F490980
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1159 | 478 | 2312 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300025961|Ga0207712_10745246|Ga0207712_107452461 |
| Length | 249 |
| Sequence | MKPRYRPARRKRSANACRPFSPAAKYSAVDVFSRIAAIRFLRNSTSSRCSGPEGTYVNLGIGLPTLIGNHLPKDRDIFLHSENGILGLGPAPAKGAEDEDLINAGKQPVTLLTGGAYFHHGDSFAMMRGGHLDICVLGAFQVSAEGDLANWHTGEPDAIPAVGGAMDLAIGARQVFIMMEHVTKAGEPKIVARCTYPLTAMHCVDRIYTDLAVIDVTDRGLKVVEMVDGMQLDELQRLTGAPLALKGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 259 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 260 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 261 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 275 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 363 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 364 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 368 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 373 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 374 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 375 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 376 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 377 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 378 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 379 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 400 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 412 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 413 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 416 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 417 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 418 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 419 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 420 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 421 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 422 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 428 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 429 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 430 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 431 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 432 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 433 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 434 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 435 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 436 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 437 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 438 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 439 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 440 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 441 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 442 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 443 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 444 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 445 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 446 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 447 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 448 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 449 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 450 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 451 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 452 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 453 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 454 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 455 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 456 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 457 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 458 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 459 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 460 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 461 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 462 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 463 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 464 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 465 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 466 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 467 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 468 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 469 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 470 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 471 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 472 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 473 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 474 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 475 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 476 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 477 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 478 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.22 |
| Metatranscriptomes | 0.78 |
| Isolates | 5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.18 |
| Nodule | 0.35 |
| Rhizoplane | 3.97 |
| Rhizosphere | 74.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207712_10745246 | 3300025961 | Bacteria | 858 |
| 2 | MRS2a_Contig_1767 | 2124908027 | Bacteria | 19337 |
| 3 | MRS2a_Contig_1768 | 2124908027 | Bacteria | 8639 |
| 4 | MRS2a_Contig_70 | 2124908027 | Bacteria | 29249 |
| 5 | JGI24739J22299_10069019 | 3300001989 | Bacteria | 1102 |
| 6 | JGI24744J21845_10002945 | 3300002077 | Bacteria | 3484 |
| 7 | JGI25156J39149_1009071 | 3300002705 | Bacteria | 2446 |
| 8 | JGI25162J39368_1005763 | 3300002737 | Bacteria | 2315 |
| 9 | JGI25154J39366_1001103 | 3300002738 | Bacteria | 10529 |
| 10 | JGI25154J39366_1001202 | 3300002738 | Bacteria | 9805 |
| 11 | JGI25150J39212_1002842 | 3300002774 | Bacteria | 4191 |
| 12 | JGI25159J45721_1002305 | 3300002987 | Bacteria | 7342 |
| 13 | JGI25151J46595_10004466 | 3300003187 | Bacteria | 7396 |
| 14 | JGI25151J46595_10025792 | 3300003187 | Bacteria | 2384 |
| 15 | rootH1_10018504 | 3300003316 | Bacteria | 1863 |
| 16 | rootH2_10004328 | 3300003320 | Bacteria | 6862 |
| 17 | rootL2_10132830 | 3300003322 | Bacteria | 1658 |
| 18 | rootH1_10048604 | 3300003323 | Bacteria | 8499 |
| 19 | JGI25160J50197_1001072 | 3300003354 | Bacteria | 14026 |
| 20 | JGI25161J50226_1000013 | 3300003374 | Bacteria | 199086 |
| 21 | Ga0055529_1002255 | 3300003763 | Bacteria | 3916 |
| 22 | Ga0055526_1000344 | 3300003771 | Bacteria | 38140 |
| 23 | Ga0055526_1016030 | 3300003771 | Bacteria | 2967 |
| 24 | Ga0055537_1000066 | 3300003773 | Bacteria | 76478 |
| 25 | Ga0055537_1000576 | 3300003773 | Bacteria | 20455 |
| 26 | Ga0055537_1005089 | 3300003773 | Bacteria | 3594 |
| 27 | Ga0055524_1000331 | 3300003775 | Bacteria | 43988 |
| 28 | Ga0055524_1000519 | 3300003775 | Bacteria | 29658 |
| 29 | Ga0055536_1001260 | 3300003781 | Bacteria | 15591 |
| 30 | Ga0055534_1000031 | 3300003784 | Bacteria | 120517 |
| 31 | Ga0055534_1000057 | 3300003784 | Bacteria | 85576 |
| 32 | Ga0055534_1001922 | 3300003784 | Bacteria | 7652 |
| 33 | Ga0055534_1011496 | 3300003784 | Bacteria | 1796 |
| 34 | Ga0055528_1000069 | 3300003790 | Bacteria | 83002 |
| 35 | Ga0055528_1001047 | 3300003790 | Bacteria | 18233 |
| 36 | Ga0055530_10001163 | 3300003791 | Bacteria | 20390 |
| 37 | Ga0055530_10002703 | 3300003791 | Bacteria | 11028 |
| 38 | Ga0055530_10014555 | 3300003791 | Bacteria | 2613 |
| 39 | Ga0055540_1000067 | 3300003792 | Bacteria | 122108 |
| 40 | Ga0055531_10000480 | 3300003794 | Bacteria | 36934 |
| 41 | Ga0058692_1000051 | 3300003856 | Bacteria | 107880 |
| 42 | Ga0055543_1000239 | 3300004625 | Bacteria | 42667 |
| 43 | Ga0065165_1007939 | 3300005262 | Bacteria | 5086 |
| 44 | Ga0065165_1066496 | 3300005262 | Bacteria | 970 |
| 45 | Ga0065165_1069390 | 3300005262 | Bacteria | 940 |
| 46 | Ga0065703_1021859 | 3300005272 | Bacteria | 1076 |
| 47 | Ga0065714_10000917 | 3300005288 | Bacteria | 19048 |
| 48 | Ga0065704_10004515 | 3300005289 | Bacteria | 3336 |
| 49 | Ga0065704_10011001 | 3300005289 | Bacteria | 2008 |
| 50 | Ga0065704_10011853 | 3300005289 | Bacteria | 2170 |
| 51 | Ga0065704_10013108 | 3300005289 | Bacteria | 3582 |
| 52 | Ga0065704_10111899 | 3300005289 | Bacteria | 1929 |
| 53 | Ga0065704_10118072 | 3300005289 | Bacteria | 1821 |
| 54 | Ga0065704_10121111 | 3300005289 | Bacteria | 1766 |
| 55 | Ga0065704_10371111 | 3300005289 | Bacteria | 785 |
| 56 | Ga0065707_10021373 | 3300005295 | Bacteria | 1878 |
| 57 | Ga0070658_10000050 | 3300005327 | Bacteria | 119052 |
| 58 | Ga0070676_10015306 | 3300005328 | Bacteria | 4231 |
| 59 | Ga0070676_10115083 | 3300005328 | Bacteria | 1680 |
| 60 | Ga0070683_100195024 | 3300005329 | Bacteria | 1923 |
| 61 | Ga0070690_100344715 | 3300005330 | Bacteria | 1080 |
| 62 | Ga0070670_100063805 | 3300005331 | Bacteria | 3161 |
| 63 | Ga0070670_100065195 | 3300005331 | Bacteria | 3125 |
| 64 | Ga0070670_100236638 | 3300005331 | Bacteria | 1590 |
| 65 | Ga0070670_100429365 | 3300005331 | Bacteria | 1169 |
| 66 | Ga0068869_100098293 | 3300005334 | Bacteria | 2211 |
| 67 | Ga0070666_10022663 | 3300005335 | Bacteria | 4080 |
| 68 | Ga0070682_100010437 | 3300005337 | Bacteria | 5271 |
| 69 | Ga0068868_100041322 | 3300005338 | Bacteria | 3592 |
| 70 | Ga0068868_100394124 | 3300005338 | Bacteria | 1194 |
| 71 | Ga0070660_100039316 | 3300005339 | Bacteria | 3595 |
| 72 | Ga0070660_100115496 | 3300005339 | Bacteria | 2139 |
| 73 | Ga0070689_100069857 | 3300005340 | Bacteria | 2741 |
| 74 | Ga0070691_10002978 | 3300005341 | Bacteria | 7581 |
| 75 | Ga0070661_100093040 | 3300005344 | Bacteria | 2234 |
| 76 | Ga0070692_10220545 | 3300005345 | Bacteria | 1121 |
| 77 | Ga0070668_100001214 | 3300005347 | Bacteria | 18317 |
| 78 | Ga0070668_100008872 | 3300005347 | Bacteria | 7465 |
| 79 | Ga0070669_100260598 | 3300005353 | Bacteria | 1383 |
| 80 | Ga0070669_100378931 | 3300005353 | Bacteria | 1153 |
| 81 | Ga0070675_100131608 | 3300005354 | Bacteria | 2132 |
| 82 | Ga0070675_100311297 | 3300005354 | Bacteria | 1389 |
| 83 | Ga0070671_100097719 | 3300005355 | Bacteria | 2462 |
| 84 | Ga0070671_100339872 | 3300005355 | Bacteria | 1280 |
| 85 | Ga0070688_100010538 | 3300005365 | Bacteria | 5102 |
| 86 | Ga0070688_100115903 | 3300005365 | Bacteria | 1788 |
| 87 | Ga0070688_100145208 | 3300005365 | Bacteria | 1616 |
| 88 | Ga0070667_100012675 | 3300005367 | Bacteria | 6972 |
| 89 | Ga0070667_100167634 | 3300005367 | Bacteria | 1937 |
| 90 | Ga0070703_10199704 | 3300005406 | Bacteria | 784 |
| 91 | Ga0070709_10430341 | 3300005434 | Bacteria | 991 |
| 92 | Ga0070711_100185451 | 3300005439 | Bacteria | 1595 |
| 93 | Ga0070705_100074739 | 3300005440 | Bacteria | 2061 |
| 94 | Ga0070708_100006204 | 3300005445 | Bacteria | 9505 |
| 95 | Ga0070663_100325544 | 3300005455 | Bacteria | 1237 |
| 96 | Ga0070678_100001422 | 3300005456 | Bacteria | 12742 |
| 97 | Ga0070678_100004688 | 3300005456 | Bacteria | 7782 |
| 98 | Ga0070678_100065700 | 3300005456 | Bacteria | 2694 |
| 99 | Ga0070678_100318857 | 3300005456 | Bacteria | 1327 |
| 100 | Ga0070678_100488510 | 3300005456 | Bacteria | 1085 |
| 101 | Ga0070678_101194587 | 3300005456 | Bacteria | 705 |
| 102 | Ga0070681_10042215 | 3300005458 | Bacteria | 4571 |
| 103 | Ga0068867_100000817 | 3300005459 | Bacteria | 21028 |
| 104 | Ga0070698_100039235 | 3300005471 | Bacteria | 4875 |
| 105 | Ga0070698_100289305 | 3300005471 | Bacteria | 1570 |
| 106 | Ga0070699_100550962 | 3300005518 | Bacteria | 1050 |
| 107 | Ga0070679_100007035 | 3300005530 | Bacteria | 10491 |
| 108 | Ga0068853_100322409 | 3300005539 | Bacteria | 1432 |
| 109 | Ga0068853_100616769 | 3300005539 | Bacteria | 1031 |
| 110 | Ga0070672_100050901 | 3300005543 | Bacteria | 3228 |
| 111 | Ga0070672_100092311 | 3300005543 | Bacteria | 2444 |
| 112 | Ga0070695_100341583 | 3300005545 | Bacteria | 1119 |
| 113 | Ga0070696_100308250 | 3300005546 | Bacteria | 1215 |
| 114 | Ga0070693_100001130 | 3300005547 | Bacteria | 11958 |
| 115 | Ga0070665_100092762 | 3300005548 | Bacteria | 3024 |
| 116 | Ga0070665_100165919 | 3300005548 | Bacteria | 2211 |
| 117 | Ga0070704_100001833 | 3300005549 | Bacteria | 11711 |
| 118 | Ga0070704_100018375 | 3300005549 | Bacteria | 4470 |
| 119 | Ga0070704_100541400 | 3300005549 | Bacteria | 1016 |
| 120 | Ga0068855_100002023 | 3300005563 | Bacteria | 25157 |
| 121 | Ga0068857_100037080 | 3300005577 | Bacteria | 4318 |
| 122 | Ga0068856_100001944 | 3300005614 | Bacteria | 21515 |
| 123 | Ga0068852_100007122 | 3300005616 | Bacteria | 8147 |
| 124 | Ga0068852_100335770 | 3300005616 | Bacteria | 1472 |
| 125 | Ga0068859_100000102 | 3300005617 | Bacteria | 79658 |
| 126 | Ga0068859_100157686 | 3300005617 | Bacteria | 2348 |
| 127 | Ga0068859_100537833 | 3300005617 | Bacteria | 1263 |
| 128 | Ga0068864_100022445 | 3300005618 | Bacteria | 5292 |
| 129 | Ga0068864_100948490 | 3300005618 | Bacteria | 851 |
| 130 | Ga0068861_100002978 | 3300005719 | Bacteria | 11173 |
| 131 | Ga0068861_100049115 | 3300005719 | Bacteria | 3193 |
| 132 | Ga0068861_100187120 | 3300005719 | Bacteria | 1728 |
| 133 | Ga0068851_10003029 | 3300005834 | Bacteria | 7426 |
| 134 | Ga0068851_10107724 | 3300005834 | Bacteria | 1485 |
| 135 | Ga0068870_10004266 | 3300005840 | Bacteria | 6145 |
| 136 | Ga0068870_10368464 | 3300005840 | Bacteria | 926 |
| 137 | Ga0068863_100002676 | 3300005841 | Bacteria | 17618 |
| 138 | Ga0068863_100002708 | 3300005841 | Bacteria | 17501 |
| 139 | Ga0068863_100271929 | 3300005841 | Bacteria | 1640 |
| 140 | Ga0068858_100005282 | 3300005842 | Bacteria | 12658 |
| 141 | Ga0068858_100214049 | 3300005842 | Bacteria | 1824 |
| 142 | Ga0068860_100011245 | 3300005843 | Bacteria | 8820 |
| 143 | Ga0068862_100000273 | 3300005844 | Bacteria | 57697 |
| 144 | Ga0070717_10055546 | 3300006028 | Bacteria | 3268 |
| 145 | Ga0075365_10001342 | 3300006038 | Bacteria | 11024 |
| 146 | Ga0075365_10068681 | 3300006038 | Bacteria | 2381 |
| 147 | Ga0075365_10156649 | 3300006038 | Bacteria | 1585 |
| 148 | Ga0075365_10176804 | 3300006038 | Bacteria | 1491 |
| 149 | Ga0075368_10012672 | 3300006042 | Bacteria | 3088 |
| 150 | Ga0075368_10019966 | 3300006042 | Bacteria | 2533 |
| 151 | Ga0075363_100019977 | 3300006048 | Bacteria | 3355 |
| 152 | Ga0075364_10027807 | 3300006051 | Bacteria | 3616 |
| 153 | Ga0075364_10115864 | 3300006051 | Bacteria | 1791 |
| 154 | Ga0075364_10126914 | 3300006051 | Bacteria | 1711 |
| 155 | Ga0075364_10268827 | 3300006051 | Bacteria | 1159 |
| 156 | Ga0075364_10293033 | 3300006051 | Bacteria | 1107 |
| 157 | Ga0075362_10067403 | 3300006177 | Bacteria | 1628 |
| 158 | Ga0075362_10089313 | 3300006177 | Bacteria | 1429 |
| 159 | Ga0075367_10070788 | 3300006178 | Bacteria | 2097 |
| 160 | Ga0075369_10153111 | 3300006186 | Bacteria | 1055 |
| 161 | Ga0075366_10119074 | 3300006195 | Bacteria | 1591 |
| 162 | Ga0097621_100069994 | 3300006237 | Bacteria | 2897 |
| 163 | Ga0075370_10020335 | 3300006353 | Bacteria | 3626 |
| 164 | Ga0075370_10041784 | 3300006353 | Bacteria | 2589 |
| 165 | Ga0068871_100000429 | 3300006358 | Bacteria | 28894 |
| 166 | Ga0068871_100083858 | 3300006358 | Bacteria | 2644 |
| 167 | Ga0068871_100173275 | 3300006358 | Bacteria | 1851 |
| 168 | Ga0075428_100128714 | 3300006844 | Bacteria | 2754 |
| 169 | Ga0075428_100357960 | 3300006844 | Bacteria | 1566 |
| 170 | Ga0075431_100018399 | 3300006847 | Bacteria | 7114 |
| 171 | Ga0075431_100032618 | 3300006847 | Bacteria | 5367 |
| 172 | Ga0075431_100143311 | 3300006847 | Bacteria | 2462 |
| 173 | Ga0075433_10030675 | 3300006852 | Bacteria | 4589 |
| 174 | Ga0075433_10839414 | 3300006852 | Bacteria | 802 |
| 175 | Ga0075434_100002700 | 3300006871 | Bacteria | 15678 |
| 176 | Ga0075434_100363056 | 3300006871 | Bacteria | 1469 |
| 177 | Ga0075429_100010239 | 3300006880 | Bacteria | 8118 |
| 178 | Ga0068865_100439506 | 3300006881 | Bacteria | 1076 |
| 179 | Ga0075436_100001293 | 3300006914 | Bacteria | 17017 |
| 180 | Ga0097620_100000102 | 3300006931 | Bacteria | 79658 |
| 181 | Ga0097620_100157690 | 3300006931 | Bacteria | 2348 |
| 182 | Ga0097620_100537858 | 3300006931 | Bacteria | 1263 |
| 183 | Ga0075435_100262392 | 3300007076 | Bacteria | 1472 |
| 184 | Ga0105251_10015911 | 3300009011 | Bacteria | 4090 |
| 185 | Ga0105251_10094477 | 3300009011 | Bacteria | 1371 |
| 186 | Ga0105244_10014391 | 3300009036 | Bacteria | 4576 |
| 187 | Ga0105244_10018048 | 3300009036 | Bacteria | 3971 |
| 188 | Ga0105244_10019613 | 3300009036 | Bacteria | 3770 |
| 189 | Ga0105244_10020545 | 3300009036 | Bacteria | 3666 |
| 190 | Ga0105244_10071203 | 3300009036 | Bacteria | 1734 |
| 191 | Ga0105244_10102481 | 3300009036 | Bacteria | 1399 |
| 192 | Ga0105250_10046744 | 3300009092 | Bacteria | 1735 |
| 193 | Ga0105250_10074614 | 3300009092 | Bacteria | 1372 |
| 194 | Ga0105240_10002032 | 3300009093 | Bacteria | 33348 |
| 195 | Ga0105240_10005710 | 3300009093 | Bacteria | 18461 |
| 196 | Ga0111539_10000829 | 3300009094 | Bacteria | 40191 |
| 197 | Ga0111539_10073415 | 3300009094 | Bacteria | 4034 |
| 198 | Ga0111539_10078552 | 3300009094 | Bacteria | 3882 |
| 199 | Ga0111539_10316784 | 3300009094 | Bacteria | 1815 |
| 200 | Ga0105247_10013390 | 3300009101 | Bacteria | 4920 |
| 201 | Ga0105247_10085341 | 3300009101 | Bacteria | 1996 |
| 202 | Ga0105247_10086811 | 3300009101 | Bacteria | 1980 |
| 203 | Ga0114129_10024326 | 3300009147 | Bacteria | 8582 |
| 204 | Ga0105243_10000614 | 3300009148 | Bacteria | 35544 |
| 205 | Ga0105243_10000650 | 3300009148 | Bacteria | 34412 |
| 206 | Ga0105243_10036361 | 3300009148 | Bacteria | 3823 |
| 207 | Ga0105241_10002429 | 3300009174 | Bacteria | 13980 |
| 208 | Ga0105248_10000324 | 3300009177 | Bacteria | 56570 |
| 209 | Ga0105248_10000710 | 3300009177 | Bacteria | 37689 |
| 210 | Ga0105248_10054071 | 3300009177 | Bacteria | 4503 |
| 211 | Ga0105248_10116926 | 3300009177 | Bacteria | 3007 |
| 212 | Ga0105237_10028563 | 3300009545 | Bacteria | 5680 |
| 213 | Ga0105237_10052722 | 3300009545 | Bacteria | 4082 |
| 214 | Ga0105237_10054710 | 3300009545 | Bacteria | 3999 |
| 215 | Ga0105238_10044844 | 3300009551 | Bacteria | 4469 |
| 216 | Ga0105238_10113261 | 3300009551 | Bacteria | 2692 |
| 217 | Ga0105249_10000320 | 3300009553 | Bacteria | 48700 |
| 218 | Ga0105249_10014726 | 3300009553 | Bacteria | 6913 |
| 219 | Ga0105249_10251057 | 3300009553 | Bacteria | 1754 |
| 220 | Ga0105249_10347070 | 3300009553 | Bacteria | 1503 |
| 221 | Ga0105239_10005669 | 3300010375 | Bacteria | 14587 |
| 222 | Ga0105239_10057759 | 3300010375 | Bacteria | 4257 |
| 223 | Ga0105246_10006706 | 3300011119 | Bacteria | 7038 |
| 224 | Ga0105246_10086329 | 3300011119 | Bacteria | 2249 |
| 225 | Ga0105246_10107020 | 3300011119 | Bacteria | 2047 |
| 226 | Ga0157373_10143778 | 3300013100 | Bacteria | 1677 |
| 227 | Ga0157373_10144608 | 3300013100 | Bacteria | 1672 |
| 228 | Ga0157371_10000337 | 3300013102 | Bacteria | 60433 |
| 229 | Ga0157371_10002500 | 3300013102 | Bacteria | 17479 |
| 230 | Ga0157371_10293702 | 3300013102 | Bacteria | 1175 |
| 231 | Ga0157371_10506495 | 3300013102 | Bacteria | 892 |
| 232 | Ga0157370_10005499 | 3300013104 | Bacteria | 14203 |
| 233 | Ga0157370_10028779 | 3300013104 | Bacteria | 5462 |
| 234 | Ga0157370_10060408 | 3300013104 | Bacteria | 3599 |
| 235 | Ga0157370_10182582 | 3300013104 | Bacteria | 1949 |
| 236 | Ga0157369_10000342 | 3300013105 | Bacteria | 61773 |
| 237 | Ga0157374_10139663 | 3300013296 | Bacteria | 2351 |
| 238 | Ga0157378_11237764 | 3300013297 | Bacteria | 786 |
| 239 | Ga0163162_10149149 | 3300013306 | Bacteria | 2455 |
| 240 | Ga0157375_10027645 | 3300013308 | Bacteria | 5306 |
| 241 | Ga0157375_10146387 | 3300013308 | Bacteria | 2493 |
| 242 | Ga0163163_10446789 | 3300014325 | Bacteria | 1353 |
| 243 | Ga0157380_10505032 | 3300014326 | Bacteria | 1175 |
| 244 | Ga0157380_10742090 | 3300014326 | Bacteria | 992 |
| 245 | Ga0182008_10000115 | 3300014497 | Bacteria | 61294 |
| 246 | Ga0182008_10000708 | 3300014497 | Bacteria | 23865 |
| 247 | Ga0182008_10130397 | 3300014497 | Bacteria | 1253 |
| 248 | Ga0157379_10004351 | 3300014968 | Bacteria | 12112 |
| 249 | Ga0157379_10009608 | 3300014968 | Bacteria | 8424 |
| 250 | Ga0157376_10278571 | 3300014969 | Bacteria | 1574 |
| 251 | Ga0182007_10000103 | 3300015262 | Bacteria | 59975 |
| 252 | Ga0182007_10120962 | 3300015262 | Bacteria | 876 |
| 253 | Ga0163161_10002266 | 3300017792 | Bacteria | 13796 |
| 254 | Ga0163161_10008437 | 3300017792 | Bacteria | 7133 |
| 255 | Ga0163161_10014688 | 3300017792 | Bacteria | 5453 |
| 256 | Ga0163161_10030084 | 3300017792 | Bacteria | 3862 |
| 257 | Ga0163161_10041540 | 3300017792 | Bacteria | 3304 |
| 258 | Ga0163161_10209787 | 3300017792 | Bacteria | 1504 |
| 259 | Ga0163161_10379015 | 3300017792 | Bacteria | 1130 |
| 260 | Ga0197907_10974739 | 3300020069 | Bacteria | 1654 |
| 261 | Ga0206356_10543351 | 3300020070 | Bacteria | 4078 |
| 262 | Ga0206354_10161263 | 3300020081 | Bacteria | 1535 |
| 263 | Ga0209435_100067 | 3300025206 | Bacteria | 66388 |
| 264 | Ga0209672_103863 | 3300025228 | Bacteria | 2955 |
| 265 | Ga0209437_100566 | 3300025233 | Bacteria | 24156 |
| 266 | Ga0209258_106772 | 3300025242 | Bacteria | 1759 |
| 267 | Ga0207425_1001894 | 3300025245 | Bacteria | 7975 |
| 268 | Ga0209646_1000023 | 3300025246 | Bacteria | 441100 |
| 269 | Ga0209646_1000061 | 3300025246 | Bacteria | 255495 |
| 270 | Ga0209026_1000754 | 3300025250 | Bacteria | 18343 |
| 271 | Ga0209759_1000209 | 3300025256 | Bacteria | 90642 |
| 272 | Ga0209129_1008654 | 3300025258 | Bacteria | 2798 |
| 273 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 274 | Ga0209565_1000072 | 3300025263 | Bacteria | 164988 |
| 275 | Ga0209565_1000111 | 3300025263 | Bacteria | 117862 |
| 276 | Ga0209565_1004904 | 3300025263 | Bacteria | 3989 |
| 277 | Ga0209455_1002615 | 3300025272 | Bacteria | 6843 |
| 278 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 279 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 280 | Ga0209130_1000095 | 3300025284 | Bacteria | 145126 |
| 281 | Ga0209130_1001113 | 3300025284 | Bacteria | 19768 |
| 282 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 283 | Ga0209675_1000049 | 3300025291 | Bacteria | 215042 |
| 284 | Ga0209675_1000373 | 3300025291 | Bacteria | 38099 |
| 285 | Ga0209675_1004344 | 3300025291 | Bacteria | 6347 |
| 286 | Ga0209676_1000145 | 3300025292 | Bacteria | 174391 |
| 287 | Ga0209676_1007092 | 3300025292 | Bacteria | 5363 |
| 288 | Ga0209676_1018411 | 3300025292 | Bacteria | 2437 |
| 289 | Ga0209025_1001400 | 3300025294 | Bacteria | 32034 |
| 290 | Ga0209025_1003004 | 3300025294 | Bacteria | 16678 |
| 291 | Ga0209025_1013182 | 3300025294 | Bacteria | 5219 |
| 292 | Ga0209564_1000102 | 3300025295 | Bacteria | 222597 |
| 293 | Ga0209564_1000130 | 3300025295 | Bacteria | 194399 |
| 294 | Ga0209564_1002035 | 3300025295 | Bacteria | 17497 |
| 295 | Ga0209564_1005377 | 3300025295 | Bacteria | 7341 |
| 296 | Ga0209564_1021069 | 3300025295 | Bacteria | 2361 |
| 297 | Ga0209758_1023004 | 3300025297 | Bacteria | 2834 |
| 298 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 299 | Ga0209050_1000192 | 3300025298 | Bacteria | 138262 |
| 300 | Ga0209050_1012100 | 3300025298 | Bacteria | 4002 |
| 301 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 302 | Ga0209256_1000037 | 3300025299 | Bacteria | 377661 |
| 303 | Ga0209256_1000126 | 3300025299 | Bacteria | 165242 |
| 304 | Ga0207426_1001496 | 3300025302 | Bacteria | 19140 |
| 305 | Ga0207426_1004536 | 3300025302 | Bacteria | 6717 |
| 306 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 307 | Ga0209051_1031038 | 3300025303 | Bacteria | 2063 |
| 308 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 309 | Ga0207697_10012975 | 3300025315 | Bacteria | 3482 |
| 310 | Ga0207656_10095323 | 3300025321 | Bacteria | 1356 |
| 311 | Ga0207696_1006016 | 3300025711 | Bacteria | 4952 |
| 312 | Ga0207696_1009865 | 3300025711 | Bacteria | 3536 |
| 313 | Ga0207696_1013069 | 3300025711 | Bacteria | 2910 |
| 314 | Ga0207696_1041747 | 3300025711 | Bacteria | 1339 |
| 315 | Ga0207655_1000575 | 3300025728 | Bacteria | 45532 |
| 316 | Ga0207655_1000626 | 3300025728 | Bacteria | 42454 |
| 317 | Ga0207655_1000627 | 3300025728 | Bacteria | 42405 |
| 318 | Ga0207655_1007194 | 3300025728 | Bacteria | 7257 |
| 319 | Ga0207655_1007198 | 3300025728 | Bacteria | 7256 |
| 320 | Ga0207655_1007651 | 3300025728 | Bacteria | 6974 |
| 321 | Ga0207655_1023080 | 3300025728 | Bacteria | 3097 |
| 322 | Ga0207713_1000501 | 3300025735 | Bacteria | 40333 |
| 323 | Ga0207713_1002798 | 3300025735 | Bacteria | 12315 |
| 324 | Ga0207713_1008316 | 3300025735 | Bacteria | 5991 |
| 325 | Ga0207713_1024683 | 3300025735 | Bacteria | 2796 |
| 326 | Ga0207713_1035512 | 3300025735 | Bacteria | 2151 |
| 327 | Ga0207682_10241509 | 3300025893 | Bacteria | 839 |
| 328 | Ga0207642_10180201 | 3300025899 | Bacteria | 1151 |
| 329 | Ga0207710_10019305 | 3300025900 | Bacteria | 2908 |
| 330 | Ga0207710_10039916 | 3300025900 | Bacteria | 2079 |
| 331 | Ga0207710_10044374 | 3300025900 | Bacteria | 1979 |
| 332 | Ga0207688_10001145 | 3300025901 | Bacteria | 13661 |
| 333 | Ga0207680_10107661 | 3300025903 | Bacteria | 1802 |
| 334 | Ga0207647_10004470 | 3300025904 | Bacteria | 10362 |
| 335 | Ga0207645_10000039 | 3300025907 | Bacteria | 88205 |
| 336 | Ga0207645_10012427 | 3300025907 | Bacteria | 5774 |
| 337 | Ga0207705_10000014 | 3300025909 | Bacteria | 434286 |
| 338 | Ga0207705_10009139 | 3300025909 | Bacteria | 7224 |
| 339 | Ga0207705_10017949 | 3300025909 | Bacteria | 5061 |
| 340 | Ga0207705_10267779 | 3300025909 | Bacteria | 1306 |
| 341 | Ga0207705_10540780 | 3300025909 | Bacteria | 906 |
| 342 | Ga0207707_10346576 | 3300025912 | Bacteria | 1280 |
| 343 | Ga0207707_10680289 | 3300025912 | Bacteria | 865 |
| 344 | Ga0207695_10004527 | 3300025913 | Bacteria | 18917 |
| 345 | Ga0207695_10087242 | 3300025913 | Bacteria | 3143 |
| 346 | Ga0207695_10540200 | 3300025913 | Bacteria | 1047 |
| 347 | Ga0207671_10021108 | 3300025914 | Bacteria | 4946 |
| 348 | Ga0207671_10037527 | 3300025914 | Bacteria | 3593 |
| 349 | Ga0207663_10085290 | 3300025916 | Bacteria | 2079 |
| 350 | Ga0207662_10452809 | 3300025918 | Bacteria | 878 |
| 351 | Ga0207657_10062715 | 3300025919 | Bacteria | 3181 |
| 352 | Ga0207657_10083840 | 3300025919 | Bacteria | 2673 |
| 353 | Ga0207652_10008612 | 3300025921 | Bacteria | 8207 |
| 354 | Ga0207646_10140866 | 3300025922 | Bacteria | 2172 |
| 355 | Ga0207681_10001411 | 3300025923 | Bacteria | 15520 |
| 356 | Ga0207681_10010671 | 3300025923 | Bacteria | 5636 |
| 357 | Ga0207681_10275103 | 3300025923 | Bacteria | 1323 |
| 358 | Ga0207694_10029537 | 3300025924 | Bacteria | 4184 |
| 359 | Ga0207650_10007054 | 3300025925 | Bacteria | 7660 |
| 360 | Ga0207650_10048331 | 3300025925 | Bacteria | 3138 |
| 361 | Ga0207650_10081382 | 3300025925 | Bacteria | 2457 |
| 362 | Ga0207650_10213371 | 3300025925 | Bacteria | 1551 |
| 363 | Ga0207659_10000981 | 3300025926 | Bacteria | 17029 |
| 364 | Ga0207659_10089628 | 3300025926 | Bacteria | 2294 |
| 365 | Ga0207644_10021202 | 3300025931 | Bacteria | 4424 |
| 366 | Ga0207644_10136038 | 3300025931 | Bacteria | 1887 |
| 367 | Ga0207644_10707161 | 3300025931 | Bacteria | 840 |
| 368 | Ga0207690_10026037 | 3300025932 | Bacteria | 3682 |
| 369 | Ga0207706_10047717 | 3300025933 | Bacteria | 3789 |
| 370 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 371 | Ga0207670_10690761 | 3300025936 | Bacteria | 844 |
| 372 | Ga0207691_10000027 | 3300025940 | Bacteria | 126502 |
| 373 | Ga0207691_10212460 | 3300025940 | Bacteria | 1680 |
| 374 | Ga0207711_10000398 | 3300025941 | Bacteria | 45914 |
| 375 | Ga0207711_10001657 | 3300025941 | Bacteria | 20542 |
| 376 | Ga0207711_10138236 | 3300025941 | Bacteria | 2190 |
| 377 | Ga0207689_10005641 | 3300025942 | Bacteria | 11151 |
| 378 | Ga0207661_10586927 | 3300025944 | Bacteria | 1022 |
| 379 | Ga0207667_10000007 | 3300025949 | Bacteria | 630590 |
| 380 | Ga0207667_10049806 | 3300025949 | Bacteria | 4422 |
| 381 | Ga0207712_10000413 | 3300025961 | Bacteria | 36586 |
| 382 | Ga0207712_10007985 | 3300025961 | Bacteria | 6690 |
| 383 | Ga0207712_10312631 | 3300025961 | Bacteria | 1293 |
| 384 | Ga0207712_10392759 | 3300025961 | Bacteria | 1164 |
| 385 | Ga0207668_10001633 | 3300025972 | Bacteria | 13105 |
| 386 | Ga0207668_10007857 | 3300025972 | Bacteria | 6342 |
| 387 | Ga0207640_10082887 | 3300025981 | Bacteria | 2197 |
| 388 | Ga0207658_10001299 | 3300025986 | Bacteria | 19720 |
| 389 | Ga0207658_10010287 | 3300025986 | Bacteria | 6357 |
| 390 | Ga0207677_10006642 | 3300026023 | Bacteria | 6348 |
| 391 | Ga0207677_10463230 | 3300026023 | Bacteria | 1088 |
| 392 | Ga0207703_10017904 | 3300026035 | Bacteria | 5532 |
| 393 | Ga0207703_10214743 | 3300026035 | Bacteria | 1717 |
| 394 | Ga0207639_10011964 | 3300026041 | Bacteria | 6038 |
| 395 | Ga0207639_10550354 | 3300026041 | Bacteria | 1059 |
| 396 | Ga0207678_10000720 | 3300026067 | Bacteria | 30194 |
| 397 | Ga0207678_10095314 | 3300026067 | Bacteria | 2543 |
| 398 | Ga0207678_10316580 | 3300026067 | Bacteria | 1342 |
| 399 | Ga0207708_10047203 | 3300026075 | Bacteria | 3280 |
| 400 | Ga0207702_10000147 | 3300026078 | Bacteria | 82633 |
| 401 | Ga0207641_10004970 | 3300026088 | Bacteria | 11405 |
| 402 | Ga0207641_10021577 | 3300026088 | Bacteria | 5291 |
| 403 | Ga0207641_10134324 | 3300026088 | Bacteria | 2225 |
| 404 | Ga0207648_10003178 | 3300026089 | Bacteria | 17305 |
| 405 | Ga0207648_10826775 | 3300026089 | Bacteria | 863 |
| 406 | Ga0207676_10001854 | 3300026095 | Bacteria | 15472 |
| 407 | Ga0207676_10098249 | 3300026095 | Bacteria | 2420 |
| 408 | Ga0207674_10030781 | 3300026116 | Bacteria | 5641 |
| 409 | Ga0207674_10049037 | 3300026116 | Bacteria | 4320 |
| 410 | Ga0207674_10246925 | 3300026116 | Bacteria | 1732 |
| 411 | Ga0207675_100000066 | 3300026118 | Bacteria | 78979 |
| 412 | Ga0207675_100139004 | 3300026118 | Bacteria | 2306 |
| 413 | Ga0207675_100145269 | 3300026118 | Bacteria | 2255 |
| 414 | Ga0207675_100343238 | 3300026118 | Bacteria | 1462 |
| 415 | Ga0207683_10000061 | 3300026121 | Bacteria | 81399 |
| 416 | Ga0207683_10001996 | 3300026121 | Bacteria | 18056 |
| 417 | Ga0207683_10363649 | 3300026121 | Bacteria | 1329 |
| 418 | Ga0207683_10893345 | 3300026121 | Bacteria | 825 |
| 419 | Ga0207698_10701810 | 3300026142 | Bacteria | 1007 |
| 420 | Ga0209371_1000008 | 3300027312 | Bacteria | 1024606 |
| 421 | Ga0209813_10063468 | 3300027866 | Bacteria | 1185 |
| 422 | Ga0207428_10005656 | 3300027907 | Bacteria | 11618 |
| 423 | Ga0207428_10222568 | 3300027907 | Bacteria | 1414 |
| 424 | Ga0268266_10026002 | 3300028379 | Bacteria | 4979 |
| 425 | Ga0268266_10687949 | 3300028379 | Bacteria | 985 |
| 426 | Ga0268265_10000174 | 3300028380 | Bacteria | 76817 |
| 427 | Ga0268265_10353978 | 3300028380 | Bacteria | 1342 |
| 428 | Ga0265318_10113080 | 3300028577 | Bacteria | 998 |
| 429 | Ga0307515_10000921 | 3300028794 | Bacteria | 67536 |
| 430 | Ga0307515_10419150 | 3300028794 | Bacteria | 960 |
| 431 | Ga0268256_1000009 | 3300030500 | Bacteria | 1022625 |
| 432 | Ga0307511_10013789 | 3300030521 | Bacteria | 7886 |
| 433 | Ga0265331_10008658 | 3300031250 | Bacteria | 5767 |
| 434 | Ga0265327_10008996 | 3300031251 | Bacteria | 7312 |
| 435 | Ga0307513_10000113 | 3300031456 | Bacteria | 114576 |
| 436 | Ga0307408_100000301 | 3300031548 | Bacteria | 47479 |
| 437 | Ga0307408_100324555 | 3300031548 | Bacteria | 1298 |
| 438 | Ga0307408_100533180 | 3300031548 | Bacteria | 1033 |
| 439 | Ga0307408_100683939 | 3300031548 | Bacteria | 920 |
| 440 | Ga0307508_10002291 | 3300031616 | Bacteria | 20329 |
| 441 | Ga0265314_10064978 | 3300031711 | Bacteria | 2467 |
| 442 | Ga0265314_10245137 | 3300031711 | Bacteria | 1031 |
| 443 | Ga0307516_10436618 | 3300031730 | Bacteria | 966 |
| 444 | Ga0307405_10376224 | 3300031731 | Bacteria | 1104 |
| 445 | Ga0307410_10702481 | 3300031852 | Bacteria | 853 |
| 446 | Ga0307409_100069488 | 3300031995 | Bacteria | 2791 |
| 447 | Ga0307409_100965372 | 3300031995 | Bacteria | 869 |
| 448 | Ga0307409_101046293 | 3300031995 | Bacteria | 836 |
| 449 | Ga0307416_100181703 | 3300032002 | Bacteria | 1972 |
| 450 | Ga0307416_101329606 | 3300032002 | Bacteria | 824 |
| 451 | Ga0307414_10599218 | 3300032004 | Bacteria | 988 |
| 452 | Ga0307415_100079860 | 3300032126 | Bacteria | 2332 |
| 453 | Ga0373938_0014196 | 3300034957 | Bacteria | 1525 |
| 454 | Ga0373929_0007658 | 3300035085 | Bacteria | 1976 |
| 455 | Ga0373934_0065819 | 3300035086 | Bacteria | 1447 |
| 456 | Ga0373949_0018127 | 3300035090 | Bacteria | 1593 |
| 457 | Ga0373951_0050481 | 3300035091 | Bacteria | 1022 |
| 458 | Ga0373923_0207723 | 3300035111 | Bacteria | 907 |
| 459 | Ga0373932_0004781 | 3300035112 | Bacteria | 3193 |
| 460 | Ga0373939_0086778 | 3300035114 | Bacteria | 1050 |
| 461 | Ga0373953_0100978 | 3300035117 | Bacteria | 1214 |
| 462 | Ga0373942_0089800 | 3300035207 | Bacteria | 924 |
| 463 | Ga0373961_0005960 | 3300035241 | Bacteria | 2928 |
| 464 | Ga0373962_0013966 | 3300035242 | Bacteria | 2041 |
| 465 | Ga0373924_0004330 | 3300035410 | Bacteria | 4954 |
| 466 | Ga0373931_0007152 | 3300035691 | Bacteria | 5250 |
| 467 | Ga0373931_0307168 | 3300035691 | Bacteria | 981 |
| 468 | Ga0373931_0432606 | 3300035691 | Bacteria | 838 |
| 469 | Ga0373937_0222488 | 3300036401 | Bacteria | 1777 |
| 470 | Ga0395899_0000005 | 3300037312 | Bacteria | 772966 |
| 471 | Ga0395900_0000003 | 3300037418 | Bacteria | 587648 |
| 472 | Ga0395900_0250548 | 3300037418 | Bacteria | 1772 |
| 473 | Ga0395900_0846332 | 3300037418 | Bacteria | 840 |
| 474 | Ga0395898_0000003 | 3300037466 | Bacteria | 772986 |
| 475 | Ga0395905_0035594 | 3300037471 | Bacteria | 4675 |
| 476 | Ga0395905_0078520 | 3300037471 | Bacteria | 3093 |
| 477 | Ga0395905_0276889 | 3300037471 | Bacteria | 1564 |
| 478 | Ga0395905_0297864 | 3300037471 | Bacteria | 1500 |
| 479 | Ga0395905_0598951 | 3300037471 | Bacteria | 1004 |
| 480 | Ga0395901_0003694 | 3300038443 | Bacteria | 15432 |
| 481 | Ga0395901_0130167 | 3300038443 | Bacteria | 2644 |
| 482 | Ga0395901_0189780 | 3300038443 | Bacteria | 2155 |
| 483 | Ga0395901_0433511 | 3300038443 | Bacteria | 1346 |
| 484 | Ga0395901_0472872 | 3300038443 | Bacteria | 1279 |
| 485 | Ga0395901_0544468 | 3300038443 | Bacteria | 1177 |
| 486 | Ga0436365_1617569 | 3300039437 | Bacteria | 699 |
| 487 | Ga0436361_0739886 | 3300039447 | Bacteria | 1329 |
| 488 | Ga0439439_0016402 | 3300041406 | Bacteria | 1814 |
| 489 | Ga0439461_0041974 | 3300041410 | Bacteria | 991 |
| 490 | Ga0439466_0028322 | 3300041411 | Bacteria | 1934 |
| 491 | Ga0451793_1256750 | 3300041452 | Bacteria | 3375 |
| 492 | Ga0451804_0767943 | 3300041463 | Bacteria | 832 |
| 493 | Ga0451833_0651743 | 3300041491 | Bacteria | 1101 |
| 494 | Ga0451853_3559394 | 3300041512 | Bacteria | 903 |
| 495 | Ga0439448_0021716 | 3300042005 | Bacteria | 1990 |
| 496 | Ga0466969_0068415 | 3300044656 | Bacteria | 1711 |
| 497 | Ga0466972_0022390 | 3300044658 | Bacteria | 3148 |
| 498 | Ga0466973_0010320 | 3300044659 | Bacteria | 8611 |
| 499 | Ga0466965_0050893 | 3300044683 | Bacteria | 2054 |
| 500 | Ga0466966_0000035 | 3300044684 | Bacteria | 98928 |
| 501 | Ga0466966_0010854 | 3300044684 | Bacteria | 6050 |
| 502 | Ga0466966_0068519 | 3300044684 | Bacteria | 2227 |
| 503 | Ga0466966_0118480 | 3300044684 | Bacteria | 1628 |
| 504 | Ga0466966_0310483 | 3300044684 | Bacteria | 948 |
| 505 | Ga0466961_0000336 | 3300044693 | Bacteria | 30807 |
| 506 | Ga0466961_0002332 | 3300044693 | Bacteria | 11791 |
| 507 | Ga0466961_0009907 | 3300044693 | Bacteria | 6073 |
| 508 | Ga0466963_0004216 | 3300044694 | Bacteria | 8337 |
| 509 | Ga0466963_0006557 | 3300044694 | Bacteria | 6894 |
| 510 | Ga0466963_0089659 | 3300044694 | Bacteria | 2092 |
| 511 | Ga0466964_0086694 | 3300044706 | Bacteria | 1355 |
| 512 | Ga0466971_0009252 | 3300044719 | Bacteria | 4305 |
| 513 | Ga0466968_0037529 | 3300044735 | Bacteria | 2033 |
| 514 | Ga0466968_0060109 | 3300044735 | Bacteria | 1638 |
| 515 | Ga0466970_0050844 | 3300044765 | Bacteria | 2211 |
| 516 | Ga0466970_0054906 | 3300044765 | Bacteria | 2127 |
| 517 | Ga0466970_0117361 | 3300044765 | Bacteria | 1456 |
| 518 | Ga0466957_0000649 | 3300044842 | Bacteria | 17672 |
| 519 | Ga0466957_0011503 | 3300044842 | Bacteria | 5108 |
| 520 | Ga0466957_0130055 | 3300044842 | Bacteria | 1612 |
| 521 | Ga0466957_0302846 | 3300044842 | Bacteria | 1074 |
| 522 | Ga0466959_0005789 | 3300045049 | Bacteria | 8513 |
| 523 | Ga0466959_0019544 | 3300045049 | Bacteria | 4981 |
| 524 | Ga0466959_0184894 | 3300045049 | Bacteria | 1456 |
| 525 | Ga0451576_0134953 | 3300045051 | Bacteria | 2573 |
| 526 | Ga0451576_0156905 | 3300045051 | Bacteria | 2374 |
| 527 | Ga0466958_0020593 | 3300045836 | Bacteria | 3848 |
| 528 | Ga0466958_0025530 | 3300045836 | Bacteria | 3484 |
| 529 | Ga0466958_0039955 | 3300045836 | Bacteria | 2819 |
| 530 | Ga0466958_0125049 | 3300045836 | Bacteria | 1612 |
| 531 | Ga0466967_0054425 | 3300045976 | Bacteria | 3521 |
| 532 | Ga0466967_0128037 | 3300045976 | Bacteria | 2354 |
| 533 | Ga0466967_0588214 | 3300045976 | Bacteria | 1098 |
| 534 | Ga0495617_000150 | 3300046452 | Bacteria | 44881 |
| 535 | Ga0495617_000161 | 3300046452 | Bacteria | 42643 |
| 536 | Ga0495617_000482 | 3300046452 | Bacteria | 21208 |
| 537 | Ga0495617_053734 | 3300046452 | Bacteria | 1338 |
| 538 | Ga0495627_000598 | 3300046453 | Bacteria | 28785 |
| 539 | Ga0495627_006747 | 3300046453 | Bacteria | 4468 |
| 540 | Ga0495627_011318 | 3300046453 | Bacteria | 3206 |
| 541 | Ga0495627_014601 | 3300046453 | Bacteria | 2735 |
| 542 | Ga0495627_016507 | 3300046453 | Bacteria | 2525 |
| 543 | Ga0495627_030390 | 3300046453 | Bacteria | 1712 |
| 544 | Ga0495603_0001565 | 3300046455 | Bacteria | 13380 |
| 545 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 546 | Ga0495590_0000013 | 3300046457 | Bacteria | 271977 |
| 547 | Ga0495590_0001057 | 3300046457 | Bacteria | 12118 |
| 548 | Ga0495591_000109 | 3300046458 | Bacteria | 94877 |
| 549 | Ga0495591_062307 | 3300046458 | Bacteria | 988 |
| 550 | Ga0495638_0000027 | 3300046460 | Bacteria | 337569 |
| 551 | Ga0495638_0000034 | 3300046460 | Bacteria | 282038 |
| 552 | Ga0495638_0002984 | 3300046460 | Bacteria | 13503 |
| 553 | Ga0495638_0008497 | 3300046460 | Bacteria | 7278 |
| 554 | Ga0495638_0047171 | 3300046460 | Bacteria | 2702 |
| 555 | Ga0495638_0056554 | 3300046460 | Bacteria | 2434 |
| 556 | Ga0495638_0081076 | 3300046460 | Bacteria | 1970 |
| 557 | Ga0495651_0133033 | 3300046462 | Bacteria | 1813 |
| 558 | Ga0495653_0002434 | 3300046463 | Bacteria | 14798 |
| 559 | Ga0495653_0049957 | 3300046463 | Bacteria | 3218 |
| 560 | Ga0495650_0000322 | 3300046471 | Bacteria | 85802 |
| 561 | Ga0495650_0000653 | 3300046471 | Bacteria | 45690 |
| 562 | Ga0495650_0004075 | 3300046471 | Bacteria | 10219 |
| 563 | Ga0495650_0004125 | 3300046471 | Bacteria | 10121 |
| 564 | Ga0495580_0034724 | 3300046472 | Bacteria | 3628 |
| 565 | Ga0495605_0005435 | 3300046474 | Bacteria | 7418 |
| 566 | Ga0495605_0006402 | 3300046474 | Bacteria | 6777 |
| 567 | Ga0495605_0016476 | 3300046474 | Bacteria | 4000 |
| 568 | Ga0495605_0031057 | 3300046474 | Bacteria | 2731 |
| 569 | Ga0495605_0040684 | 3300046474 | Bacteria | 2319 |
| 570 | Ga0495605_0221990 | 3300046474 | Bacteria | 816 |
| 571 | Ga0495639_0113686 | 3300046475 | Bacteria | 1287 |
| 572 | Ga0495639_0150653 | 3300046475 | Bacteria | 1122 |
| 573 | Ga0495584_0000004 | 3300046491 | Bacteria | 314714 |
| 574 | Ga0495584_0000029 | 3300046491 | Bacteria | 105850 |
| 575 | Ga0495584_0000168 | 3300046491 | Bacteria | 46140 |
| 576 | Ga0495584_0004385 | 3300046491 | Bacteria | 7599 |
| 577 | Ga0495584_0007594 | 3300046491 | Bacteria | 5651 |
| 578 | Ga0495584_0028515 | 3300046491 | Bacteria | 2829 |
| 579 | Ga0495584_0108255 | 3300046491 | Bacteria | 1405 |
| 580 | Ga0495585_0000746 | 3300046492 | Bacteria | 28843 |
| 581 | Ga0495585_0001437 | 3300046492 | Bacteria | 18679 |
| 582 | Ga0495585_0003077 | 3300046492 | Bacteria | 11468 |
| 583 | Ga0495585_0008335 | 3300046492 | Bacteria | 6285 |
| 584 | Ga0495585_0012851 | 3300046492 | Bacteria | 4922 |
| 585 | Ga0495585_0019523 | 3300046492 | Bacteria | 3907 |
| 586 | Ga0495585_0036621 | 3300046492 | Bacteria | 2765 |
| 587 | Ga0495585_0044004 | 3300046492 | Bacteria | 2495 |
| 588 | Ga0495585_0049484 | 3300046492 | Bacteria | 2333 |
| 589 | Ga0495585_0056798 | 3300046492 | Bacteria | 2161 |
| 590 | Ga0495585_0058845 | 3300046492 | Bacteria | 2119 |
| 591 | Ga0495596_0000016 | 3300046500 | Bacteria | 117489 |
| 592 | Ga0495596_0000508 | 3300046500 | Bacteria | 24723 |
| 593 | Ga0495596_0001287 | 3300046500 | Bacteria | 14494 |
| 594 | Ga0495596_0001871 | 3300046500 | Bacteria | 11673 |
| 595 | Ga0495596_0008416 | 3300046500 | Bacteria | 4593 |
| 596 | Ga0495596_0045209 | 3300046500 | Bacteria | 1731 |
| 597 | Ga0495596_0072015 | 3300046500 | Bacteria | 1342 |
| 598 | Ga0495607_0000010 | 3300046501 | Bacteria | 206525 |
| 599 | Ga0495607_0002596 | 3300046501 | Bacteria | 14539 |
| 600 | Ga0495607_0002953 | 3300046501 | Bacteria | 13366 |
| 601 | Ga0495607_0006941 | 3300046501 | Bacteria | 7895 |
| 602 | Ga0495607_0008769 | 3300046501 | Bacteria | 6888 |
| 603 | Ga0495607_0026641 | 3300046501 | Bacteria | 3585 |
| 604 | Ga0495607_0028658 | 3300046501 | Bacteria | 3433 |
| 605 | Ga0495607_0038878 | 3300046501 | Bacteria | 2846 |
| 606 | Ga0495607_0044662 | 3300046501 | Bacteria | 2611 |
| 607 | Ga0495607_0046022 | 3300046501 | Bacteria | 2564 |
| 608 | Ga0495607_0047554 | 3300046501 | Bacteria | 2513 |
| 609 | Ga0495607_0051633 | 3300046501 | Bacteria | 2386 |
| 610 | Ga0495607_0073599 | 3300046501 | Bacteria | 1898 |
| 611 | Ga0495607_0077443 | 3300046501 | Bacteria | 1837 |
| 612 | Ga0495607_0116460 | 3300046501 | Bacteria | 1409 |
| 613 | Ga0495607_0172438 | 3300046501 | Bacteria | 1091 |
| 614 | Ga0495607_0212452 | 3300046501 | Bacteria | 951 |
| 615 | Ga0495583_0000108 | 3300046506 | Bacteria | 139791 |
| 616 | Ga0495583_0000246 | 3300046506 | Bacteria | 89354 |
| 617 | Ga0495583_0000574 | 3300046506 | Bacteria | 50599 |
| 618 | Ga0495583_0001070 | 3300046506 | Bacteria | 30573 |
| 619 | Ga0495583_0002517 | 3300046506 | Bacteria | 15512 |
| 620 | Ga0495583_0005662 | 3300046506 | Bacteria | 8406 |
| 621 | Ga0495583_0017679 | 3300046506 | Bacteria | 3779 |
| 622 | Ga0495583_0021670 | 3300046506 | Bacteria | 3300 |
| 623 | Ga0495583_0027221 | 3300046506 | Bacteria | 2824 |
| 624 | Ga0495583_0029106 | 3300046506 | Bacteria | 2706 |
| 625 | Ga0495583_0034876 | 3300046506 | Bacteria | 2406 |
| 626 | Ga0495606_0007104 | 3300046507 | Bacteria | 10123 |
| 627 | Ga0495606_0007228 | 3300046507 | Bacteria | 10009 |
| 628 | Ga0495606_0015743 | 3300046507 | Bacteria | 5807 |
| 629 | Ga0495606_0063848 | 3300046507 | Bacteria | 2345 |
| 630 | Ga0495606_0076487 | 3300046507 | Bacteria | 2092 |
| 631 | Ga0495606_0116642 | 3300046507 | Bacteria | 1603 |
| 632 | Ga0495606_0206351 | 3300046507 | Bacteria | 1116 |
| 633 | Ga0495606_0220410 | 3300046507 | Bacteria | 1069 |
| 634 | Ga0495610_0000198 | 3300046512 | Bacteria | 67337 |
| 635 | Ga0495610_0003668 | 3300046512 | Bacteria | 11807 |
| 636 | Ga0495610_0005787 | 3300046512 | Bacteria | 8700 |
| 637 | Ga0495610_0006766 | 3300046512 | Bacteria | 7780 |
| 638 | Ga0495610_0017574 | 3300046512 | Bacteria | 4074 |
| 639 | Ga0495610_0060835 | 3300046512 | Bacteria | 1796 |
| 640 | Ga0495610_0077586 | 3300046512 | Bacteria | 1534 |
| 641 | Ga0495616_0001871 | 3300046513 | Bacteria | 14224 |
| 642 | Ga0495616_0003207 | 3300046513 | Bacteria | 10544 |
| 643 | Ga0495616_0003752 | 3300046513 | Bacteria | 9693 |
| 644 | Ga0495616_0010304 | 3300046513 | Bacteria | 5416 |
| 645 | Ga0495616_0027024 | 3300046513 | Bacteria | 3048 |
| 646 | Ga0495616_0027242 | 3300046513 | Bacteria | 3034 |
| 647 | Ga0495616_0032583 | 3300046513 | Bacteria | 2720 |
| 648 | Ga0495616_0042619 | 3300046513 | Bacteria | 2310 |
| 649 | Ga0495616_0086986 | 3300046513 | Bacteria | 1485 |
| 650 | Ga0495620_0004589 | 3300046515 | Bacteria | 7769 |
| 651 | Ga0495620_0021521 | 3300046515 | Bacteria | 3130 |
| 652 | Ga0495628_0000366 | 3300046516 | Bacteria | 41368 |
| 653 | Ga0495628_0422885 | 3300046516 | Bacteria | 971 |
| 654 | Ga0495631_0000063 | 3300046518 | Bacteria | 66560 |
| 655 | Ga0495631_0007886 | 3300046518 | Bacteria | 5390 |
| 656 | Ga0495631_0008421 | 3300046518 | Bacteria | 5198 |
| 657 | Ga0495631_0029987 | 3300046518 | Bacteria | 2470 |
| 658 | Ga0495631_0038814 | 3300046518 | Bacteria | 2115 |
| 659 | Ga0495631_0042417 | 3300046518 | Bacteria | 2010 |
| 660 | Ga0495631_0146325 | 3300046518 | Bacteria | 1014 |
| 661 | Ga0495632_0000118 | 3300046519 | Bacteria | 81183 |
| 662 | Ga0495632_0008663 | 3300046519 | Bacteria | 6211 |
| 663 | Ga0495632_0034637 | 3300046519 | Bacteria | 2582 |
| 664 | Ga0495632_0035531 | 3300046519 | Bacteria | 2541 |
| 665 | Ga0495632_0035944 | 3300046519 | Bacteria | 2523 |
| 666 | Ga0495632_0053177 | 3300046519 | Bacteria | 1989 |
| 667 | Ga0495632_0130380 | 3300046519 | Bacteria | 1170 |
| 668 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 669 | Ga0495637_0003117 | 3300046520 | Bacteria | 8844 |
| 670 | Ga0495637_0057625 | 3300046520 | Bacteria | 1604 |
| 671 | Ga0495637_0061927 | 3300046520 | Bacteria | 1532 |
| 672 | Ga0495637_0064385 | 3300046520 | Bacteria | 1495 |
| 673 | Ga0495643_0000028 | 3300046522 | Bacteria | 262886 |
| 674 | Ga0495643_0000167 | 3300046522 | Bacteria | 104447 |
| 675 | Ga0495643_0000398 | 3300046522 | Bacteria | 57089 |
| 676 | Ga0495643_0000806 | 3300046522 | Bacteria | 34503 |
| 677 | Ga0495643_0031419 | 3300046522 | Bacteria | 2954 |
| 678 | Ga0495643_0045741 | 3300046522 | Bacteria | 2375 |
| 679 | Ga0495643_0092380 | 3300046522 | Bacteria | 1560 |
| 680 | Ga0495643_0169218 | 3300046522 | Bacteria | 1069 |
| 681 | Ga0495644_0001842 | 3300046523 | Bacteria | 8552 |
| 682 | Ga0495644_0003267 | 3300046523 | Bacteria | 6408 |
| 683 | Ga0495644_0017201 | 3300046523 | Bacteria | 2765 |
| 684 | Ga0495644_0045134 | 3300046523 | Bacteria | 1657 |
| 685 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 686 | Ga0495648_0000127 | 3300046524 | Bacteria | 89962 |
| 687 | Ga0495648_0003027 | 3300046524 | Bacteria | 15061 |
| 688 | Ga0495648_0006784 | 3300046524 | Bacteria | 9257 |
| 689 | Ga0495648_0016213 | 3300046524 | Bacteria | 5376 |
| 690 | Ga0495648_0043266 | 3300046524 | Bacteria | 2825 |
| 691 | Ga0495648_0053579 | 3300046524 | Bacteria | 2443 |
| 692 | Ga0495648_0069857 | 3300046524 | Bacteria | 2042 |
| 693 | Ga0495648_0087131 | 3300046524 | Bacteria | 1759 |
| 694 | Ga0495663_0000430 | 3300046525 | Bacteria | 15337 |
| 695 | Ga0495663_0000667 | 3300046525 | Bacteria | 11844 |
| 696 | Ga0495663_0002025 | 3300046525 | Bacteria | 6225 |
| 697 | Ga0495663_0002087 | 3300046525 | Bacteria | 6113 |
| 698 | Ga0495663_0011033 | 3300046525 | Bacteria | 2515 |
| 699 | Ga0495663_0026855 | 3300046525 | Bacteria | 1687 |
| 700 | Ga0495663_0029574 | 3300046525 | Bacteria | 1619 |
| 701 | Ga0495663_0029935 | 3300046525 | Bacteria | 1610 |
| 702 | Ga0495663_0061670 | 3300046525 | Bacteria | 1180 |
| 703 | Ga0495666_0000042 | 3300046526 | Bacteria | 47032 |
| 704 | Ga0495642_0000713 | 3300046528 | Bacteria | 16565 |
| 705 | Ga0495642_0006913 | 3300046528 | Bacteria | 4350 |
| 706 | Ga0495642_0015223 | 3300046528 | Bacteria | 2986 |
| 707 | Ga0495642_0135830 | 3300046528 | Bacteria | 1060 |
| 708 | Ga0495652_0007817 | 3300046529 | Bacteria | 9822 |
| 709 | Ga0495652_0034272 | 3300046529 | Bacteria | 4426 |
| 710 | Ga0495654_0157555 | 3300046530 | Bacteria | 999 |
| 711 | Ga0495654_0193116 | 3300046530 | Bacteria | 875 |
| 712 | Ga0495586_0187068 | 3300046535 | Bacteria | 1172 |
| 713 | Ga0495586_0257319 | 3300046535 | Bacteria | 997 |
| 714 | Ga0495587_0177490 | 3300046536 | Bacteria | 1208 |
| 715 | Ga0495587_0182111 | 3300046536 | Bacteria | 1191 |
| 716 | Ga0495609_0001891 | 3300046538 | Bacteria | 13361 |
| 717 | Ga0495609_0003441 | 3300046538 | Bacteria | 9060 |
| 718 | Ga0495609_0003916 | 3300046538 | Bacteria | 8348 |
| 719 | Ga0495609_0005560 | 3300046538 | Bacteria | 6579 |
| 720 | Ga0495609_0028674 | 3300046538 | Bacteria | 2540 |
| 721 | Ga0495609_0031199 | 3300046538 | Bacteria | 2423 |
| 722 | Ga0495609_0043209 | 3300046538 | Bacteria | 2023 |
| 723 | Ga0495609_0097429 | 3300046538 | Bacteria | 1275 |
| 724 | Ga0495609_0111753 | 3300046538 | Bacteria | 1179 |
| 725 | Ga0495609_0186241 | 3300046538 | Bacteria | 872 |
| 726 | Ga0495609_0201788 | 3300046538 | Bacteria | 831 |
| 727 | Ga0495621_0092438 | 3300046539 | Bacteria | 1142 |
| 728 | Ga0495597_0000072 | 3300046542 | Bacteria | 87914 |
| 729 | Ga0495597_0000227 | 3300046542 | Bacteria | 50869 |
| 730 | Ga0495597_0000855 | 3300046542 | Bacteria | 23940 |
| 731 | Ga0495597_0008907 | 3300046542 | Bacteria | 5003 |
| 732 | Ga0495597_0015375 | 3300046542 | Bacteria | 3625 |
| 733 | Ga0495597_0060129 | 3300046542 | Bacteria | 1657 |
| 734 | Ga0495597_0061909 | 3300046542 | Bacteria | 1629 |
| 735 | Ga0495645_0320471 | 3300046543 | Bacteria | 1007 |
| 736 | Ga0495622_0000002 | 3300046557 | Bacteria | 321742 |
| 737 | Ga0495622_0000200 | 3300046557 | Bacteria | 47745 |
| 738 | Ga0495622_0126161 | 3300046557 | Bacteria | 1167 |
| 739 | Ga0495633_0000033 | 3300046558 | Bacteria | 186714 |
| 740 | Ga0495633_0000055 | 3300046558 | Bacteria | 151013 |
| 741 | Ga0495633_0000358 | 3300046558 | Bacteria | 49277 |
| 742 | Ga0495633_0003373 | 3300046558 | Bacteria | 10698 |
| 743 | Ga0495633_0005693 | 3300046558 | Bacteria | 7541 |
| 744 | Ga0495633_0027144 | 3300046558 | Bacteria | 2801 |
| 745 | Ga0495633_0031404 | 3300046558 | Bacteria | 2575 |
| 746 | Ga0495633_0034184 | 3300046558 | Bacteria | 2446 |
| 747 | Ga0495633_0157881 | 3300046558 | Bacteria | 1046 |
| 748 | Ga0495633_0232800 | 3300046558 | Bacteria | 842 |
| 749 | Ga0495656_0001583 | 3300046615 | Bacteria | 7456 |
| 750 | Ga0495656_0053816 | 3300046615 | Bacteria | 1730 |
| 751 | Ga0495656_0056704 | 3300046615 | Bacteria | 1694 |
| 752 | Ga0495656_0153134 | 3300046615 | Bacteria | 1115 |
| 753 | Ga0495656_0176141 | 3300046615 | Bacteria | 1048 |
| 754 | Ga0495656_0215911 | 3300046615 | Bacteria | 957 |
| 755 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 756 | Ga0495668_0000065 | 3300046616 | Bacteria | 178985 |
| 757 | Ga0495668_0004167 | 3300046616 | Bacteria | 10436 |
| 758 | Ga0495668_0012198 | 3300046616 | Bacteria | 5107 |
| 759 | Ga0495668_0021032 | 3300046616 | Bacteria | 3746 |
| 760 | Ga0495668_0032724 | 3300046616 | Bacteria | 2923 |
| 761 | Ga0495668_0036883 | 3300046616 | Bacteria | 2737 |
| 762 | Ga0495668_0144662 | 3300046616 | Bacteria | 1301 |
| 763 | Ga0495668_0174317 | 3300046616 | Bacteria | 1178 |
| 764 | Ga0495668_0198177 | 3300046616 | Bacteria | 1099 |
| 765 | Ga0495634_0035042 | 3300046642 | Bacteria | 3440 |
| 766 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 767 | Ga0495611_0000410 | 3300046648 | Bacteria | 26643 |
| 768 | Ga0495611_0000965 | 3300046648 | Bacteria | 15317 |
| 769 | Ga0495611_0004192 | 3300046648 | Bacteria | 6275 |
| 770 | Ga0495611_0004303 | 3300046648 | Bacteria | 6185 |
| 771 | Ga0495611_0081476 | 3300046648 | Bacteria | 1488 |
| 772 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 773 | Ga0495625_0000121 | 3300046660 | Bacteria | 121186 |
| 774 | Ga0495625_0000272 | 3300046660 | Bacteria | 80655 |
| 775 | Ga0495625_0001594 | 3300046660 | Bacteria | 26845 |
| 776 | Ga0495625_0003267 | 3300046660 | Bacteria | 16384 |
| 777 | Ga0495625_0036183 | 3300046660 | Bacteria | 3631 |
| 778 | Ga0495625_0071882 | 3300046660 | Bacteria | 2427 |
| 779 | Ga0495625_0090919 | 3300046660 | Bacteria | 2110 |
| 780 | Ga0495625_0092736 | 3300046660 | Bacteria | 2086 |
| 781 | Ga0495625_0095803 | 3300046660 | Bacteria | 2045 |
| 782 | Ga0495625_0252418 | 3300046660 | Bacteria | 1144 |
| 783 | Ga0495635_0059085 | 3300046663 | Bacteria | 2637 |
| 784 | Ga0495635_0260240 | 3300046663 | Bacteria | 1168 |
| 785 | Ga0495659_0000068 | 3300046664 | Bacteria | 46175 |
| 786 | Ga0495659_0000327 | 3300046664 | Bacteria | 18786 |
| 787 | Ga0495661_0000049 | 3300046665 | Bacteria | 144060 |
| 788 | Ga0495661_0000839 | 3300046665 | Bacteria | 28706 |
| 789 | Ga0495661_0011847 | 3300046665 | Bacteria | 5905 |
| 790 | Ga0495661_0014616 | 3300046665 | Bacteria | 5257 |
| 791 | Ga0495661_0033552 | 3300046665 | Bacteria | 3237 |
| 792 | Ga0495661_0045135 | 3300046665 | Bacteria | 2696 |
| 793 | Ga0495661_0068329 | 3300046665 | Bacteria | 2084 |
| 794 | Ga0495661_0068964 | 3300046665 | Bacteria | 2073 |
| 795 | Ga0495661_0077750 | 3300046665 | Bacteria | 1921 |
| 796 | Ga0495661_0080141 | 3300046665 | Bacteria | 1885 |
| 797 | Ga0495661_0135623 | 3300046665 | Bacteria | 1344 |
| 798 | Ga0495661_0145386 | 3300046665 | Bacteria | 1285 |
| 799 | Ga0495661_0332408 | 3300046665 | Bacteria | 752 |
| 800 | Ga0495623_0011973 | 3300046679 | Bacteria | 5619 |
| 801 | Ga0495658_0103700 | 3300046683 | Bacteria | 1701 |
| 802 | Ga0495658_0192797 | 3300046683 | Bacteria | 1268 |
| 803 | Ga0495658_0279392 | 3300046683 | Bacteria | 1054 |
| 804 | Ga0495669_0003845 | 3300046684 | Bacteria | 6172 |
| 805 | Ga0495669_0070249 | 3300046684 | Bacteria | 1594 |
| 806 | Ga0495670_0000676 | 3300046691 | Bacteria | 16204 |
| 807 | Ga0495670_0003614 | 3300046691 | Bacteria | 7596 |
| 808 | Ga0495670_0022234 | 3300046691 | Bacteria | 3130 |
| 809 | Ga0495670_0022929 | 3300046691 | Bacteria | 3082 |
| 810 | Ga0495671_0000129 | 3300046692 | Bacteria | 68297 |
| 811 | Ga0495671_0043038 | 3300046692 | Bacteria | 2267 |
| 812 | Ga0495671_0059437 | 3300046692 | Bacteria | 1889 |
| 813 | Ga0495671_0064592 | 3300046692 | Bacteria | 1802 |
| 814 | Ga0495671_0151025 | 3300046692 | Bacteria | 1131 |
| 815 | Ga0495671_0285830 | 3300046692 | Bacteria | 794 |
| 816 | Ga0495649_0000071 | 3300046694 | Bacteria | 89386 |
| 817 | Ga0495649_0004200 | 3300046694 | Bacteria | 9453 |
| 818 | Ga0495649_0024198 | 3300046694 | Bacteria | 3387 |
| 819 | Ga0495649_0049519 | 3300046694 | Bacteria | 2282 |
| 820 | Ga0495649_0066875 | 3300046694 | Bacteria | 1928 |
| 821 | Ga0495589_0000048 | 3300046794 | Bacteria | 117134 |
| 822 | Ga0495589_0000112 | 3300046794 | Bacteria | 77426 |
| 823 | Ga0495589_0017854 | 3300046794 | Bacteria | 3639 |
| 824 | Ga0495589_0024781 | 3300046794 | Bacteria | 3047 |
| 825 | Ga0495589_0065123 | 3300046794 | Bacteria | 1786 |
| 826 | Ga0495660_0000008 | 3300046810 | Bacteria | 435769 |
| 827 | Ga0495660_0004944 | 3300046810 | Bacteria | 8029 |
| 828 | Ga0495660_0007687 | 3300046810 | Bacteria | 6332 |
| 829 | Ga0495660_0015575 | 3300046810 | Bacteria | 4392 |
| 830 | Ga0495660_0076122 | 3300046810 | Bacteria | 1768 |
| 831 | Ga0495660_0088509 | 3300046810 | Bacteria | 1613 |
| 832 | Ga0495660_0138521 | 3300046810 | Bacteria | 1213 |
| 833 | Ga0495604_0080259 | 3300047317 | Bacteria | 2445 |
| 834 | Ga0495604_0131275 | 3300047317 | Bacteria | 1800 |
| 835 | Ga0495636_0000799 | 3300047318 | Bacteria | 11574 |
| 836 | Ga0495636_0015324 | 3300047318 | Bacteria | 3055 |
| 837 | Ga0495674_0016607 | 3300047319 | Bacteria | 6870 |
| 838 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 839 | Ga0495672_0000191 | 3300047320 | Bacteria | 88319 |
| 840 | Ga0495672_0001752 | 3300047320 | Bacteria | 20938 |
| 841 | Ga0495672_0005042 | 3300047320 | Bacteria | 10563 |
| 842 | Ga0495672_0016900 | 3300047320 | Bacteria | 4893 |
| 843 | Ga0495672_0028568 | 3300047320 | Bacteria | 3527 |
| 844 | Ga0495680_0150482 | 3300047322 | Bacteria | 1697 |
| 845 | Ga0495680_0246890 | 3300047322 | Bacteria | 1266 |
| 846 | Ga0495683_0000168 | 3300047323 | Bacteria | 63828 |
| 847 | Ga0495683_0000174 | 3300047323 | Bacteria | 63168 |
| 848 | Ga0495683_0015029 | 3300047323 | Bacteria | 4031 |
| 849 | Ga0495683_0021392 | 3300047323 | Bacteria | 3333 |
| 850 | Ga0495683_0097507 | 3300047323 | Bacteria | 1417 |
| 851 | Ga0495683_0162306 | 3300047323 | Bacteria | 1032 |
| 852 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 853 | Ga0495687_000015 | 3300047443 | Bacteria | 365627 |
| 854 | Ga0495687_000369 | 3300047443 | Bacteria | 56056 |
| 855 | Ga0495687_000924 | 3300047443 | Bacteria | 30497 |
| 856 | Ga0495687_002679 | 3300047443 | Bacteria | 13854 |
| 857 | Ga0495687_002834 | 3300047443 | Bacteria | 13350 |
| 858 | Ga0495687_052618 | 3300047443 | Bacteria | 1720 |
| 859 | Ga0495687_134554 | 3300047443 | Bacteria | 869 |
| 860 | Ga0495675_0008485 | 3300047444 | Bacteria | 6368 |
| 861 | Ga0495677_0000355 | 3300047445 | Bacteria | 19826 |
| 862 | Ga0495677_0000910 | 3300047445 | Bacteria | 11901 |
| 863 | Ga0495677_0005688 | 3300047445 | Bacteria | 4725 |
| 864 | Ga0495677_0007740 | 3300047445 | Bacteria | 4005 |
| 865 | Ga0495677_0012898 | 3300047445 | Bacteria | 3043 |
| 866 | Ga0495677_0022125 | 3300047445 | Bacteria | 2304 |
| 867 | Ga0495677_0025475 | 3300047445 | Bacteria | 2146 |
| 868 | Ga0495677_0037543 | 3300047445 | Bacteria | 1769 |
| 869 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 870 | Ga0495679_001633 | 3300047446 | Bacteria | 12492 |
| 871 | Ga0495679_002909 | 3300047446 | Bacteria | 8478 |
| 872 | Ga0495685_000192 | 3300047447 | Bacteria | 20404 |
| 873 | Ga0495685_012712 | 3300047447 | Bacteria | 2851 |
| 874 | Ga0495685_031041 | 3300047447 | Bacteria | 1837 |
| 875 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 876 | Ga0495673_0000061 | 3300047469 | Bacteria | 230647 |
| 877 | Ga0495673_0000089 | 3300047469 | Bacteria | 188744 |
| 878 | Ga0495681_0000016 | 3300047470 | Bacteria | 181322 |
| 879 | Ga0495681_0000658 | 3300047470 | Bacteria | 26270 |
| 880 | Ga0495681_0001103 | 3300047470 | Bacteria | 20503 |
| 881 | Ga0495681_0004943 | 3300047470 | Bacteria | 8996 |
| 882 | Ga0495681_0006172 | 3300047470 | Bacteria | 7913 |
| 883 | Ga0495681_0009251 | 3300047470 | Bacteria | 6091 |
| 884 | Ga0495681_0011767 | 3300047470 | Bacteria | 5181 |
| 885 | Ga0495681_0019397 | 3300047470 | Bacteria | 3714 |
| 886 | Ga0495681_0022548 | 3300047470 | Bacteria | 3366 |
| 887 | Ga0495681_0040619 | 3300047470 | Bacteria | 2264 |
| 888 | Ga0495681_0090335 | 3300047470 | Bacteria | 1353 |
| 889 | Ga0495681_0179504 | 3300047470 | Bacteria | 871 |
| 890 | Ga0495686_0000146 | 3300047472 | Bacteria | 141435 |
| 891 | Ga0495686_0003433 | 3300047472 | Bacteria | 13745 |
| 892 | Ga0495686_0017581 | 3300047472 | Bacteria | 4811 |
| 893 | Ga0495686_0057450 | 3300047472 | Bacteria | 2428 |
| 894 | Ga0495686_0118304 | 3300047472 | Bacteria | 1582 |
| 895 | Ga0495602_0026419 | 3300048088 | Bacteria | 5599 |
| 896 | Ga0495615_0000012 | 3300048090 | Bacteria | 64858 |
| 897 | Ga0495615_0036450 | 3300048090 | Bacteria | 1207 |
| 898 | Ga0495615_0042955 | 3300048090 | Bacteria | 1136 |
| 899 | Ga0495626_0006364 | 3300048091 | Bacteria | 6731 |
| 900 | Ga0495626_0021288 | 3300048091 | Bacteria | 3218 |
| 901 | Ga0495626_0067203 | 3300048091 | Bacteria | 1619 |
| 902 | Ga0496100_0013632 | 3300048903 | Bacteria | 4695 |
| 903 | Ga0496100_0190993 | 3300048903 | Bacteria | 1487 |
| 904 | Ga0496101_0003543 | 3300048904 | Bacteria | 9740 |
| 905 | Ga0496101_0201911 | 3300048904 | Bacteria | 1537 |
| 906 | Ga0496101_0264110 | 3300048904 | Bacteria | 1343 |
| 907 | Ga0496102_0000103 | 3300048905 | Bacteria | 122239 |
| 908 | Ga0496102_0114554 | 3300048905 | Bacteria | 2515 |
| 909 | Ga0496102_0206472 | 3300048905 | Bacteria | 1852 |
| 910 | Ga0496103_0000036 | 3300048906 | Bacteria | 180019 |
| 911 | Ga0496103_0005307 | 3300048906 | Bacteria | 7731 |
| 912 | Ga0496103_0243090 | 3300048906 | Bacteria | 1158 |
| 913 | Ga0496104_0002829 | 3300048907 | Bacteria | 14970 |
| 914 | Ga0496104_0013012 | 3300048907 | Bacteria | 7492 |
| 915 | Ga0496104_0085803 | 3300048907 | Bacteria | 3005 |
| 916 | Ga0496104_0321070 | 3300048907 | Bacteria | 1461 |
| 917 | Ga0496105_0001982 | 3300048908 | Bacteria | 14740 |
| 918 | Ga0496105_0030075 | 3300048908 | Bacteria | 4449 |
| 919 | Ga0496105_0061406 | 3300048908 | Bacteria | 3101 |
| 920 | Ga0496105_0069371 | 3300048908 | Bacteria | 2913 |
| 921 | Ga0496106_0010373 | 3300048909 | Bacteria | 6883 |
| 922 | Ga0496107_0143245 | 3300048910 | Bacteria | 1767 |
| 923 | Ga0496107_0274533 | 3300048910 | Bacteria | 1255 |
| 924 | Ga0496107_0446481 | 3300048910 | Bacteria | 961 |
| 925 | Ga0496108_0015009 | 3300048911 | Bacteria | 6323 |
| 926 | Ga0496108_0041368 | 3300048911 | Bacteria | 3848 |
| 927 | Ga0496108_0145189 | 3300048911 | Bacteria | 2045 |
| 928 | Ga0496109_0101361 | 3300048912 | Bacteria | 2672 |
| 929 | Ga0496109_0207592 | 3300048912 | Bacteria | 1842 |
| 930 | Ga0496110_0026193 | 3300048913 | Bacteria | 4987 |
| 931 | Ga0496110_0080787 | 3300048913 | Bacteria | 2897 |
| 932 | Ga0496110_0334973 | 3300048913 | Bacteria | 1378 |
| 933 | Ga0496111_0081081 | 3300048914 | Bacteria | 2368 |
| 934 | Ga0496111_0273641 | 3300048914 | Bacteria | 1253 |
| 935 | Ga0496111_0467944 | 3300048914 | Bacteria | 929 |
| 936 | Ga0496112_0215527 | 3300048915 | Bacteria | 1876 |
| 937 | Ga0496113_0002745 | 3300048916 | Bacteria | 10352 |
| 938 | Ga0496113_0113912 | 3300048916 | Bacteria | 2108 |
| 939 | Ga0496114_0032300 | 3300048917 | Bacteria | 4307 |
| 940 | Ga0496114_0101033 | 3300048917 | Bacteria | 2462 |
| 941 | Ga0496114_0160197 | 3300048917 | Bacteria | 1956 |
| 942 | Ga0496114_0406589 | 3300048917 | Bacteria | 1205 |
| 943 | Ga0496115_0389635 | 3300048918 | Bacteria | 1132 |
| 944 | Ga0496115_0502766 | 3300048918 | Bacteria | 974 |
| 945 | Ga0496116_0000160 | 3300048919 | Bacteria | 137507 |
| 946 | Ga0496116_0001705 | 3300048919 | Bacteria | 24088 |
| 947 | Ga0496116_0007161 | 3300048919 | Bacteria | 9973 |
| 948 | Ga0496116_0174638 | 3300048919 | Bacteria | 1159 |
| 949 | Ga0496117_0000202 | 3300048920 | Bacteria | 117638 |
| 950 | Ga0496117_0000810 | 3300048920 | Bacteria | 48467 |
| 951 | Ga0496117_0001291 | 3300048920 | Bacteria | 36931 |
| 952 | Ga0496117_0003022 | 3300048920 | Bacteria | 20187 |
| 953 | Ga0496117_0226481 | 3300048920 | Bacteria | 1036 |
| 954 | Ga0496118_0000318 | 3300048921 | Bacteria | 83296 |
| 955 | Ga0496118_0000579 | 3300048921 | Bacteria | 60445 |
| 956 | Ga0496118_0003511 | 3300048921 | Bacteria | 19659 |
| 957 | Ga0496118_0005968 | 3300048921 | Bacteria | 13587 |
| 958 | Ga0496118_0017237 | 3300048921 | Bacteria | 6585 |
| 959 | Ga0496119_0000480 | 3300048922 | Bacteria | 54616 |
| 960 | Ga0496119_0004992 | 3300048922 | Bacteria | 12953 |
| 961 | Ga0496119_0042204 | 3300048922 | Bacteria | 2896 |
| 962 | Ga0496119_0044188 | 3300048922 | Bacteria | 2807 |
| 963 | Ga0496120_0000511 | 3300048923 | Bacteria | 60526 |
| 964 | Ga0496120_0031643 | 3300048923 | Bacteria | 3200 |
| 965 | Ga0496121_0002018 | 3300048924 | Bacteria | 32204 |
| 966 | Ga0496121_0003167 | 3300048924 | Bacteria | 23721 |
| 967 | Ga0496121_0009473 | 3300048924 | Bacteria | 11188 |
| 968 | Ga0496121_0012029 | 3300048924 | Bacteria | 9509 |
| 969 | Ga0496121_0015334 | 3300048924 | Bacteria | 8040 |
| 970 | Ga0496121_0017579 | 3300048924 | Bacteria | 7291 |
| 971 | Ga0496121_0092537 | 3300048924 | Bacteria | 2357 |
| 972 | Ga0496122_0000410 | 3300048925 | Bacteria | 91128 |
| 973 | Ga0496122_0000662 | 3300048925 | Bacteria | 69323 |
| 974 | Ga0496122_0001600 | 3300048925 | Bacteria | 35421 |
| 975 | Ga0496122_0001753 | 3300048925 | Bacteria | 33345 |
| 976 | Ga0496122_0003832 | 3300048925 | Bacteria | 19331 |
| 977 | Ga0496122_0005663 | 3300048925 | Bacteria | 14748 |
| 978 | Ga0496122_0006221 | 3300048925 | Bacteria | 13828 |
| 979 | Ga0496122_0008250 | 3300048925 | Bacteria | 11301 |
| 980 | Ga0496122_0019858 | 3300048925 | Bacteria | 6114 |
| 981 | Ga0496122_0130777 | 3300048925 | Bacteria | 1595 |
| 982 | Ga0496123_0000478 | 3300048926 | Bacteria | 69650 |
| 983 | Ga0496123_0000818 | 3300048926 | Bacteria | 50079 |
| 984 | Ga0496123_0001311 | 3300048926 | Bacteria | 35270 |
| 985 | Ga0496123_0002081 | 3300048926 | Bacteria | 25765 |
| 986 | Ga0496123_0003504 | 3300048926 | Bacteria | 17485 |
| 987 | Ga0496123_0003783 | 3300048926 | Bacteria | 16574 |
| 988 | Ga0496123_0004715 | 3300048926 | Bacteria | 14107 |
| 989 | Ga0496123_0006472 | 3300048926 | Bacteria | 11333 |
| 990 | Ga0496123_0095277 | 3300048926 | Bacteria | 1751 |
| 991 | Ga0496123_0120161 | 3300048926 | Bacteria | 1480 |
| 992 | Ga0496124_0003904 | 3300048927 | Bacteria | 17822 |
| 993 | Ga0496124_0004765 | 3300048927 | Bacteria | 15616 |
| 994 | Ga0496124_0005128 | 3300048927 | Bacteria | 14910 |
| 995 | Ga0496124_0007020 | 3300048927 | Bacteria | 12067 |
| 996 | Ga0496124_0007341 | 3300048927 | Bacteria | 11740 |
| 997 | Ga0496124_0008353 | 3300048927 | Bacteria | 10841 |
| 998 | Ga0496124_0010750 | 3300048927 | Bacteria | 9227 |
| 999 | Ga0496124_0155339 | 3300048927 | Bacteria | 1790 |
| 1000 | Ga0496124_0259885 | 3300048927 | Bacteria | 1278 |
| 1001 | Ga0496124_0310325 | 3300048927 | Bacteria | 1134 |
| 1002 | Ga0496125_0000166 | 3300048928 | Bacteria | 147432 |
| 1003 | Ga0496125_0001775 | 3300048928 | Bacteria | 29811 |
| 1004 | Ga0496125_0003280 | 3300048928 | Bacteria | 19885 |
| 1005 | Ga0496125_0003538 | 3300048928 | Bacteria | 18831 |
| 1006 | Ga0496125_0005574 | 3300048928 | Bacteria | 13921 |
| 1007 | Ga0496125_0006247 | 3300048928 | Bacteria | 12950 |
| 1008 | Ga0496125_0018022 | 3300048928 | Bacteria | 6712 |
| 1009 | Ga0496125_0237624 | 3300048928 | Bacteria | 1159 |
| 1010 | Ga0496125_0294352 | 3300048928 | Bacteria | 998 |
| 1011 | Ga0496126_0000116 | 3300048929 | Bacteria | 188390 |
| 1012 | Ga0496126_0036200 | 3300048929 | Bacteria | 4617 |
| 1013 | Ga0496126_0036879 | 3300048929 | Bacteria | 4568 |
| 1014 | Ga0496126_0046931 | 3300048929 | Bacteria | 3957 |
| 1015 | Ga0496126_0095044 | 3300048929 | Bacteria | 2615 |
| 1016 | Ga0496126_0397380 | 3300048929 | Bacteria | 1119 |
| 1017 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 1018 | Ga0495678_000061 | 3300049459 | Bacteria | 142649 |
| 1019 | Ga0495678_000080 | 3300049459 | Bacteria | 120033 |
| 1020 | Ga0495678_000367 | 3300049459 | Bacteria | 46226 |
| 1021 | Ga0495678_001099 | 3300049459 | Bacteria | 22809 |
| 1022 | Ga0495678_002662 | 3300049459 | Bacteria | 11827 |
| 1023 | Ga0495678_005899 | 3300049459 | Bacteria | 6630 |
| 1024 | Ga0495678_022773 | 3300049459 | Bacteria | 2734 |
| 1025 | Ga0495678_035769 | 3300049459 | Bacteria | 2032 |
| 1026 | Ga0495678_074579 | 3300049459 | Bacteria | 1234 |
| 1027 | Ga0495682_0000284 | 3300049460 | Bacteria | 39605 |
| 1028 | Ga0495682_0000409 | 3300049460 | Bacteria | 30562 |
| 1029 | Ga0495682_0000411 | 3300049460 | Bacteria | 30452 |
| 1030 | Ga0495682_0001519 | 3300049460 | Bacteria | 12302 |
| 1031 | Ga0495682_0013200 | 3300049460 | Bacteria | 3150 |
| 1032 | Ga0495682_0015985 | 3300049460 | Bacteria | 2840 |
| 1033 | Ga0501313_000711 | 3300049529 | Bacteria | 2470 |
| 1034 | Ga0501033_0130265 | 3300049570 | Bacteria | 1823 |
| 1035 | Ga0501034_0056876 | 3300049571 | Bacteria | 3934 |
| 1036 | Ga0501034_0365802 | 3300049571 | Bacteria | 1369 |
| 1037 | Ga0501037_0200556 | 3300049573 | Bacteria | 1410 |
| 1038 | Ga0501038_0198498 | 3300049574 | Bacteria | 1611 |
| 1039 | Ga0501047_0007859 | 3300049581 | Bacteria | 10051 |
| 1040 | Ga0501067_0051471 | 3300049583 | Bacteria | 2283 |
| 1041 | Ga0501073_0000012 | 3300049589 | Bacteria | 161319 |
| 1042 | Ga0501269_000034 | 3300049766 | Bacteria | 42532 |
| 1043 | Ga0501035_0006617 | 3300049822 | Bacteria | 10849 |
| 1044 | Ga0501035_0009730 | 3300049822 | Bacteria | 8939 |
| 1045 | Ga0501035_0022652 | 3300049822 | Bacteria | 5770 |
| 1046 | Ga0501035_0120648 | 3300049822 | Bacteria | 2292 |
| 1047 | Ga0501044_0000236 | 3300049823 | Bacteria | 69634 |
| 1048 | Ga0501044_0044554 | 3300049823 | Bacteria | 4603 |
| 1049 | nmdc:mga03683_277671_c1 | 3300050489 | Bacteria | 782 |
| 1050 | nmdc:mga00v17_41700_c1 | 3300050491 | Bacteria | 2758 |
| 1051 | nmdc:mga00v17_96686_c1 | 3300050491 | Bacteria | 1860 |
| 1052 | nmdc:mga0yw44_1980_c1 | 3300050492 | Bacteria | 8494 |
| 1053 | nmdc:mga0yw44_4987_c1 | 3300050492 | Bacteria | 6196 |
| 1054 | nmdc:mga0yw44_92232_c1 | 3300050492 | Bacteria | 1917 |
| 1055 | nmdc:mga0yw44_96069_c1 | 3300050492 | Bacteria | 1881 |
| 1056 | nmdc:mga0k408_78977_c1 | 3300050493 | Bacteria | 1926 |
| 1057 | nmdc:mga0k408_9809_c1 | 3300050493 | Bacteria | 5172 |
| 1058 | nmdc:mga06z11_28077_c1 | 3300050494 | Bacteria | 2697 |
| 1059 | nmdc:mga07m45_2540_c1 | 3300050496 | Bacteria | 8572 |
| 1060 | nmdc:mga07m45_37452_c1 | 3300050496 | Bacteria | 1460 |
| 1061 | nmdc:mga05p37_209_c1 | 3300050507 | Bacteria | 59030 |
| 1062 | nmdc:mga09592_150_c1 | 3300050508 | Bacteria | 47613 |
| 1063 | nmdc:mga06r32_128933_c1 | 3300050510 | Bacteria | 2499 |
| 1064 | nmdc:mga06r32_148815_c1 | 3300050510 | Bacteria | 2319 |
| 1065 | nmdc:mga06r32_39269_c1 | 3300050510 | Bacteria | 4491 |
| 1066 | nmdc:mga08y16_111071_c1 | 3300050511 | Bacteria | 2854 |
| 1067 | nmdc:mga08y16_261223_c1 | 3300050511 | Bacteria | 1788 |
| 1068 | nmdc:mga08y16_42698_c1 | 3300050511 | Bacteria | 4748 |
| 1069 | nmdc:mga08y16_656469_c1 | 3300050511 | Bacteria | 1052 |
| 1070 | nmdc:mga0rr50_119166_c1 | 3300050513 | Bacteria | 2098 |
| 1071 | nmdc:mga0rr50_229454_c1 | 3300050513 | Bacteria | 1536 |
| 1072 | nmdc:mga08x19_6630_c1 | 3300050514 | Bacteria | 6865 |
| 1073 | nmdc:mga0a205_30059_c1 | 3300050515 | Bacteria | 5200 |
| 1074 | nmdc:mga0a205_648526_c1 | 3300050515 | Bacteria | 907 |
| 1075 | Ga0495595_0165436 | 3300053084 | Bacteria | 1093 |
| 1076 | Ga0500644_0143440 | 3300053088 | Bacteria | 951 |
| 1077 | Ga0500646_0074727 | 3300053090 | Bacteria | 1023 |
| 1078 | Ga0500651_0018685 | 3300053093 | Bacteria | 4294 |
| 1079 | Ga0500651_0065804 | 3300053093 | Bacteria | 2257 |
| 1080 | Ga0500555_000019 | 3300053103 | Bacteria | 175470 |
| 1081 | Ga0500594_0022935 | 3300053118 | Bacteria | 1578 |
| 1082 | Ga0500594_0046611 | 3300053118 | Bacteria | 1206 |
| 1083 | Ga0500652_000792 | 3300053131 | Bacteria | 10629 |
| 1084 | Ga0500559_0003954 | 3300053136 | Bacteria | 7141 |
| 1085 | Ga0500573_0005953 | 3300053140 | Bacteria | 6564 |
| 1086 | Ga0500586_002700 | 3300053145 | Bacteria | 4064 |
| 1087 | Ga0500622_0000146 | 3300053156 | Bacteria | 74615 |
| 1088 | Ga0500634_0175155 | 3300053161 | Bacteria | 972 |
| 1089 | Ga0500645_000242 | 3300053730 | Bacteria | 40854 |
| 1090 | Ga0587070_008462 | 3300059491 | Bacteria | 1459 |
| 1091 | Ga0587080_013453 | 3300059503 | Bacteria | 1253 |
| 1092 | Ga0587083_0009809 | 3300059505 | Bacteria | 1535 |
| 1093 | Ga0587083_0032420 | 3300059505 | Bacteria | 1048 |
| 1094 | Ga0587076_063013 | 3300059645 | Bacteria | 752 |
| 1095 | Ga0466962_0037154 | 3300061719 | Bacteria | 2331 |
| 1096 | Ga0466962_0047494 | 3300061719 | Bacteria | 2051 |
| 1097 | Ga0466962_0068362 | 3300061719 | Bacteria | 1696 |
| 1098 | Ga0530510_0417292 | 3300061734 | Bacteria | 1013 |
| 1099 | 2511242871 | 2511231002 | Bacteria | 5042903 |
| 1100 | 2513953387 | 2513237150 | Bacteria | 6553639 |
| 1101 | 2514044665 | 2513237165 | Bacteria | 6771773 |
| 1102 | 2552748891 | 2551306352 | Bacteria | 3873115 |
| 1103 | 2552748931 | 2551306352 | Bacteria | 3873115 |
| 1104 | 2563060598 | 2562617112 | Bacteria | 10918404 |
| 1105 | 2578458660 | 2576861471 | Bacteria | 4648976 |
| 1106 | 2587730616 | 2585428057 | Bacteria | 6737412 |
| 1107 | 2587736839 | 2585428058 | Bacteria | 6853932 |
| 1108 | 2588294911 | 2588253510 | Bacteria | 6901809 |
| 1109 | 2599902574 | 2599185292 | Bacteria | 6290804 |
| 1110 | 2640735110 | 2639762793 | Bacteria | 3943681 |
| 1111 | 2643752234 | 2643221546 | Bacteria | 2910897 |
| 1112 | 2643861368 | 2643221569 | Bacteria | 6064337 |
| 1113 | 2643894572 | 2643221577 | Bacteria | 3710843 |
| 1114 | 2644123777 | 2643221621 | Bacteria | 6212786 |
| 1115 | 2644338882 | 2643221660 | Bacteria | 4208257 |
| 1116 | 2644364146 | 2643221665 | Bacteria | 4699229 |
| 1117 | 2644476726 | 2643221685 | Bacteria | 3673288 |
| 1118 | 2678231389 | 2675903507 | Bacteria | 3737791 |
| 1119 | 2678231430 | 2675903507 | Bacteria | 3737791 |
| 1120 | 2678231991 | 2675903507 | Bacteria | 3737791 |
| 1121 | 2713475775 | 2711768613 | Bacteria | 11048459 |
| 1122 | 2738713138 | 2738541275 | Bacteria | 4830863 |
| 1123 | 2738740503 | 2738541280 | Bacteria | 6630198 |
| 1124 | 2738843244 | 2738541300 | Bacteria | 6675882 |
| 1125 | 2738851561 | 2738541301 | Bacteria | 4834102 |
| 1126 | 2738867292 | 2738541304 | Bacteria | 4833665 |
| 1127 | 2739272119 | 2738543018 | Bacteria | 6718814 |
| 1128 | 2739299808 | 2738543022 | Bacteria | 4835059 |
| 1129 | 2739341163 | 2738543030 | Bacteria | 6719714 |
| 1130 | 2739361488 | 2738543033 | Bacteria | 4833336 |
| 1131 | 2747948227 | 2747842428 | Bacteria | 4689383 |
| 1132 | 2747948626 | 2747842428 | Bacteria | 4689383 |
| 1133 | 2774437126 | 2773857770 | Bacteria | 3911866 |
| 1134 | 2774437166 | 2773857770 | Bacteria | 3911866 |
| 1135 | 2819553710 | 2818991438 | Bacteria | 5793701 |
| 1136 | 2842737562 | 2842733646 | Bacteria | 5716726 |
| 1137 | 2847933222 | 2847930680 | Bacteria | 9342022 |
| 1138 | 2857446001 | 2857442823 | Bacteria | 4562550 |
| 1139 | 2857541740 | 2857537821 | Bacteria | 5248181 |
| 1140 | 2881929484 | 2881927736 | Bacteria | 3993927 |
| 1141 | 2885084143 | 2885080285 | Bacteria | 6355622 |
| 1142 | 2885277564 | 2885270888 | Bacteria | 9831543 |
| 1143 | 2894027253 | 2894023352 | Bacteria | 5167372 |
| 1144 | 2919182614 | 2919182534 | Bacteria | 3907101 |
| 1145 | 2919182654 | 2919182534 | Bacteria | 3907101 |
| 1146 | 2919506797 | 2919506607 | Bacteria | 3392955 |
| 1147 | 2919710078 | 2919709256 | Bacteria | 4318106 |
| 1148 | 2928104676 | 2928100450 | Bacteria | 4837635 |
| 1149 | 2928515685 | 2928515477 | Bacteria | 4448421 |
| 1150 | 2928519666 | 2928515477 | Bacteria | 4448421 |
| 1151 | 2939622995 | 2939622612 | Bacteria | 4698046 |
| 1152 | 2974320572 | 2974320154 | Bacteria | 4571377 |
| 1153 | 2996222241 | 2996221748 | Bacteria | 6799777 |
| 1154 | 3000865542 | 3000865235 | Bacteria | 3106258 |
| 1155 | 644750265 | 644736347 | Bacteria | 6476522 |
| 1156 | 8033234522 | 8033232454 | Bacteria | 3202805 |
| 1157 | Ga0207712_10745246 | |||
| 1158 | MRS2a_Contig_1767 | |||
| 1159 | MRS2a_Contig_1768 | |||
| 1160 | MRS2a_Contig_70 | |||
| 1161 | JGI24739J22299_10069019 | |||
| 1162 | JGI24744J21845_10002945 | |||
| 1163 | JGI25156J39149_1009071 | |||
| 1164 | JGI25162J39368_1005763 | |||
| 1165 | JGI25154J39366_1001103 | |||
| 1166 | JGI25154J39366_1001202 | |||
| 1167 | JGI25150J39212_1002842 | |||
| 1168 | JGI25159J45721_1002305 | |||
| 1169 | JGI25151J46595_10004466 | |||
| 1170 | JGI25151J46595_10025792 | |||
| 1171 | rootH1_10018504 | |||
| 1172 | rootH2_10004328 | |||
| 1173 | rootL2_10132830 | |||
| 1174 | rootH1_10048604 | |||
| 1175 | JGI25160J50197_1001072 | |||
| 1176 | JGI25161J50226_1000013 | |||
| 1177 | Ga0055529_1002255 | |||
| 1178 | Ga0055526_1000344 | |||
| 1179 | Ga0055526_1016030 | |||
| 1180 | Ga0055537_1000066 | |||
| 1181 | Ga0055537_1000576 | |||
| 1182 | Ga0055537_1005089 | |||
| 1183 | Ga0055524_1000331 | |||
| 1184 | Ga0055524_1000519 | |||
| 1185 | Ga0055536_1001260 | |||
| 1186 | Ga0055534_1000031 | |||
| 1187 | Ga0055534_1000057 | |||
| 1188 | Ga0055534_1001922 | |||
| 1189 | Ga0055534_1011496 | |||
| 1190 | Ga0055528_1000069 | |||
| 1191 | Ga0055528_1001047 | |||
| 1192 | Ga0055530_10001163 | |||
| 1193 | Ga0055530_10002703 | |||
| 1194 | Ga0055530_10014555 | |||
| 1195 | Ga0055540_1000067 | |||
| 1196 | Ga0055531_10000480 | |||
| 1197 | Ga0058692_1000051 | |||
| 1198 | Ga0055543_1000239 | |||
| 1199 | Ga0065165_1007939 | |||
| 1200 | Ga0065165_1066496 | |||
| 1201 | Ga0065165_1069390 | |||
| 1202 | Ga0065703_1021859 | |||
| 1203 | Ga0065714_10000917 | |||
| 1204 | Ga0065704_10004515 | |||
| 1205 | Ga0065704_10011001 | |||
| 1206 | Ga0065704_10011853 | |||
| 1207 | Ga0065704_10013108 | |||
| 1208 | Ga0065704_10111899 | |||
| 1209 | Ga0065704_10118072 | |||
| 1210 | Ga0065704_10121111 | |||
| 1211 | Ga0065704_10371111 | |||
| 1212 | Ga0065707_10021373 | |||
| 1213 | Ga0070658_10000050 | |||
| 1214 | Ga0070676_10015306 | |||
| 1215 | Ga0070676_10115083 | |||
| 1216 | Ga0070683_100195024 | |||
| 1217 | Ga0070690_100344715 | |||
| 1218 | Ga0070670_100063805 | |||
| 1219 | Ga0070670_100065195 | |||
| 1220 | Ga0070670_100236638 | |||
| 1221 | Ga0070670_100429365 | |||
| 1222 | Ga0068869_100098293 | |||
| 1223 | Ga0070666_10022663 | |||
| 1224 | Ga0070682_100010437 | |||
| 1225 | Ga0068868_100041322 | |||
| 1226 | Ga0068868_100394124 | |||
| 1227 | Ga0070660_100039316 | |||
| 1228 | Ga0070660_100115496 | |||
| 1229 | Ga0070689_100069857 | |||
| 1230 | Ga0070691_10002978 | |||
| 1231 | Ga0070661_100093040 | |||
| 1232 | Ga0070692_10220545 | |||
| 1233 | Ga0070668_100001214 | |||
| 1234 | Ga0070668_100008872 | |||
| 1235 | Ga0070669_100260598 | |||
| 1236 | Ga0070669_100378931 | |||
| 1237 | Ga0070675_100131608 | |||
| 1238 | Ga0070675_100311297 | |||
| 1239 | Ga0070671_100097719 | |||
| 1240 | Ga0070671_100339872 | |||
| 1241 | Ga0070688_100010538 | |||
| 1242 | Ga0070688_100115903 | |||
| 1243 | Ga0070688_100145208 | |||
| 1244 | Ga0070667_100012675 | |||
| 1245 | Ga0070667_100167634 | |||
| 1246 | Ga0070703_10199704 | |||
| 1247 | Ga0070709_10430341 | |||
| 1248 | Ga0070711_100185451 | |||
| 1249 | Ga0070705_100074739 | |||
| 1250 | Ga0070708_100006204 | |||
| 1251 | Ga0070663_100325544 | |||
| 1252 | Ga0070678_100001422 | |||
| 1253 | Ga0070678_100004688 | |||
| 1254 | Ga0070678_100065700 | |||
| 1255 | Ga0070678_100318857 | |||
| 1256 | Ga0070678_100488510 | |||
| 1257 | Ga0070678_101194587 | |||
| 1258 | Ga0070681_10042215 | |||
| 1259 | Ga0068867_100000817 | |||
| 1260 | Ga0070698_100039235 | |||
| 1261 | Ga0070698_100289305 | |||
| 1262 | Ga0070699_100550962 | |||
| 1263 | Ga0070679_100007035 | |||
| 1264 | Ga0068853_100322409 | |||
| 1265 | Ga0068853_100616769 | |||
| 1266 | Ga0070672_100050901 | |||
| 1267 | Ga0070672_100092311 | |||
| 1268 | Ga0070695_100341583 | |||
| 1269 | Ga0070696_100308250 | |||
| 1270 | Ga0070693_100001130 | |||
| 1271 | Ga0070665_100092762 | |||
| 1272 | Ga0070665_100165919 | |||
| 1273 | Ga0070704_100001833 | |||
| 1274 | Ga0070704_100018375 | |||
| 1275 | Ga0070704_100541400 | |||
| 1276 | Ga0068855_100002023 | |||
| 1277 | Ga0068857_100037080 | |||
| 1278 | Ga0068856_100001944 | |||
| 1279 | Ga0068852_100007122 | |||
| 1280 | Ga0068852_100335770 | |||
| 1281 | Ga0068859_100000102 | |||
| 1282 | Ga0068859_100157686 | |||
| 1283 | Ga0068859_100537833 | |||
| 1284 | Ga0068864_100022445 | |||
| 1285 | Ga0068864_100948490 | |||
| 1286 | Ga0068861_100002978 | |||
| 1287 | Ga0068861_100049115 | |||
| 1288 | Ga0068861_100187120 | |||
| 1289 | Ga0068851_10003029 | |||
| 1290 | Ga0068851_10107724 | |||
| 1291 | Ga0068870_10004266 | |||
| 1292 | Ga0068870_10368464 | |||
| 1293 | Ga0068863_100002676 | |||
| 1294 | Ga0068863_100002708 | |||
| 1295 | Ga0068863_100271929 | |||
| 1296 | Ga0068858_100005282 | |||
| 1297 | Ga0068858_100214049 | |||
| 1298 | Ga0068860_100011245 | |||
| 1299 | Ga0068862_100000273 | |||
| 1300 | Ga0070717_10055546 | |||
| 1301 | Ga0075365_10001342 | |||
| 1302 | Ga0075365_10068681 | |||
| 1303 | Ga0075365_10156649 | |||
| 1304 | Ga0075365_10176804 | |||
| 1305 | Ga0075368_10012672 | |||
| 1306 | Ga0075368_10019966 | |||
| 1307 | Ga0075363_100019977 | |||
| 1308 | Ga0075364_10027807 | |||
| 1309 | Ga0075364_10115864 | |||
| 1310 | Ga0075364_10126914 | |||
| 1311 | Ga0075364_10268827 | |||
| 1312 | Ga0075364_10293033 | |||
| 1313 | Ga0075362_10067403 | |||
| 1314 | Ga0075362_10089313 | |||
| 1315 | Ga0075367_10070788 | |||
| 1316 | Ga0075369_10153111 | |||
| 1317 | Ga0075366_10119074 | |||
| 1318 | Ga0097621_100069994 | |||
| 1319 | Ga0075370_10020335 | |||
| 1320 | Ga0075370_10041784 | |||
| 1321 | Ga0068871_100000429 | |||
| 1322 | Ga0068871_100083858 | |||
| 1323 | Ga0068871_100173275 | |||
| 1324 | Ga0075428_100128714 | |||
| 1325 | Ga0075428_100357960 | |||
| 1326 | Ga0075431_100018399 | |||
| 1327 | Ga0075431_100032618 | |||
| 1328 | Ga0075431_100143311 | |||
| 1329 | Ga0075433_10030675 | |||
| 1330 | Ga0075433_10839414 | |||
| 1331 | Ga0075434_100002700 | |||
| 1332 | Ga0075434_100363056 | |||
| 1333 | Ga0075429_100010239 | |||
| 1334 | Ga0068865_100439506 | |||
| 1335 | Ga0075436_100001293 | |||
| 1336 | Ga0097620_100000102 | |||
| 1337 | Ga0097620_100157690 | |||
| 1338 | Ga0097620_100537858 | |||
| 1339 | Ga0075435_100262392 | |||
| 1340 | Ga0105251_10015911 | |||
| 1341 | Ga0105251_10094477 | |||
| 1342 | Ga0105244_10014391 | |||
| 1343 | Ga0105244_10018048 | |||
| 1344 | Ga0105244_10019613 | |||
| 1345 | Ga0105244_10020545 | |||
| 1346 | Ga0105244_10071203 | |||
| 1347 | Ga0105244_10102481 | |||
| 1348 | Ga0105250_10046744 | |||
| 1349 | Ga0105250_10074614 | |||
| 1350 | Ga0105240_10002032 | |||
| 1351 | Ga0105240_10005710 | |||
| 1352 | Ga0111539_10000829 | |||
| 1353 | Ga0111539_10073415 | |||
| 1354 | Ga0111539_10078552 | |||
| 1355 | Ga0111539_10316784 | |||
| 1356 | Ga0105247_10013390 | |||
| 1357 | Ga0105247_10085341 | |||
| 1358 | Ga0105247_10086811 | |||
| 1359 | Ga0114129_10024326 | |||
| 1360 | Ga0105243_10000614 | |||
| 1361 | Ga0105243_10000650 | |||
| 1362 | Ga0105243_10036361 | |||
| 1363 | Ga0105241_10002429 | |||
| 1364 | Ga0105248_10000324 | |||
| 1365 | Ga0105248_10000710 | |||
| 1366 | Ga0105248_10054071 | |||
| 1367 | Ga0105248_10116926 | |||
| 1368 | Ga0105237_10028563 | |||
| 1369 | Ga0105237_10052722 | |||
| 1370 | Ga0105237_10054710 | |||
| 1371 | Ga0105238_10044844 | |||
| 1372 | Ga0105238_10113261 | |||
| 1373 | Ga0105249_10000320 | |||
| 1374 | Ga0105249_10014726 | |||
| 1375 | Ga0105249_10251057 | |||
| 1376 | Ga0105249_10347070 | |||
| 1377 | Ga0105239_10005669 | |||
| 1378 | Ga0105239_10057759 | |||
| 1379 | Ga0105246_10006706 | |||
| 1380 | Ga0105246_10086329 | |||
| 1381 | Ga0105246_10107020 | |||
| 1382 | Ga0157373_10143778 | |||
| 1383 | Ga0157373_10144608 | |||
| 1384 | Ga0157371_10000337 | |||
| 1385 | Ga0157371_10002500 | |||
| 1386 | Ga0157371_10293702 | |||
| 1387 | Ga0157371_10506495 | |||
| 1388 | Ga0157370_10005499 | |||
| 1389 | Ga0157370_10028779 | |||
| 1390 | Ga0157370_10060408 | |||
| 1391 | Ga0157370_10182582 | |||
| 1392 | Ga0157369_10000342 | |||
| 1393 | Ga0157374_10139663 | |||
| 1394 | Ga0157378_11237764 | |||
| 1395 | Ga0163162_10149149 | |||
| 1396 | Ga0157375_10027645 | |||
| 1397 | Ga0157375_10146387 | |||
| 1398 | Ga0163163_10446789 | |||
| 1399 | Ga0157380_10505032 | |||
| 1400 | Ga0157380_10742090 | |||
| 1401 | Ga0182008_10000115 | |||
| 1402 | Ga0182008_10000708 | |||
| 1403 | Ga0182008_10130397 | |||
| 1404 | Ga0157379_10004351 | |||
| 1405 | Ga0157379_10009608 | |||
| 1406 | Ga0157376_10278571 | |||
| 1407 | Ga0182007_10000103 | |||
| 1408 | Ga0182007_10120962 | |||
| 1409 | Ga0163161_10002266 | |||
| 1410 | Ga0163161_10008437 | |||
| 1411 | Ga0163161_10014688 | |||
| 1412 | Ga0163161_10030084 | |||
| 1413 | Ga0163161_10041540 | |||
| 1414 | Ga0163161_10209787 | |||
| 1415 | Ga0163161_10379015 | |||
| 1416 | Ga0197907_10974739 | |||
| 1417 | Ga0206356_10543351 | |||
| 1418 | Ga0206354_10161263 | |||
| 1419 | Ga0209435_100067 | |||
| 1420 | Ga0209672_103863 | |||
| 1421 | Ga0209437_100566 | |||
| 1422 | Ga0209258_106772 | |||
| 1423 | Ga0207425_1001894 | |||
| 1424 | Ga0209646_1000023 | |||
| 1425 | Ga0209646_1000061 | |||
| 1426 | Ga0209026_1000754 | |||
| 1427 | Ga0209759_1000209 | |||
| 1428 | Ga0209129_1008654 | |||
| 1429 | Ga0209565_1000006 | |||
| 1430 | Ga0209565_1000072 | |||
| 1431 | Ga0209565_1000111 | |||
| 1432 | Ga0209565_1004904 | |||
| 1433 | Ga0209455_1002615 | |||
| 1434 | Ga0209673_1000004 | |||
| 1435 | Ga0209673_1000012 | |||
| 1436 | Ga0209130_1000095 | |||
| 1437 | Ga0209130_1001113 | |||
| 1438 | Ga0209675_1000006 | |||
| 1439 | Ga0209675_1000049 | |||
| 1440 | Ga0209675_1000373 | |||
| 1441 | Ga0209675_1004344 | |||
| 1442 | Ga0209676_1000145 | |||
| 1443 | Ga0209676_1007092 | |||
| 1444 | Ga0209676_1018411 | |||
| 1445 | Ga0209025_1001400 | |||
| 1446 | Ga0209025_1003004 | |||
| 1447 | Ga0209025_1013182 | |||
| 1448 | Ga0209564_1000102 | |||
| 1449 | Ga0209564_1000130 | |||
| 1450 | Ga0209564_1002035 | |||
| 1451 | Ga0209564_1005377 | |||
| 1452 | Ga0209564_1021069 | |||
| 1453 | Ga0209758_1023004 | |||
| 1454 | Ga0209050_1000023 | |||
| 1455 | Ga0209050_1000192 | |||
| 1456 | Ga0209050_1012100 | |||
| 1457 | Ga0209256_1000003 | |||
| 1458 | Ga0209256_1000037 | |||
| 1459 | Ga0209256_1000126 | |||
| 1460 | Ga0207426_1001496 | |||
| 1461 | Ga0207426_1004536 | |||
| 1462 | Ga0209051_1000017 | |||
| 1463 | Ga0209051_1031038 | |||
| 1464 | Ga0209257_1000041 | |||
| 1465 | Ga0207697_10012975 | |||
| 1466 | Ga0207656_10095323 | |||
| 1467 | Ga0207696_1006016 | |||
| 1468 | Ga0207696_1009865 | |||
| 1469 | Ga0207696_1013069 | |||
| 1470 | Ga0207696_1041747 | |||
| 1471 | Ga0207655_1000575 | |||
| 1472 | Ga0207655_1000626 | |||
| 1473 | Ga0207655_1000627 | |||
| 1474 | Ga0207655_1007194 | |||
| 1475 | Ga0207655_1007198 | |||
| 1476 | Ga0207655_1007651 | |||
| 1477 | Ga0207655_1023080 | |||
| 1478 | Ga0207713_1000501 | |||
| 1479 | Ga0207713_1002798 | |||
| 1480 | Ga0207713_1008316 | |||
| 1481 | Ga0207713_1024683 | |||
| 1482 | Ga0207713_1035512 | |||
| 1483 | Ga0207682_10241509 | |||
| 1484 | Ga0207642_10180201 | |||
| 1485 | Ga0207710_10019305 | |||
| 1486 | Ga0207710_10039916 | |||
| 1487 | Ga0207710_10044374 | |||
| 1488 | Ga0207688_10001145 | |||
| 1489 | Ga0207680_10107661 | |||
| 1490 | Ga0207647_10004470 | |||
| 1491 | Ga0207645_10000039 | |||
| 1492 | Ga0207645_10012427 | |||
| 1493 | Ga0207705_10000014 | |||
| 1494 | Ga0207705_10009139 | |||
| 1495 | Ga0207705_10017949 | |||
| 1496 | Ga0207705_10267779 | |||
| 1497 | Ga0207705_10540780 | |||
| 1498 | Ga0207707_10346576 | |||
| 1499 | Ga0207707_10680289 | |||
| 1500 | Ga0207695_10004527 | |||
| 1501 | Ga0207695_10087242 | |||
| 1502 | Ga0207695_10540200 | |||
| 1503 | Ga0207671_10021108 | |||
| 1504 | Ga0207671_10037527 | |||
| 1505 | Ga0207663_10085290 | |||
| 1506 | Ga0207662_10452809 | |||
| 1507 | Ga0207657_10062715 | |||
| 1508 | Ga0207657_10083840 | |||
| 1509 | Ga0207652_10008612 | |||
| 1510 | Ga0207646_10140866 | |||
| 1511 | Ga0207681_10001411 | |||
| 1512 | Ga0207681_10010671 | |||
| 1513 | Ga0207681_10275103 | |||
| 1514 | Ga0207694_10029537 | |||
| 1515 | Ga0207650_10007054 | |||
| 1516 | Ga0207650_10048331 | |||
| 1517 | Ga0207650_10081382 | |||
| 1518 | Ga0207650_10213371 | |||
| 1519 | Ga0207659_10000981 | |||
| 1520 | Ga0207659_10089628 | |||
| 1521 | Ga0207644_10021202 | |||
| 1522 | Ga0207644_10136038 | |||
| 1523 | Ga0207644_10707161 | |||
| 1524 | Ga0207690_10026037 | |||
| 1525 | Ga0207706_10047717 | |||
| 1526 | Ga0207709_10000001 | |||
| 1527 | Ga0207670_10690761 | |||
| 1528 | Ga0207691_10000027 | |||
| 1529 | Ga0207691_10212460 | |||
| 1530 | Ga0207711_10000398 | |||
| 1531 | Ga0207711_10001657 | |||
| 1532 | Ga0207711_10138236 | |||
| 1533 | Ga0207689_10005641 | |||
| 1534 | Ga0207661_10586927 | |||
| 1535 | Ga0207667_10000007 | |||
| 1536 | Ga0207667_10049806 | |||
| 1537 | Ga0207712_10000413 | |||
| 1538 | Ga0207712_10007985 | |||
| 1539 | Ga0207712_10312631 | |||
| 1540 | Ga0207712_10392759 | |||
| 1541 | Ga0207668_10001633 | |||
| 1542 | Ga0207668_10007857 | |||
| 1543 | Ga0207640_10082887 | |||
| 1544 | Ga0207658_10001299 | |||
| 1545 | Ga0207658_10010287 | |||
| 1546 | Ga0207677_10006642 | |||
| 1547 | Ga0207677_10463230 | |||
| 1548 | Ga0207703_10017904 | |||
| 1549 | Ga0207703_10214743 | |||
| 1550 | Ga0207639_10011964 | |||
| 1551 | Ga0207639_10550354 | |||
| 1552 | Ga0207678_10000720 | |||
| 1553 | Ga0207678_10095314 | |||
| 1554 | Ga0207678_10316580 | |||
| 1555 | Ga0207708_10047203 | |||
| 1556 | Ga0207702_10000147 | |||
| 1557 | Ga0207641_10004970 | |||
| 1558 | Ga0207641_10021577 | |||
| 1559 | Ga0207641_10134324 | |||
| 1560 | Ga0207648_10003178 | |||
| 1561 | Ga0207648_10826775 | |||
| 1562 | Ga0207676_10001854 | |||
| 1563 | Ga0207676_10098249 | |||
| 1564 | Ga0207674_10030781 | |||
| 1565 | Ga0207674_10049037 | |||
| 1566 | Ga0207674_10246925 | |||
| 1567 | Ga0207675_100000066 | |||
| 1568 | Ga0207675_100139004 | |||
| 1569 | Ga0207675_100145269 | |||
| 1570 | Ga0207675_100343238 | |||
| 1571 | Ga0207683_10000061 | |||
| 1572 | Ga0207683_10001996 | |||
| 1573 | Ga0207683_10363649 | |||
| 1574 | Ga0207683_10893345 | |||
| 1575 | Ga0207698_10701810 | |||
| 1576 | Ga0209371_1000008 | |||
| 1577 | Ga0209813_10063468 | |||
| 1578 | Ga0207428_10005656 | |||
| 1579 | Ga0207428_10222568 | |||
| 1580 | Ga0268266_10026002 | |||
| 1581 | Ga0268266_10687949 | |||
| 1582 | Ga0268265_10000174 | |||
| 1583 | Ga0268265_10353978 | |||
| 1584 | Ga0265318_10113080 | |||
| 1585 | Ga0307515_10000921 | |||
| 1586 | Ga0307515_10419150 | |||
| 1587 | Ga0268256_1000009 | |||
| 1588 | Ga0307511_10013789 | |||
| 1589 | Ga0265331_10008658 | |||
| 1590 | Ga0265327_10008996 | |||
| 1591 | Ga0307513_10000113 | |||
| 1592 | Ga0307408_100000301 | |||
| 1593 | Ga0307408_100324555 | |||
| 1594 | Ga0307408_100533180 | |||
| 1595 | Ga0307408_100683939 | |||
| 1596 | Ga0307508_10002291 | |||
| 1597 | Ga0265314_10064978 | |||
| 1598 | Ga0265314_10245137 | |||
| 1599 | Ga0307516_10436618 | |||
| 1600 | Ga0307405_10376224 | |||
| 1601 | Ga0307410_10702481 | |||
| 1602 | Ga0307409_100069488 | |||
| 1603 | Ga0307409_100965372 | |||
| 1604 | Ga0307409_101046293 | |||
| 1605 | Ga0307416_100181703 | |||
| 1606 | Ga0307416_101329606 | |||
| 1607 | Ga0307414_10599218 | |||
| 1608 | Ga0307415_100079860 | |||
| 1609 | Ga0373938_0014196 | |||
| 1610 | Ga0373929_0007658 | |||
| 1611 | Ga0373934_0065819 | |||
| 1612 | Ga0373949_0018127 | |||
| 1613 | Ga0373951_0050481 | |||
| 1614 | Ga0373923_0207723 | |||
| 1615 | Ga0373932_0004781 | |||
| 1616 | Ga0373939_0086778 | |||
| 1617 | Ga0373953_0100978 | |||
| 1618 | Ga0373942_0089800 | |||
| 1619 | Ga0373961_0005960 | |||
| 1620 | Ga0373962_0013966 | |||
| 1621 | Ga0373924_0004330 | |||
| 1622 | Ga0373931_0007152 | |||
| 1623 | Ga0373931_0307168 | |||
| 1624 | Ga0373931_0432606 | |||
| 1625 | Ga0373937_0222488 | |||
| 1626 | Ga0395899_0000005 | |||
| 1627 | Ga0395900_0000003 | |||
| 1628 | Ga0395900_0250548 | |||
| 1629 | Ga0395900_0846332 | |||
| 1630 | Ga0395898_0000003 | |||
| 1631 | Ga0395905_0035594 | |||
| 1632 | Ga0395905_0078520 | |||
| 1633 | Ga0395905_0276889 | |||
| 1634 | Ga0395905_0297864 | |||
| 1635 | Ga0395905_0598951 | |||
| 1636 | Ga0395901_0003694 | |||
| 1637 | Ga0395901_0130167 | |||
| 1638 | Ga0395901_0189780 | |||
| 1639 | Ga0395901_0433511 | |||
| 1640 | Ga0395901_0472872 | |||
| 1641 | Ga0395901_0544468 | |||
| 1642 | Ga0436365_1617569 | |||
| 1643 | Ga0436361_0739886 | |||
| 1644 | Ga0439439_0016402 | |||
| 1645 | Ga0439461_0041974 | |||
| 1646 | Ga0439466_0028322 | |||
| 1647 | Ga0451793_1256750 | |||
| 1648 | Ga0451804_0767943 | |||
| 1649 | Ga0451833_0651743 | |||
| 1650 | Ga0451853_3559394 | |||
| 1651 | Ga0439448_0021716 | |||
| 1652 | Ga0466969_0068415 | |||
| 1653 | Ga0466972_0022390 | |||
| 1654 | Ga0466973_0010320 | |||
| 1655 | Ga0466965_0050893 | |||
| 1656 | Ga0466966_0000035 | |||
| 1657 | Ga0466966_0010854 | |||
| 1658 | Ga0466966_0068519 | |||
| 1659 | Ga0466966_0118480 | |||
| 1660 | Ga0466966_0310483 | |||
| 1661 | Ga0466961_0000336 | |||
| 1662 | Ga0466961_0002332 | |||
| 1663 | Ga0466961_0009907 | |||
| 1664 | Ga0466963_0004216 | |||
| 1665 | Ga0466963_0006557 | |||
| 1666 | Ga0466963_0089659 | |||
| 1667 | Ga0466964_0086694 | |||
| 1668 | Ga0466971_0009252 | |||
| 1669 | Ga0466968_0037529 | |||
| 1670 | Ga0466968_0060109 | |||
| 1671 | Ga0466970_0050844 | |||
| 1672 | Ga0466970_0054906 | |||
| 1673 | Ga0466970_0117361 | |||
| 1674 | Ga0466957_0000649 | |||
| 1675 | Ga0466957_0011503 | |||
| 1676 | Ga0466957_0130055 | |||
| 1677 | Ga0466957_0302846 | |||
| 1678 | Ga0466959_0005789 | |||
| 1679 | Ga0466959_0019544 | |||
| 1680 | Ga0466959_0184894 | |||
| 1681 | Ga0451576_0134953 | |||
| 1682 | Ga0451576_0156905 | |||
| 1683 | Ga0466958_0020593 | |||
| 1684 | Ga0466958_0025530 | |||
| 1685 | Ga0466958_0039955 | |||
| 1686 | Ga0466958_0125049 | |||
| 1687 | Ga0466967_0054425 | |||
| 1688 | Ga0466967_0128037 | |||
| 1689 | Ga0466967_0588214 | |||
| 1690 | Ga0495617_000150 | |||
| 1691 | Ga0495617_000161 | |||
| 1692 | Ga0495617_000482 | |||
| 1693 | Ga0495617_053734 | |||
| 1694 | Ga0495627_000598 | |||
| 1695 | Ga0495627_006747 | |||
| 1696 | Ga0495627_011318 | |||
| 1697 | Ga0495627_014601 | |||
| 1698 | Ga0495627_016507 | |||
| 1699 | Ga0495627_030390 | |||
| 1700 | Ga0495603_0001565 | |||
| 1701 | Ga0495590_0000005 | |||
| 1702 | Ga0495590_0000013 | |||
| 1703 | Ga0495590_0001057 | |||
| 1704 | Ga0495591_000109 | |||
| 1705 | Ga0495591_062307 | |||
| 1706 | Ga0495638_0000027 | |||
| 1707 | Ga0495638_0000034 | |||
| 1708 | Ga0495638_0002984 | |||
| 1709 | Ga0495638_0008497 | |||
| 1710 | Ga0495638_0047171 | |||
| 1711 | Ga0495638_0056554 | |||
| 1712 | Ga0495638_0081076 | |||
| 1713 | Ga0495651_0133033 | |||
| 1714 | Ga0495653_0002434 | |||
| 1715 | Ga0495653_0049957 | |||
| 1716 | Ga0495650_0000322 | |||
| 1717 | Ga0495650_0000653 | |||
| 1718 | Ga0495650_0004075 | |||
| 1719 | Ga0495650_0004125 | |||
| 1720 | Ga0495580_0034724 | |||
| 1721 | Ga0495605_0005435 | |||
| 1722 | Ga0495605_0006402 | |||
| 1723 | Ga0495605_0016476 | |||
| 1724 | Ga0495605_0031057 | |||
| 1725 | Ga0495605_0040684 | |||
| 1726 | Ga0495605_0221990 | |||
| 1727 | Ga0495639_0113686 | |||
| 1728 | Ga0495639_0150653 | |||
| 1729 | Ga0495584_0000004 | |||
| 1730 | Ga0495584_0000029 | |||
| 1731 | Ga0495584_0000168 | |||
| 1732 | Ga0495584_0004385 | |||
| 1733 | Ga0495584_0007594 | |||
| 1734 | Ga0495584_0028515 | |||
| 1735 | Ga0495584_0108255 | |||
| 1736 | Ga0495585_0000746 | |||
| 1737 | Ga0495585_0001437 | |||
| 1738 | Ga0495585_0003077 | |||
| 1739 | Ga0495585_0008335 | |||
| 1740 | Ga0495585_0012851 | |||
| 1741 | Ga0495585_0019523 | |||
| 1742 | Ga0495585_0036621 | |||
| 1743 | Ga0495585_0044004 | |||
| 1744 | Ga0495585_0049484 | |||
| 1745 | Ga0495585_0056798 | |||
| 1746 | Ga0495585_0058845 | |||
| 1747 | Ga0495596_0000016 | |||
| 1748 | Ga0495596_0000508 | |||
| 1749 | Ga0495596_0001287 | |||
| 1750 | Ga0495596_0001871 | |||
| 1751 | Ga0495596_0008416 | |||
| 1752 | Ga0495596_0045209 | |||
| 1753 | Ga0495596_0072015 | |||
| 1754 | Ga0495607_0000010 | |||
| 1755 | Ga0495607_0002596 | |||
| 1756 | Ga0495607_0002953 | |||
| 1757 | Ga0495607_0006941 | |||
| 1758 | Ga0495607_0008769 | |||
| 1759 | Ga0495607_0026641 | |||
| 1760 | Ga0495607_0028658 | |||
| 1761 | Ga0495607_0038878 | |||
| 1762 | Ga0495607_0044662 | |||
| 1763 | Ga0495607_0046022 | |||
| 1764 | Ga0495607_0047554 | |||
| 1765 | Ga0495607_0051633 | |||
| 1766 | Ga0495607_0073599 | |||
| 1767 | Ga0495607_0077443 | |||
| 1768 | Ga0495607_0116460 | |||
| 1769 | Ga0495607_0172438 | |||
| 1770 | Ga0495607_0212452 | |||
| 1771 | Ga0495583_0000108 | |||
| 1772 | Ga0495583_0000246 | |||
| 1773 | Ga0495583_0000574 | |||
| 1774 | Ga0495583_0001070 | |||
| 1775 | Ga0495583_0002517 | |||
| 1776 | Ga0495583_0005662 | |||
| 1777 | Ga0495583_0017679 | |||
| 1778 | Ga0495583_0021670 | |||
| 1779 | Ga0495583_0027221 | |||
| 1780 | Ga0495583_0029106 | |||
| 1781 | Ga0495583_0034876 | |||
| 1782 | Ga0495606_0007104 | |||
| 1783 | Ga0495606_0007228 | |||
| 1784 | Ga0495606_0015743 | |||
| 1785 | Ga0495606_0063848 | |||
| 1786 | Ga0495606_0076487 | |||
| 1787 | Ga0495606_0116642 | |||
| 1788 | Ga0495606_0206351 | |||
| 1789 | Ga0495606_0220410 | |||
| 1790 | Ga0495610_0000198 | |||
| 1791 | Ga0495610_0003668 | |||
| 1792 | Ga0495610_0005787 | |||
| 1793 | Ga0495610_0006766 | |||
| 1794 | Ga0495610_0017574 | |||
| 1795 | Ga0495610_0060835 | |||
| 1796 | Ga0495610_0077586 | |||
| 1797 | Ga0495616_0001871 | |||
| 1798 | Ga0495616_0003207 | |||
| 1799 | Ga0495616_0003752 | |||
| 1800 | Ga0495616_0010304 | |||
| 1801 | Ga0495616_0027024 | |||
| 1802 | Ga0495616_0027242 | |||
| 1803 | Ga0495616_0032583 | |||
| 1804 | Ga0495616_0042619 | |||
| 1805 | Ga0495616_0086986 | |||
| 1806 | Ga0495620_0004589 | |||
| 1807 | Ga0495620_0021521 | |||
| 1808 | Ga0495628_0000366 | |||
| 1809 | Ga0495628_0422885 | |||
| 1810 | Ga0495631_0000063 | |||
| 1811 | Ga0495631_0007886 | |||
| 1812 | Ga0495631_0008421 | |||
| 1813 | Ga0495631_0029987 | |||
| 1814 | Ga0495631_0038814 | |||
| 1815 | Ga0495631_0042417 | |||
| 1816 | Ga0495631_0146325 | |||
| 1817 | Ga0495632_0000118 | |||
| 1818 | Ga0495632_0008663 | |||
| 1819 | Ga0495632_0034637 | |||
| 1820 | Ga0495632_0035531 | |||
| 1821 | Ga0495632_0035944 | |||
| 1822 | Ga0495632_0053177 | |||
| 1823 | Ga0495632_0130380 | |||
| 1824 | Ga0495637_0000008 | |||
| 1825 | Ga0495637_0003117 | |||
| 1826 | Ga0495637_0057625 | |||
| 1827 | Ga0495637_0061927 | |||
| 1828 | Ga0495637_0064385 | |||
| 1829 | Ga0495643_0000028 | |||
| 1830 | Ga0495643_0000167 | |||
| 1831 | Ga0495643_0000398 | |||
| 1832 | Ga0495643_0000806 | |||
| 1833 | Ga0495643_0031419 | |||
| 1834 | Ga0495643_0045741 | |||
| 1835 | Ga0495643_0092380 | |||
| 1836 | Ga0495643_0169218 | |||
| 1837 | Ga0495644_0001842 | |||
| 1838 | Ga0495644_0003267 | |||
| 1839 | Ga0495644_0017201 | |||
| 1840 | Ga0495644_0045134 | |||
| 1841 | Ga0495648_0000002 | |||
| 1842 | Ga0495648_0000127 | |||
| 1843 | Ga0495648_0003027 | |||
| 1844 | Ga0495648_0006784 | |||
| 1845 | Ga0495648_0016213 | |||
| 1846 | Ga0495648_0043266 | |||
| 1847 | Ga0495648_0053579 | |||
| 1848 | Ga0495648_0069857 | |||
| 1849 | Ga0495648_0087131 | |||
| 1850 | Ga0495663_0000430 | |||
| 1851 | Ga0495663_0000667 | |||
| 1852 | Ga0495663_0002025 | |||
| 1853 | Ga0495663_0002087 | |||
| 1854 | Ga0495663_0011033 | |||
| 1855 | Ga0495663_0026855 | |||
| 1856 | Ga0495663_0029574 | |||
| 1857 | Ga0495663_0029935 | |||
| 1858 | Ga0495663_0061670 | |||
| 1859 | Ga0495666_0000042 | |||
| 1860 | Ga0495642_0000713 | |||
| 1861 | Ga0495642_0006913 | |||
| 1862 | Ga0495642_0015223 | |||
| 1863 | Ga0495642_0135830 | |||
| 1864 | Ga0495652_0007817 | |||
| 1865 | Ga0495652_0034272 | |||
| 1866 | Ga0495654_0157555 | |||
| 1867 | Ga0495654_0193116 | |||
| 1868 | Ga0495586_0187068 | |||
| 1869 | Ga0495586_0257319 | |||
| 1870 | Ga0495587_0177490 | |||
| 1871 | Ga0495587_0182111 | |||
| 1872 | Ga0495609_0001891 | |||
| 1873 | Ga0495609_0003441 | |||
| 1874 | Ga0495609_0003916 | |||
| 1875 | Ga0495609_0005560 | |||
| 1876 | Ga0495609_0028674 | |||
| 1877 | Ga0495609_0031199 | |||
| 1878 | Ga0495609_0043209 | |||
| 1879 | Ga0495609_0097429 | |||
| 1880 | Ga0495609_0111753 | |||
| 1881 | Ga0495609_0186241 | |||
| 1882 | Ga0495609_0201788 | |||
| 1883 | Ga0495621_0092438 | |||
| 1884 | Ga0495597_0000072 | |||
| 1885 | Ga0495597_0000227 | |||
| 1886 | Ga0495597_0000855 | |||
| 1887 | Ga0495597_0008907 | |||
| 1888 | Ga0495597_0015375 | |||
| 1889 | Ga0495597_0060129 | |||
| 1890 | Ga0495597_0061909 | |||
| 1891 | Ga0495645_0320471 | |||
| 1892 | Ga0495622_0000002 | |||
| 1893 | Ga0495622_0000200 | |||
| 1894 | Ga0495622_0126161 | |||
| 1895 | Ga0495633_0000033 | |||
| 1896 | Ga0495633_0000055 | |||
| 1897 | Ga0495633_0000358 | |||
| 1898 | Ga0495633_0003373 | |||
| 1899 | Ga0495633_0005693 | |||
| 1900 | Ga0495633_0027144 | |||
| 1901 | Ga0495633_0031404 | |||
| 1902 | Ga0495633_0034184 | |||
| 1903 | Ga0495633_0157881 | |||
| 1904 | Ga0495633_0232800 | |||
| 1905 | Ga0495656_0001583 | |||
| 1906 | Ga0495656_0053816 | |||
| 1907 | Ga0495656_0056704 | |||
| 1908 | Ga0495656_0153134 | |||
| 1909 | Ga0495656_0176141 | |||
| 1910 | Ga0495656_0215911 | |||
| 1911 | Ga0495668_0000008 | |||
| 1912 | Ga0495668_0000065 | |||
| 1913 | Ga0495668_0004167 | |||
| 1914 | Ga0495668_0012198 | |||
| 1915 | Ga0495668_0021032 | |||
| 1916 | Ga0495668_0032724 | |||
| 1917 | Ga0495668_0036883 | |||
| 1918 | Ga0495668_0144662 | |||
| 1919 | Ga0495668_0174317 | |||
| 1920 | Ga0495668_0198177 | |||
| 1921 | Ga0495634_0035042 | |||
| 1922 | Ga0495611_0000001 | |||
| 1923 | Ga0495611_0000410 | |||
| 1924 | Ga0495611_0000965 | |||
| 1925 | Ga0495611_0004192 | |||
| 1926 | Ga0495611_0004303 | |||
| 1927 | Ga0495611_0081476 | |||
| 1928 | Ga0495625_0000001 | |||
| 1929 | Ga0495625_0000121 | |||
| 1930 | Ga0495625_0000272 | |||
| 1931 | Ga0495625_0001594 | |||
| 1932 | Ga0495625_0003267 | |||
| 1933 | Ga0495625_0036183 | |||
| 1934 | Ga0495625_0071882 | |||
| 1935 | Ga0495625_0090919 | |||
| 1936 | Ga0495625_0092736 | |||
| 1937 | Ga0495625_0095803 | |||
| 1938 | Ga0495625_0252418 | |||
| 1939 | Ga0495635_0059085 | |||
| 1940 | Ga0495635_0260240 | |||
| 1941 | Ga0495659_0000068 | |||
| 1942 | Ga0495659_0000327 | |||
| 1943 | Ga0495661_0000049 | |||
| 1944 | Ga0495661_0000839 | |||
| 1945 | Ga0495661_0011847 | |||
| 1946 | Ga0495661_0014616 | |||
| 1947 | Ga0495661_0033552 | |||
| 1948 | Ga0495661_0045135 | |||
| 1949 | Ga0495661_0068329 | |||
| 1950 | Ga0495661_0068964 | |||
| 1951 | Ga0495661_0077750 | |||
| 1952 | Ga0495661_0080141 | |||
| 1953 | Ga0495661_0135623 | |||
| 1954 | Ga0495661_0145386 | |||
| 1955 | Ga0495661_0332408 | |||
| 1956 | Ga0495623_0011973 | |||
| 1957 | Ga0495658_0103700 | |||
| 1958 | Ga0495658_0192797 | |||
| 1959 | Ga0495658_0279392 | |||
| 1960 | Ga0495669_0003845 | |||
| 1961 | Ga0495669_0070249 | |||
| 1962 | Ga0495670_0000676 | |||
| 1963 | Ga0495670_0003614 | |||
| 1964 | Ga0495670_0022234 | |||
| 1965 | Ga0495670_0022929 | |||
| 1966 | Ga0495671_0000129 | |||
| 1967 | Ga0495671_0043038 | |||
| 1968 | Ga0495671_0059437 | |||
| 1969 | Ga0495671_0064592 | |||
| 1970 | Ga0495671_0151025 | |||
| 1971 | Ga0495671_0285830 | |||
| 1972 | Ga0495649_0000071 | |||
| 1973 | Ga0495649_0004200 | |||
| 1974 | Ga0495649_0024198 | |||
| 1975 | Ga0495649_0049519 | |||
| 1976 | Ga0495649_0066875 | |||
| 1977 | Ga0495589_0000048 | |||
| 1978 | Ga0495589_0000112 | |||
| 1979 | Ga0495589_0017854 | |||
| 1980 | Ga0495589_0024781 | |||
| 1981 | Ga0495589_0065123 | |||
| 1982 | Ga0495660_0000008 | |||
| 1983 | Ga0495660_0004944 | |||
| 1984 | Ga0495660_0007687 | |||
| 1985 | Ga0495660_0015575 | |||
| 1986 | Ga0495660_0076122 | |||
| 1987 | Ga0495660_0088509 | |||
| 1988 | Ga0495660_0138521 | |||
| 1989 | Ga0495604_0080259 | |||
| 1990 | Ga0495604_0131275 | |||
| 1991 | Ga0495636_0000799 | |||
| 1992 | Ga0495636_0015324 | |||
| 1993 | Ga0495674_0016607 | |||
| 1994 | Ga0495672_0000033 | |||
| 1995 | Ga0495672_0000191 | |||
| 1996 | Ga0495672_0001752 | |||
| 1997 | Ga0495672_0005042 | |||
| 1998 | Ga0495672_0016900 | |||
| 1999 | Ga0495672_0028568 | |||
| 2000 | Ga0495680_0150482 | |||
| 2001 | Ga0495680_0246890 | |||
| 2002 | Ga0495683_0000168 | |||
| 2003 | Ga0495683_0000174 | |||
| 2004 | Ga0495683_0015029 | |||
| 2005 | Ga0495683_0021392 | |||
| 2006 | Ga0495683_0097507 | |||
| 2007 | Ga0495683_0162306 | |||
| 2008 | Ga0495687_000007 | |||
| 2009 | Ga0495687_000015 | |||
| 2010 | Ga0495687_000369 | |||
| 2011 | Ga0495687_000924 | |||
| 2012 | Ga0495687_002679 | |||
| 2013 | Ga0495687_002834 | |||
| 2014 | Ga0495687_052618 | |||
| 2015 | Ga0495687_134554 | |||
| 2016 | Ga0495675_0008485 | |||
| 2017 | Ga0495677_0000355 | |||
| 2018 | Ga0495677_0000910 | |||
| 2019 | Ga0495677_0005688 | |||
| 2020 | Ga0495677_0007740 | |||
| 2021 | Ga0495677_0012898 | |||
| 2022 | Ga0495677_0022125 | |||
| 2023 | Ga0495677_0025475 | |||
| 2024 | Ga0495677_0037543 | |||
| 2025 | Ga0495679_000001 | |||
| 2026 | Ga0495679_001633 | |||
| 2027 | Ga0495679_002909 | |||
| 2028 | Ga0495685_000192 | |||
| 2029 | Ga0495685_012712 | |||
| 2030 | Ga0495685_031041 | |||
| 2031 | Ga0495673_0000003 | |||
| 2032 | Ga0495673_0000061 | |||
| 2033 | Ga0495673_0000089 | |||
| 2034 | Ga0495681_0000016 | |||
| 2035 | Ga0495681_0000658 | |||
| 2036 | Ga0495681_0001103 | |||
| 2037 | Ga0495681_0004943 | |||
| 2038 | Ga0495681_0006172 | |||
| 2039 | Ga0495681_0009251 | |||
| 2040 | Ga0495681_0011767 | |||
| 2041 | Ga0495681_0019397 | |||
| 2042 | Ga0495681_0022548 | |||
| 2043 | Ga0495681_0040619 | |||
| 2044 | Ga0495681_0090335 | |||
| 2045 | Ga0495681_0179504 | |||
| 2046 | Ga0495686_0000146 | |||
| 2047 | Ga0495686_0003433 | |||
| 2048 | Ga0495686_0017581 | |||
| 2049 | Ga0495686_0057450 | |||
| 2050 | Ga0495686_0118304 | |||
| 2051 | Ga0495602_0026419 | |||
| 2052 | Ga0495615_0000012 | |||
| 2053 | Ga0495615_0036450 | |||
| 2054 | Ga0495615_0042955 | |||
| 2055 | Ga0495626_0006364 | |||
| 2056 | Ga0495626_0021288 | |||
| 2057 | Ga0495626_0067203 | |||
| 2058 | Ga0496100_0013632 | |||
| 2059 | Ga0496100_0190993 | |||
| 2060 | Ga0496101_0003543 | |||
| 2061 | Ga0496101_0201911 | |||
| 2062 | Ga0496101_0264110 | |||
| 2063 | Ga0496102_0000103 | |||
| 2064 | Ga0496102_0114554 | |||
| 2065 | Ga0496102_0206472 | |||
| 2066 | Ga0496103_0000036 | |||
| 2067 | Ga0496103_0005307 | |||
| 2068 | Ga0496103_0243090 | |||
| 2069 | Ga0496104_0002829 | |||
| 2070 | Ga0496104_0013012 | |||
| 2071 | Ga0496104_0085803 | |||
| 2072 | Ga0496104_0321070 | |||
| 2073 | Ga0496105_0001982 | |||
| 2074 | Ga0496105_0030075 | |||
| 2075 | Ga0496105_0061406 | |||
| 2076 | Ga0496105_0069371 | |||
| 2077 | Ga0496106_0010373 | |||
| 2078 | Ga0496107_0143245 | |||
| 2079 | Ga0496107_0274533 | |||
| 2080 | Ga0496107_0446481 | |||
| 2081 | Ga0496108_0015009 | |||
| 2082 | Ga0496108_0041368 | |||
| 2083 | Ga0496108_0145189 | |||
| 2084 | Ga0496109_0101361 | |||
| 2085 | Ga0496109_0207592 | |||
| 2086 | Ga0496110_0026193 | |||
| 2087 | Ga0496110_0080787 | |||
| 2088 | Ga0496110_0334973 | |||
| 2089 | Ga0496111_0081081 | |||
| 2090 | Ga0496111_0273641 | |||
| 2091 | Ga0496111_0467944 | |||
| 2092 | Ga0496112_0215527 | |||
| 2093 | Ga0496113_0002745 | |||
| 2094 | Ga0496113_0113912 | |||
| 2095 | Ga0496114_0032300 | |||
| 2096 | Ga0496114_0101033 | |||
| 2097 | Ga0496114_0160197 | |||
| 2098 | Ga0496114_0406589 | |||
| 2099 | Ga0496115_0389635 | |||
| 2100 | Ga0496115_0502766 | |||
| 2101 | Ga0496116_0000160 | |||
| 2102 | Ga0496116_0001705 | |||
| 2103 | Ga0496116_0007161 | |||
| 2104 | Ga0496116_0174638 | |||
| 2105 | Ga0496117_0000202 | |||
| 2106 | Ga0496117_0000810 | |||
| 2107 | Ga0496117_0001291 | |||
| 2108 | Ga0496117_0003022 | |||
| 2109 | Ga0496117_0226481 | |||
| 2110 | Ga0496118_0000318 | |||
| 2111 | Ga0496118_0000579 | |||
| 2112 | Ga0496118_0003511 | |||
| 2113 | Ga0496118_0005968 | |||
| 2114 | Ga0496118_0017237 | |||
| 2115 | Ga0496119_0000480 | |||
| 2116 | Ga0496119_0004992 | |||
| 2117 | Ga0496119_0042204 | |||
| 2118 | Ga0496119_0044188 | |||
| 2119 | Ga0496120_0000511 | |||
| 2120 | Ga0496120_0031643 | |||
| 2121 | Ga0496121_0002018 | |||
| 2122 | Ga0496121_0003167 | |||
| 2123 | Ga0496121_0009473 | |||
| 2124 | Ga0496121_0012029 | |||
| 2125 | Ga0496121_0015334 | |||
| 2126 | Ga0496121_0017579 | |||
| 2127 | Ga0496121_0092537 | |||
| 2128 | Ga0496122_0000410 | |||
| 2129 | Ga0496122_0000662 | |||
| 2130 | Ga0496122_0001600 | |||
| 2131 | Ga0496122_0001753 | |||
| 2132 | Ga0496122_0003832 | |||
| 2133 | Ga0496122_0005663 | |||
| 2134 | Ga0496122_0006221 | |||
| 2135 | Ga0496122_0008250 | |||
| 2136 | Ga0496122_0019858 | |||
| 2137 | Ga0496122_0130777 | |||
| 2138 | Ga0496123_0000478 | |||
| 2139 | Ga0496123_0000818 | |||
| 2140 | Ga0496123_0001311 | |||
| 2141 | Ga0496123_0002081 | |||
| 2142 | Ga0496123_0003504 | |||
| 2143 | Ga0496123_0003783 | |||
| 2144 | Ga0496123_0004715 | |||
| 2145 | Ga0496123_0006472 | |||
| 2146 | Ga0496123_0095277 | |||
| 2147 | Ga0496123_0120161 | |||
| 2148 | Ga0496124_0003904 | |||
| 2149 | Ga0496124_0004765 | |||
| 2150 | Ga0496124_0005128 | |||
| 2151 | Ga0496124_0007020 | |||
| 2152 | Ga0496124_0007341 | |||
| 2153 | Ga0496124_0008353 | |||
| 2154 | Ga0496124_0010750 | |||
| 2155 | Ga0496124_0155339 | |||
| 2156 | Ga0496124_0259885 | |||
| 2157 | Ga0496124_0310325 | |||
| 2158 | Ga0496125_0000166 | |||
| 2159 | Ga0496125_0001775 | |||
| 2160 | Ga0496125_0003280 | |||
| 2161 | Ga0496125_0003538 | |||
| 2162 | Ga0496125_0005574 | |||
| 2163 | Ga0496125_0006247 | |||
| 2164 | Ga0496125_0018022 | |||
| 2165 | Ga0496125_0237624 | |||
| 2166 | Ga0496125_0294352 | |||
| 2167 | Ga0496126_0000116 | |||
| 2168 | Ga0496126_0036200 | |||
| 2169 | Ga0496126_0036879 | |||
| 2170 | Ga0496126_0046931 | |||
| 2171 | Ga0496126_0095044 | |||
| 2172 | Ga0496126_0397380 | |||
| 2173 | Ga0495678_000024 | |||
| 2174 | Ga0495678_000061 | |||
| 2175 | Ga0495678_000080 | |||
| 2176 | Ga0495678_000367 | |||
| 2177 | Ga0495678_001099 | |||
| 2178 | Ga0495678_002662 | |||
| 2179 | Ga0495678_005899 | |||
| 2180 | Ga0495678_022773 | |||
| 2181 | Ga0495678_035769 | |||
| 2182 | Ga0495678_074579 | |||
| 2183 | Ga0495682_0000284 | |||
| 2184 | Ga0495682_0000409 | |||
| 2185 | Ga0495682_0000411 | |||
| 2186 | Ga0495682_0001519 | |||
| 2187 | Ga0495682_0013200 | |||
| 2188 | Ga0495682_0015985 | |||
| 2189 | Ga0501313_000711 | |||
| 2190 | Ga0501033_0130265 | |||
| 2191 | Ga0501034_0056876 | |||
| 2192 | Ga0501034_0365802 | |||
| 2193 | Ga0501037_0200556 | |||
| 2194 | Ga0501038_0198498 | |||
| 2195 | Ga0501047_0007859 | |||
| 2196 | Ga0501067_0051471 | |||
| 2197 | Ga0501073_0000012 | |||
| 2198 | Ga0501269_000034 | |||
| 2199 | Ga0501035_0006617 | |||
| 2200 | Ga0501035_0009730 | |||
| 2201 | Ga0501035_0022652 | |||
| 2202 | Ga0501035_0120648 | |||
| 2203 | Ga0501044_0000236 | |||
| 2204 | Ga0501044_0044554 | |||
| 2205 | nmdc:mga03683_277671_c1 | |||
| 2206 | nmdc:mga00v17_41700_c1 | |||
| 2207 | nmdc:mga00v17_96686_c1 | |||
| 2208 | nmdc:mga0yw44_1980_c1 | |||
| 2209 | nmdc:mga0yw44_4987_c1 | |||
| 2210 | nmdc:mga0yw44_92232_c1 | |||
| 2211 | nmdc:mga0yw44_96069_c1 | |||
| 2212 | nmdc:mga0k408_78977_c1 | |||
| 2213 | nmdc:mga0k408_9809_c1 | |||
| 2214 | nmdc:mga06z11_28077_c1 | |||
| 2215 | nmdc:mga07m45_2540_c1 | |||
| 2216 | nmdc:mga07m45_37452_c1 | |||
| 2217 | nmdc:mga05p37_209_c1 | |||
| 2218 | nmdc:mga09592_150_c1 | |||
| 2219 | nmdc:mga06r32_128933_c1 | |||
| 2220 | nmdc:mga06r32_148815_c1 | |||
| 2221 | nmdc:mga06r32_39269_c1 | |||
| 2222 | nmdc:mga08y16_111071_c1 | |||
| 2223 | nmdc:mga08y16_261223_c1 | |||
| 2224 | nmdc:mga08y16_42698_c1 | |||
| 2225 | nmdc:mga08y16_656469_c1 | |||
| 2226 | nmdc:mga0rr50_119166_c1 | |||
| 2227 | nmdc:mga0rr50_229454_c1 | |||
| 2228 | nmdc:mga08x19_6630_c1 | |||
| 2229 | nmdc:mga0a205_30059_c1 | |||
| 2230 | nmdc:mga0a205_648526_c1 | |||
| 2231 | Ga0495595_0165436 | |||
| 2232 | Ga0500644_0143440 | |||
| 2233 | Ga0500646_0074727 | |||
| 2234 | Ga0500651_0018685 | |||
| 2235 | Ga0500651_0065804 | |||
| 2236 | Ga0500555_000019 | |||
| 2237 | Ga0500594_0022935 | |||
| 2238 | Ga0500594_0046611 | |||
| 2239 | Ga0500652_000792 | |||
| 2240 | Ga0500559_0003954 | |||
| 2241 | Ga0500573_0005953 | |||
| 2242 | Ga0500586_002700 | |||
| 2243 | Ga0500622_0000146 | |||
| 2244 | Ga0500634_0175155 | |||
| 2245 | Ga0500645_000242 | |||
| 2246 | Ga0587070_008462 | |||
| 2247 | Ga0587080_013453 | |||
| 2248 | Ga0587083_0009809 | |||
| 2249 | Ga0587083_0032420 | |||
| 2250 | Ga0587076_063013 | |||
| 2251 | Ga0466962_0037154 | |||
| 2252 | Ga0466962_0047494 | |||
| 2253 | Ga0466962_0068362 | |||
| 2254 | Ga0530510_0417292 | |||
| 2255 | 2511242871 | |||
| 2256 | 2513953387 | |||
| 2257 | 2514044665 | |||
| 2258 | 2552748891 | |||
| 2259 | 2552748931 | |||
| 2260 | 2563060598 | |||
| 2261 | 2578458660 | |||
| 2262 | 2587730616 | |||
| 2263 | 2587736839 | |||
| 2264 | 2588294911 | |||
| 2265 | 2599902574 | |||
| 2266 | 2640735110 | |||
| 2267 | 2643752234 | |||
| 2268 | 2643861368 | |||
| 2269 | 2643894572 | |||
| 2270 | 2644123777 | |||
| 2271 | 2644338882 | |||
| 2272 | 2644364146 | |||
| 2273 | 2644476726 | |||
| 2274 | 2678231389 | |||
| 2275 | 2678231430 | |||
| 2276 | 2678231991 | |||
| 2277 | 2713475775 | |||
| 2278 | 2738713138 | |||
| 2279 | 2738740503 | |||
| 2280 | 2738843244 | |||
| 2281 | 2738851561 | |||
| 2282 | 2738867292 | |||
| 2283 | 2739272119 | |||
| 2284 | 2739299808 | |||
| 2285 | 2739341163 | |||
| 2286 | 2739361488 | |||
| 2287 | 2747948227 | |||
| 2288 | 2747948626 | |||
| 2289 | 2774437126 | |||
| 2290 | 2774437166 | |||
| 2291 | 2819553710 | |||
| 2292 | 2842737562 | |||
| 2293 | 2847933222 | |||
| 2294 | 2857446001 | |||
| 2295 | 2857541740 | |||
| 2296 | 2881929484 | |||
| 2297 | 2885084143 | |||
| 2298 | 2885277564 | |||
| 2299 | 2894027253 | |||
| 2300 | 2919182614 | |||
| 2301 | 2919182654 | |||
| 2302 | 2919506797 | |||
| 2303 | 2919710078 | |||
| 2304 | 2928104676 | |||
| 2305 | 2928515685 | |||
| 2306 | 2928519666 | |||
| 2307 | 2939622995 | |||
| 2308 | 2974320572 | |||
| 2309 | 2996222241 | |||
| 2310 | 3000865542 | |||
| 2311 | 644750265 | |||
| 2312 | 8033234522 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o9l-assembly2.cif.gz_D | succinate:coenzyme-a transferase (pig heart) | 0.9255 | 8 | 207 |
| 3cdk-assembly1.cif.gz_D | crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis | 0.922 | 8 | 211 |
| 3rrl-assembly1.cif.gz_D | complex structure of 3-oxoadipate coa-transferase subunit a and b from helicobacter pylori 26695 | 0.9217 | 11 | 211 |
| 1ooy-assembly1.cif.gz_A | succinyl-coa:3-ketoacid coa transferase from pig heart | 0.9206 | 8 | 207 |
| 4kgb-assembly1.cif.gz_B | structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster | 0.9197 | 8 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nrcB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9185 | 8 | 207 | 3.40.1080.10 |
| 5dbnD00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8986 | 8 | 219 | 3.40.1080.10 |
| 5dbnD00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8828 | 8 | 219 | 3.40.1080.10 |
| 1o9lB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8765 | 8 | 211 | 3.40.1080.10 |
| 2nrcB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.85 | 8 | 207 | 3.40.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F8VZX9-F1-model_v4 | 3-oxoadipate CoA-transferase | 0.9664 | 1 | 213 |
GO:0008410
|
| AF-A0A6H9WP19-F1-model_v4 | 3-oxoacid CoA-transferase subunit B | 0.9652 | 2 | 209 |
GO:0008410
|
| AF-A0A838L7R7-F1-model_v4 | 3-oxoacid CoA-transferase subunit B | 0.9643 | 3 | 211 |
GO:0008410
|
| AF-A0A2M6VCW0-F1-model_v4 | 3-oxoadipate CoA-transferase | 0.9619 | 1 | 211 |
GO:0008410
|
| AF-A0A292PJC2-F1-model_v4 | 3-oxoacid CoA-transferase (EC 2.8.3.5) | 0.9607 | 11 | 103 |
GO:0005739
GO:0008260 |