237_112171991 | 115 |
| 293 | 3300009545 | Ga0105237_12364879 | Ga0105237_123648791 | 115 |
| 294 | 3300009551 | Ga0105238_10288636 | Ga0105238_102886363 | 115 |
| 295 | 3300009551 | Ga0105238_10757190 | Ga0105238_107571902 | 115 |
| 296 | 3300009551 | Ga0105238_10841709 | Ga0105238_108417092 | 115 |
| 297 | 3300009553 | Ga0105249_10439601 | Ga0105249_104396012 | 115 |
| 298 | 3300010375 | Ga0105239_10139390 | Ga0105239_101393902 | 115 |
| 299 | 3300010375 | Ga0105239_10378821 | Ga0105239_103788213 | 115 |
| 300 | 3300010375 | Ga0105239_10572903 | Ga0105239_105729032 | 115 |
| 301 | 3300010375 | Ga0105239_11553082 | Ga0105239_115530821 | 115 |
| 302 | 3300011119 | Ga0105246_10090848 | Ga0105246_100908485 | 115 |
| 303 | 3300012503 | Ga0157313_1011741 | Ga0157313_10117412 | 115 |
| 304 | 3300013100 | Ga0157373_10916273 | Ga0157373_109162731 | 115 |
| 305 | 3300013102 | Ga0157371_10016630 | Ga0157371_100166301 | 115 |
| 306 | 3300013104 | Ga0157370_10173785 | Ga0157370_101737852 | 115 |
| 307 | 3300013104 | Ga0157370_11463455 | Ga0157370_114634552 | 115 |
| 308 | 3300013105 | Ga0157369_10620518 | Ga0157369_106205182 | 115 |
| 309 | 3300013105 | Ga0157369_11344430 | Ga0157369_113444301 | 115 |
| 310 | 3300013296 | Ga0157374_10571546 | Ga0157374_105715462 | 115 |
| 311 | 3300013296 | Ga0157374_11779034 | Ga0157374_117790342 | 115 |
| 312 | 3300013296 | Ga0157374_12297389 | Ga0157374_122973892 | 115 |
| 313 | 3300013297 | Ga0157378_10089571 | Ga0157378_100895712 | 115 |
| 314 | 3300013297 | Ga0157378_11835622 | Ga0157378_118356221 | 115 |
| 315 | 3300013306 | Ga0163162_10184281 | Ga0163162_101842815 | 115 |
| 316 | 3300013306 | Ga0163162_12306768 | Ga0163162_123067682 | 115 |
| 317 | 3300013307 | Ga0157372_10154473 | Ga0157372_101544734 | 115 |
| 318 | 3300013307 | Ga0157372_12488904 | Ga0157372_124889041 | 115 |
| 319 | 3300013308 | Ga0157375_10077436 | Ga0157375_100774363 | 115 |
| 320 | 3300013308 | Ga0157375_10141200 | Ga0157375_101412006 | 115 |
| 321 | 3300014497 | Ga0182008_10216701 | Ga0182008_102167012 | 115 |
| 322 | 3300014745 | Ga0157377_10111160 | Ga0157377_101111602 | 115 |
| 323 | 3300014968 | Ga0157379_10023573 | Ga0157379_100235733 | 115 |
| 324 | 3300014968 | Ga0157379_10037476 | Ga0157379_100374763 | 115 |
| 325 | 3300014969 | Ga0157376_10863077 | Ga0157376_108630772 | 115 |
| 326 | 3300015262 | Ga0182007_10198257 | Ga0182007_101982571 | 115 |
| 327 | 3300017792 | Ga0163161_10820407 | Ga0163161_108204072 | 115 |
| 328 | 3300020069 | Ga0197907_10602326 | Ga0197907_106023261 | 115 |
| 329 | 3300020069 | Ga0197907_11126863 | Ga0197907_111268631 | 115 |
| 330 | 3300020070 | Ga0206356_10126309 | Ga0206356_101263091 | 115 |
| 331 | 3300020070 | Ga0206356_11271281 | Ga0206356_112712812 | 115 |
| 332 | 3300020076 | Ga0206355_1281966 | Ga0206355_12819662 | 115 |
| 333 | 3300020077 | Ga0206351_10048997 | Ga0206351_100489972 | 115 |
| 334 | 3300020078 | Ga0206352_10966106 | Ga0206352_109661061 | 115 |
| 335 | 3300020078 | Ga0206352_10967525 | Ga0206352_109675253 | 115 |
| 336 | 3300020081 | Ga0206354_10046039 | Ga0206354_100460391 | 115 |
| 337 | 3300020081 | Ga0206354_10084735 | Ga0206354_100847353 | 115 |
| 338 | 3300020081 | Ga0206354_10478325 | Ga0206354_104783252 | 115 |
| 339 | 3300020082 | Ga0206353_10124804 | Ga0206353_101248042 | 115 |
| 340 | 3300020082 | Ga0206353_10148832 | Ga0206353_101488321 | 115 |
| 341 | 3300020082 | Ga0206353_10229974 | Ga0206353_102299746 | 115 |
| 342 | 3300020082 | Ga0206353_10644972 | Ga0206353_106449721 | 115 |
| 343 | 3300020082 | Ga0206353_10996184 | Ga0206353_109961842 | 115 |
| 344 | 3300020082 | Ga0206353_11555357 | Ga0206353_115553572 | 115 |
| 345 | 3300020082 | Ga0206353_11600473 | Ga0206353_116004731 | 115 |
| 346 | 3300020082 | Ga0206353_12027566 | Ga0206353_120275662 | 115 |
| 347 | 3300020610 | Ga0154015_1211593 | Ga0154015_12115931 | 115 |
| 348 | 3300021388 | Ga0213875_10006095 | Ga0213875_100060954 | 115 |
| 349 | 3300021388 | Ga0213875_10055171 | Ga0213875_100551712 | 115 |
| 350 | 3300022467 | Ga0224712_10071922 | Ga0224712_100719221 | 115 |
| 351 | 3300022467 | Ga0224712_10256245 | Ga0224712_102562451 | 115 |
| 352 | 3300022467 | Ga0224712_10669228 | Ga0224712_106692281 | 115 |
| 353 | 3300023436 | Ga0256743_110435 | Ga0256743_1104351 | 115 |
| 354 | 3300025256 | Ga0209759_1010174 | Ga0209759_10101745 | 115 |
| 355 | 3300025271 | Ga0207666_1006476 | Ga0207666_10064763 | 115 |
| 356 | 3300025302 | Ga0207426_1006048 | Ga0207426_10060486 | 115 |
| 357 | 3300025302 | Ga0207426_1034672 | Ga0207426_10346722 | 115 |
| 358 | 3300025315 | Ga0207697_10045334 | Ga0207697_100453343 | 115 |
| 359 | 3300025321 | Ga0207656_10080193 | Ga0207656_100801933 | 115 |
| 360 | 3300025735 | Ga0207713_1148810 | Ga0207713_11488102 | 115 |
| 361 | 3300025899 | Ga0207642_10078464 | Ga0207642_100784645 | 115 |
| 362 | 3300025900 | Ga0207710_10195016 | Ga0207710_101950162 | 115 |
| 363 | 3300025901 | Ga0207688_10006789 | Ga0207688_100067896 | 115 |
| 364 | 3300025901 | Ga0207688_10037503 | Ga0207688_100375032 | 115 |
| 365 | 3300025903 | Ga0207680_10150777 | Ga0207680_101507772 | 115 |
| 366 | 3300025904 | Ga0207647_10392352 | Ga0207647_103923521 | 115 |
| 367 | 3300025907 | Ga0207645_10043563 | Ga0207645_100435632 | 115 |
| 368 | 3300025907 | Ga0207645_10339075 | Ga0207645_103390752 | 115 |
| 369 | 3300025908 | Ga0207643_10012956 | Ga0207643_100129566 | 115 |
| 370 | 3300025911 | Ga0207654_11031051 | Ga0207654_110310511 | 115 |
| 371 | 3300025913 | Ga0207695_10098040 | Ga0207695_100980402 | 115 |
| 372 | 3300025913 | Ga0207695_10123739 | Ga0207695_101237393 | 115 |
| 373 | 3300025913 | Ga0207695_10214520 | Ga0207695_102145203 | 115 |
| 374 | 3300025914 | Ga0207671_10065836 | Ga0207671_100658365 | 115 |
| 375 | 3300025914 | Ga0207671_10390977 | Ga0207671_103909771 | 115 |
| 376 | 3300025914 | Ga0207671_10770275 | Ga0207671_107702752 | 115 |
| 377 | 3300025917 | Ga0207660_10124976 | Ga0207660_101249762 | 115 |
| 378 | 3300025917 | Ga0207660_10199417 | Ga0207660_101994173 | 115 |
| 379 | 3300025917 | Ga0207660_11054154 | Ga0207660_110541541 | 115 |
| 380 | 3300025918 | Ga0207662_10036297 | Ga0207662_100362972 | 115 |
| 381 | 3300025918 | Ga0207662_10042916 | Ga0207662_100429164 | 115 |
| 382 | 3300025919 | Ga0207657_10031777 | Ga0207657_100317775 | 115 |
| 383 | 3300025919 | Ga0207657_10440527 | Ga0207657_104405272 | 115 |
| 384 | 3300025920 | Ga0207649_10106206 | Ga0207649_101062062 | 115 |
| 385 | 3300025921 | Ga0207652_10060892 | Ga0207652_100608922 | 115 |
| 386 | 3300025923 | Ga0207681_10786564 | Ga0207681_107865642 | 115 |
| 387 | 3300025924 | Ga0207694_10819994 | Ga0207694_108199942 | 115 |
| 388 | 3300025925 | Ga0207650_10003481 | Ga0207650_1000348110 | 115 |
| 389 | 3300025926 | Ga0207659_10041151 | Ga0207659_100411513 | 115 |
| 390 | 3300025926 | Ga0207659_10083792 | Ga0207659_100837923 | 115 |
| 391 | 3300025929 | Ga0207664_10000074 | Ga0207664_1000007426 | 115 |
| 392 | 3300025931 | Ga0207644_10027943 | Ga0207644_100279437 | 115 |
| 393 | 3300025931 | Ga0207644_10264749 | Ga0207644_102647491 | 115 |
| 394 | 3300025932 | Ga0207690_10092924 | Ga0207690_100929244 | 115 |
| 395 | 3300025932 | Ga0207690_10735476 | Ga0207690_107354762 | 115 |
| 396 | 3300025933 | Ga0207706_10059914 | Ga0207706_100599142 | 115 |
| 397 | 3300025933 | Ga0207706_10500547 | Ga0207706_105005472 | 115 |
| 398 | 3300025934 | Ga0207686_10058976 | Ga0207686_100589762 | 115 |
| 399 | 3300025934 | Ga0207686_10689665 | Ga0207686_106896652 | 115 |
| 400 | 3300025935 | Ga0207709_10148897 | Ga0207709_101488972 | 115 |
| 401 | 3300025937 | Ga0207669_10052969 | Ga0207669_100529692 | 115 |
| 402 | 3300025938 | Ga0207704_10113671 | Ga0207704_101136712 | 115 |
| 403 | 3300025938 | Ga0207704_10694822 | Ga0207704_106948222 | 115 |
| 404 | 3300025939 | Ga0207665_10277014 | Ga0207665_102770142 | 115 |
| 405 | 3300025940 | Ga0207691_10072212 | Ga0207691_100722122 | 115 |
| 406 | 3300025940 | Ga0207691_10142987 | Ga0207691_101429872 | 115 |
| 407 | 3300025941 | Ga0207711_10277548 | Ga0207711_102775482 | 115 |
| 408 | 3300025941 | Ga0207711_10795102 | Ga0207711_107951022 | 115 |
| 409 | 3300025942 | Ga0207689_10008742 | Ga0207689_1000874210 | 115 |
| 410 | 3300025942 | Ga0207689_10738895 | Ga0207689_107388951 | 115 |
| 411 | 3300025944 | Ga0207661_10074429 | Ga0207661_100744292 | 115 |
| 412 | 3300025944 | Ga0207661_11153729 | Ga0207661_111537291 | 115 |
| 413 | 3300025945 | Ga0207679_10175991 | Ga0207679_101759913 | 115 |
| 414 | 3300025945 | Ga0207679_11210917 | Ga0207679_112109172 | 115 |
| 415 | 3300025949 | Ga0207667_10008347 | Ga0207667_100083475 | 115 |
| 416 | 3300025960 | Ga0207651_10552710 | Ga0207651_105527101 | 115 |
| 417 | 3300025961 | Ga0207712_10633744 | Ga0207712_106337442 | 115 |
| 418 | 3300025981 | Ga0207640_10144304 | Ga0207640_101443042 | 115 |
| 419 | 3300025986 | Ga0207658_10013733 | Ga0207658_100137336 | 115 |
| 420 | 3300025986 | Ga0207658_11242081 | Ga0207658_112420812 | 115 |
| 421 | 3300026023 | Ga0207677_10015903 | Ga0207677_100159033 | 115 |
| 422 | 3300026035 | Ga0207703_10065103 | Ga0207703_100651033 | 115 |
| 423 | 3300026041 | Ga0207639_10089629 | Ga0207639_100896292 | 115 |
| 424 | 3300026067 | Ga0207678_10032545 | Ga0207678_100325453 | 115 |
| 425 | 3300026067 | Ga0207678_10305489 | Ga0207678_103054892 | 115 |
| 426 | 3300026075 | Ga0207708_10000038 | Ga0207708_1000003818 | 115 |
| 427 | 3300026075 | Ga0207708_10197219 | Ga0207708_101972192 | 115 |
| 428 | 3300026075 | Ga0207708_10954537 | Ga0207708_109545371 | 115 |
| 429 | 3300026078 | Ga0207702_10016911 | Ga0207702_100169117 | 115 |
| 430 | 3300026078 | Ga0207702_10061015 | Ga0207702_100610155 | 115 |
| 431 | 3300026078 | Ga0207702_10429833 | Ga0207702_104298332 | 115 |
| 432 | 3300026088 | Ga0207641_11353176 | Ga0207641_113531762 | 115 |
| 433 | 3300026089 | Ga0207648_10000791 | Ga0207648_100007915 | 115 |
| 434 | 3300026089 | Ga0207648_10173261 | Ga0207648_101732611 | 115 |
| 435 | 3300026095 | Ga0207676_10004681 | Ga0207676_1000468110 | 115 |
| 436 | 3300026095 | Ga0207676_11134984 | Ga0207676_111349842 | 115 |
| 437 | 3300026116 | Ga0207674_10074232 | Ga0207674_100742323 | 115 |
| 438 | 3300026116 | Ga0207674_10485402 | Ga0207674_104854022 | 115 |
| 439 | 3300026118 | Ga0207675_100081690 | Ga0207675_1000816902 | 115 |
| 440 | 3300026121 | Ga0207683_10005295 | Ga0207683_100052956 | 115 |
| 441 | 3300026121 | Ga0207683_10254946 | Ga0207683_102549463 | 115 |
| 442 | 3300026142 | Ga0207698_10350739 | Ga0207698_103507392 | 115 |
| 443 | 3300026142 | Ga0207698_10489059 | Ga0207698_104890592 | 115 |
| 444 | 3300027907 | Ga0207428_10045123 | Ga0207428_100451235 | 115 |
| 445 | 3300028379 | Ga0268266_12271432 | Ga0268266_122714321 | 115 |
| 446 | 3300028380 | Ga0268265_10983058 | Ga0268265_109830582 | 115 |
| 447 | 3300028381 | Ga0268264_10874725 | Ga0268264_108747252 | 115 |
| 448 | 3300029285 | Ga0310981_1035178 | Ga0310981_10351781 | 115 |
| 449 | 3300031247 | Ga0265340_10019149 | Ga0265340_100191492 | 115 |
| 450 | 3300031456 | Ga0307513_10001645 | Ga0307513_1000164518 | 115 |
| 451 | 3300031548 | Ga0307408_100068924 | Ga0307408_1000689243 | 115 |
| 452 | 3300031548 | Ga0307408_100646044 | Ga0307408_1006460442 | 115 |
| 453 | 3300031727 | Ga0316576_10053892 | Ga0316576_100538923 | 115 |
| 454 | 3300031728 | Ga0316578_10229605 | Ga0316578_102296051 | 115 |
| 455 | 3300031731 | Ga0307405_10347368 | Ga0307405_103473682 | 115 |
| 456 | 3300031731 | Ga0307405_11450362 | Ga0307405_114503621 | 115 |
| 457 | 3300031824 | Ga0307413_10094194 | Ga0307413_100941941 | 115 |
| 458 | 3300031824 | Ga0307413_10115416 | Ga0307413_101154162 | 115 |
| 459 | 3300031824 | Ga0307413_10168344 | Ga0307413_101683442 | 115 |
| 460 | 3300031824 | Ga0307413_10564963 | Ga0307413_105649632 | 115 |
| 461 | 3300031852 | Ga0307410_10061170 | Ga0307410_100611702 | 115 |
| 462 | 3300031852 | Ga0307410_10093844 | Ga0307410_100938442 | 115 |
| 463 | 3300031852 | Ga0307410_10159586 | Ga0307410_101595861 | 115 |
| 464 | 3300031852 | Ga0307410_10252713 | Ga0307410_102527131 | 115 |
| 465 | 3300031852 | Ga0307410_10308428 | Ga0307410_103084282 | 115 |
| 466 | 3300031852 | Ga0307410_10667714 | Ga0307410_106677141 | 115 |
| 467 | 3300031852 | Ga0307410_11593889 | Ga0307410_115938891 | 115 |
| 468 | 3300031901 | Ga0307406_10046861 | Ga0307406_100468612 | 115 |
| 469 | 3300031901 | Ga0307406_10054504 | Ga0307406_100545042 | 115 |
| 470 | 3300031901 | Ga0307406_10166696 | Ga0307406_101666962 | 115 |
| 471 | 3300031901 | Ga0307406_10252750 | Ga0307406_102527501 | 115 |
| 472 | 3300031901 | Ga0307406_10446659 | Ga0307406_104466592 | 115 |
| 473 | 3300031901 | Ga0307406_10461123 | Ga0307406_104611232 | 115 |
| 474 | 3300031901 | Ga0307406_11042925 | Ga0307406_110429252 | 115 |
| 475 | 3300031903 | Ga0307407_10038070 | Ga0307407_100380702 | 115 |
| 476 | 3300031903 | Ga0307407_10110765 | Ga0307407_101107652 | 115 |
| 477 | 3300031903 | Ga0307407_10111440 | Ga0307407_101114401 | 115 |
| 478 | 3300031903 | Ga0307407_10685600 | Ga0307407_106856002 | 115 |
| 479 | 3300031995 | Ga0307409_100021978 | Ga0307409_1000219784 | 115 |
| 480 | 3300031995 | Ga0307409_100030729 | Ga0307409_1000307292 | 115 |
| 481 | 3300031995 | Ga0307409_100113279 | Ga0307409_1001132792 | 115 |
| 482 | 3300031995 | Ga0307409_100144899 | Ga0307409_1001448993 | 115 |
| 483 | 3300031995 | Ga0307409_100233596 | Ga0307409_1002335962 | 115 |
| 484 | 3300031995 | Ga0307409_100470610 | Ga0307409_1004706101 | 115 |
| 485 | 3300031995 | Ga0307409_100555237 | Ga0307409_1005552373 | 115 |
| 486 | 3300031995 | Ga0307409_100560076 | Ga0307409_1005600762 | 115 |
| 487 | 3300031995 | Ga0307409_101637708 | Ga0307409_1016377081 | 115 |
| 488 | 3300031995 | Ga0307409_102107766 | Ga0307409_1021077661 | 115 |
| 489 | 3300032002 | Ga0307416_100019059 | Ga0307416_1000190593 | 115 |
| 490 | 3300032002 | Ga0307416_100074220 | Ga0307416_1000742205 | 115 |
| 491 | 3300032002 | Ga0307416_100134924 | Ga0307416_1001349242 | 115 |
| 492 | 3300032002 | Ga0307416_100375603 | Ga0307416_1003756033 | 115 |
| 493 | 3300032002 | Ga0307416_100892800 | Ga0307416_1008928002 | 115 |
| 494 | 3300032004 | Ga0307414_10132521 | Ga0307414_101325213 | 115 |
| 495 | 3300032004 | Ga0307414_10255421 | Ga0307414_102554212 | 115 |
| 496 | 3300032004 | Ga0307414_10744643 | Ga0307414_107446432 | 115 |
| 497 | 3300032005 | Ga0307411_10055052 | Ga0307411_100550523 | 115 |
| 498 | 3300032126 | Ga0307415_100150557 | Ga0307415_1001505571 | 115 |
| 499 | 3300032126 | Ga0307415_100278278 | Ga0307415_1002782783 | 115 |
| 500 | 3300032126 | Ga0307415_100439606 | Ga0307415_1004396062 | 115 |
| 501 | 3300032126 | Ga0307415_100725307 | Ga0307415_1007253072 | 115 |
| 502 | 3300032126 | Ga0307415_101406780 | Ga0307415_1014067801 | 115 |
| 503 | 3300032126 | Ga0307415_101482482 | Ga0307415_1014824822 | 115 |
| 504 | 3300035092 | Ga0373952_0150446 | Ga0373952_0150446_263_610 | 115 |
| 505 | 3300035114 | Ga0373939_0128482 | Ga0373939_0128482_117_464 | 115 |
| 506 | 3300035115 | Ga0373941_0025167 | Ga0373941_0025167_608_964 | 115 |
| 507 | 3300035171 | Ga0373946_0364039 | Ga0373946_0364039_145_501 | 115 |
| 508 | 3300035242 | Ga0373962_0170854 | Ga0373962_0170854_47_394 | 115 |
| 509 | 3300035691 | Ga0373931_0103926 | Ga0373931_0103926_799_1146 | 115 |
| 510 | 3300035691 | Ga0373931_0116383 | Ga0373931_0116383_278_634 | 115 |
| 511 | 3300035695 | Ga0373927_0667869 | Ga0373927_0667869_300_656 | 115 |
| 512 | 3300035725 | Ga0373947_0708730 | Ga0373947_0708730_163_519 | 115 |
| 513 | 3300037312 | Ga0395899_0069827 | Ga0395899_0069827_2006_2362 | 115 |
| 514 | 3300037418 | Ga0395900_0364943 | Ga0395900_0364943_773_1129 | 115 |
| 515 | 3300037418 | Ga0395900_0544908 | Ga0395900_0544908_720_1076 | 115 |
| 516 | 3300037418 | Ga0395900_1616007 | Ga0395900_1616007_172_528 | 115 |
| 517 | 3300037466 | Ga0395898_0055976 | Ga0395898_0055976_570_926 | 115 |
| 518 | 3300037466 | Ga0395898_0197075 | Ga0395898_0197075_465_821 | 115 |
| 519 | 3300037466 | Ga0395898_0977710 | Ga0395898_0977710_97_456 | 115 |
| 520 | 3300037853 | Ga0436364_0015698 | Ga0436364_0015698_2938_3294 | 115 |
| 521 | 3300037853 | Ga0436364_1240818 | Ga0436364_1240818_12967_13314 | 115 |
| 522 | 3300038443 | Ga0395901_0028124 | Ga0395901_0028124_2575_2931 | 115 |
| 523 | 3300038443 | Ga0395901_1163335 | Ga0395901_1163335_182_538 | 115 |
| 524 | 3300039450 | Ga0436363_0419769 | Ga0436363_0419769_272_631 | 115 |
| 525 | 3300041444 | Ga0451790_03754 | Ga0451790_03754_264_623 | 115 |
| 526 | 3300041446 | Ga0451794_27686 | Ga0451794_27686_66_425 | 115 |
| 527 | 3300041451 | Ga0451791_1298264 | Ga0451791_1298264_583_942 | 115 |
| 528 | 3300041452 | Ga0451793_1234677 | Ga0451793_1234677_1316_1675 | 115 |
| 529 | 3300041453 | Ga0451797_1536272 | Ga0451797_1536272_1377_1724 | 115 |
| 530 | 3300041498 | Ga0451841_0812607 | Ga0451841_0812607_493_852 | 115 |
| 531 | 3300041507 | Ga0451851_0858940 | Ga0451851_0858940_207_554 | 115 |
| 532 | 3300041509 | Ga0451843_1132984 | Ga0451843_1132984_268_615 | 115 |
| 533 | 3300042005 | Ga0439448_0017498 | Ga0439448_0017498_1753_2109 | 115 |
| 534 | 3300042008 | Ga0439450_103098 | Ga0439450_103098_241_597 | 115 |
| 535 | 3300042016 | Ga0439463_090544 | Ga0439463_090544_99_455 | 115 |
| 536 | 3300042016 | Ga0439463_130461 | Ga0439463_130461_52_408 | 115 |
| 537 | 3300042157 | Ga0439458_0080796 | Ga0439458_0080796_23_379 | 115 |
| 538 | 3300042438 | Ga0439459_0002037 | Ga0439459_0002037_958_1314 | 115 |
| 539 | 3300042438 | Ga0439459_0226140 | Ga0439459_0226140_39_395 | 115 |
| 540 | 3300042533 | Ga0450901_024484 | Ga0450901_024484_50_406 | 115 |
| 541 | 3300042876 | Ga0451577_1706676 | Ga0451577_1706676_182_541 | 115 |
| 542 | 3300044656 | Ga0466969_0446088 | Ga0466969_0446088_205_561 | 115 |
| 543 | 3300044656 | Ga0466969_0503516 | Ga0466969_0503516_22_378 | 115 |
| 544 | 3300044658 | Ga0466972_0113828 | Ga0466972_0113828_512_868 | 115 |
| 545 | 3300044658 | Ga0466972_0172134 | Ga0466972_0172134_425_781 | 115 |
| 546 | 3300044658 | Ga0466972_0360972 | Ga0466972_0360972_44_403 | 115 |
| 547 | 3300044658 | Ga0466972_0446788 | Ga0466972_0446788_177_533 | 115 |
| 548 | 3300044683 | Ga0466965_0223347 | Ga0466965_0223347_79_435 | 115 |
| 549 | 3300044684 | Ga0466966_0171150 | Ga0466966_0171150_20_376 | 115 |
| 550 | 3300044684 | Ga0466966_0420282 | Ga0466966_0420282_290_646 | 115 |
| 551 | 3300044684 | Ga0466966_0440904 | Ga0466966_0440904_317_673 | 115 |
| 552 | 3300044684 | Ga0466966_0454419 | Ga0466966_0454419_341_697 | 115 |
| 553 | 3300044684 | Ga0466966_0525201 | Ga0466966_0525201_185_541 | 115 |
| 554 | 3300044684 | Ga0466966_0529490 | Ga0466966_0529490_167_523 | 115 |
| 555 | 3300044684 | Ga0466966_0981930 | Ga0466966_0981930_129_485 | 115 |
| 556 | 3300044693 | Ga0466961_0052078 | Ga0466961_0052078_1873_2229 | 115 |
| 557 | 3300044693 | Ga0466961_0143827 | Ga0466961_0143827_1079_1435 | 115 |
| 558 | 3300044693 | Ga0466961_0430413 | Ga0466961_0430413_363_719 | 115 |
| 559 | 3300044693 | Ga0466961_0911935 | Ga0466961_0911935_114_470 | 115 |
| 560 | 3300044694 | Ga0466963_0014526 | Ga0466963_0014526_2975_3331 | 115 |
| 561 | 3300044694 | Ga0466963_0028931 | Ga0466963_0028931_2214_2570 | 115 |
| 562 | 3300044694 | Ga0466963_0098004 | Ga0466963_0098004_627_983 | 115 |
| 563 | 3300044694 | Ga0466963_0181518 | Ga0466963_0181518_261_617 | 115 |
| 564 | 3300044694 | Ga0466963_0228978 | Ga0466963_0228978_167_523 | 115 |
| 565 | 3300044694 | Ga0466963_0398320 | Ga0466963_0398320_425_781 | 115 |
| 566 | 3300044694 | Ga0466963_0477357 | Ga0466963_0477357_436_792 | 115 |
| 567 | 3300044694 | Ga0466963_0854537 | Ga0466963_0854537_80_436 | 115 |
| 568 | 3300044706 | Ga0466964_0345727 | Ga0466964_0345727_325_681 | 115 |
| 569 | 3300044706 | Ga0466964_0472591 | Ga0466964_0472591_184_540 | 115 |
| 570 | 3300044706 | Ga0466964_0499535 | Ga0466964_0499535_228_584 | 115 |
| 571 | 3300044719 | Ga0466971_0011648 | Ga0466971_0011648_1282_1638 | 115 |
| 572 | 3300044719 | Ga0466971_0063406 | Ga0466971_0063406_1124_1480 | 115 |
| 573 | 3300044719 | Ga0466971_0305531 | Ga0466971_0305531_314_670 | 115 |
| 574 | 3300044719 | Ga0466971_0487446 | Ga0466971_0487446_203_559 | 115 |
| 575 | 3300044735 | Ga0466968_0373528 | Ga0466968_0373528_18_374 | 115 |
| 576 | 3300044735 | Ga0466968_0746118 | Ga0466968_0746118_76_432 | 115 |
| 577 | 3300044765 | Ga0466970_0025462 | Ga0466970_0025462_111_467 | 115 |
| 578 | 3300044765 | Ga0466970_0064379 | Ga0466970_0064379_1356_1715 | 115 |
| 579 | 3300044765 | Ga0466970_0143955 | Ga0466970_0143955_294_650 | 115 |
| 580 | 3300044765 | Ga0466970_0460741 | Ga0466970_0460741_337_693 | 115 |
| 581 | 3300044765 | Ga0466970_0905803 | Ga0466970_0905803_133_489 | 115 |
| 582 | 3300044842 | Ga0466957_0044337 | Ga0466957_0044337_1972_2328 | 115 |
| 583 | 3300044842 | Ga0466957_0074035 | Ga0466957_0074035_135_491 | 115 |
| 584 | 3300044842 | Ga0466957_0091115 | Ga0466957_0091115_133_489 | 115 |
| 585 | 3300044842 | Ga0466957_0109985 | Ga0466957_0109985_809_1165 | 115 |
| 586 | 3300044842 | Ga0466957_0145874 | Ga0466957_0145874_310_666 | 115 |
| 587 | 3300044842 | Ga0466957_0247638 | Ga0466957_0247638_683_1039 | 115 |
| 588 | 3300044842 | Ga0466957_0288429 | Ga0466957_0288429_676_1032 | 115 |
| 589 | 3300044842 | Ga0466957_0760955 | Ga0466957_0760955_192_548 | 115 |
| 590 | 3300044842 | Ga0466957_0801704 | Ga0466957_0801704_175_531 | 115 |
| 591 | 3300044901 | Ga0466960_0085719 | Ga0466960_0085719_1180_1536 | 115 |
| 592 | 3300044901 | Ga0466960_0259110 | Ga0466960_0259110_602_958 | 115 |
| 593 | 3300044901 | Ga0466960_0332823 | Ga0466960_0332823_450_806 | 115 |
| 594 | 3300044901 | Ga0466960_0741557 | Ga0466960_0741557_34_390 | 115 |
| 595 | 3300044901 | Ga0466960_0778339 | Ga0466960_0778339_142_498 | 115 |
| 596 | 3300045049 | Ga0466959_0038875 | Ga0466959_0038875_3117_3473 | 115 |
| 597 | 3300045049 | Ga0466959_0067574 | Ga0466959_0067574_1518_1874 | 115 |
| 598 | 3300045049 | Ga0466959_0213082 | Ga0466959_0213082_966_1322 | 115 |
| 599 | 3300045049 | Ga0466959_0247785 | Ga0466959_0247785_357_713 | 115 |
| 600 | 3300045049 | Ga0466959_0764431 | Ga0466959_0764431_33_389 | 115 |
| 601 | 3300045836 | Ga0466958_0012760 | Ga0466958_0012760_2700_3056 | 115 |
| 602 | 3300045836 | Ga0466958_0056863 | Ga0466958_0056863_1177_1533 | 115 |
| 603 | 3300045836 | Ga0466958_0079976 | Ga0466958_0079976_943_1299 | 115 |
| 604 | 3300045836 | Ga0466958_0345485 | Ga0466958_0345485_23_379 | 115 |
| 605 | 3300045836 | Ga0466958_0353209 | Ga0466958_0353209_533_889 | 115 |
| 606 | 3300045976 | Ga0466967_0018985 | Ga0466967_0018985_4943_5299 | 115 |
| 607 | 3300045976 | Ga0466967_0044355 | Ga0466967_0044355_2184_2540 | 115 |
| 608 | 3300045976 | Ga0466967_0052834 | Ga0466967_0052834_1702_2058 | 115 |
| 609 | 3300045976 | Ga0466967_0190583 | Ga0466967_0190583_18_374 | 115 |
| 610 | 3300045976 | Ga0466967_0236855 | Ga0466967_0236855_481_837 | 115 |
| 611 | 3300045976 | Ga0466967_0997036 | Ga0466967_0997036_339_695 | 115 |
| 612 | 3300046460 | Ga0495638_0021586 | Ga0495638_0021586_1435_1794 | 115 |
| 613 | 3300046473 | Ga0495582_0712604 | Ga0495582_0712604_137_493 | 115 |
| 614 | 3300046500 | Ga0495596_0314237 | Ga0495596_0314237_19_375 | 115 |
| 615 | 3300046530 | Ga0495654_0311109 | Ga0495654_0311109_68_424 | 115 |
| 616 | 3300046533 | Ga0495640_0722461 | Ga0495640_0722461_107_463 | 115 |
| 617 | 3300046615 | Ga0495656_0048916 | Ga0495656_0048916_438_794 | 115 |
| 618 | 3300046648 | Ga0495611_0366612 | Ga0495611_0366612_105_461 | 115 |
| 619 | 3300046665 | Ga0495661_0193687 | Ga0495661_0193687_394_750 | 115 |
| 620 | 3300046691 | Ga0495670_0318576 | Ga0495670_0318576_160_516 | 115 |
| 621 | 3300047318 | Ga0495636_0228364 | Ga0495636_0228364_83_439 | 115 |
| 622 | 3300047319 | Ga0495674_1137700 | Ga0495674_1137700_89_445 | 115 |
| 623 | 3300047321 | Ga0495676_1078376 | Ga0495676_1078376_56_412 | 115 |
| 624 | 3300047471 | Ga0495684_0859343 | Ga0495684_0859343_179_535 | 115 |
| 625 | 3300047673 | Ga0495593_0497878 | Ga0495593_0497878_133_489 | 115 |
| 626 | 3300048903 | Ga0496100_0027222 | Ga0496100_0027222_965_1312 | 115 |
| 627 | 3300048903 | Ga0496100_0693152 | Ga0496100_0693152_38_394 | 115 |
| 628 | 3300048904 | Ga0496101_0019706 | Ga0496101_0019706_2218_2565 | 115 |
| 629 | 3300048904 | Ga0496101_0074802 | Ga0496101_0074802_1886_2242 | 115 |
| 630 | 3300048905 | Ga0496102_0029226 | Ga0496102_0029226_2160_2519 | 115 |
| 631 | 3300048905 | Ga0496102_0057858 | Ga0496102_0057858_677_1033 | 115 |
| 632 | 3300048905 | Ga0496102_0062378 | Ga0496102_0062378_377_733 | 115 |
| 633 | 3300048905 | Ga0496102_0831254 | Ga0496102_0831254_182_538 | 115 |
| 634 | 3300048906 | Ga0496103_0025995 | Ga0496103_0025995_2558_2914 | 115 |
| 635 | 3300048906 | Ga0496103_0071303 | Ga0496103_0071303_1011_1370 | 115 |
| 636 | 3300048906 | Ga0496103_0254815 | Ga0496103_0254815_489_845 | 115 |
| 637 | 3300048906 | Ga0496103_0962290 | Ga0496103_0962290_82_438 | 115 |
| 638 | 3300048907 | Ga0496104_0014881 | Ga0496104_0014881_2284_2640 | 115 |
| 639 | 3300048907 | Ga0496104_0239789 | Ga0496104_0239789_248_595 | 115 |
| 640 | 3300048908 | Ga0496105_0002556 | Ga0496105_0002556_118_474 | 115 |
| 641 | 3300048908 | Ga0496105_0026209 | Ga0496105_0026209_3375_3722 | 115 |
| 642 | 3300048909 | Ga0496106_0027625 | Ga0496106_0027625_170_526 | 115 |
| 643 | 3300048909 | Ga0496106_0179373 | Ga0496106_0179373_278_625 | 115 |
| 644 | 3300048910 | Ga0496107_0045567 | Ga0496107_0045567_358_714 | 115 |
| 645 | 3300048910 | Ga0496107_0081284 | Ga0496107_0081284_1538_1885 | 115 |
| 646 | 3300048910 | Ga0496107_1355052 | Ga0496107_1355052_107_463 | 115 |
| 647 | 3300048911 | Ga0496108_0110189 | Ga0496108_0110189_1070_1426 | 115 |
| 648 | 3300048911 | Ga0496108_0508321 | Ga0496108_0508321_467_814 | 115 |
| 649 | 3300048912 | Ga0496109_0129313 | Ga0496109_0129313_1073_1429 | 115 |
| 650 | 3300048912 | Ga0496109_0628631 | Ga0496109_0628631_464_820 | 115 |
| 651 | 3300048913 | Ga0496110_0010215 | Ga0496110_0010215_161_517 | 115 |
| 652 | 3300048913 | Ga0496110_0055620 | Ga0496110_0055620_2174_2521 | 115 |
| 653 | 3300048914 | Ga0496111_0020293 | Ga0496111_0020293_423_779 | 115 |
| 654 | 3300048914 | Ga0496111_0192641 | Ga0496111_0192641_753_1100 | 115 |
| 655 | 3300048915 | Ga0496112_0043364 | Ga0496112_0043364_3771_4130 | 115 |
| 656 | 3300048915 | Ga0496112_1099633 | Ga0496112_1099633_291_647 | 115 |
| 657 | 3300048915 | Ga0496112_1470125 | Ga0496112_1470125_48_404 | 115 |
| 658 | 3300048916 | Ga0496113_0464820 | Ga0496113_0464820_620_976 | 115 |
| 659 | 3300048916 | Ga0496113_0749279 | Ga0496113_0749279_412_768 | 115 |
| 660 | 3300048916 | Ga0496113_0867380 | Ga0496113_0867380_197_544 | 115 |
| 661 | 3300048917 | Ga0496114_0015303 | Ga0496114_0015303_567_914 | 115 |
| 662 | 3300048917 | Ga0496114_0596319 | Ga0496114_0596319_549_908 | 115 |
| 663 | 3300048922 | Ga0496119_0478656 | Ga0496119_0478656_202_558 | 115 |
| 664 | 3300048924 | Ga0496121_0107424 | Ga0496121_0107424_1300_1656 | 115 |
| 665 | 3300049127 | Ga0501306_108022 | Ga0501306_108022_107_463 | 115 |
| 666 | 3300049128 | Ga0501308_068801 | Ga0501308_068801_63_410 | 115 |
| 667 | 3300049128 | Ga0501308_077349 | Ga0501308_077349_120_467 | 115 |
| 668 | 3300049129 | Ga0501309_051092 | Ga0501309_051092_125_481 | 115 |
| 669 | 3300049161 | Ga0501305_069521 | Ga0501305_069521_117_473 | 115 |
| 670 | 3300049522 | Ga0501299_112720 | Ga0501299_112720_134_490 | 115 |
| 671 | 3300049534 | Ga0501318_013508 | Ga0501318_013508_271_627 | 115 |
| 672 | 3300049534 | Ga0501318_034880 | Ga0501318_034880_210_566 | 115 |
| 673 | 3300049537 | Ga0501321_030912 | Ga0501321_030912_217_573 | 115 |
| 674 | 3300049537 | Ga0501321_085692 | Ga0501321_085692_23_379 | 115 |
| 675 | 3300049540 | Ga0501324_021226 | Ga0501324_021226_38_394 | 115 |
| 676 | 3300049571 | Ga0501034_0219254 | Ga0501034_0219254_745_1092 | 115 |
| 677 | 3300049572 | Ga0501036_1681471 | Ga0501036_1681471_62_409 | 115 |
| 678 | 3300049574 | Ga0501038_0780973 | Ga0501038_0780973_20_424 | 115 |
| 679 | 3300049575 | Ga0501039_0731267 | Ga0501039_0731267_307_663 | 115 |
| 680 | 3300049576 | Ga0501040_0549096 | Ga0501040_0549096_336_692 | 115 |
| 681 | 3300049577 | Ga0501041_0461445 | Ga0501041_0461445_214_570 | 115 |
| 682 | 3300049577 | Ga0501041_1113318 | Ga0501041_1113318_89_448 | 115 |
| 683 | 3300049582 | Ga0501048_0475757 | Ga0501048_0475757_168_524 | 115 |
| 684 | 3300049587 | Ga0501071_0717463 | Ga0501071_0717463_153_509 | 115 |
| 685 | 3300049593 | Ga0501077_0762965 | Ga0501077_0762965_102_458 | 115 |
| 686 | 3300049653 | Ga0501206_071852 | Ga0501206_071852_209_565 | 115 |
| 687 | 3300049661 | Ga0501217_329327 | Ga0501217_329327_71_427 | 115 |
| 688 | 3300049667 | Ga0501230_050159 | Ga0501230_050159_344_691 | 115 |
| 689 | 3300049741 | Ga0501079_0790151 | Ga0501079_0790151_183_539 | 115 |
| 690 | 3300049779 | Ga0501283_110602 | Ga0501283_110602_145_501 | 115 |
| 691 | 3300049824 | Ga0501045_0940722 | Ga0501045_0940722_52_408 | 115 |
| 692 | 3300049851 | Ga0501212_044926 | Ga0501212_044926_253_609 | 115 |
| 693 | 3300050490 | nmdc:mga03n38_556311_c1 | nmdc:mga03n38_556311_c1_291_638 | 115 |
| 694 | 3300050491 | nmdc:mga00v17_283425_c1 | nmdc:mga00v17_283425_c1_234_581 | 115 |
| 695 | 3300050492 | nmdc:mga0yw44_655894_c1 | nmdc:mga0yw44_655894_c1_102_449 | 115 |
| 696 | 3300050493 | nmdc:mga0k408_309561_c1 | nmdc:mga0k408_309561_c1_394_741 | 115 |
| 697 | 3300050496 | nmdc:mga07m45_386664_c1 | nmdc:mga07m45_386664_c1_402_749 | 115 |
| 698 | 3300050507 | nmdc:mga05p37_168354_c1 | nmdc:mga05p37_168354_c1_88_444 | 115 |
| 699 | 3300050508 | nmdc:mga09592_242618_c1 | nmdc:mga09592_242618_c1_24_380 | 115 |
| 700 | 3300050511 | nmdc:mga08y16_8126_c1 | nmdc:mga08y16_8126_c1_2392_2748 | 115 |
| 701 | 3300050512 | nmdc:mga0n895_50638_c1 | nmdc:mga0n895_50638_c1_3416_3772 | 115 |
| 702 | 3300050513 | nmdc:mga0rr50_189702_c1 | nmdc:mga0rr50_189702_c1_928_1284 | 115 |
| 703 | 3300050514 | nmdc:mga08x19_3690_c1 | nmdc:mga08x19_3690_c1_564_920 | 115 |
| 704 | 3300050515 | nmdc:mga0a205_90473_c1 | nmdc:mga0a205_90473_c1_114_470 | 115 |
| 705 | 3300053085 | Ga0495619_0698039 | Ga0495619_0698039_260_619 | 115 |
| 706 | 3300053090 | Ga0500646_0085751 | Ga0500646_0085751_98_445 | 115 |
| 707 | 3300053117 | Ga0500593_051396 | Ga0500593_051396_162_509 | 115 |
| 708 | 3300053117 | Ga0500593_139492 | Ga0500593_139492_156_515 | 115 |
| 709 | 3300053153 | Ga0500616_0001526 | Ga0500616_0001526_18712_19071 | 115 |
| 710 | 3300053739 | Ga0500587_059787 | Ga0500587_059787_45_401 | 115 |
| 711 | 3300054114 | Ga0501084_0984585 | Ga0501084_0984585_277_633 | 115 |
| 712 | 3300059477 | Ga0587084_124884 | Ga0587084_124884_136_492 | 115 |
| 713 | 3300059492 | Ga0587073_0176173 | Ga0587073_0176173_181_534 | 115 |
| 714 | 3300059492 | Ga0587073_0335136 | Ga0587073_0335136_136_492 | 115 |
| 715 | 3300059503 | Ga0587080_110456 | Ga0587080_110456_14_370 | 115 |
| 716 | 3300059505 | Ga0587083_0076057 | Ga0587083_0076057_134_481 | 115 |
| 717 | 3300059506 | Ga0587085_010526 | Ga0587085_010526_193_546 | 115 |
| 718 | 3300059508 | Ga0587088_127822 | Ga0587088_127822_143_499 | 115 |
| 719 | 3300059511 | Ga0587091_008928 | Ga0587091_008928_385_744 | 115 |
| 720 | 3300059511 | Ga0587091_127304 | Ga0587091_127304_50_409 | 115 |
| 721 | 3300059511 | Ga0587091_129478 | Ga0587091_129478_138_494 | 115 |
| 722 | 3300059513 | Ga0587094_044011 | Ga0587094_044011_160_513 | 115 |
| 723 | 3300059605 | Ga0587106_136977 | Ga0587106_136977_62_421 | 115 |
| 724 | 3300059622 | Ga0587099_037994 | Ga0587099_037994_170_523 | 115 |
| 725 | 3300059623 | Ga0587101_153575 | Ga0587101_153575_14_370 | 115 |
| 726 | 3300059626 | Ga0587115_117682 | Ga0587115_117682_117_476 | 115 |
| 727 | 3300059628 | Ga0587122_036320 | Ga0587122_036320_74_427 | 115 |
| 728 | 3300059630 | Ga0587128_091779 | Ga0587128_091779_107_463 | 115 |
| 729 | 3300059631 | Ga0587130_019187 | Ga0587130_019187_196_549 | 115 |
| 730 | 3300059640 | Ga0587067_213509 | Ga0587067_213509_134_490 | 115 |
| 731 | 3300059640 | Ga0587067_230846 | Ga0587067_230846_132_488 | 115 |
| 732 | 3300059641 | Ga0587068_161250 | Ga0587068_161250_106_465 | 115 |
| 733 | 3300059643 | Ga0587072_163732 | Ga0587072_163732_78_437 | 115 |
| 734 | 3300059645 | Ga0587076_193782 | Ga0587076_193782_100_456 | 115 |
| 735 | 3300059653 | Ga0587108_014746 | Ga0587108_014746_89_448 | 115 |
| 736 | 3300059655 | Ga0587114_058829 | Ga0587114_058829_211_567 | 115 |
| 737 | 3300060243 | Ga0587060_025524 | Ga0587060_025524_170_523 | 115 |
| 738 | 3300060346 | Ga0587111_0149818 | Ga0587111_0149818_180_536 | 115 |
| 739 | 3300061719 | Ga0466962_0155377 | Ga0466962_0155377_535_891 | 115 |
| 740 | 3300061719 | Ga0466962_0155536 | Ga0466962_0155536_704_1060 | 115 |
| 741 | 3300061719 | Ga0466962_0614769 | Ga0466962_0614769_57_413 | 115 |
| 742 | 3300061719 | Ga0466962_0687160 | Ga0466962_0687160_84_440 | 115 |
| 743 | 2209111006 | 2214637478 | 2213666977 | 116 |
| 744 | 3300001989 | JGI24739J22299_10068969 | JGI24739J22299_100689692 | 116 |
| 745 | 3300001990 | JGI24737J22298_10026270 | JGI24737J22298_100262702 | 116 |
| 746 | 3300002067 | JGI24735J21928_10195025 | JGI24735J21928_101950251 | 116 |
| 747 | 3300002075 | JGI24738J21930_10007820 | JGI24738J21930_100078203 | 116 |
| 748 | 3300003316 | rootH1_10010292 | rootH1_100102925 | 116 |
| 749 | 3300003856 | Ga0058692_1024712 | Ga0058692_10247121 | 116 |
| 750 | 3300005329 | Ga0070683_100353724 | Ga0070683_1003537242 | 116 |
| 751 | 3300005536 | Ga0070697_101858954 | Ga0070697_1018589541 | 116 |
| 752 | 3300005539 | Ga0068853_100051137 | Ga0068853_1000511373 | 116 |
| 753 | 3300005543 | Ga0070672_101547359 | Ga0070672_1015473592 | 116 |
| 754 | 3300005548 | Ga0070665_100115915 | Ga0070665_1001159153 | 116 |
| 755 | 3300005563 | Ga0068855_100818276 | Ga0068855_1008182761 | 116 |
| 756 | 3300005577 | Ga0068857_101642883 | Ga0068857_1016428831 | 116 |
| 757 | 3300005578 | Ga0068854_100172269 | Ga0068854_1001722692 | 116 |
| 758 | 3300005614 | Ga0068856_100709988 | Ga0068856_1007099882 | 116 |
| 759 | 3300005615 | Ga0070702_100978694 | Ga0070702_1009786941 | 116 |
| 760 | 3300005843 | Ga0068860_101673940 | Ga0068860_1016739401 | 116 |
| 761 | 3300005937 | Ga0081455_10000841 | Ga0081455_1000084137 | 116 |
| 762 | 3300006178 | Ga0075367_10065028 | Ga0075367_100650283 | 116 |
| 763 | 3300006353 | Ga0075370_10114704 | Ga0075370_101147042 | 116 |
| 764 | 3300006844 | Ga0075428_102576154 | Ga0075428_1025761541 | 116 |
| 765 | 3300006948 | Ga0099826_10047403 | Ga0099826_100474034 | 116 |
| 766 | 3300009011 | Ga0105251_10073292 | Ga0105251_100732922 | 116 |
| 767 | 3300009036 | Ga0105244_10166265 | Ga0105244_101662652 | 116 |
| 768 | 3300009094 | Ga0111539_11269307 | Ga0111539_112693072 | 116 |
| 769 | 3300009148 | Ga0105243_10616657 | Ga0105243_106166572 | 116 |
| 770 | 3300009176 | Ga0105242_10531799 | Ga0105242_105317992 | 116 |
| 771 | 3300009551 | Ga0105238_10291505 | Ga0105238_102915052 | 116 |
| 772 | 3300009551 | Ga0105238_12620460 | Ga0105238_126204601 | 116 |
| 773 | 3300010375 | Ga0105239_10921052 | Ga0105239_109210521 | 116 |
| 774 | 3300011119 | Ga0105246_10137672 | Ga0105246_101376721 | 116 |
| 775 | 3300012512 | Ga0157327_1072430 | Ga0157327_10724301 | 116 |
| 776 | 3300013062 | Ga0154010_142966 | Ga0154010_1429661 | 116 |
| 777 | 3300013105 | Ga0157369_10068099 | Ga0157369_100680994 | 116 |
| 778 | 3300013306 | Ga0163162_11726437 | Ga0163162_117264371 | 116 |
| 779 | 3300013307 | Ga0157372_10072973 | Ga0157372_100729734 | 116 |
| 780 | 3300013307 | Ga0157372_10846462 | Ga0157372_108464622 | 116 |
| 781 | 3300014497 | Ga0182008_10000192 | Ga0182008_1000019228 | 116 |
| 782 | 3300014969 | Ga0157376_11449097 | Ga0157376_114490972 | 116 |
| 783 | 3300015261 | Ga0182006_1008560 | Ga0182006_10085606 | 116 |
| 784 | 3300015262 | Ga0182007_10000165 | Ga0182007_1000016538 | 116 |
| 785 | 3300015265 | Ga0182005_1014651 | Ga0182005_10146512 | 116 |
| 786 | 3300015688 | Ga0183367_1013 | Ga0183367_1013109 | 116 |
| 787 | 3300020070 | Ga0206356_11196099 | Ga0206356_111960991 | 116 |
| 788 | 3300020070 | Ga0206356_11249890 | Ga0206356_112498901 | 116 |
| 789 | 3300020075 | Ga0206349_1321064 | Ga0206349_13210641 | 116 |
| 790 | 3300020076 | Ga0206355_1292636 | Ga0206355_12926361 | 116 |
| 791 | 3300020078 | Ga0206352_10120208 | Ga0206352_101202081 | 116 |
| 792 | 3300020080 | Ga0206350_10420881 | Ga0206350_104208811 | 116 |
| 793 | 3300022467 | Ga0224712_10237984 | Ga0224712_102379842 | 116 |
| 794 | 3300025904 | Ga0207647_10005464 | Ga0207647_100054643 | 116 |
| 795 | 3300025924 | Ga0207694_10234848 | Ga0207694_102348483 | 116 |
| 796 | 3300025933 | Ga0207706_10612862 | Ga0207706_106128621 | 116 |
| 797 | 3300025935 | Ga0207709_10171834 | Ga0207709_101718341 | 116 |
| 798 | 3300025937 | Ga0207669_10707120 | Ga0207669_107071202 | 116 |
| 799 | 3300025938 | Ga0207704_11090714 | Ga0207704_110907142 | 116 |
| 800 | 3300025942 | Ga0207689_11805296 | Ga0207689_118052961 | 116 |
| 801 | 3300025949 | Ga0207667_10961805 | Ga0207667_109618052 | 116 |
| 802 | 3300025961 | Ga0207712_11124983 | Ga0207712_111249831 | 116 |
| 803 | 3300025981 | Ga0207640_10132995 | Ga0207640_101329952 | 116 |
| 804 | 3300026041 | Ga0207639_10013447 | Ga0207639_100134473 | 116 |
| 805 | 3300026067 | Ga0207678_10705127 | Ga0207678_107051272 | 116 |
| 806 | 3300026078 | Ga0207702_10676833 | Ga0207702_106768332 | 116 |
| 807 | 3300026116 | Ga0207674_10694103 | Ga0207674_106941031 | 116 |
| 808 | 3300026118 | Ga0207675_100212568 | Ga0207675_1002125682 | 116 |
| 809 | 3300027666 | Ga0209282_1059004 | Ga0209282_10590042 | 116 |
| 810 | 3300028379 | Ga0268266_10112928 | Ga0268266_101129283 | 116 |
| 811 | 3300028381 | Ga0268264_10993032 | Ga0268264_109930322 | 116 |
| 812 | 3300028786 | Ga0307517_10006461 | Ga0307517_100064617 | 116 |
| 813 | 3300029285 | Ga0310981_1041595 | Ga0310981_10415952 | 116 |
| 814 | 3300030500 | Ga0268256_1087008 | Ga0268256_10870081 | 116 |
| 815 | 3300030522 | Ga0307512_10003420 | Ga0307512_1000342014 | 116 |
| 816 | 3300031456 | Ga0307513_10040582 | Ga0307513_100405821 | 116 |
| 817 | 3300031507 | Ga0307509_10283304 | Ga0307509_102833041 | 116 |
| 818 | 3300031548 | Ga0307408_102077793 | Ga0307408_1020777931 | 116 |
| 819 | 3300031616 | Ga0307508_10117044 | Ga0307508_101170443 | 116 |
| 820 | 3300031616 | Ga0307508_10209470 | Ga0307508_102094702 | 116 |
| 821 | 3300031616 | Ga0307508_10225626 | Ga0307508_102256262 | 116 |
| 822 | 3300031730 | Ga0307516_10069653 | Ga0307516_100696533 | 116 |
| 823 | 3300031731 | Ga0307405_10978194 | Ga0307405_109781942 | 116 |
| 824 | 3300031852 | Ga0307410_10034538 | Ga0307410_100345384 | 116 |
| 825 | 3300031852 | Ga0307410_11551088 | Ga0307410_115510881 | 116 |
| 826 | 3300031995 | Ga0307409_101229459 | Ga0307409_1012294592 | 116 |
| 827 | 3300032002 | Ga0307416_100405564 | Ga0307416_1004055642 | 116 |
| 828 | 3300032002 | Ga0307416_101177373 | Ga0307416_1011773732 | 116 |
| 829 | 3300033179 | Ga0307507_10050576 | Ga0307507_100505763 | 116 |
| 830 | 3300035398 | Ga0316574_0015038 | Ga0316574_0015038_2424_2804 | 116 |
| 831 | 3300041406 | Ga0439439_0107685 | Ga0439439_0107685_88_468 | 116 |
| 832 | 3300041453 | Ga0451797_1390623 | Ga0451797_1390623_740_1090 | 116 |
| 833 | 3300041457 | Ga0451803_04285 | Ga0451803_04285_91_441 | 116 |
| 834 | 3300041491 | Ga0451833_0338502 | Ga0451833_0338502_134_484 | 116 |
| 835 | 3300041492 | Ga0451835_1157284 | Ga0451835_1157284_185_535 | 116 |
| 836 | 3300041494 | Ga0451837_0109316 | Ga0451837_0109316_649_999 | 116 |
| 837 | 3300041501 | Ga0451845_0415626 | Ga0451845_0415626_731_1081 | 116 |
| 838 | 3300041506 | Ga0451850_36237 | Ga0451850_36237_67_417 | 116 |
| 839 | 3300041907 | Ga0452268_01162 | Ga0452268_01162_94_444 | 116 |
| 840 | 3300041997 | Ga0439431_0257699 | Ga0439431_0257699_81_431 | 116 |
| 841 | 3300042004 | Ga0439445_0027638 | Ga0439445_0027638_49_429 | 116 |
| 842 | 3300042005 | Ga0439448_0001321 | Ga0439448_0001321_5283_5633 | 116 |
| 843 | 3300042008 | Ga0439450_078273 | Ga0439450_078273_231_581 | 116 |
| 844 | 3300042012 | Ga0439455_0000697 | Ga0439455_0000697_2707_3057 | 116 |
| 845 | 3300042014 | Ga0439457_001462 | Ga0439457_001462_6213_6563 | 116 |
| 846 | 3300042115 | Ga0450911_036247 | Ga0450911_036247_216_566 | 116 |
| 847 | 3300042131 | Ga0450894_000097 | Ga0450894_000097_8020_8370 | 116 |
| 848 | 3300042135 | Ga0450899_001301 | Ga0450899_001301_1900_2250 | 116 |
| 849 | 3300042136 | Ga0450900_020528 | Ga0450900_020528_438_812 | 116 |
| 850 | 3300042138 | Ga0450903_000108 | Ga0450903_000108_6651_7001 | 116 |
| 851 | 3300042145 | Ga0450906_000741 | Ga0450906_000741_2197_2547 | 116 |
| 852 | 3300042157 | Ga0439458_0001252 | Ga0439458_0001252_2344_2694 | 116 |
| 853 | 3300042184 | Ga0450908_004744 | Ga0450908_004744_2041_2391 | 116 |
| 854 | 3300044656 | Ga0466969_0000702 | Ga0466969_0000702_1314_1664 | 116 |
| 855 | 3300044656 | Ga0466969_0003828 | Ga0466969_0003828_3137_3487 | 116 |
| 856 | 3300044656 | Ga0466969_0005495 | Ga0466969_0005495_4099_4449 | 116 |
| 857 | 3300044658 | Ga0466972_0002160 | Ga0466972_0002160_8122_8472 | 116 |
| 858 | 3300044658 | Ga0466972_0007644 | Ga0466972_0007644_2294_2644 | 116 |
| 859 | 3300044658 | Ga0466972_0240215 | Ga0466972_0240215_59_409 | 116 |
| 860 | 3300044683 | Ga0466965_0000386 | Ga0466965_0000386_11123_11473 | 116 |
| 861 | 3300044684 | Ga0466966_0001246 | Ga0466966_0001246_4707_5057 | 116 |
| 862 | 3300044684 | Ga0466966_0015896 | Ga0466966_0015896_1615_1965 | 116 |
| 863 | 3300044693 | Ga0466961_0002056 | Ga0466961_0002056_7997_8347 | 116 |
| 864 | 3300044693 | Ga0466961_0039678 | Ga0466961_0039678_1080_1430 | 116 |
| 865 | 3300044693 | Ga0466961_0236849 | Ga0466961_0236849_755_1105 | 116 |
| 866 | 3300044693 | Ga0466961_0364814 | Ga0466961_0364814_12_362 | 116 |
| 867 | 3300044694 | Ga0466963_0000197 | Ga0466963_0000197_18408_18758 | 116 |
| 868 | 3300044694 | Ga0466963_0020849 | Ga0466963_0020849_3062_3412 | 116 |
| 869 | 3300044706 | Ga0466964_0067739 | Ga0466964_0067739_270_620 | 116 |
| 870 | 3300044719 | Ga0466971_0000315 | Ga0466971_0000315_16010_16360 | 116 |
| 871 | 3300044719 | Ga0466971_0028463 | Ga0466971_0028463_558_908 | 116 |
| 872 | 3300044719 | Ga0466971_0146909 | Ga0466971_0146909_665_1015 | 116 |
| 873 | 3300044765 | Ga0466970_0000309 | Ga0466970_0000309_13617_13967 | 116 |
| 874 | 3300044765 | Ga0466970_0010660 | Ga0466970_0010660_1897_2247 | 116 |
| 875 | 3300044842 | Ga0466957_0002768 | Ga0466957_0002768_4827_5177 | 116 |
| 876 | 3300044842 | Ga0466957_0607325 | Ga0466957_0607325_288_638 | 116 |
| 877 | 3300045049 | Ga0466959_0001433 | Ga0466959_0001433_9869_10219 | 116 |
| 878 | 3300045049 | Ga0466959_0090817 | Ga0466959_0090817_1722_2072 | 116 |
| 879 | 3300045049 | Ga0466959_0317905 | Ga0466959_0317905_438_788 | 116 |
| 880 | 3300045836 | Ga0466958_0002057 | Ga0466958_0002057_5059_5409 | 116 |
| 881 | 3300045836 | Ga0466958_0234619 | Ga0466958_0234619_72_422 | 116 |
| 882 | 3300045836 | Ga0466958_0899937 | Ga0466958_0899937_70_420 | 116 |
| 883 | 3300045976 | Ga0466967_0026295 | Ga0466967_0026295_1198_1548 | 116 |
| 884 | 3300045976 | Ga0466967_0069564 | Ga0466967_0069564_501_851 | 116 |
| 885 | 3300045976 | Ga0466967_0194681 | Ga0466967_0194681_12_362 | 116 |
| 886 | 3300046454 | Ga0495592_0008402 | Ga0495592_0008402_4186_4563 | 116 |
| 887 | 3300046455 | Ga0495603_0002384 | Ga0495603_0002384_10266_10643 | 116 |
| 888 | 3300046455 | Ga0495603_0005417 | Ga0495603_0005417_235_612 | 116 |
| 889 | 3300046455 | Ga0495603_0164273 | Ga0495603_0164273_88_498 | 116 |
| 890 | 3300046455 | Ga0495603_0714975 | Ga0495603_0714975_73_450 | 116 |
| 891 | 3300046459 | Ga0495629_0003973 | Ga0495629_0003973_8540_8917 | 116 |
| 892 | 3300046459 | Ga0495629_0009899 | Ga0495629_0009899_1381_1758 | 116 |
| 893 | 3300046459 | Ga0495629_0010531 | Ga0495629_0010531_4878_5255 | 116 |
| 894 | 3300046459 | Ga0495629_0314225 | Ga0495629_0314225_229_579 | 116 |
| 895 | 3300046460 | Ga0495638_0187882 | Ga0495638_0187882_118_468 | 116 |
| 896 | 3300046462 | Ga0495651_0040275 | Ga0495651_0040275_973_1350 | 116 |
| 897 | 3300046473 | Ga0495582_0408510 | Ga0495582_0408510_118_480 | 116 |
| 898 | 3300046476 | Ga0495662_0603838 | Ga0495662_0603838_83_460 | 116 |
| 899 | 3300046476 | Ga0495662_0669106 | Ga0495662_0669106_12_374 | 116 |
| 900 | 3300046477 | Ga0495664_0070825 | Ga0495664_0070825_1384_1761 | 116 |
| 901 | 3300046492 | Ga0495585_0023490 | Ga0495585_0023490_3078_3455 | 116 |
| 902 | 3300046499 | Ga0495594_0010888 | Ga0495594_0010888_2115_2492 | 116 |
| 903 | 3300046499 | Ga0495594_0106141 | Ga0495594_0106141_533_910 | 116 |
| 904 | 3300046499 | Ga0495594_0130657 | Ga0495594_0130657_816_1166 | 116 |
| 905 | 3300046514 | Ga0495618_0158636 | Ga0495618_0158636_76_453 | 116 |
| 906 | 3300046516 | Ga0495628_0059390 | Ga0495628_0059390_1390_1767 | 116 |
| 907 | 3300046517 | Ga0495630_1116758 | Ga0495630_1116758_95_457 | 116 |
| 908 | 3300046522 | Ga0495643_0004276 | Ga0495643_0004276_2868_3218 | 116 |
| 909 | 3300046529 | Ga0495652_0500645 | Ga0495652_0500645_98_475 | 116 |
| 910 | 3300046533 | Ga0495640_0003660 | Ga0495640_0003660_2658_3035 | 116 |
| 911 | 3300046557 | Ga0495622_0043127 | Ga0495622_0043127_104_481 | 116 |
| 912 | 3300046557 | Ga0495622_0069186 | Ga0495622_0069186_159_509 | 116 |
| 913 | 3300046557 | Ga0495622_0094185 | Ga0495622_0094185_535_885 | 116 |
| 914 | 3300046558 | Ga0495633_0565983 | Ga0495633_0565983_52_402 | 116 |
| 915 | 3300046559 | Ga0495667_0244862 | Ga0495667_0244862_746_1123 | 116 |
| 916 | 3300046642 | Ga0495634_0143012 | Ga0495634_0143012_1033_1410 | 116 |
| 917 | 3300046648 | Ga0495611_0021321 | Ga0495611_0021321_857_1234 | 116 |
| 918 | 3300046660 | Ga0495625_0085695 | Ga0495625_0085695_1204_1554 | 116 |
| 919 | 3300046674 | Ga0495588_0007531 | Ga0495588_0007531_1839_2216 | 116 |
| 920 | 3300046674 | Ga0495588_0056176 | Ga0495588_0056176_171_533 | 116 |
| 921 | 3300046675 | Ga0495657_0004911 | Ga0495657_0004911_1410_1787 | 116 |
| 922 | 3300046679 | Ga0495623_0472937 | Ga0495623_0472937_111_473 | 116 |
| 923 | 3300046683 | Ga0495658_0015832 | Ga0495658_0015832_104_454 | 116 |
| 924 | 3300046689 | Ga0495613_0001297 | Ga0495613_0001297_6750_7127 | 116 |
| 925 | 3300046689 | Ga0495613_0010337 | Ga0495613_0010337_5667_6044 | 116 |
| 926 | 3300046689 | Ga0495613_0113088 | Ga0495613_0113088_1212_1589 | 116 |
| 927 | 3300046690 | Ga0495624_0136841 | Ga0495624_0136841_775_1152 | 116 |
| 928 | 3300046691 | Ga0495670_0008008 | Ga0495670_0008008_4793_5143 | 116 |
| 929 | 3300046691 | Ga0495670_0212517 | Ga0495670_0212517_553_930 | 116 |
| 930 | 3300046692 | Ga0495671_0273064 | Ga0495671_0273064_372_722 | 116 |
| 931 | 3300046794 | Ga0495589_0232165 | Ga0495589_0232165_255_632 | 116 |
| 932 | 3300046809 | Ga0495600_0029385 | Ga0495600_0029385_2261_2638 | 116 |
| 933 | 3300046810 | Ga0495660_0022537 | Ga0495660_0022537_1799_2149 | 116 |
| 934 | 3300047315 | Ga0495581_0042190 | Ga0495581_0042190_13_390 | 116 |
| 935 | 3300047317 | Ga0495604_0005332 | Ga0495604_0005332_1890_2252 | 116 |
| 936 | 3300047317 | Ga0495604_0040078 | Ga0495604_0040078_2269_2646 | 116 |
| 937 | 3300047317 | Ga0495604_0116521 | Ga0495604_0116521_633_1043 | 116 |
| 938 | 3300047321 | Ga0495676_0004096 | Ga0495676_0004096_1570_1947 | 116 |
| 939 | 3300047321 | Ga0495676_0005521 | Ga0495676_0005521_8969_9346 | 116 |
| 940 | 3300047321 | Ga0495676_0120101 | Ga0495676_0120101_618_980 | 116 |
| 941 | 3300047323 | Ga0495683_0281237 | Ga0495683_0281237_292_669 | 116 |
| 942 | 3300047443 | Ga0495687_009794 | Ga0495687_009794_4273_4623 | 116 |
| 943 | 3300047444 | Ga0495675_0002248 | Ga0495675_0002248_9653_10015 | 116 |
| 944 | 3300047444 | Ga0495675_0012460 | Ga0495675_0012460_420_797 | 116 |
| 945 | 3300047444 | Ga0495675_0148739 | Ga0495675_0148739_981_1331 | 116 |
| 946 | 3300047446 | Ga0495679_116154 | Ga0495679_116154_337_687 | 116 |
| 947 | 3300047447 | Ga0495685_010235 | Ga0495685_010235_1891_2241 | 116 |
| 948 | 3300047447 | Ga0495685_023335 | Ga0495685_023335_735_1097 | 116 |
| 949 | 3300047469 | Ga0495673_0185048 | Ga0495673_0185048_271_648 | 116 |
| 950 | 3300047470 | Ga0495681_0001356 | Ga0495681_0001356_9803_10153 | 116 |
| 951 | 3300047673 | Ga0495593_0190175 | Ga0495593_0190175_75_425 | 116 |
| 952 | 3300048088 | Ga0495602_0318202 | Ga0495602_0318202_657_1034 | 116 |
| 953 | 3300048088 | Ga0495602_1025220 | Ga0495602_1025220_172_522 | 116 |
| 954 | 3300048089 | Ga0495614_0000128 | Ga0495614_0000128_9418_9795 | 116 |
| 955 | 3300048905 | Ga0496102_1302104 | Ga0496102_1302104_197_574 | 116 |
| 956 | 3300048905 | Ga0496102_1746672 | Ga0496102_1746672_53_424 | 116 |
| 957 | 3300048909 | Ga0496106_0071319 | Ga0496106_0071319_1268_1645 | 116 |
| 958 | 3300048929 | Ga0496126_0092088 | Ga0496126_0092088_1398_1757 | 116 |
| 959 | 3300049127 | Ga0501306_002344 | Ga0501306_002344_1384_1734 | 116 |
| 960 | 3300049127 | Ga0501306_048812 | Ga0501306_048812_221_571 | 116 |
| 961 | 3300049127 | Ga0501306_093945 | Ga0501306_093945_91_465 | 116 |
| 962 | 3300049128 | Ga0501308_049542 | Ga0501308_049542_171_521 | 116 |
| 963 | 3300049128 | Ga0501308_050071 | Ga0501308_050071_69_419 | 116 |
| 964 | 3300049128 | Ga0501308_069693 | Ga0501308_069693_97_447 | 116 |
| 965 | 3300049129 | Ga0501309_004429 | Ga0501309_004429_388_738 | 116 |
| 966 | 3300049129 | Ga0501309_088084 | Ga0501309_088084_68_418 | 116 |
| 967 | 3300049130 | Ga0501310_037620 | Ga0501310_037620_197_547 | 116 |
| 968 | 3300049130 | Ga0501310_064137 | Ga0501310_064137_87_464 | 116 |
| 969 | 3300049131 | Ga0501341_16491 | Ga0501341_16491_118_468 | 116 |
| 970 | 3300049161 | Ga0501305_076545 | Ga0501305_076545_154_504 | 116 |
| 971 | 3300049162 | Ga0501307_047922 | Ga0501307_047922_91_441 | 116 |
| 972 | 3300049162 | Ga0501307_056132 | Ga0501307_056132_135_485 | 116 |
| 973 | 3300049527 | Ga0501311_060043 | Ga0501311_060043_92_442 | 116 |
| 974 | 3300049527 | Ga0501311_064537 | Ga0501311_064537_179_556 | 116 |
| 975 | 3300049527 | Ga0501311_094769 | Ga0501311_094769_40_411 | 116 |
| 976 | 3300049528 | Ga0501312_031431 | Ga0501312_031431_388_738 | 116 |
| 977 | 3300049528 | Ga0501312_091582 | Ga0501312_091582_89_451 | 116 |
| 978 | 3300049529 | Ga0501313_047613 | Ga0501313_047613_146_496 | 116 |
| 979 | 3300049529 | Ga0501313_065552 | Ga0501313_065552_78_452 | 116 |
| 980 | 3300049530 | Ga0501314_038247 | Ga0501314_038247_109_459 | 116 |
| 981 | 3300049531 | Ga0501315_055238 | Ga0501315_055238_196_546 | 116 |
| 982 | 3300049531 | Ga0501315_078598 | Ga0501315_078598_91_441 | 116 |
| 983 | 3300049532 | Ga0501316_024584 | Ga0501316_024584_240_590 | 116 |
| 984 | 3300049532 | Ga0501316_070175 | Ga0501316_070175_67_444 | 116 |
| 985 | 3300049533 | Ga0501317_033903 | Ga0501317_033903_238_588 | 116 |
| 986 | 3300049533 | Ga0501317_037960 | Ga0501317_037960_283_633 | 116 |
| 987 | 3300049533 | Ga0501317_068366 | Ga0501317_068366_67_444 | 116 |
| 988 | 3300049534 | Ga0501318_011984 | Ga0501318_011984_290_640 | 116 |
| 989 | 3300049534 | Ga0501318_023663 | Ga0501318_023663_346_723 | 116 |
| 990 | 3300049534 | Ga0501318_040620 | Ga0501318_040620_197_547 | 116 |
| 991 | 3300049534 | Ga0501318_075714 | Ga0501318_075714_108_458 | 116 |
| 992 | 3300049535 | Ga0501319_006849 | Ga0501319_006849_68_445 | 116 |
| 993 | 3300049535 | Ga0501319_007938 | Ga0501319_007938_342_692 | 116 |
| 994 | 3300049535 | Ga0501319_016168 | Ga0501319_016168_190_564 | 116 |
| 995 | 3300049536 | Ga0501320_012495 | Ga0501320_012495_171_521 | 116 |
| 996 | 3300049536 | Ga0501320_030467 | Ga0501320_030467_228_602 | 116 |
| 997 | 3300049537 | Ga0501321_007367 | Ga0501321_007367_84_434 | 116 |
| 998 | 3300049537 | Ga0501321_055598 | Ga0501321_055598_67_417 | 116 |
| 999 | 3300049538 | Ga0501322_023909 | Ga0501322_023909_132_482 | 116 |
| 1000 | 3300049539 | Ga0501323_000434 | Ga0501323_000434_37_387 | 116 |
| 1001 | 3300049539 | Ga0501323_001661 | Ga0501323_001661_11_361 | 116 |
| 1002 | 3300049539 | Ga0501323_082180 | Ga0501323_082180_168_518 | 116 |
| 1003 | 3300049540 | Ga0501324_001570 | Ga0501324_001570_207_557 | 116 |
| 1004 | 3300049540 | Ga0501324_021502 | Ga0501324_021502_32_406 | 116 |
| 1005 | 3300049540 | Ga0501324_027495 | Ga0501324_027495_32_382 | 116 |
| 1006 | 3300049541 | Ga0501325_025587 | Ga0501325_025587_227_604 | 116 |
| 1007 | 3300049541 | Ga0501325_025892 | Ga0501325_025892_105_455 | 116 |
| 1008 | 3300049542 | Ga0501326_10657 | Ga0501326_10657_116_466 | 116 |
| 1009 | 3300049543 | Ga0501327_14382 | Ga0501327_14382_85_435 | 116 |
| 1010 | 3300049544 | Ga0501328_08731 | Ga0501328_08731_74_424 | 116 |
| 1011 | 3300049545 | Ga0501329_11672 | Ga0501329_11672_95_445 | 116 |
| 1012 | 3300049552 | Ga0501336_019049 | Ga0501336_019049_198_548 | 116 |
| 1013 | 3300049556 | Ga0501340_018995 | Ga0501340_018995_98_448 | 116 |
| 1014 | 3300049568 | Ga0501031_0008502 | Ga0501031_0008502_5204_5554 | 116 |
| 1015 | 3300049568 | Ga0501031_0117254 | Ga0501031_0117254_370_720 | 116 |
| 1016 | 3300049568 | Ga0501031_0174279 | Ga0501031_0174279_687_1037 | 116 |
| 1017 | 3300049568 | Ga0501031_0242552 | Ga0501031_0242552_377_727 | 116 |
| 1018 | 3300049569 | Ga0501032_0000992 | Ga0501032_0000992_76_426 | 116 |
| 1019 | 3300049569 | Ga0501032_0022986 | Ga0501032_0022986_2141_2491 | 116 |
| 1020 | 3300049569 | Ga0501032_0047631 | Ga0501032_0047631_830_1180 | 116 |
| 1021 | 3300049569 | Ga0501032_0588156 | Ga0501032_0588156_298_648 | 116 |
| 1022 | 3300049570 | Ga0501033_0008908 | Ga0501033_0008908_6952_7302 | 116 |
| 1023 | 3300049570 | Ga0501033_0019275 | Ga0501033_0019275_804_1154 | 116 |
| 1024 | 3300049570 | Ga0501033_0048689 | Ga0501033_0048689_643_993 | 116 |
| 1025 | 3300049570 | Ga0501033_0112297 | Ga0501033_0112297_1040_1390 | 116 |
| 1026 | 3300049571 | Ga0501034_0001415 | Ga0501034_0001415_30762_31112 | 116 |
| 1027 | 3300049571 | Ga0501034_0022300 | Ga0501034_0022300_4165_4515 | 116 |
| 1028 | 3300049571 | Ga0501034_0038129 | Ga0501034_0038129_3499_3849 | 116 |
| 1029 | 3300049571 | Ga0501034_0098261 | Ga0501034_0098261_1210_1560 | 116 |
| 1030 | 3300049571 | Ga0501034_0180396 | Ga0501034_0180396_129_506 | 116 |
| 1031 | 3300049571 | Ga0501034_0632182 | Ga0501034_0632182_262_612 | 116 |
| 1032 | 3300049572 | Ga0501036_0003744 | Ga0501036_0003744_6663_7013 | 116 |
| 1033 | 3300049572 | Ga0501036_0024929 | Ga0501036_0024929_3064_3414 | 116 |
| 1034 | 3300049572 | Ga0501036_0197018 | Ga0501036_0197018_323_673 | 116 |
| 1035 | 3300049573 | Ga0501037_0021712 | Ga0501037_0021712_1259_1609 | 116 |
| 1036 | 3300049573 | Ga0501037_0023501 | Ga0501037_0023501_3198_3548 | 116 |
| 1037 | 3300049573 | Ga0501037_0031984 | Ga0501037_0031984_486_875 | 116 |
| 1038 | 3300049574 | Ga0501038_0004040 | Ga0501038_0004040_7730_8080 | 116 |
| 1039 | 3300049574 | Ga0501038_0010353 | Ga0501038_0010353_1127_1477 | 116 |
| 1040 | 3300049574 | Ga0501038_0017612 | Ga0501038_0017612_1327_1677 | 116 |
| 1041 | 3300049574 | Ga0501038_0086627 | Ga0501038_0086627_570_947 | 116 |
| 1042 | 3300049574 | Ga0501038_0120122 | Ga0501038_0120122_425_775 | 116 |
| 1043 | 3300049574 | Ga0501038_0132229 | Ga0501038_0132229_1662_2012 | 116 |
| 1044 | 3300049575 | Ga0501039_0017749 | Ga0501039_0017749_1576_1926 | 116 |
| 1045 | 3300049575 | Ga0501039_0046879 | Ga0501039_0046879_1979_2329 | 116 |
| 1046 | 3300049576 | Ga0501040_0026897 | Ga0501040_0026897_323_673 | 116 |
| 1047 | 3300049577 | Ga0501041_0005651 | Ga0501041_0005651_4167_4517 | 116 |
| 1048 | 3300049578 | Ga0501042_0045563 | Ga0501042_0045563_2142_2531 | 116 |
| 1049 | 3300049578 | Ga0501042_0075939 | Ga0501042_0075939_76_426 | 116 |
| 1050 | 3300049579 | Ga0501043_0029608 | Ga0501043_0029608_2943_3293 | 116 |
| 1051 | 3300049579 | Ga0501043_0067586 | Ga0501043_0067586_2374_2724 | 116 |
| 1052 | 3300049579 | Ga0501043_0119001 | Ga0501043_0119001_1251_1601 | 116 |
| 1053 | 3300049579 | Ga0501043_0173366 | Ga0501043_0173366_1275_1625 | 116 |
| 1054 | 3300049580 | Ga0501046_0012079 | Ga0501046_0012079_1115_1465 | 116 |
| 1055 | 3300049580 | Ga0501046_0071099 | Ga0501046_0071099_1373_1759 | 116 |
| 1056 | 3300049580 | Ga0501046_0117678 | Ga0501046_0117678_743_1105 | 116 |
| 1057 | 3300049580 | Ga0501046_0126295 | Ga0501046_0126295_65_415 | 116 |
| 1058 | 3300049581 | Ga0501047_0000029 | Ga0501047_0000029_11238_11627 | 116 |
| 1059 | 3300049581 | Ga0501047_0000826 | Ga0501047_0000826_1011_1415 | 116 |
| 1060 | 3300049581 | Ga0501047_0061360 | Ga0501047_0061360_71_421 | 116 |
| 1061 | 3300049581 | Ga0501047_0115868 | Ga0501047_0115868_1054_1404 | 116 |
| 1062 | 3300049581 | Ga0501047_0180078 | Ga0501047_0180078_1615_1965 | 116 |
| 1063 | 3300049581 | Ga0501047_0258430 | Ga0501047_0258430_179_556 | 116 |
| 1064 | 3300049581 | Ga0501047_0327202 | Ga0501047_0327202_864_1214 | 116 |
| 1065 | 3300049581 | Ga0501047_0338172 | Ga0501047_0338172_870_1220 | 116 |
| 1066 | 3300049581 | Ga0501047_0398005 | Ga0501047_0398005_43_429 | 116 |
| 1067 | 3300049581 | Ga0501047_0407405 | Ga0501047_0407405_237_587 | 116 |
| 1068 | 3300049582 | Ga0501048_0007462 | Ga0501048_0007462_1011_1361 | 116 |
| 1069 | 3300049583 | Ga0501067_0004401 | Ga0501067_0004401_4624_4974 | 116 |
| 1070 | 3300049584 | Ga0501068_0000050 | Ga0501068_0000050_35296_35646 | 116 |
| 1071 | 3300049585 | Ga0501069_0001601 | Ga0501069_0001601_1337_1687 | 116 |
| 1072 | 3300049586 | Ga0501070_0018409 | Ga0501070_0018409_3883_4233 | 116 |
| 1073 | 3300049586 | Ga0501070_0250874 | Ga0501070_0250874_76_426 | 116 |
| 1074 | 3300049586 | Ga0501070_0330824 | Ga0501070_0330824_149_499 | 116 |
| 1075 | 3300049586 | Ga0501070_0448206 | Ga0501070_0448206_462_839 | 116 |
| 1076 | 3300049586 | Ga0501070_0568376 | Ga0501070_0568376_456_806 | 116 |
| 1077 | 3300049586 | Ga0501070_1029908 | Ga0501070_1029908_274_624 | 116 |
| 1078 | 3300049587 | Ga0501071_0003321 | Ga0501071_0003321_5654_6004 | 116 |
| 1079 | 3300049588 | Ga0501072_0001327 | Ga0501072_0001327_2981_3331 | 116 |
| 1080 | 3300049588 | Ga0501072_0816766 | Ga0501072_0816766_69_446 | 116 |
| 1081 | 3300049589 | Ga0501073_0014076 | Ga0501073_0014076_76_426 | 116 |
| 1082 | 3300049590 | Ga0501074_0089493 | Ga0501074_0089493_323_673 | 116 |
| 1083 | 3300049591 | Ga0501075_0366247 | Ga0501075_0366247_714_1064 | 116 |
| 1084 | 3300049592 | Ga0501076_0020533 | Ga0501076_0020533_1483_1833 | 116 |
| 1085 | 3300049593 | Ga0501077_0016094 | Ga0501077_0016094_3283_3633 | 116 |
| 1086 | 3300049652 | Ga0501202_004992 | Ga0501202_004992_98_448 | 116 |
| 1087 | 3300049661 | Ga0501217_204226 | Ga0501217_204226_234_584 | 116 |
| 1088 | 3300049668 | Ga0501233_174932 | Ga0501233_174932_157_519 | 116 |
| 1089 | 3300049684 | Ga0501255_080427 | Ga0501255_080427_129_479 | 116 |
| 1090 | 3300049741 | Ga0501079_0026015 | Ga0501079_0026015_3549_3899 | 116 |
| 1091 | 3300049742 | Ga0501080_0125002 | Ga0501080_0125002_1022_1372 | 116 |
| 1092 | 3300049743 | Ga0501081_0479308 | Ga0501081_0479308_129_479 | 116 |
| 1093 | 3300049744 | Ga0501083_0055973 | Ga0501083_0055973_1881_2231 | 116 |
| 1094 | 3300049822 | Ga0501035_0003339 | Ga0501035_0003339_14015_14365 | 116 |
| 1095 | 3300049822 | Ga0501035_0046471 | Ga0501035_0046471_1813_2163 | 116 |
| 1096 | 3300049822 | Ga0501035_0082627 | Ga0501035_0082627_661_1011 | 116 |
| 1097 | 3300049822 | Ga0501035_0108671 | Ga0501035_0108671_1028_1378 | 116 |
| 1098 | 3300049822 | Ga0501035_0360751 | Ga0501035_0360751_167_544 | 116 |
| 1099 | 3300049822 | Ga0501035_0368951 | Ga0501035_0368951_477_827 | 116 |
| 1100 | 3300049823 | Ga0501044_0006353 | Ga0501044_0006353_2341_2691 | 116 |
| 1101 | 3300049823 | Ga0501044_0008682 | Ga0501044_0008682_1011_1361 | 116 |
| 1102 | 3300049823 | Ga0501044_0033956 | Ga0501044_0033956_3182_3532 | 116 |
| 1103 | 3300049823 | Ga0501044_0052380 | Ga0501044_0052380_2415_2765 | 116 |
| 1104 | 3300049823 | Ga0501044_0057740 | Ga0501044_0057740_1890_2240 | 116 |
| 1105 | 3300049823 | Ga0501044_0219353 | Ga0501044_0219353_1451_1840 | 116 |
| 1106 | 3300049823 | Ga0501044_1147674 | Ga0501044_1147674_20_370 | 116 |
| 1107 | 3300049824 | Ga0501045_0128892 | Ga0501045_0128892_307_657 | 116 |
| 1108 | 3300049824 | Ga0501045_0365333 | Ga0501045_0365333_253_603 | 116 |
| 1109 | 3300049824 | Ga0501045_0371387 | Ga0501045_0371387_76_426 | 116 |
| 1110 | 3300049824 | Ga0501045_0502670 | Ga0501045_0502670_512_889 | 116 |
| 1111 | 3300050489 | nmdc:mga03683_503981_c1 | nmdc:mga03683_503981_c1_199_549 | 116 |
| 1112 | 3300050490 | nmdc:mga03n38_182969_c1 | nmdc:mga03n38_182969_c1_664_1014 | 116 |
| 1113 | 3300050494 | nmdc:mga06z11_1569_c1 | nmdc:mga06z11_1569_c1_1127_1477 | 116 |
| 1114 | 3300050495 | nmdc:mga04h51_61093_c1 | nmdc:mga04h51_61093_c1_910_1260 | 116 |
| 1115 | 3300050496 | nmdc:mga07m45_282602_c1 | nmdc:mga07m45_282602_c1_507_857 | 116 |
| 1116 | 3300050511 | nmdc:mga08y16_1776517_c1 | nmdc:mga08y16_1776517_c1_55_405 | 116 |
| 1117 | 3300053086 | Ga0500578_0014126 | Ga0500578_0014126_3411_3761 | 116 |
| 1118 | 3300053099 | Ga0500654_008366 | Ga0500654_008366_4256_4606 | 116 |
| 1119 | 3300053101 | Ga0500553_125659 | Ga0500553_125659_465_815 | 116 |
| 1120 | 3300053106 | Ga0500558_132555 | Ga0500558_132555_317_667 | 116 |
| 1121 | 3300053107 | Ga0500560_025525 | Ga0500560_025525_427_777 | 116 |
| 1122 | 3300053107 | Ga0500560_136483 | Ga0500560_136483_389_739 | 116 |
| 1123 | 3300053109 | Ga0500569_004889 | Ga0500569_004889_2487_2837 | 116 |
| 1124 | 3300053113 | Ga0500580_203029 | Ga0500580_203029_211_561 | 116 |
| 1125 | 3300053123 | Ga0500614_076573 | Ga0500614_076573_503_853 | 116 |
| 1126 | 3300053126 | Ga0500621_121448 | Ga0500621_121448_50_400 | 116 |
| 1127 | 3300053129 | Ga0500628_004632 | Ga0500628_004632_218_568 | 116 |
| 1128 | 3300053137 | Ga0500561_0000783 | Ga0500561_0000783_415_765 | 116 |
| 1129 | 3300053140 | Ga0500573_0002621 | Ga0500573_0002621_7139_7489 | 116 |
| 1130 | 3300053140 | Ga0500573_0292054 | Ga0500573_0292054_407_757 | 116 |
| 1131 | 3300053145 | Ga0500586_254671 | Ga0500586_254671_49_399 | 116 |
| 1132 | 3300053149 | Ga0500600_0235850 | Ga0500600_0235850_401_751 | 116 |
| 1133 | 3300053160 | Ga0500633_0008690 | Ga0500633_0008690_2017_2367 | 116 |
| 1134 | 3300053739 | Ga0500587_009997 | Ga0500587_009997_758_1108 | 116 |
| 1135 | 3300054114 | Ga0501084_0018187 | Ga0501084_0018187_5426_5776 | 116 |
| 1136 | 3300059492 | Ga0587073_0200785 | Ga0587073_0200785_48_398 | 116 |
| 1137 | 3300059492 | Ga0587073_0257957 | Ga0587073_0257957_115_465 | 116 |
| 1138 | 3300059503 | Ga0587080_087681 | Ga0587080_087681_230_580 | 116 |
| 1139 | 3300059503 | Ga0587080_101174 | Ga0587080_101174_119_469 | 116 |
| 1140 | 3300059504 | Ga0587082_039895 | Ga0587082_039895_392_742 | 116 |
| 1141 | 3300059505 | Ga0587083_0144242 | Ga0587083_0144242_221_571 | 116 |
| 1142 | 3300059506 | Ga0587085_159863 | Ga0587085_159863_124_483 | 116 |
| 1143 | 3300059510 | Ga0587090_129224 | Ga0587090_129224_119_469 | 116 |
| 1144 | 3300059605 | Ga0587106_033627 | Ga0587106_033627_91_441 | 116 |
| 1145 | 3300059608 | Ga0587129_031918 | Ga0587129_031918_42_392 | 116 |
| 1146 | 3300059627 | Ga0587117_099500 | Ga0587117_099500_84_434 | 116 |
| 1147 | 3300059630 | Ga0587128_138908 | Ga0587128_138908_96_455 | 116 |
| 1148 | 3300059639 | Ga0587062_129071 | Ga0587062_129071_104_454 | 116 |
| 1149 | 3300059644 | Ga0587075_100706 | Ga0587075_100706_162_512 | 116 |
| 1150 | 3300059645 | Ga0587076_061984 | Ga0587076_061984_62_412 | 116 |
| 1151 | 3300059649 | Ga0587102_008941 | Ga0587102_008941_141_491 | 116 |
| 1152 | 3300059651 | Ga0587105_028109 | Ga0587105_028109_112_462 | 116 |
| 1153 | 3300059659 | Ga0587120_019907 | Ga0587120_019907_199_549 | 116 |
| 1154 | 3300060344 | Ga0587071_188374 | Ga0587071_188374_67_444 | 116 |
| 1155 | 3300060353 | Ga0501082_0205256 | Ga0501082_0205256_1224_1574 | 116 |
| 1156 | 3300061719 | Ga0466962_0004974 | Ga0466962_0004974_4185_4535 | 116 |
| 1157 | 3300061719 | Ga0466962_0032558 | Ga0466962_0032558_1114_1464 | 116 |
| 1158 | iso_pu_bacteria | 3006321560 | 3006324775 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7e4v-assembly1.cif.gz_A | crystal structure of mosquito staufen dsrna binding domain 4 | 0.8459 | 46 | 76 |
| 6sj6-assembly1.cif.gz_S | cryo-em structure of 50s-rsfs complex from staphylococcus aureus | 0.8376 | 2 | 100 |
| 3j7y-assembly1.cif.gz_Q | structure of the large ribosomal subunit from human mitochondria | 0.8324 | 2 | 89 |
| 7nsh-assembly1.cif.gz_BT | 39s mammalian mitochondrial large ribosomal subunit with mtrrf (post) and mtefg2 | 0.8317 | 2 | 89 |
| 7nqh-assembly1.cif.gz_BT | 55s mammalian mitochondrial ribosome with mtrf1a and p-site trnamet | 0.8249 | 2 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VRL8_239_320_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9102 | 46 | 75 | 3.30.160.20 |
| af_P97473_17_105_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8732 | 47 | 75 | 3.30.160.20 |
| af_A0A2R8Q731_63_142_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8431 | 47 | 74 | 3.30.160.20 |
| af_Q9VHN6_73_196_2.30.30.790 | Mainly Beta;Roll;SH3 type barrels.; | 0.776 | 2 | 89 | 2.30.30.790 |
| af_P9WHC9_4_113_2.30.30.790 | Mainly Beta;Roll;SH3 type barrels.; | 0.7644 | 6 | 114 | 2.30.30.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7S5A4-F1-model_v4 | 50S ribosomal protein L19 | 0.9753 | 3 | 90 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A496TPK9-F1-model_v4 | 50S ribosomal protein L19 | 0.9688 | 5 | 87 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7X7G057-F1-model_v4 | 50S ribosomal protein L19 | 0.9633 | 2 | 90 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2V6KAW7-F1-model_v4 | 50S ribosomal protein L19 | 0.9564 | 1 | 90 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A354LU83-F1-model_v4 | deleted | 0.9554 | 2 | 90 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar