F490982

General Info

Members Datasets Scaffolds Average Seq Length
1159 265 2318 293

Family's Representative Sequence

Representative Sequence 3300042004|Ga0439445_0000033|Ga0439445_0000033_7139_8110
Length 299
Sequence MIYIIILAVGSPRKAQKRRMELIKERHADGILAANAQAQIRKLMAARSSRVEGIFSTLIPKPALMRKRLEQTGKPITLGQYAMASVGLALFVAVLIALKGAPFMLALFVGLFFGIAVPHFVVGFLIKRRLNKFNTNFPDAIELMVRGLRSGLPITETLGIVAGEISGPVGIEFRAVADKMKIGRTMEAALQETSDRLGTAEFQFFVITLAIQRETGGNLAERKRGQMKLKIRAMSSESKASAYIVGSLPFVVFTLVWMINPGYMGGFFVDQRLIVAGLGGLCWMGIGVFIMAKMVNFEI

Samples

Sample ID Description Type Environment
1 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
200 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
201 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
202 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
249 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
250 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
253 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
254 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
255 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
259 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
260 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.49
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439445_0000033 3300042004 Bacteria 18479
2 JGI24736J21556_1015226 3300001904 Bacteria 1233
3 JGI24741J21665_1000614 3300001915 Bacteria 10762
4 JGI24741J21665_1004043 3300001915 Bacteria 3336
5 JGI24741J21665_1014236 3300001915 Bacteria 1333
6 JGI24747J21853_1000282 3300001978 Bacteria 2827
7 JGI24740J21852_10001651 3300001979 Bacteria 10235
8 JGI24740J21852_10004950 3300001979 Bacteria 5665
9 JGI24740J21852_10006123 3300001979 Bacteria 5022
10 JGI24740J21852_10006423 3300001979 Bacteria 4871
11 JGI24740J21852_10033413 3300001979 Bacteria 1633
12 JGI24740J21852_10034857 3300001979 Bacteria 1580
13 JGI24740J21852_10045052 3300001979 Bacteria 1304
14 JGI24739J22299_10000962 3300001989 Bacteria 10709
15 JGI24739J22299_10005783 3300001989 Bacteria 4685
16 JGI24739J22299_10006785 3300001989 Bacteria 4310
17 JGI24739J22299_10008692 3300001989 Bacteria 3788
18 JGI24739J22299_10016938 3300001989 Bacteria 2634
19 JGI24737J22298_10000221 3300001990 Bacteria 18699
20 JGI24737J22298_10005094 3300001990 Bacteria 4550
21 JGI24737J22298_10007887 3300001990 Bacteria 3585
22 JGI24737J22298_10012795 3300001990 Bacteria 2735
23 JGI24743J22301_10025292 3300001991 Bacteria 1150
24 JGI24735J21928_10001120 3300002067 Bacteria 9610
25 JGI24735J21928_10005874 3300002067 Bacteria 4058
26 JGI24735J21928_10007590 3300002067 Bacteria 3534
27 JGI24735J21928_10015504 3300002067 Bacteria 2377
28 JGI24735J21928_10022580 3300002067 Bacteria 1914
29 JGI24735J21928_10037210 3300002067 Bacteria 1427
30 JGI24738J21930_10001585 3300002075 Bacteria 6264
31 JGI24738J21930_10005295 3300002075 Bacteria 3103
32 JGI24738J21930_10008738 3300002075 Bacteria 2298
33 JGI24744J21845_10002922 3300002077 Bacteria 3494
34 JGI24035J26624_1004103 3300002126 Bacteria 1378
35 Ga0065712_10094335 3300005290 Bacteria 2259
36 Ga0065712_10156713 3300005290 Bacteria 1330
37 Ga0065715_10137581 3300005293 Bacteria 1905
38 Ga0065715_10150715 3300005293 Bacteria 1727
39 Ga0070658_10000183 3300005327 Bacteria 54970
40 Ga0070658_10006907 3300005327 Bacteria 9165
41 Ga0070658_10007728 3300005327 Bacteria 8663
42 Ga0070658_10028609 3300005327 Bacteria 4475
43 Ga0070658_10032687 3300005327 Bacteria 4183
44 Ga0070658_10032766 3300005327 Bacteria 4178
45 Ga0070658_10089328 3300005327 Bacteria 2537
46 Ga0070658_10094459 3300005327 Bacteria 2467
47 Ga0070658_10121855 3300005327 Bacteria 2167
48 Ga0070658_10179683 3300005327 Bacteria 1780
49 Ga0070676_10004745 3300005328 Bacteria 7190
50 Ga0070676_10129340 3300005328 Bacteria 1595
51 Ga0070676_10216416 3300005328 Bacteria 1263
52 Ga0070683_100004468 3300005329 Bacteria 11542
53 Ga0070683_100021904 3300005329 Bacteria 5706
54 Ga0070683_100022586 3300005329 Bacteria 5624
55 Ga0070683_100030748 3300005329 Bacteria 4878
56 Ga0070683_100074787 3300005329 Bacteria 3164
57 Ga0070683_100194134 3300005329 Bacteria 1928
58 Ga0070690_100000787 3300005330 Bacteria 16090
59 Ga0070670_100001654 3300005331 Bacteria 18060
60 Ga0070670_100005417 3300005331 Bacteria 10767
61 Ga0070670_100005651 3300005331 Bacteria 10549
62 Ga0070670_100006313 3300005331 Bacteria 10035
63 Ga0070670_100007094 3300005331 Bacteria 9487
64 Ga0070670_100034916 3300005331 Bacteria 4328
65 Ga0070670_100052697 3300005331 Bacteria 3494
66 Ga0070670_100115100 3300005331 Bacteria 2318
67 Ga0070670_100132381 3300005331 Bacteria 2154
68 Ga0068869_100003110 3300005334 Bacteria 10120
69 Ga0068869_100109312 3300005334 Bacteria 2101
70 Ga0070666_10000235 3300005335 Bacteria 37441
71 Ga0070666_10009444 3300005335 Bacteria 6081
72 Ga0070666_10018688 3300005335 Bacteria 4463
73 Ga0070666_10019541 3300005335 Bacteria 4375
74 Ga0070666_10035423 3300005335 Bacteria 3310
75 Ga0070680_100000385 3300005336 Bacteria 29938
76 Ga0070680_100003098 3300005336 Bacteria 12342
77 Ga0070680_100006794 3300005336 Bacteria 8718
78 Ga0070680_100015101 3300005336 Bacteria 6047
79 Ga0070680_100059057 3300005336 Bacteria 3137
80 Ga0070680_100112652 3300005336 Bacteria 2265
81 Ga0070682_100007746 3300005337 Bacteria 6051
82 Ga0070682_100009275 3300005337 Bacteria 5569
83 Ga0070682_100206799 3300005337 Bacteria 1388
84 Ga0068868_100001447 3300005338 Bacteria 16366
85 Ga0068868_100199254 3300005338 Bacteria 1668
86 Ga0068868_100232839 3300005338 Bacteria 1546
87 Ga0070660_100003909 3300005339 Bacteria 10295
88 Ga0070660_100004385 3300005339 Bacteria 9748
89 Ga0070660_100005119 3300005339 Bacteria 9055
90 Ga0070660_100007290 3300005339 Bacteria 7705
91 Ga0070660_100007456 3300005339 Bacteria 7624
92 Ga0070660_100013729 3300005339 Bacteria 5823
93 Ga0070660_100020482 3300005339 Bacteria 4861
94 Ga0070660_100045400 3300005339 Bacteria 3363
95 Ga0070660_100050928 3300005339 Bacteria 3187
96 Ga0070660_100070038 3300005339 Bacteria 2736
97 Ga0070660_100098832 3300005339 Bacteria 2310
98 Ga0070660_100117986 3300005339 Bacteria 2116
99 Ga0070660_100173717 3300005339 Bacteria 1741
100 Ga0070660_100212587 3300005339 Bacteria 1570
101 Ga0070660_100339111 3300005339 Bacteria 1237
102 Ga0070691_10006423 3300005341 Bacteria 5374
103 Ga0070661_100000682 3300005344 Bacteria 24927
104 Ga0070661_100001721 3300005344 Bacteria 15161
105 Ga0070661_100009008 3300005344 Bacteria 6904
106 Ga0070661_100011134 3300005344 Bacteria 6264
107 Ga0070661_100012200 3300005344 Bacteria 6008
108 Ga0070661_100026019 3300005344 Bacteria 4205
109 Ga0070661_100028075 3300005344 Bacteria 4057
110 Ga0070661_100044442 3300005344 Bacteria 3246
111 Ga0070661_100065834 3300005344 Bacteria 2663
112 Ga0070661_100180797 3300005344 Bacteria 1604
113 Ga0070661_100193700 3300005344 Bacteria 1551
114 Ga0070661_100288443 3300005344 Bacteria 1275
115 Ga0070692_10004085 3300005345 Bacteria 6034
116 Ga0070692_10069470 3300005345 Bacteria 1874
117 Ga0070668_100008023 3300005347 Bacteria 7844
118 Ga0070668_100044135 3300005347 Bacteria 3420
119 Ga0070668_100078481 3300005347 Bacteria 2583
120 Ga0070668_100345752 3300005347 Bacteria 1258
121 Ga0070668_100424648 3300005347 Bacteria 1139
122 Ga0070669_100000682 3300005353 Bacteria 24837
123 Ga0070669_100062727 3300005353 Bacteria 2734
124 Ga0070675_100003697 3300005354 Bacteria 11623
125 Ga0070675_100012174 3300005354 Bacteria 6744
126 Ga0070675_100075776 3300005354 Bacteria 2797
127 Ga0070675_100109732 3300005354 Bacteria 2332
128 Ga0070671_100000937 3300005355 Bacteria 21358
129 Ga0070671_100002662 3300005355 Bacteria 13841
130 Ga0070671_100035190 3300005355 Bacteria 4149
131 Ga0070671_100035235 3300005355 Bacteria 4146
132 Ga0070671_100041357 3300005355 Bacteria 3831
133 Ga0070671_100042010 3300005355 Bacteria 3800
134 Ga0070671_100061812 3300005355 Bacteria 3119
135 Ga0070671_100128088 3300005355 Bacteria 2137
136 Ga0070671_100141748 3300005355 Bacteria 2028
137 Ga0070671_100194733 3300005355 Bacteria 1718
138 Ga0070674_100004075 3300005356 Bacteria 8298
139 Ga0070674_100015941 3300005356 Bacteria 4703
140 Ga0070674_100031086 3300005356 Bacteria 3535
141 Ga0070674_100093580 3300005356 Bacteria 2175
142 Ga0070674_100183010 3300005356 Bacteria 1606
143 Ga0070673_100000833 3300005364 Bacteria 17279
144 Ga0070673_100003744 3300005364 Bacteria 9537
145 Ga0070673_100045049 3300005364 Bacteria 3419
146 Ga0070673_100095688 3300005364 Bacteria 2436
147 Ga0070673_100110547 3300005364 Bacteria 2278
148 Ga0070673_100350524 3300005364 Bacteria 1310
149 Ga0070659_100000643 3300005366 Bacteria 25509
150 Ga0070659_100000950 3300005366 Bacteria 21306
151 Ga0070659_100001481 3300005366 Bacteria 16916
152 Ga0070659_100004836 3300005366 Bacteria 9620
153 Ga0070659_100015330 3300005366 Bacteria 5740
154 Ga0070659_100015369 3300005366 Bacteria 5733
155 Ga0070659_100050451 3300005366 Bacteria 3271
156 Ga0070659_100096078 3300005366 Bacteria 2380
157 Ga0070659_100099729 3300005366 Bacteria 2336
158 Ga0070659_100145132 3300005366 Bacteria 1933
159 Ga0070659_100167563 3300005366 Bacteria 1798
160 Ga0070659_100187615 3300005366 Bacteria 1699
161 Ga0070667_100005345 3300005367 Bacteria 10728
162 Ga0070667_100007376 3300005367 Bacteria 9132
163 Ga0070667_100008901 3300005367 Bacteria 8309
164 Ga0070667_100012249 3300005367 Bacteria 7094
165 Ga0070667_100013448 3300005367 Bacteria 6765
166 Ga0070667_100072516 3300005367 Bacteria 2935
167 Ga0070667_100257006 3300005367 Bacteria 1563
168 Ga0070667_100270712 3300005367 Bacteria 1523
169 Ga0070709_10018451 3300005434 Bacteria 4017
170 Ga0070714_100025191 3300005435 Bacteria 4908
171 Ga0070714_100070079 3300005435 Bacteria 3030
172 Ga0070714_100077881 3300005435 Bacteria 2880
173 Ga0070714_100186426 3300005435 Bacteria 1891
174 Ga0070714_100251725 3300005435 Bacteria 1633
175 Ga0070713_100005789 3300005436 Bacteria 8496
176 Ga0070713_100137579 3300005436 Bacteria 2160
177 Ga0070713_100370905 3300005436 Bacteria 1332
178 Ga0070705_100252470 3300005440 Bacteria 1239
179 Ga0070694_100004281 3300005444 Bacteria 8587
180 Ga0070663_100003716 3300005455 Bacteria 8847
181 Ga0070663_100006382 3300005455 Bacteria 7087
182 Ga0070663_100014245 3300005455 Bacteria 5098
183 Ga0070663_100052254 3300005455 Bacteria 2914
184 Ga0070663_100193887 3300005455 Bacteria 1582
185 Ga0070663_100267152 3300005455 Bacteria 1359
186 Ga0070663_100362232 3300005455 Bacteria 1176
187 Ga0070678_100001779 3300005456 Bacteria 11617
188 Ga0070678_100040826 3300005456 Bacteria 3285
189 Ga0070678_100055592 3300005456 Bacteria 2890
190 Ga0070678_100251378 3300005456 Bacteria 1482
191 Ga0070678_100292218 3300005456 Bacteria 1382
192 Ga0070662_100000837 3300005457 Bacteria 18934
193 Ga0070662_100004005 3300005457 Bacteria 9236
194 Ga0070662_100005364 3300005457 Bacteria 8189
195 Ga0070662_100006602 3300005457 Bacteria 7490
196 Ga0070662_100009256 3300005457 Bacteria 6435
197 Ga0070662_100014381 3300005457 Bacteria 5286
198 Ga0070662_100074783 3300005457 Bacteria 2507
199 Ga0070662_100104150 3300005457 Bacteria 2152
200 Ga0070662_100135770 3300005457 Bacteria 1902
201 Ga0070662_100206106 3300005457 Bacteria 1562
202 Ga0070662_100273316 3300005457 Bacteria 1365
203 Ga0070662_100309997 3300005457 Bacteria 1284
204 Ga0070681_10012278 3300005458 Bacteria 8496
205 Ga0070681_10023104 3300005458 Bacteria 6253
206 Ga0070681_10043796 3300005458 Bacteria 4480
207 Ga0070681_10063259 3300005458 Bacteria 3673
208 Ga0070681_10180377 3300005458 Bacteria 2033
209 Ga0068867_100002583 3300005459 Bacteria 12765
210 Ga0068867_100015227 3300005459 Bacteria 5453
211 Ga0068867_100050312 3300005459 Bacteria 3070
212 Ga0068867_100193902 3300005459 Bacteria 1623
213 Ga0070706_100389279 3300005467 Bacteria 1298
214 Ga0070679_100008172 3300005530 Bacteria 9835
215 Ga0070679_100012904 3300005530 Bacteria 8000
216 Ga0070679_100028208 3300005530 Bacteria 5533
217 Ga0070679_100124000 3300005530 Bacteria 2566
218 Ga0070679_100206547 3300005530 Bacteria 1928
219 Ga0070679_100242019 3300005530 Bacteria 1761
220 Ga0070684_100009332 3300005535 Bacteria 7722
221 Ga0070684_100051750 3300005535 Bacteria 3569
222 Ga0068853_100001045 3300005539 Bacteria 19580
223 Ga0068853_100001659 3300005539 Bacteria 16300
224 Ga0068853_100007145 3300005539 Bacteria 8931
225 Ga0068853_100008873 3300005539 Bacteria 8090
226 Ga0068853_100026189 3300005539 Bacteria 4897
227 Ga0068853_100031255 3300005539 Bacteria 4503
228 Ga0068853_100060593 3300005539 Bacteria 3270
229 Ga0068853_100067472 3300005539 Bacteria 3108
230 Ga0068853_100116544 3300005539 Bacteria 2378
231 Ga0068853_100144893 3300005539 Bacteria 2134
232 Ga0068853_100199923 3300005539 Bacteria 1819
233 Ga0068853_100471481 3300005539 Bacteria 1183
234 Ga0070672_100000589 3300005543 Bacteria 21279
235 Ga0070672_100054622 3300005543 Bacteria 3128
236 Ga0070672_100060796 3300005543 Bacteria 2976
237 Ga0070672_100063123 3300005543 Bacteria 2925
238 Ga0070672_100064682 3300005543 Bacteria 2890
239 Ga0070672_100075053 3300005543 Bacteria 2698
240 Ga0070672_100146730 3300005543 Bacteria 1950
241 Ga0070672_100225234 3300005543 Bacteria 1574
242 Ga0070672_100336142 3300005543 Bacteria 1285
243 Ga0070686_100021370 3300005544 Bacteria 3846
244 Ga0070686_100228304 3300005544 Bacteria 1349
245 Ga0070696_100159189 3300005546 Bacteria 1663
246 Ga0070693_100000320 3300005547 Bacteria 22053
247 Ga0070693_100024049 3300005547 Bacteria 3263
248 Ga0070665_100003564 3300005548 Bacteria 16507
249 Ga0070665_100007212 3300005548 Bacteria 11297
250 Ga0070665_100010214 3300005548 Bacteria 9497
251 Ga0070665_100020654 3300005548 Bacteria 6616
252 Ga0070665_100044104 3300005548 Bacteria 4479
253 Ga0070665_100320631 3300005548 Bacteria 1554
254 Ga0068855_100004727 3300005563 Bacteria 16630
255 Ga0068855_100008531 3300005563 Bacteria 12386
256 Ga0068855_100011826 3300005563 Bacteria 10552
257 Ga0068855_100036759 3300005563 Bacteria 5826
258 Ga0068855_100046200 3300005563 Bacteria 5148
259 Ga0068855_100048507 3300005563 Bacteria 5011
260 Ga0068855_100103050 3300005563 Bacteria 3284
261 Ga0068855_100217505 3300005563 Bacteria 2144
262 Ga0068855_100223315 3300005563 Bacteria 2111
263 Ga0068855_100241393 3300005563 Bacteria 2019
264 Ga0070664_100001349 3300005564 Bacteria 19586
265 Ga0070664_100006689 3300005564 Bacteria 9297
266 Ga0070664_100007037 3300005564 Bacteria 9079
267 Ga0070664_100016262 3300005564 Bacteria 6099
268 Ga0070664_100028889 3300005564 Bacteria 4618
269 Ga0070664_100030355 3300005564 Bacteria 4509
270 Ga0070664_100035271 3300005564 Bacteria 4199
271 Ga0070664_100060658 3300005564 Bacteria 3221
272 Ga0070664_100113668 3300005564 Bacteria 2365
273 Ga0070664_100149192 3300005564 Bacteria 2063
274 Ga0070664_100167666 3300005564 Bacteria 1946
275 Ga0070664_100325400 3300005564 Bacteria 1394
276 Ga0070664_100357586 3300005564 Bacteria 1329
277 Ga0068857_100004459 3300005577 Bacteria 11831
278 Ga0068857_100004827 3300005577 Bacteria 11423
279 Ga0068857_100006517 3300005577 Bacteria 10017
280 Ga0068857_100017036 3300005577 Bacteria 6364
281 Ga0068857_100017657 3300005577 Bacteria 6256
282 Ga0068857_100045037 3300005577 Bacteria 3913
283 Ga0068857_100099653 3300005577 Bacteria 2606
284 Ga0068857_100141149 3300005577 Bacteria 2178
285 Ga0068857_100143755 3300005577 Bacteria 2158
286 Ga0068854_100002308 3300005578 Bacteria 11750
287 Ga0068854_100006106 3300005578 Bacteria 7641
288 Ga0068854_100007831 3300005578 Bacteria 6838
289 Ga0068854_100010315 3300005578 Bacteria 6055
290 Ga0068854_100048634 3300005578 Bacteria 3026
291 Ga0068854_100104351 3300005578 Bacteria 2129
292 Ga0068856_100000213 3300005614 Bacteria 62582
293 Ga0068856_100055161 3300005614 Bacteria 3922
294 Ga0068856_100065734 3300005614 Bacteria 3584
295 Ga0068856_100101240 3300005614 Bacteria 2874
296 Ga0068856_100119630 3300005614 Bacteria 2635
297 Ga0068856_100200210 3300005614 Bacteria 2011
298 Ga0068856_100204422 3300005614 Bacteria 1989
299 Ga0068856_100387160 3300005614 Bacteria 1418
300 Ga0068856_100449907 3300005614 Bacteria 1309
301 Ga0068852_100001218 3300005616 Bacteria 17107
302 Ga0068852_100002661 3300005616 Bacteria 12350
303 Ga0068852_100009304 3300005616 Bacteria 7287
304 Ga0068852_100011783 3300005616 Bacteria 6603
305 Ga0068852_100019494 3300005616 Bacteria 5370
306 Ga0068852_100021157 3300005616 Bacteria 5185
307 Ga0068852_100025865 3300005616 Bacteria 4762
308 Ga0068852_100035873 3300005616 Bacteria 4142
309 Ga0068852_100048500 3300005616 Bacteria 3629
310 Ga0068852_100058098 3300005616 Bacteria 3349
311 Ga0068852_100094893 3300005616 Bacteria 2677
312 Ga0068852_100103286 3300005616 Bacteria 2577
313 Ga0068852_100113706 3300005616 Bacteria 2465
314 Ga0068852_100146284 3300005616 Bacteria 2192
315 Ga0068852_100150827 3300005616 Bacteria 2161
316 Ga0068852_100153655 3300005616 Bacteria 2142
317 Ga0068852_100176638 3300005616 Bacteria 2005
318 Ga0068852_100259687 3300005616 Bacteria 1667
319 Ga0068859_100002632 3300005617 Bacteria 18266
320 Ga0068859_100007420 3300005617 Bacteria 11132
321 Ga0068859_100016870 3300005617 Bacteria 7330
322 Ga0068859_100057714 3300005617 Bacteria 3910
323 Ga0068859_100059672 3300005617 Bacteria 3843
324 Ga0068859_100134169 3300005617 Bacteria 2547
325 Ga0068859_100225546 3300005617 Bacteria 1962
326 Ga0068864_100000287 3300005618 Bacteria 44806
327 Ga0068864_100000748 3300005618 Bacteria 27277
328 Ga0068864_100003954 3300005618 Bacteria 12212
329 Ga0068864_100013544 3300005618 Bacteria 6761
330 Ga0068864_100020141 3300005618 Bacteria 5579
331 Ga0068864_100021896 3300005618 Bacteria 5358
332 Ga0068864_100024831 3300005618 Bacteria 5042
333 Ga0068864_100033272 3300005618 Bacteria 4382
334 Ga0068864_100045158 3300005618 Bacteria 3779
335 Ga0068864_100433880 3300005618 Bacteria 1254
336 Ga0068866_10023723 3300005718 Bacteria 2857
337 Ga0068866_10060476 3300005718 Bacteria 1964
338 Ga0068866_10107187 3300005718 Bacteria 1552
339 Ga0068851_10008573 3300005834 Bacteria 4730
340 Ga0068851_10020484 3300005834 Bacteria 3204
341 Ga0068851_10023154 3300005834 Bacteria 3033
342 Ga0068851_10031862 3300005834 Bacteria 2620
343 Ga0068851_10043074 3300005834 Bacteria 2274
344 Ga0068851_10059722 3300005834 Bacteria 1951
345 Ga0068851_10069226 3300005834 Bacteria 1822
346 Ga0068851_10072209 3300005834 Bacteria 1787
347 Ga0068851_10086911 3300005834 Bacteria 1641
348 Ga0068863_100002077 3300005841 Bacteria 19858
349 Ga0068863_100011329 3300005841 Bacteria 8635
350 Ga0068863_100024805 3300005841 Bacteria 5719
351 Ga0068863_100027016 3300005841 Bacteria 5474
352 Ga0068863_100035052 3300005841 Bacteria 4780
353 Ga0068863_100044564 3300005841 Bacteria 4210
354 Ga0068863_100047365 3300005841 Bacteria 4078
355 Ga0068858_100003680 3300005842 Bacteria 15192
356 Ga0068858_100024193 3300005842 Bacteria 5659
357 Ga0068858_100032495 3300005842 Bacteria 4845
358 Ga0068858_100046841 3300005842 Bacteria 4008
359 Ga0068860_100006012 3300005843 Bacteria 12215
360 Ga0068860_100021925 3300005843 Bacteria 6181
361 Ga0068860_100032628 3300005843 Bacteria 5002
362 Ga0068860_100033473 3300005843 Bacteria 4930
363 Ga0068860_100038805 3300005843 Bacteria 4556
364 Ga0068860_100421700 3300005843 Bacteria 1323
365 Ga0068860_100553751 3300005843 Bacteria 1152
366 Ga0068862_100033929 3300005844 Bacteria 4317
367 Ga0070717_10264670 3300006028 Bacteria 1522
368 Ga0075365_10228437 3300006038 Bacteria 1306
369 Ga0070716_100084613 3300006173 Bacteria 1903
370 Ga0070712_100016600 3300006175 Bacteria 4757
371 Ga0097621_100006129 3300006237 Bacteria 8515
372 Ga0097621_100079507 3300006237 Bacteria 2726
373 Ga0097621_100091908 3300006237 Bacteria 2541
374 Ga0068871_100007717 3300006358 Bacteria 7701
375 Ga0068871_100050766 3300006358 Bacteria 3355
376 Ga0068871_100051817 3300006358 Bacteria 3323
377 Ga0068871_100090661 3300006358 Bacteria 2546
378 Ga0068871_100109249 3300006358 Bacteria 2325
379 Ga0068871_100159617 3300006358 Bacteria 1928
380 Ga0075433_10006864 3300006852 Bacteria 9020
381 Ga0068865_100002284 3300006881 Bacteria 11291
382 Ga0068865_100006654 3300006881 Bacteria 7070
383 Ga0068865_100047444 3300006881 Bacteria 2951
384 Ga0097620_100002632 3300006931 Bacteria 18266
385 Ga0097620_100007420 3300006931 Bacteria 11132
386 Ga0097620_100016869 3300006931 Bacteria 7330
387 Ga0097620_100057714 3300006931 Bacteria 3910
388 Ga0097620_100059671 3300006931 Bacteria 3843
389 Ga0097620_100134171 3300006931 Bacteria 2547
390 Ga0097620_100225557 3300006931 Bacteria 1962
391 Ga0105250_10008325 3300009092 Bacteria 4413
392 Ga0105240_10010105 3300009093 Bacteria 13280
393 Ga0105240_10062213 3300009093 Bacteria 4648
394 Ga0105240_10159707 3300009093 Bacteria 2678
395 Ga0105240_10192964 3300009093 Bacteria 2393
396 Ga0105240_10289875 3300009093 Bacteria 1877
397 Ga0111539_10179624 3300009094 Bacteria 2472
398 Ga0105245_10002935 3300009098 Bacteria 15310
399 Ga0105245_10010933 3300009098 Bacteria 7896
400 Ga0105245_10056028 3300009098 Bacteria 3542
401 Ga0105245_10188470 3300009098 Bacteria 1974
402 Ga0105247_10190221 3300009101 Bacteria 1374
403 Ga0114129_10209942 3300009147 Bacteria 2633
404 Ga0105243_10029860 3300009148 Bacteria 4195
405 Ga0105243_10089411 3300009148 Bacteria 2532
406 Ga0105241_10017774 3300009174 Bacteria 5230
407 Ga0105241_10020264 3300009174 Bacteria 4912
408 Ga0105242_10070948 3300009176 Bacteria 2889
409 Ga0105242_10371764 3300009176 Bacteria 1326
410 Ga0105248_10000259 3300009177 Bacteria 62005
411 Ga0105248_10000552 3300009177 Bacteria 42448
412 Ga0105248_10001298 3300009177 Bacteria 27820
413 Ga0105248_10005830 3300009177 Bacteria 13540
414 Ga0105248_10014157 3300009177 Bacteria 8781
415 Ga0105248_10045074 3300009177 Bacteria 4945
416 Ga0105248_10061978 3300009177 Bacteria 4200
417 Ga0105248_10258855 3300009177 Bacteria 1959
418 Ga0105237_10036207 3300009545 Bacteria 4993
419 Ga0105237_10234938 3300009545 Bacteria 1834
420 Ga0105238_10005992 3300009551 Bacteria 12056
421 Ga0105238_10081961 3300009551 Bacteria 3216
422 Ga0105238_10102884 3300009551 Bacteria 2838
423 Ga0105238_10162395 3300009551 Bacteria 2210
424 Ga0105249_10020324 3300009553 Bacteria 5936
425 Ga0105239_10055953 3300010375 Bacteria 4327
426 Ga0105239_10550030 3300010375 Bacteria 1314
427 Ga0105246_10032217 3300011119 Bacteria 3475
428 Ga0157373_10022273 3300013100 Bacteria 4597
429 Ga0157373_10022789 3300013100 Bacteria 4541
430 Ga0157373_10051547 3300013100 Bacteria 2930
431 Ga0157373_10057609 3300013100 Bacteria 2756
432 Ga0157373_10059583 3300013100 Bacteria 2705
433 Ga0157373_10070567 3300013100 Bacteria 2469
434 Ga0157373_10083125 3300013100 Bacteria 2257
435 Ga0157373_10119028 3300013100 Bacteria 1856
436 Ga0157373_10124110 3300013100 Bacteria 1816
437 Ga0157373_10150206 3300013100 Bacteria 1639
438 Ga0157371_10004027 3300013102 Bacteria 13004
439 Ga0157371_10007641 3300013102 Bacteria 8717
440 Ga0157371_10010050 3300013102 Bacteria 7397
441 Ga0157371_10014756 3300013102 Bacteria 5880
442 Ga0157371_10062531 3300013102 Bacteria 2639
443 Ga0157371_10160140 3300013102 Bacteria 1607
444 Ga0157371_10340322 3300013102 Bacteria 1091
445 Ga0157370_10000244 3300013104 Bacteria 69583
446 Ga0157370_10021029 3300013104 Bacteria 6506
447 Ga0157370_10055025 3300013104 Bacteria 3792
448 Ga0157370_10116225 3300013104 Bacteria 2499
449 Ga0157370_10177514 3300013104 Bacteria 1980
450 Ga0157370_10263810 3300013104 Bacteria 1592
451 Ga0157370_10282783 3300013104 Bacteria 1533
452 Ga0157369_10001746 3300013105 Bacteria 26366
453 Ga0157369_10019876 3300013105 Bacteria 7514
454 Ga0157369_10038117 3300013105 Bacteria 5258
455 Ga0157369_10044996 3300013105 Bacteria 4803
456 Ga0157369_10056409 3300013105 Bacteria 4239
457 Ga0157369_10095254 3300013105 Bacteria 3177
458 Ga0157369_10115489 3300013105 Bacteria 2851
459 Ga0157369_10147001 3300013105 Bacteria 2492
460 Ga0157369_10225991 3300013105 Bacteria 1958
461 Ga0157369_10309734 3300013105 Bacteria 1642
462 Ga0157369_10531672 3300013105 Bacteria 1216
463 Ga0157374_10022995 3300013296 Bacteria 5567
464 Ga0157374_10106424 3300013296 Bacteria 2695
465 Ga0157374_10313202 3300013296 Bacteria 1554
466 Ga0157374_10315268 3300013296 Bacteria 1549
467 Ga0157374_10327602 3300013296 Bacteria 1519
468 Ga0157374_10442353 3300013296 Bacteria 1301
469 Ga0157378_10014131 3300013297 Bacteria 6986
470 Ga0157378_10086216 3300013297 Bacteria 2846
471 Ga0157378_10143056 3300013297 Bacteria 2222
472 Ga0157378_10169503 3300013297 Bacteria 2046
473 Ga0163162_10011397 3300013306 Bacteria 8669
474 Ga0163162_10048657 3300013306 Bacteria 4249
475 Ga0163162_10052428 3300013306 Bacteria 4097
476 Ga0163162_10088200 3300013306 Bacteria 3182
477 Ga0163162_10323466 3300013306 Bacteria 1675
478 Ga0163162_10465910 3300013306 Bacteria 1395
479 Ga0157372_10006288 3300013307 Bacteria 12631
480 Ga0157372_10007538 3300013307 Bacteria 11574
481 Ga0157372_10054863 3300013307 Bacteria 4448
482 Ga0157372_10063477 3300013307 Bacteria 4142
483 Ga0157372_10094379 3300013307 Bacteria 3406
484 Ga0157372_10116183 3300013307 Bacteria 3068
485 Ga0157372_10220039 3300013307 Bacteria 2201
486 Ga0157372_10287951 3300013307 Bacteria 1910
487 Ga0157372_10291604 3300013307 Bacteria 1897
488 Ga0157372_10395048 3300013307 Bacteria 1611
489 Ga0157372_10551460 3300013307 Bacteria 1344
490 Ga0157372_10751818 3300013307 Bacteria 1134
491 Ga0157375_10007050 3300013308 Bacteria 9817
492 Ga0157375_10109699 3300013308 Bacteria 2856
493 Ga0157375_10113595 3300013308 Bacteria 2809
494 Ga0157375_10634381 3300013308 Bacteria 1226
495 Ga0163163_10000178 3300014325 Bacteria 65511
496 Ga0163163_10000390 3300014325 Bacteria 41759
497 Ga0163163_10099667 3300014325 Bacteria 2927
498 Ga0157380_10049784 3300014326 Bacteria 3306
499 Ga0157377_10038726 3300014745 Bacteria 2634
500 Ga0157379_10014618 3300014968 Bacteria 6884
501 Ga0157379_10156407 3300014968 Bacteria 2057
502 Ga0157379_10159748 3300014968 Bacteria 2034
503 Ga0157376_10221663 3300014969 Bacteria 1752
504 Ga0207673_1000329 3300025290 Bacteria 4761
505 Ga0207697_10000253 3300025315 Bacteria 29506
506 Ga0207697_10024622 3300025315 Bacteria 2464
507 Ga0207697_10093178 3300025315 Bacteria 1278
508 Ga0207656_10004953 3300025321 Bacteria 4678
509 Ga0207656_10018146 3300025321 Bacteria 2765
510 Ga0207656_10025982 3300025321 Bacteria 2383
511 Ga0207656_10062208 3300025321 Bacteria 1640
512 Ga0207656_10107720 3300025321 Bacteria 1284
513 Ga0207682_10026841 3300025893 Bacteria 2292
514 Ga0207682_10040701 3300025893 Bacteria 1894
515 Ga0207642_10039013 3300025899 Bacteria 2060
516 Ga0207642_10100912 3300025899 Bacteria 1448
517 Ga0207710_10108572 3300025900 Bacteria 1316
518 Ga0207688_10000652 3300025901 Bacteria 17096
519 Ga0207688_10004204 3300025901 Bacteria 7852
520 Ga0207688_10014817 3300025901 Bacteria 4231
521 Ga0207680_10000868 3300025903 Bacteria 14275
522 Ga0207680_10001140 3300025903 Bacteria 12557
523 Ga0207680_10008481 3300025903 Bacteria 5046
524 Ga0207680_10017428 3300025903 Bacteria 3795
525 Ga0207680_10023077 3300025903 Bacteria 3392
526 Ga0207647_10000327 3300025904 Bacteria 38973
527 Ga0207647_10000721 3300025904 Bacteria 25921
528 Ga0207647_10000760 3300025904 Bacteria 25232
529 Ga0207647_10003308 3300025904 Bacteria 12103
530 Ga0207647_10047804 3300025904 Bacteria 2659
531 Ga0207647_10101967 3300025904 Bacteria 1702
532 Ga0207699_10006504 3300025906 Bacteria 5665
533 Ga0207645_10017300 3300025907 Bacteria 4762
534 Ga0207645_10071823 3300025907 Bacteria 2215
535 Ga0207645_10142958 3300025907 Bacteria 1559
536 Ga0207643_10124875 3300025908 Bacteria 1527
537 Ga0207705_10000234 3300025909 Bacteria 55024
538 Ga0207705_10000358 3300025909 Bacteria 41389
539 Ga0207705_10002566 3300025909 Bacteria 13964
540 Ga0207705_10004181 3300025909 Bacteria 10953
541 Ga0207705_10005492 3300025909 Bacteria 9483
542 Ga0207705_10006601 3300025909 Bacteria 8587
543 Ga0207705_10007357 3300025909 Bacteria 8093
544 Ga0207705_10007386 3300025909 Bacteria 8081
545 Ga0207705_10011403 3300025909 Bacteria 6435
546 Ga0207705_10011674 3300025909 Bacteria 6347
547 Ga0207705_10027535 3300025909 Bacteria 4053
548 Ga0207705_10038212 3300025909 Bacteria 3436
549 Ga0207705_10085063 3300025909 Bacteria 2310
550 Ga0207705_10289718 3300025909 Bacteria 1254
551 Ga0207654_10064375 3300025911 Bacteria 2155
552 Ga0207707_10003621 3300025912 Bacteria 13697
553 Ga0207707_10062067 3300025912 Bacteria 3252
554 Ga0207707_10105969 3300025912 Bacteria 2457
555 Ga0207707_10280726 3300025912 Bacteria 1443
556 Ga0207695_10008705 3300025913 Bacteria 12656
557 Ga0207695_10013260 3300025913 Bacteria 9834
558 Ga0207695_10159210 3300025913 Bacteria 2191
559 Ga0207671_10032582 3300025914 Bacteria 3878
560 Ga0207671_10132939 3300025914 Bacteria 1911
561 Ga0207671_10179252 3300025914 Bacteria 1648
562 Ga0207660_10000492 3300025917 Bacteria 26361
563 Ga0207660_10001664 3300025917 Bacteria 14894
564 Ga0207660_10008071 3300025917 Bacteria 6811
565 Ga0207660_10011001 3300025917 Bacteria 5884
566 Ga0207660_10019271 3300025917 Bacteria 4558
567 Ga0207660_10050146 3300025917 Bacteria 2963
568 Ga0207657_10000598 3300025919 Bacteria 38277
569 Ga0207657_10000857 3300025919 Bacteria 32134
570 Ga0207657_10003838 3300025919 Bacteria 15962
571 Ga0207657_10006329 3300025919 Bacteria 12297
572 Ga0207657_10009112 3300025919 Bacteria 10011
573 Ga0207657_10009165 3300025919 Bacteria 9984
574 Ga0207657_10009579 3300025919 Bacteria 9724
575 Ga0207657_10009649 3300025919 Bacteria 9685
576 Ga0207657_10011706 3300025919 Bacteria 8692
577 Ga0207657_10012777 3300025919 Bacteria 8267
578 Ga0207657_10017703 3300025919 Bacteria 6823
579 Ga0207657_10022817 3300025919 Bacteria 5844
580 Ga0207657_10023805 3300025919 Bacteria 5693
581 Ga0207657_10031781 3300025919 Bacteria 4776
582 Ga0207657_10066704 3300025919 Bacteria 3062
583 Ga0207657_10107656 3300025919 Bacteria 2305
584 Ga0207657_10129961 3300025919 Bacteria 2065
585 Ga0207657_10238791 3300025919 Bacteria 1451
586 Ga0207649_10000159 3300025920 Bacteria 54703
587 Ga0207649_10002045 3300025920 Bacteria 11469
588 Ga0207649_10010001 3300025920 Bacteria 5201
589 Ga0207649_10018675 3300025920 Bacteria 3948
590 Ga0207649_10027881 3300025920 Bacteria 3320
591 Ga0207649_10034775 3300025920 Bacteria 3022
592 Ga0207649_10040105 3300025920 Bacteria 2843
593 Ga0207649_10064254 3300025920 Bacteria 2320
594 Ga0207649_10137728 3300025920 Bacteria 1666
595 Ga0207649_10248815 3300025920 Bacteria 1279
596 Ga0207652_10005719 3300025921 Bacteria 10095
597 Ga0207652_10010205 3300025921 Bacteria 7560
598 Ga0207652_10032849 3300025921 Bacteria 4366
599 Ga0207652_10131636 3300025921 Bacteria 2231
600 Ga0207652_10173625 3300025921 Bacteria 1935
601 Ga0207652_10178043 3300025921 Bacteria 1910
602 Ga0207681_10005247 3300025923 Bacteria 7960
603 Ga0207681_10012088 3300025923 Bacteria 5319
604 Ga0207694_10004611 3300025924 Bacteria 10730
605 Ga0207694_10023671 3300025924 Bacteria 4662
606 Ga0207694_10048231 3300025924 Bacteria 3295
607 Ga0207694_10053518 3300025924 Bacteria 3130
608 Ga0207694_10073372 3300025924 Bacteria 2677
609 Ga0207650_10002087 3300025925 Bacteria 13979
610 Ga0207650_10004458 3300025925 Bacteria 9566
611 Ga0207650_10020275 3300025925 Bacteria 4687
612 Ga0207650_10057717 3300025925 Bacteria 2888
613 Ga0207650_10091860 3300025925 Bacteria 2320
614 Ga0207650_10106975 3300025925 Bacteria 2160
615 Ga0207659_10042325 3300025926 Bacteria 3193
616 Ga0207659_10045438 3300025926 Bacteria 3097
617 Ga0207687_10003036 3300025927 Bacteria 11376
618 Ga0207687_10186033 3300025927 Bacteria 1613
619 Ga0207700_10144907 3300025928 Bacteria 1956
620 Ga0207700_10505777 3300025928 Bacteria 1069
621 Ga0207664_10013789 3300025929 Bacteria 5816
622 Ga0207664_10017647 3300025929 Bacteria 5237
623 Ga0207664_10024615 3300025929 Bacteria 4525
624 Ga0207664_10161669 3300025929 Bacteria 1910
625 Ga0207664_10205809 3300025929 Bacteria 1700
626 Ga0207664_10267396 3300025929 Bacteria 1497
627 Ga0207644_10000465 3300025931 Bacteria 26250
628 Ga0207644_10000576 3300025931 Bacteria 23579
629 Ga0207644_10000983 3300025931 Bacteria 18207
630 Ga0207644_10005885 3300025931 Bacteria 7996
631 Ga0207644_10021402 3300025931 Bacteria 4404
632 Ga0207644_10072265 3300025931 Bacteria 2526
633 Ga0207644_10127453 3300025931 Bacteria 1944
634 Ga0207644_10162834 3300025931 Bacteria 1735
635 Ga0207644_10262101 3300025931 Bacteria 1382
636 Ga0207644_10307008 3300025931 Bacteria 1280
637 Ga0207690_10000120 3300025932 Bacteria 65338
638 Ga0207690_10001585 3300025932 Bacteria 14215
639 Ga0207690_10001987 3300025932 Bacteria 12527
640 Ga0207690_10002341 3300025932 Bacteria 11505
641 Ga0207690_10009049 3300025932 Bacteria 5911
642 Ga0207690_10017503 3300025932 Bacteria 4377
643 Ga0207690_10020955 3300025932 Bacteria 4047
644 Ga0207690_10029684 3300025932 Bacteria 3480
645 Ga0207690_10057388 3300025932 Bacteria 2630
646 Ga0207690_10075592 3300025932 Bacteria 2336
647 Ga0207690_10100997 3300025932 Bacteria 2060
648 Ga0207690_10114103 3300025932 Bacteria 1951
649 Ga0207690_10432678 3300025932 Bacteria 1054
650 Ga0207706_10000200 3300025933 Bacteria 65947
651 Ga0207706_10000904 3300025933 Bacteria 30508
652 Ga0207706_10001168 3300025933 Bacteria 26635
653 Ga0207706_10003074 3300025933 Bacteria 16047
654 Ga0207706_10003639 3300025933 Bacteria 14720
655 Ga0207706_10008292 3300025933 Bacteria 9581
656 Ga0207706_10015445 3300025933 Bacteria 6898
657 Ga0207706_10016651 3300025933 Bacteria 6634
658 Ga0207706_10036707 3300025933 Bacteria 4352
659 Ga0207706_10090804 3300025933 Bacteria 2685
660 Ga0207706_10095256 3300025933 Bacteria 2618
661 Ga0207706_10145010 3300025933 Bacteria 2089
662 Ga0207706_10173165 3300025933 Bacteria 1896
663 Ga0207706_10227721 3300025933 Bacteria 1631
664 Ga0207706_10252518 3300025933 Bacteria 1540
665 Ga0207706_10275983 3300025933 Bacteria 1466
666 Ga0207706_10290059 3300025933 Bacteria 1426
667 Ga0207686_10017230 3300025934 Bacteria 4068
668 Ga0207686_10024382 3300025934 Bacteria 3506
669 Ga0207709_10031799 3300025935 Bacteria 3086
670 Ga0207709_10066790 3300025935 Bacteria 2267
671 Ga0207709_10118424 3300025935 Bacteria 1784
672 Ga0207669_10010514 3300025937 Bacteria 4458
673 Ga0207669_10028380 3300025937 Bacteria 3078
674 Ga0207669_10112711 3300025937 Bacteria 1827
675 Ga0207704_10003953 3300025938 Bacteria 6742
676 Ga0207704_10019399 3300025938 Bacteria 3570
677 Ga0207704_10039360 3300025938 Bacteria 2752
678 Ga0207665_10018962 3300025939 Bacteria 4519
679 Ga0207691_10000743 3300025940 Bacteria 32192
680 Ga0207691_10008733 3300025940 Bacteria 9718
681 Ga0207691_10011096 3300025940 Bacteria 8649
682 Ga0207691_10023264 3300025940 Bacteria 5833
683 Ga0207691_10076123 3300025940 Bacteria 3025
684 Ga0207691_10088170 3300025940 Bacteria 2783
685 Ga0207691_10114833 3300025940 Bacteria 2392
686 Ga0207691_10149440 3300025940 Bacteria 2054
687 Ga0207691_10176534 3300025940 Bacteria 1868
688 Ga0207711_10000046 3300025941 Bacteria 153238
689 Ga0207711_10000180 3300025941 Bacteria 68214
690 Ga0207711_10001359 3300025941 Bacteria 23095
691 Ga0207711_10002324 3300025941 Bacteria 17040
692 Ga0207711_10004487 3300025941 Bacteria 11896
693 Ga0207711_10018147 3300025941 Bacteria 5850
694 Ga0207711_10020483 3300025941 Bacteria 5515
695 Ga0207711_10021803 3300025941 Bacteria 5350
696 Ga0207711_10038404 3300025941 Bacteria 4071
697 Ga0207689_10000372 3300025942 Bacteria 42301
698 Ga0207689_10003887 3300025942 Bacteria 13614
699 Ga0207689_10012648 3300025942 Bacteria 7211
700 Ga0207689_10287052 3300025942 Bacteria 1363
701 Ga0207661_10002690 3300025944 Bacteria 12221
702 Ga0207661_10004435 3300025944 Bacteria 9853
703 Ga0207661_10015252 3300025944 Bacteria 5650
704 Ga0207661_10069119 3300025944 Bacteria 2878
705 Ga0207679_10000150 3300025945 Bacteria 57426
706 Ga0207679_10001640 3300025945 Bacteria 13955
707 Ga0207679_10002544 3300025945 Bacteria 11241
708 Ga0207679_10021124 3300025945 Bacteria 4405
709 Ga0207679_10070120 3300025945 Bacteria 2640
710 Ga0207679_10115721 3300025945 Bacteria 2125
711 Ga0207679_10160847 3300025945 Bacteria 1838
712 Ga0207679_10173026 3300025945 Bacteria 1779
713 Ga0207679_10260987 3300025945 Bacteria 1477
714 Ga0207679_10372260 3300025945 Bacteria 1250
715 Ga0207667_10000443 3300025949 Bacteria 55591
716 Ga0207667_10003333 3300025949 Bacteria 19825
717 Ga0207667_10012934 3300025949 Bacteria 9585
718 Ga0207667_10021932 3300025949 Bacteria 7070
719 Ga0207667_10025695 3300025949 Bacteria 6443
720 Ga0207667_10031216 3300025949 Bacteria 5753
721 Ga0207667_10078617 3300025949 Bacteria 3419
722 Ga0207667_10144912 3300025949 Bacteria 2445
723 Ga0207667_10263510 3300025949 Bacteria 1762
724 Ga0207667_10267869 3300025949 Bacteria 1746
725 Ga0207667_10301942 3300025949 Bacteria 1636
726 Ga0207651_10000440 3300025960 Bacteria 17582
727 Ga0207651_10000948 3300025960 Bacteria 12795
728 Ga0207651_10002871 3300025960 Bacteria 8310
729 Ga0207651_10011648 3300025960 Bacteria 4932
730 Ga0207651_10021677 3300025960 Bacteria 3910
731 Ga0207651_10145045 3300025960 Bacteria 1839
732 Ga0207712_10008941 3300025961 Bacteria 6334
733 Ga0207668_10007965 3300025972 Bacteria 6305
734 Ga0207668_10020110 3300025972 Bacteria 4234
735 Ga0207668_10022332 3300025972 Bacteria 4049
736 Ga0207668_10049931 3300025972 Bacteria 2879
737 Ga0207668_10210660 3300025972 Bacteria 1554
738 Ga0207640_10005654 3300025981 Bacteria 6815
739 Ga0207640_10006004 3300025981 Bacteria 6637
740 Ga0207640_10006829 3300025981 Bacteria 6275
741 Ga0207640_10013558 3300025981 Bacteria 4678
742 Ga0207640_10022603 3300025981 Bacteria 3766
743 Ga0207640_10105811 3300025981 Bacteria 1983
744 Ga0207640_10125134 3300025981 Bacteria 1849
745 Ga0207640_10152519 3300025981 Bacteria 1699
746 Ga0207658_10003399 3300025986 Bacteria 11265
747 Ga0207658_10017854 3300025986 Bacteria 4889
748 Ga0207658_10019518 3300025986 Bacteria 4688
749 Ga0207658_10020213 3300025986 Bacteria 4611
750 Ga0207658_10035707 3300025986 Bacteria 3561
751 Ga0207658_10125603 3300025986 Bacteria 2052
752 Ga0207658_10161408 3300025986 Bacteria 1837
753 Ga0207658_10167734 3300025986 Bacteria 1805
754 Ga0207658_10196149 3300025986 Bacteria 1682
755 Ga0207658_10206033 3300025986 Bacteria 1645
756 Ga0207658_10244723 3300025986 Bacteria 1521
757 Ga0207677_10002330 3300026023 Bacteria 9965
758 Ga0207677_10007174 3300026023 Bacteria 6139
759 Ga0207677_10009152 3300026023 Bacteria 5561
760 Ga0207677_10016631 3300026023 Bacteria 4362
761 Ga0207677_10025806 3300026023 Bacteria 3672
762 Ga0207677_10086342 3300026023 Bacteria 2268
763 Ga0207677_10160019 3300026023 Bacteria 1748
764 Ga0207677_10186394 3300026023 Bacteria 1637
765 Ga0207677_10266936 3300026023 Bacteria 1398
766 Ga0207703_10003193 3300026035 Bacteria 13798
767 Ga0207703_10003515 3300026035 Bacteria 13109
768 Ga0207703_10004332 3300026035 Bacteria 11666
769 Ga0207703_10006456 3300026035 Bacteria 9367
770 Ga0207703_10009190 3300026035 Bacteria 7775
771 Ga0207703_10079764 3300026035 Bacteria 2725
772 Ga0207639_10000282 3300026041 Bacteria 36549
773 Ga0207639_10000575 3300026041 Bacteria 25298
774 Ga0207639_10004242 3300026041 Bacteria 9661
775 Ga0207639_10005382 3300026041 Bacteria 8654
776 Ga0207639_10026353 3300026041 Bacteria 4225
777 Ga0207639_10046502 3300026041 Bacteria 3275
778 Ga0207639_10077066 3300026041 Bacteria 2627
779 Ga0207639_10081743 3300026041 Bacteria 2559
780 Ga0207639_10100488 3300026041 Bacteria 2337
781 Ga0207639_10165280 3300026041 Bacteria 1869
782 Ga0207678_10000308 3300026067 Bacteria 43995
783 Ga0207678_10000922 3300026067 Bacteria 26916
784 Ga0207678_10003197 3300026067 Bacteria 14818
785 Ga0207678_10003750 3300026067 Bacteria 13676
786 Ga0207678_10005778 3300026067 Bacteria 11030
787 Ga0207678_10006486 3300026067 Bacteria 10382
788 Ga0207678_10020582 3300026067 Bacteria 5784
789 Ga0207678_10032097 3300026067 Bacteria 4578
790 Ga0207678_10070332 3300026067 Bacteria 3001
791 Ga0207678_10093779 3300026067 Bacteria 2565
792 Ga0207678_10134952 3300026067 Bacteria 2106
793 Ga0207678_10141796 3300026067 Bacteria 2051
794 Ga0207702_10001142 3300026078 Bacteria 27150
795 Ga0207702_10006961 3300026078 Bacteria 9683
796 Ga0207702_10011481 3300026078 Bacteria 7381
797 Ga0207702_10013433 3300026078 Bacteria 6807
798 Ga0207702_10028125 3300026078 Bacteria 4671
799 Ga0207702_10097720 3300026078 Bacteria 2585
800 Ga0207702_10244568 3300026078 Bacteria 1682
801 Ga0207702_10267100 3300026078 Bacteria 1613
802 Ga0207702_10281323 3300026078 Bacteria 1573
803 Ga0207702_10462319 3300026078 Bacteria 1233
804 Ga0207641_10001374 3300026088 Bacteria 24044
805 Ga0207641_10011379 3300026088 Bacteria 7300
806 Ga0207641_10024227 3300026088 Bacteria 5003
807 Ga0207641_10037506 3300026088 Bacteria 4048
808 Ga0207641_10051069 3300026088 Bacteria 3501
809 Ga0207641_10057135 3300026088 Bacteria 3318
810 Ga0207641_10136515 3300026088 Bacteria 2208
811 Ga0207641_10197594 3300026088 Bacteria 1852
812 Ga0207641_10204559 3300026088 Bacteria 1822
813 Ga0207641_10533979 3300026088 Bacteria 1142
814 Ga0207648_10005163 3300026089 Bacteria 13222
815 Ga0207648_10006762 3300026089 Bacteria 11369
816 Ga0207648_10010607 3300026089 Bacteria 8713
817 Ga0207648_10023837 3300026089 Bacteria 5473
818 Ga0207648_10034713 3300026089 Bacteria 4445
819 Ga0207648_10127986 3300026089 Bacteria 2234
820 Ga0207676_10000345 3300026095 Bacteria 39937
821 Ga0207676_10003004 3300026095 Bacteria 12027
822 Ga0207676_10010005 3300026095 Bacteria 6748
823 Ga0207676_10022819 3300026095 Bacteria 4607
824 Ga0207676_10041875 3300026095 Bacteria 3519
825 Ga0207676_10156047 3300026095 Bacteria 1972
826 Ga0207676_10293230 3300026095 Bacteria 1482
827 Ga0207674_10000626 3300026116 Bacteria 46240
828 Ga0207674_10002709 3300026116 Bacteria 22117
829 Ga0207674_10003151 3300026116 Bacteria 20330
830 Ga0207674_10009232 3300026116 Bacteria 11304
831 Ga0207674_10010257 3300026116 Bacteria 10631
832 Ga0207674_10014114 3300026116 Bacteria 8825
833 Ga0207674_10032785 3300026116 Bacteria 5445
834 Ga0207674_10087334 3300026116 Bacteria 3112
835 Ga0207674_10164107 3300026116 Bacteria 2176
836 Ga0207674_10356270 3300026116 Bacteria 1414
837 Ga0207683_10007119 3300026121 Bacteria 9588
838 Ga0207683_10016962 3300026121 Bacteria 6199
839 Ga0207683_10021172 3300026121 Bacteria 5565
840 Ga0207683_10061758 3300026121 Bacteria 3298
841 Ga0207683_10247156 3300026121 Bacteria 1628
842 Ga0207698_10000784 3300026142 Bacteria 18494
843 Ga0207698_10005935 3300026142 Bacteria 7586
844 Ga0207698_10006585 3300026142 Bacteria 7262
845 Ga0207698_10012795 3300026142 Bacteria 5509
846 Ga0207698_10015102 3300026142 Bacteria 5161
847 Ga0207698_10015599 3300026142 Bacteria 5093
848 Ga0207698_10017902 3300026142 Bacteria 4817
849 Ga0207698_10019275 3300026142 Bacteria 4667
850 Ga0207698_10026612 3300026142 Bacteria 4094
851 Ga0207698_10035651 3300026142 Bacteria 3642
852 Ga0207698_10100464 3300026142 Bacteria 2396
853 Ga0207698_10140538 3300026142 Bacteria 2079
854 Ga0207698_10145087 3300026142 Bacteria 2051
855 Ga0268266_10002013 3300028379 Bacteria 22668
856 Ga0268266_10007932 3300028379 Bacteria 9500
857 Ga0268266_10010566 3300028379 Bacteria 8056
858 Ga0268266_10044073 3300028379 Bacteria 3812
859 Ga0268266_10082403 3300028379 Bacteria 2806
860 Ga0268266_10091553 3300028379 Bacteria 2666
861 Ga0268266_10163677 3300028379 Bacteria 2014
862 Ga0268265_10477990 3300028380 Bacteria 1169
863 Ga0268264_10001241 3300028381 Bacteria 24400
864 Ga0268264_10002725 3300028381 Bacteria 15417
865 Ga0268264_10023296 3300028381 Bacteria 5051
866 Ga0268264_10077953 3300028381 Bacteria 2824
867 Ga0307408_100009676 3300031548 Bacteria 6356
868 Ga0307408_100123111 3300031548 Bacteria 2012
869 Ga0307405_10010277 3300031731 Bacteria 4838
870 Ga0307405_10010987 3300031731 Bacteria 4721
871 Ga0307413_10002319 3300031824 Bacteria 7717
872 Ga0307413_10007106 3300031824 Bacteria 5170
873 Ga0307413_10087895 3300031824 Bacteria 2015
874 Ga0307413_10102039 3300031824 Bacteria 1898
875 Ga0307410_10026635 3300031852 Bacteria 3643
876 Ga0307410_10077375 3300031852 Bacteria 2325
877 Ga0307410_10102294 3300031852 Bacteria 2055
878 Ga0307410_10116739 3300031852 Bacteria 1939
879 Ga0307410_10146371 3300031852 Bacteria 1753
880 Ga0307410_10149796 3300031852 Bacteria 1736
881 Ga0307410_10375048 3300031852 Bacteria 1143
882 Ga0307406_10004669 3300031901 Bacteria 7463
883 Ga0307406_10007300 3300031901 Bacteria 6122
884 Ga0307406_10123787 3300031901 Bacteria 1802
885 Ga0307407_10004184 3300031903 Bacteria 6082
886 Ga0307407_10065349 3300031903 Bacteria 2141
887 Ga0307407_10146472 3300031903 Bacteria 1530
888 Ga0307407_10215088 3300031903 Bacteria 1296
889 Ga0307412_10053357 3300031911 Bacteria 2679
890 Ga0307412_10073040 3300031911 Bacteria 2346
891 Ga0307412_10096850 3300031911 Bacteria 2077
892 Ga0307412_10226562 3300031911 Bacteria 1436
893 Ga0307409_100001300 3300031995 Bacteria 12107
894 Ga0307409_100059765 3300031995 Bacteria 2968
895 Ga0307409_100087559 3300031995 Bacteria 2538
896 Ga0307409_100167999 3300031995 Bacteria 1927
897 Ga0307409_100263363 3300031995 Bacteria 1583
898 Ga0307416_100192187 3300032002 Bacteria 1926
899 Ga0307414_10042383 3300032004 Bacteria 3092
900 Ga0307414_10049770 3300032004 Bacteria 2899
901 Ga0307414_10055305 3300032004 Bacteria 2778
902 Ga0307414_10085465 3300032004 Bacteria 2324
903 Ga0307414_10108042 3300032004 Bacteria 2109
904 Ga0307414_10213137 3300032004 Bacteria 1580
905 Ga0307411_10007859 3300032005 Bacteria 5476
906 Ga0307411_10018510 3300032005 Bacteria 3997
907 Ga0307411_10020037 3300032005 Bacteria 3880
908 Ga0307411_10064942 3300032005 Bacteria 2445
909 Ga0307411_10092479 3300032005 Bacteria 2115
910 Ga0307411_10158276 3300032005 Bacteria 1692
911 Ga0307415_100061867 3300032126 Bacteria 2594
912 Ga0307415_100082575 3300032126 Bacteria 2299
913 Ga0373929_0024968 3300035085 Bacteria 1238
914 Ga0373951_0011121 3300035091 Bacteria 2019
915 Ga0373923_0002404 3300035111 Bacteria 5755
916 Ga0373953_0043019 3300035117 Bacteria 1802
917 Ga0373954_0005957 3300035118 Bacteria 5304
918 Ga0373956_0004932 3300035119 Bacteria 5346
919 Ga0373960_0013735 3300035121 Bacteria 2039
920 Ga0373960_0068676 3300035121 Bacteria 1091
921 Ga0373943_0007620 3300035170 Bacteria 4862
922 Ga0373946_0060311 3300035171 Bacteria 1612
923 Ga0373931_0015017 3300035691 Bacteria 3795
924 Ga0373931_0034447 3300035691 Bacteria 2628
925 Ga0373935_0046594 3300035692 Bacteria 2739
926 Ga0373933_0023071 3300035724 Bacteria 3551
927 Ga0373937_0006891 3300036401 Bacteria 9806
928 Ga0395899_0000154 3300037312 Bacteria 104239
929 Ga0395899_0004539 3300037312 Bacteria 10816
930 Ga0395899_0005481 3300037312 Bacteria 9840
931 Ga0395899_0044297 3300037312 Bacteria 3317
932 Ga0395899_0060832 3300037312 Bacteria 2782
933 Ga0395899_0205936 3300037312 Bacteria 1369
934 Ga0395899_0214948 3300037312 Bacteria 1334
935 Ga0395899_0375849 3300037312 Bacteria 945
936 Ga0395900_0000693 3300037418 Bacteria 44924
937 Ga0395900_0008741 3300037418 Bacteria 10404
938 Ga0395900_0013334 3300037418 Bacteria 8403
939 Ga0395900_0017712 3300037418 Bacteria 7271
940 Ga0395900_0017735 3300037418 Bacteria 7264
941 Ga0395900_0018640 3300037418 Bacteria 7077
942 Ga0395900_0019949 3300037418 Bacteria 6833
943 Ga0395900_0024041 3300037418 Bacteria 6235
944 Ga0395900_0032829 3300037418 Bacteria 5339
945 Ga0395900_0035424 3300037418 Bacteria 5140
946 Ga0395900_0053893 3300037418 Bacteria 4140
947 Ga0395900_0093293 3300037418 Bacteria 3092
948 Ga0395900_0125103 3300037418 Bacteria 2636
949 Ga0395900_0128521 3300037418 Bacteria 2597
950 Ga0395900_0137501 3300037418 Bacteria 2503
951 Ga0395900_0141068 3300037418 Bacteria 2468
952 Ga0395900_0235903 3300037418 Bacteria 1837
953 Ga0395900_0381375 3300037418 Bacteria 1377
954 Ga0395900_0531919 3300037418 Bacteria 1122
955 Ga0395900_0542004 3300037418 Bacteria 1109
956 Ga0395898_0000219 3300037466 Bacteria 146838
957 Ga0395898_0003150 3300037466 Bacteria 18629
958 Ga0395898_0011525 3300037466 Bacteria 9181
959 Ga0395898_0028917 3300037466 Bacteria 5554
960 Ga0395898_0044222 3300037466 Bacteria 4386
961 Ga0395898_0139632 3300037466 Bacteria 2319
962 Ga0395898_0161645 3300037466 Bacteria 2142
963 Ga0395898_0391789 3300037466 Bacteria 1324
964 Ga0395898_0457929 3300037466 Bacteria 1214
965 Ga0395898_0492332 3300037466 Bacteria 1166
966 Ga0395898_0576639 3300037466 Bacteria 1067
967 Ga0395905_0000092 3300037471 Bacteria 149300
968 Ga0395905_0000094 3300037471 Bacteria 147776
969 Ga0395905_0000852 3300037471 Bacteria 39836
970 Ga0395905_0002924 3300037471 Bacteria 18610
971 Ga0395905_0003007 3300037471 Bacteria 18277
972 Ga0395905_0006376 3300037471 Bacteria 11890
973 Ga0395905_0007325 3300037471 Bacteria 10994
974 Ga0395905_0016407 3300037471 Bacteria 7038
975 Ga0395905_0023273 3300037471 Bacteria 5857
976 Ga0395905_0030575 3300037471 Bacteria 5072
977 Ga0395905_0035913 3300037471 Bacteria 4654
978 Ga0395905_0036031 3300037471 Bacteria 4646
979 Ga0395905_0043579 3300037471 Bacteria 4209
980 Ga0395905_0047189 3300037471 Bacteria 4038
981 Ga0395905_0053649 3300037471 Bacteria 3772
982 Ga0395905_0059302 3300037471 Bacteria 3577
983 Ga0395905_0061719 3300037471 Bacteria 3506
984 Ga0395905_0065621 3300037471 Bacteria 3398
985 Ga0395905_0090231 3300037471 Bacteria 2873
986 Ga0395905_0103498 3300037471 Bacteria 2673
987 Ga0395905_0110229 3300037471 Bacteria 2585
988 Ga0395905_0113367 3300037471 Bacteria 2547
989 Ga0395905_0206945 3300037471 Bacteria 1839
990 Ga0395905_0220395 3300037471 Bacteria 1775
991 Ga0395905_0434003 3300037471 Bacteria 1210
992 Ga0395905_0453377 3300037471 Bacteria 1181
993 Ga0395901_0000188 3300038443 Bacteria 78908
994 Ga0395901_0000507 3300038443 Bacteria 45109
995 Ga0395901_0001734 3300038443 Bacteria 22531
996 Ga0395901_0003296 3300038443 Bacteria 16247
997 Ga0395901_0009770 3300038443 Bacteria 9730
998 Ga0395901_0015074 3300038443 Bacteria 7862
999 Ga0395901_0021001 3300038443 Bacteria 6688
1000 Ga0395901_0080704 3300038443 Bacteria 3397
1001 Ga0395901_0141591 3300038443 Bacteria 2527
1002 Ga0395901_0151762 3300038443 Bacteria 2434
1003 Ga0395901_0162705 3300038443 Bacteria 2343
1004 Ga0395901_0307023 3300038443 Bacteria 1644
1005 Ga0395901_0415575 3300038443 Bacteria 1380
1006 Ga0395901_0450227 3300038443 Bacteria 1317
1007 Ga0395901_0616340 3300038443 Bacteria 1092
1008 Ga0439465_0028344 3300041413 Bacteria 1775
1009 Ga0450890_007831 3300042127 Bacteria 1367
1010 Ga0450905_001689 3300042142 Bacteria 2817
1011 Ga0450889_000128 3300042144 Bacteria 7543
1012 Ga0439464_0002724 3300042439 Bacteria 4383
1013 Ga0466969_0011352 3300044656 Bacteria 4717
1014 Ga0466969_0066701 3300044656 Bacteria 1737
1015 Ga0466969_0093978 3300044656 Bacteria 1418
1016 Ga0466972_0027065 3300044658 Bacteria 2839
1017 Ga0466965_0010766 3300044683 Bacteria 4278
1018 Ga0466966_0013181 3300044684 Bacteria 5474
1019 Ga0466966_0020457 3300044684 Bacteria 4351
1020 Ga0466966_0023239 3300044684 Bacteria 4061
1021 Ga0466966_0040569 3300044684 Bacteria 2995
1022 Ga0466966_0064060 3300044684 Bacteria 2315
1023 Ga0466966_0124432 3300044684 Bacteria 1582
1024 Ga0466961_0004087 3300044693 Bacteria 9116
1025 Ga0466961_0013315 3300044693 Bacteria 5265
1026 Ga0466961_0026732 3300044693 Bacteria 3711
1027 Ga0466961_0041344 3300044693 Bacteria 2955
1028 Ga0466961_0047785 3300044693 Bacteria 2736
1029 Ga0466963_0004916 3300044694 Bacteria 7792
1030 Ga0466963_0007678 3300044694 Bacteria 6441
1031 Ga0466963_0027267 3300044694 Bacteria 3656
1032 Ga0466963_0093375 3300044694 Bacteria 2051
1033 Ga0466963_0103123 3300044694 Bacteria 1954
1034 Ga0466963_0165658 3300044694 Bacteria 1539
1035 Ga0466963_0250873 3300044694 Bacteria 1242
1036 Ga0466963_0302683 3300044694 Bacteria 1124
1037 Ga0466964_0004752 3300044706 Bacteria 5020
1038 Ga0466968_0002299 3300044735 Bacteria 6981
1039 Ga0466970_0009898 3300044765 Bacteria 4827
1040 Ga0466970_0134557 3300044765 Bacteria 1359
1041 Ga0466957_0000920 3300044842 Bacteria 15076
1042 Ga0466957_0005624 3300044842 Bacteria 7048
1043 Ga0466957_0242026 3300044842 Bacteria 1197
1044 Ga0466959_0009503 3300045049 Bacteria 6918
1045 Ga0466959_0158921 3300045049 Bacteria 1589
1046 Ga0466959_0214622 3300045049 Bacteria 1336
1047 Ga0466959_0269973 3300045049 Bacteria 1169
1048 Ga0466958_0011152 3300045836 Bacteria 5056
1049 Ga0466958_0074060 3300045836 Bacteria 2086
1050 Ga0466958_0094865 3300045836 Bacteria 1849
1051 Ga0466967_0000246 3300045976 Bacteria 23831
1052 Ga0466967_0001231 3300045976 Bacteria 14453
1053 Ga0466967_0003991 3300045976 Bacteria 9831
1054 Ga0466967_0018065 3300045976 Bacteria 5625
1055 Ga0466967_0018752 3300045976 Bacteria 5542
1056 Ga0466967_0020581 3300045976 Bacteria 5337
1057 Ga0466967_0037216 3300045976 Bacteria 4162
1058 Ga0466967_0054765 3300045976 Bacteria 3512
1059 Ga0466967_0084834 3300045976 Bacteria 2867
1060 Ga0466967_0114513 3300045976 Bacteria 2482
1061 Ga0466967_0129264 3300045976 Bacteria 2343
1062 Ga0466967_0136466 3300045976 Bacteria 2281
1063 Ga0466967_0190063 3300045976 Bacteria 1940
1064 Ga0466967_0220014 3300045976 Bacteria 1804
1065 Ga0466967_0363593 3300045976 Bacteria 1402
1066 Ga0466967_0525538 3300045976 Bacteria 1163
1067 Ga0466967_0611840 3300045976 Bacteria 1076
1068 Ga0495580_0073098 3300046472 Bacteria 2394
1069 Ga0495583_0034431 3300046506 Bacteria 2426
1070 Ga0495663_0019794 3300046525 Bacteria 1929
1071 Ga0495598_0000109 3300046537 Bacteria 13624
1072 Ga0495621_0000006 3300046539 Bacteria 44306
1073 Ga0495668_0004223 3300046616 Bacteria 10344
1074 Ga0495668_0012923 3300046616 Bacteria 4944
1075 Ga0495625_0058802 3300046660 Bacteria 2730
1076 Ga0495647_0023421 3300046681 Bacteria 2239
1077 Ga0495669_0001413 3300046684 Bacteria 9880
1078 Ga0495669_0011162 3300046684 Bacteria 3809
1079 Ga0495669_0013009 3300046684 Bacteria 3545
1080 Ga0495669_0013659 3300046684 Bacteria 3465
1081 Ga0495669_0023292 3300046684 Bacteria 2694
1082 Ga0495670_0000226 3300046691 Bacteria 25540
1083 Ga0495685_033696 3300047447 Bacteria 1760
1084 Ga0495602_0015737 3300048088 Bacteria 7622
1085 Ga0496100_0003020 3300048903 Bacteria 8680
1086 Ga0496101_0001518 3300048904 Bacteria 13895
1087 Ga0496101_0022576 3300048904 Bacteria 4334
1088 Ga0496102_0044340 3300048905 Bacteria 4036
1089 Ga0496102_0045428 3300048905 Bacteria 3988
1090 Ga0496102_0070593 3300048905 Bacteria 3207
1091 Ga0496103_0003133 3300048906 Bacteria 10171
1092 Ga0496103_0007254 3300048906 Bacteria 6606
1093 Ga0496103_0082776 3300048906 Bacteria 2020
1094 Ga0496103_0172261 3300048906 Bacteria 1390
1095 Ga0496104_0090460 3300048907 Bacteria 2925
1096 Ga0496105_0227975 3300048908 Bacteria 1515
1097 Ga0496106_0019463 3300048909 Bacteria 5036
1098 Ga0496106_0019602 3300048909 Bacteria 5018
1099 Ga0496106_0206728 3300048909 Bacteria 1563
1100 Ga0496107_0003029 3300048910 Bacteria 11134
1101 Ga0496107_0149276 3300048910 Bacteria 1729
1102 Ga0496107_0158998 3300048910 Bacteria 1674
1103 Ga0496108_0004268 3300048911 Bacteria 11512
1104 Ga0496108_0004494 3300048911 Bacteria 11233
1105 Ga0496108_0004878 3300048911 Bacteria 10829
1106 Ga0496108_0011132 3300048911 Bacteria 7308
1107 Ga0496108_0027216 3300048911 Bacteria 4719
1108 Ga0496109_0006265 3300048912 Bacteria 10007
1109 Ga0496109_0008390 3300048912 Bacteria 8781
1110 Ga0496109_0026963 3300048912 Bacteria 5125
1111 Ga0496109_0051055 3300048912 Bacteria 3766
1112 Ga0496109_0106753 3300048912 Bacteria 2601
1113 Ga0496109_0354194 3300048912 Bacteria 1387
1114 Ga0496110_0001279 3300048913 Bacteria 18019
1115 Ga0496110_0008312 3300048913 Bacteria 8347
1116 Ga0496110_0011989 3300048913 Bacteria 7120
1117 Ga0496110_0308768 3300048913 Bacteria 1441
1118 Ga0496111_0002691 3300048914 Bacteria 10794
1119 Ga0496111_0004231 3300048914 Bacteria 9040
1120 Ga0496112_0001065 3300048915 Bacteria 20255
1121 Ga0496112_0002740 3300048915 Bacteria 14278
1122 Ga0496112_0011703 3300048915 Bacteria 8027
1123 Ga0496112_0022237 3300048915 Bacteria 6042
1124 Ga0496112_0039720 3300048915 Bacteria 4599
1125 Ga0496112_0083959 3300048915 Bacteria 3150
1126 Ga0496113_0001345 3300048916 Bacteria 13596
1127 Ga0496113_0001792 3300048916 Bacteria 12190
1128 Ga0496113_0001999 3300048916 Bacteria 11685
1129 Ga0496113_0006128 3300048916 Bacteria 7591
1130 Ga0496113_0008616 3300048916 Bacteria 6651
1131 Ga0496113_0039654 3300048916 Bacteria 3468
1132 Ga0496113_0117793 3300048916 Bacteria 2074
1133 Ga0496114_0000019 3300048917 Bacteria 244365
1134 Ga0496114_0027902 3300048917 Bacteria 4628
1135 Ga0496115_0000301 3300048918 Bacteria 42011
1136 Ga0496115_0140274 3300048918 Bacteria 1994
1137 Ga0501068_0220107 3300049584 Bacteria 1207
1138 Ga0501069_0134706 3300049585 Bacteria 1416
1139 Ga0501074_0074628 3300049590 Bacteria 2435
1140 Ga0501216_006499 3300049660 Bacteria 1793
1141 Ga0501217_009026 3300049661 Bacteria 2162
1142 Ga0501224_004458 3300049664 Bacteria 1990
1143 Ga0501233_008903 3300049668 Bacteria 1947
1144 Ga0501239_004212 3300049672 Bacteria 1403
1145 Ga0501249_013088 3300049679 Bacteria 1760
1146 Ga0501221_003635 3300049704 Bacteria 2541
1147 Ga0501225_0012601 3300049705 Bacteria 2373
1148 Ga0501079_0233885 3300049741 Bacteria 1436
1149 Ga0501080_0039090 3300049742 Bacteria 4428
1150 Ga0501263_001699 3300049760 Bacteria 2129
1151 Ga0501268_004038 3300049765 Bacteria 2047
1152 Ga0501268_006720 3300049765 Bacteria 1697
1153 Ga0501270_000394 3300049767 Bacteria 3758
1154 Ga0501035_0130630 3300049822 Bacteria 2190
1155 nmdc:mga0a205_3422_c1 3300050515 Bacteria 14147
1156 Ga0500658_0000044 3300053134 Bacteria 72423
1157 Ga0466962_0023416 3300061719 Bacteria 2968
1158 Ga0466962_0057631 3300061719 Bacteria 1855
1159 2896430650 2896429255 Bacteria 2557483
1160 Ga0439445_0000033
1161 JGI24736J21556_1015226
1162 JGI24741J21665_1000614
1163 JGI24741J21665_1004043
1164 JGI24741J21665_1014236
1165 JGI24747J21853_1000282
1166 JGI24740J21852_10001651
1167 JGI24740J21852_10004950
1168 JGI24740J21852_10006123
1169 JGI24740J21852_10006423
1170 JGI24740J21852_10033413
1171 JGI24740J21852_10034857
1172 JGI24740J21852_10045052
1173 JGI24739J22299_10000962
1174 JGI24739J22299_10005783
1175 JGI24739J22299_10006785
1176 JGI24739J22299_10008692
1177 JGI24739J22299_10016938
1178 JGI24737J22298_10000221
1179 JGI24737J22298_10005094
1180 JGI24737J22298_10007887
1181 JGI24737J22298_10012795
1182 JGI24743J22301_10025292
1183 JGI24735J21928_10001120
1184 JGI24735J21928_10005874
1185 JGI24735J21928_10007590
1186 JGI24735J21928_10015504
1187 JGI24735J21928_10022580
1188 JGI24735J21928_10037210
1189 JGI24738J21930_10001585
1190 JGI24738J21930_10005295
1191 JGI24738J21930_10008738
1192 JGI24744J21845_10002922
1193 JGI24035J26624_1004103
1194 Ga0065712_10094335
1195 Ga0065712_10156713
1196 Ga0065715_10137581
1197 Ga0065715_10150715
1198 Ga0070658_10000183
1199 Ga0070658_10006907
1200 Ga0070658_10007728
1201 Ga0070658_10028609
1202 Ga0070658_10032687
1203 Ga0070658_10032766
1204 Ga0070658_10089328
1205 Ga0070658_10094459
1206 Ga0070658_10121855
1207 Ga0070658_10179683
1208 Ga0070676_10004745
1209 Ga0070676_10129340
1210 Ga0070676_10216416
1211 Ga0070683_100004468
1212 Ga0070683_100021904
1213 Ga0070683_100022586
1214 Ga0070683_100030748
1215 Ga0070683_100074787
1216 Ga0070683_100194134
1217 Ga0070690_100000787
1218 Ga0070670_100001654
1219 Ga0070670_100005417
1220 Ga0070670_100005651
1221 Ga0070670_100006313
1222 Ga0070670_100007094
1223 Ga0070670_100034916
1224 Ga0070670_100052697
1225 Ga0070670_100115100
1226 Ga0070670_100132381
1227 Ga0068869_100003110
1228 Ga0068869_100109312
1229 Ga0070666_10000235
1230 Ga0070666_10009444
1231 Ga0070666_10018688
1232 Ga0070666_10019541
1233 Ga0070666_10035423
1234 Ga0070680_100000385
1235 Ga0070680_100003098
1236 Ga0070680_100006794
1237 Ga0070680_100015101
1238 Ga0070680_100059057
1239 Ga0070680_100112652
1240 Ga0070682_100007746
1241 Ga0070682_100009275
1242 Ga0070682_100206799
1243 Ga0068868_100001447
1244 Ga0068868_100199254
1245 Ga0068868_100232839
1246 Ga0070660_100003909
1247 Ga0070660_100004385
1248 Ga0070660_100005119
1249 Ga0070660_100007290
1250 Ga0070660_100007456
1251 Ga0070660_100013729
1252 Ga0070660_100020482
1253 Ga0070660_100045400
1254 Ga0070660_100050928
1255 Ga0070660_100070038
1256 Ga0070660_100098832
1257 Ga0070660_100117986
1258 Ga0070660_100173717
1259 Ga0070660_100212587
1260 Ga0070660_100339111
1261 Ga0070691_10006423
1262 Ga0070661_100000682
1263 Ga0070661_100001721
1264 Ga0070661_100009008
1265 Ga0070661_100011134
1266 Ga0070661_100012200
1267 Ga0070661_100026019
1268 Ga0070661_100028075
1269 Ga0070661_100044442
1270 Ga0070661_100065834
1271 Ga0070661_100180797
1272 Ga0070661_100193700
1273 Ga0070661_100288443
1274 Ga0070692_10004085
1275 Ga0070692_10069470
1276 Ga0070668_100008023
1277 Ga0070668_100044135
1278 Ga0070668_100078481
1279 Ga0070668_100345752
1280 Ga0070668_100424648
1281 Ga0070669_100000682
1282 Ga0070669_100062727
1283 Ga0070675_100003697
1284 Ga0070675_100012174
1285 Ga0070675_100075776
1286 Ga0070675_100109732
1287 Ga0070671_100000937
1288 Ga0070671_100002662
1289 Ga0070671_100035190
1290 Ga0070671_100035235
1291 Ga0070671_100041357
1292 Ga0070671_100042010
1293 Ga0070671_100061812
1294 Ga0070671_100128088
1295 Ga0070671_100141748
1296 Ga0070671_100194733
1297 Ga0070674_100004075
1298 Ga0070674_100015941
1299 Ga0070674_100031086
1300 Ga0070674_100093580
1301 Ga0070674_100183010
1302 Ga0070673_100000833
1303 Ga0070673_100003744
1304 Ga0070673_100045049
1305 Ga0070673_100095688
1306 Ga0070673_100110547
1307 Ga0070673_100350524
1308 Ga0070659_100000643
1309 Ga0070659_100000950
1310 Ga0070659_100001481
1311 Ga0070659_100004836
1312 Ga0070659_100015330
1313 Ga0070659_100015369
1314 Ga0070659_100050451
1315 Ga0070659_100096078
1316 Ga0070659_100099729
1317 Ga0070659_100145132
1318 Ga0070659_100167563
1319 Ga0070659_100187615
1320 Ga0070667_100005345
1321 Ga0070667_100007376
1322 Ga0070667_100008901
1323 Ga0070667_100012249
1324 Ga0070667_100013448
1325 Ga0070667_100072516
1326 Ga0070667_100257006
1327 Ga0070667_100270712
1328 Ga0070709_10018451
1329 Ga0070714_100025191
1330 Ga0070714_100070079
1331 Ga0070714_100077881
1332 Ga0070714_100186426
1333 Ga0070714_100251725
1334 Ga0070713_100005789
1335 Ga0070713_100137579
1336 Ga0070713_100370905
1337 Ga0070705_100252470
1338 Ga0070694_100004281
1339 Ga0070663_100003716
1340 Ga0070663_100006382
1341 Ga0070663_100014245
1342 Ga0070663_100052254
1343 Ga0070663_100193887
1344 Ga0070663_100267152
1345 Ga0070663_100362232
1346 Ga0070678_100001779
1347 Ga0070678_100040826
1348 Ga0070678_100055592
1349 Ga0070678_100251378
1350 Ga0070678_100292218
1351 Ga0070662_100000837
1352 Ga0070662_100004005
1353 Ga0070662_100005364
1354 Ga0070662_100006602
1355 Ga0070662_100009256
1356 Ga0070662_100014381
1357 Ga0070662_100074783
1358 Ga0070662_100104150
1359 Ga0070662_100135770
1360 Ga0070662_100206106
1361 Ga0070662_100273316
1362 Ga0070662_100309997
1363 Ga0070681_10012278
1364 Ga0070681_10023104
1365 Ga0070681_10043796
1366 Ga0070681_10063259
1367 Ga0070681_10180377
1368 Ga0068867_100002583
1369 Ga0068867_100015227
1370 Ga0068867_100050312
1371 Ga0068867_100193902
1372 Ga0070706_100389279
1373 Ga0070679_100008172
1374 Ga0070679_100012904
1375 Ga0070679_100028208
1376 Ga0070679_100124000
1377 Ga0070679_100206547
1378 Ga0070679_100242019
1379 Ga0070684_100009332
1380 Ga0070684_100051750
1381 Ga0068853_100001045
1382 Ga0068853_100001659
1383 Ga0068853_100007145
1384 Ga0068853_100008873
1385 Ga0068853_100026189
1386 Ga0068853_100031255
1387 Ga0068853_100060593
1388 Ga0068853_100067472
1389 Ga0068853_100116544
1390 Ga0068853_100144893
1391 Ga0068853_100199923
1392 Ga0068853_100471481
1393 Ga0070672_100000589
1394 Ga0070672_100054622
1395 Ga0070672_100060796
1396 Ga0070672_100063123
1397 Ga0070672_100064682
1398 Ga0070672_100075053
1399 Ga0070672_100146730
1400 Ga0070672_100225234
1401 Ga0070672_100336142
1402 Ga0070686_100021370
1403 Ga0070686_100228304
1404 Ga0070696_100159189
1405 Ga0070693_100000320
1406 Ga0070693_100024049
1407 Ga0070665_100003564
1408 Ga0070665_100007212
1409 Ga0070665_100010214
1410 Ga0070665_100020654
1411 Ga0070665_100044104
1412 Ga0070665_100320631
1413 Ga0068855_100004727
1414 Ga0068855_100008531
1415 Ga0068855_100011826
1416 Ga0068855_100036759
1417 Ga0068855_100046200
1418 Ga0068855_100048507
1419 Ga0068855_100103050
1420 Ga0068855_100217505
1421 Ga0068855_100223315
1422 Ga0068855_100241393
1423 Ga0070664_100001349
1424 Ga0070664_100006689
1425 Ga0070664_100007037
1426 Ga0070664_100016262
1427 Ga0070664_100028889
1428 Ga0070664_100030355
1429 Ga0070664_100035271
1430 Ga0070664_100060658
1431 Ga0070664_100113668
1432 Ga0070664_100149192
1433 Ga0070664_100167666
1434 Ga0070664_100325400
1435 Ga0070664_100357586
1436 Ga0068857_100004459
1437 Ga0068857_100004827
1438 Ga0068857_100006517
1439 Ga0068857_100017036
1440 Ga0068857_100017657
1441 Ga0068857_100045037
1442 Ga0068857_100099653
1443 Ga0068857_100141149
1444 Ga0068857_100143755
1445 Ga0068854_100002308
1446 Ga0068854_100006106
1447 Ga0068854_100007831
1448 Ga0068854_100010315
1449 Ga0068854_100048634
1450 Ga0068854_100104351
1451 Ga0068856_100000213
1452 Ga0068856_100055161
1453 Ga0068856_100065734
1454 Ga0068856_100101240
1455 Ga0068856_100119630
1456 Ga0068856_100200210
1457 Ga0068856_100204422
1458 Ga0068856_100387160
1459 Ga0068856_100449907
1460 Ga0068852_100001218
1461 Ga0068852_100002661
1462 Ga0068852_100009304
1463 Ga0068852_100011783
1464 Ga0068852_100019494
1465 Ga0068852_100021157
1466 Ga0068852_100025865
1467 Ga0068852_100035873
1468 Ga0068852_100048500
1469 Ga0068852_100058098
1470 Ga0068852_100094893
1471 Ga0068852_100103286
1472 Ga0068852_100113706
1473 Ga0068852_100146284
1474 Ga0068852_100150827
1475 Ga0068852_100153655
1476 Ga0068852_100176638
1477 Ga0068852_100259687
1478 Ga0068859_100002632
1479 Ga0068859_100007420
1480 Ga0068859_100016870
1481 Ga0068859_100057714
1482 Ga0068859_100059672
1483 Ga0068859_100134169
1484 Ga0068859_100225546
1485 Ga0068864_100000287
1486 Ga0068864_100000748
1487 Ga0068864_100003954
1488 Ga0068864_100013544
1489 Ga0068864_100020141
1490 Ga0068864_100021896
1491 Ga0068864_100024831
1492 Ga0068864_100033272
1493 Ga0068864_100045158
1494 Ga0068864_100433880
1495 Ga0068866_10023723
1496 Ga0068866_10060476
1497 Ga0068866_10107187
1498 Ga0068851_10008573
1499 Ga0068851_10020484
1500 Ga0068851_10023154
1501 Ga0068851_10031862
1502 Ga0068851_10043074
1503 Ga0068851_10059722
1504 Ga0068851_10069226
1505 Ga0068851_10072209
1506 Ga0068851_10086911
1507 Ga0068863_100002077
1508 Ga0068863_100011329
1509 Ga0068863_100024805
1510 Ga0068863_100027016
1511 Ga0068863_100035052
1512 Ga0068863_100044564
1513 Ga0068863_100047365
1514 Ga0068858_100003680
1515 Ga0068858_100024193
1516 Ga0068858_100032495
1517 Ga0068858_100046841
1518 Ga0068860_100006012
1519 Ga0068860_100021925
1520 Ga0068860_100032628
1521 Ga0068860_100033473
1522 Ga0068860_100038805
1523 Ga0068860_100421700
1524 Ga0068860_100553751
1525 Ga0068862_100033929
1526 Ga0070717_10264670
1527 Ga0075365_10228437
1528 Ga0070716_100084613
1529 Ga0070712_100016600
1530 Ga0097621_100006129
1531 Ga0097621_100079507
1532 Ga0097621_100091908
1533 Ga0068871_100007717
1534 Ga0068871_100050766
1535 Ga0068871_100051817
1536 Ga0068871_100090661
1537 Ga0068871_100109249
1538 Ga0068871_100159617
1539 Ga0075433_10006864
1540 Ga0068865_100002284
1541 Ga0068865_100006654
1542 Ga0068865_100047444
1543 Ga0097620_100002632
1544 Ga0097620_100007420
1545 Ga0097620_100016869
1546 Ga0097620_100057714
1547 Ga0097620_100059671
1548 Ga0097620_100134171
1549 Ga0097620_100225557
1550 Ga0105250_10008325
1551 Ga0105240_10010105
1552 Ga0105240_10062213
1553 Ga0105240_10159707
1554 Ga0105240_10192964
1555 Ga0105240_10289875
1556 Ga0111539_10179624
1557 Ga0105245_10002935
1558 Ga0105245_10010933
1559 Ga0105245_10056028
1560 Ga0105245_10188470
1561 Ga0105247_10190221
1562 Ga0114129_10209942
1563 Ga0105243_10029860
1564 Ga0105243_10089411
1565 Ga0105241_10017774
1566 Ga0105241_10020264
1567 Ga0105242_10070948
1568 Ga0105242_10371764
1569 Ga0105248_10000259
1570 Ga0105248_10000552
1571 Ga0105248_10001298
1572 Ga0105248_10005830
1573 Ga0105248_10014157
1574 Ga0105248_10045074
1575 Ga0105248_10061978
1576 Ga0105248_10258855
1577 Ga0105237_10036207
1578 Ga0105237_10234938
1579 Ga0105238_10005992
1580 Ga0105238_10081961
1581 Ga0105238_10102884
1582 Ga0105238_10162395
1583 Ga0105249_10020324
1584 Ga0105239_10055953
1585 Ga0105239_10550030
1586 Ga0105246_10032217
1587 Ga0157373_10022273
1588 Ga0157373_10022789
1589 Ga0157373_10051547
1590 Ga0157373_10057609
1591 Ga0157373_10059583
1592 Ga0157373_10070567
1593 Ga0157373_10083125
1594 Ga0157373_10119028
1595 Ga0157373_10124110
1596 Ga0157373_10150206
1597 Ga0157371_10004027
1598 Ga0157371_10007641
1599 Ga0157371_10010050
1600 Ga0157371_10014756
1601 Ga0157371_10062531
1602 Ga0157371_10160140
1603 Ga0157371_10340322
1604 Ga0157370_10000244
1605 Ga0157370_10021029
1606 Ga0157370_10055025
1607 Ga0157370_10116225
1608 Ga0157370_10177514
1609 Ga0157370_10263810
1610 Ga0157370_10282783
1611 Ga0157369_10001746
1612 Ga0157369_10019876
1613 Ga0157369_10038117
1614 Ga0157369_10044996
1615 Ga0157369_10056409
1616 Ga0157369_10095254
1617 Ga0157369_10115489
1618 Ga0157369_10147001
1619 Ga0157369_10225991
1620 Ga0157369_10309734
1621 Ga0157369_10531672
1622 Ga0157374_10022995
1623 Ga0157374_10106424
1624 Ga0157374_10313202
1625 Ga0157374_10315268
1626 Ga0157374_10327602
1627 Ga0157374_10442353
1628 Ga0157378_10014131
1629 Ga0157378_10086216
1630 Ga0157378_10143056
1631 Ga0157378_10169503
1632 Ga0163162_10011397
1633 Ga0163162_10048657
1634 Ga0163162_10052428
1635 Ga0163162_10088200
1636 Ga0163162_10323466
1637 Ga0163162_10465910
1638 Ga0157372_10006288
1639 Ga0157372_10007538
1640 Ga0157372_10054863
1641 Ga0157372_10063477
1642 Ga0157372_10094379
1643 Ga0157372_10116183
1644 Ga0157372_10220039
1645 Ga0157372_10287951
1646 Ga0157372_10291604
1647 Ga0157372_10395048
1648 Ga0157372_10551460
1649 Ga0157372_10751818
1650 Ga0157375_10007050
1651 Ga0157375_10109699
1652 Ga0157375_10113595
1653 Ga0157375_10634381
1654 Ga0163163_10000178
1655 Ga0163163_10000390
1656 Ga0163163_10099667
1657 Ga0157380_10049784
1658 Ga0157377_10038726
1659 Ga0157379_10014618
1660 Ga0157379_10156407
1661 Ga0157379_10159748
1662 Ga0157376_10221663
1663 Ga0207673_1000329
1664 Ga0207697_10000253
1665 Ga0207697_10024622
1666 Ga0207697_10093178
1667 Ga0207656_10004953
1668 Ga0207656_10018146
1669 Ga0207656_10025982
1670 Ga0207656_10062208
1671 Ga0207656_10107720
1672 Ga0207682_10026841
1673 Ga0207682_10040701
1674 Ga0207642_10039013
1675 Ga0207642_10100912
1676 Ga0207710_10108572
1677 Ga0207688_10000652
1678 Ga0207688_10004204
1679 Ga0207688_10014817
1680 Ga0207680_10000868
1681 Ga0207680_10001140
1682 Ga0207680_10008481
1683 Ga0207680_10017428
1684 Ga0207680_10023077
1685 Ga0207647_10000327
1686 Ga0207647_10000721
1687 Ga0207647_10000760
1688 Ga0207647_10003308
1689 Ga0207647_10047804
1690 Ga0207647_10101967
1691 Ga0207699_10006504
1692 Ga0207645_10017300
1693 Ga0207645_10071823
1694 Ga0207645_10142958
1695 Ga0207643_10124875
1696 Ga0207705_10000234
1697 Ga0207705_10000358
1698 Ga0207705_10002566
1699 Ga0207705_10004181
1700 Ga0207705_10005492
1701 Ga0207705_10006601
1702 Ga0207705_10007357
1703 Ga0207705_10007386
1704 Ga0207705_10011403
1705 Ga0207705_10011674
1706 Ga0207705_10027535
1707 Ga0207705_10038212
1708 Ga0207705_10085063
1709 Ga0207705_10289718
1710 Ga0207654_10064375
1711 Ga0207707_10003621
1712 Ga0207707_10062067
1713 Ga0207707_10105969
1714 Ga0207707_10280726
1715 Ga0207695_10008705
1716 Ga0207695_10013260
1717 Ga0207695_10159210
1718 Ga0207671_10032582
1719 Ga0207671_10132939
1720 Ga0207671_10179252
1721 Ga0207660_10000492
1722 Ga0207660_10001664
1723 Ga0207660_10008071
1724 Ga0207660_10011001
1725 Ga0207660_10019271
1726 Ga0207660_10050146
1727 Ga0207657_10000598
1728 Ga0207657_10000857
1729 Ga0207657_10003838
1730 Ga0207657_10006329
1731 Ga0207657_10009112
1732 Ga0207657_10009165
1733 Ga0207657_10009579
1734 Ga0207657_10009649
1735 Ga0207657_10011706
1736 Ga0207657_10012777
1737 Ga0207657_10017703
1738 Ga0207657_10022817
1739 Ga0207657_10023805
1740 Ga0207657_10031781
1741 Ga0207657_10066704
1742 Ga0207657_10107656
1743 Ga0207657_10129961
1744 Ga0207657_10238791
1745 Ga0207649_10000159
1746 Ga0207649_10002045
1747 Ga0207649_10010001
1748 Ga0207649_10018675
1749 Ga0207649_10027881
1750 Ga0207649_10034775
1751 Ga0207649_10040105
1752 Ga0207649_10064254
1753 Ga0207649_10137728
1754 Ga0207649_10248815
1755 Ga0207652_10005719
1756 Ga0207652_10010205
1757 Ga0207652_10032849
1758 Ga0207652_10131636
1759 Ga0207652_10173625
1760 Ga0207652_10178043
1761 Ga0207681_10005247
1762 Ga0207681_10012088
1763 Ga0207694_10004611
1764 Ga0207694_10023671
1765 Ga0207694_10048231
1766 Ga0207694_10053518
1767 Ga0207694_10073372
1768 Ga0207650_10002087
1769 Ga0207650_10004458
1770 Ga0207650_10020275
1771 Ga0207650_10057717
1772 Ga0207650_10091860
1773 Ga0207650_10106975
1774 Ga0207659_10042325
1775 Ga0207659_10045438
1776 Ga0207687_10003036
1777 Ga0207687_10186033
1778 Ga0207700_10144907
1779 Ga0207700_10505777
1780 Ga0207664_10013789
1781 Ga0207664_10017647
1782 Ga0207664_10024615
1783 Ga0207664_10161669
1784 Ga0207664_10205809
1785 Ga0207664_10267396
1786 Ga0207644_10000465
1787 Ga0207644_10000576
1788 Ga0207644_10000983
1789 Ga0207644_10005885
1790 Ga0207644_10021402
1791 Ga0207644_10072265
1792 Ga0207644_10127453
1793 Ga0207644_10162834
1794 Ga0207644_10262101
1795 Ga0207644_10307008
1796 Ga0207690_10000120
1797 Ga0207690_10001585
1798 Ga0207690_10001987
1799 Ga0207690_10002341
1800 Ga0207690_10009049
1801 Ga0207690_10017503
1802 Ga0207690_10020955
1803 Ga0207690_10029684
1804 Ga0207690_10057388
1805 Ga0207690_10075592
1806 Ga0207690_10100997
1807 Ga0207690_10114103
1808 Ga0207690_10432678
1809 Ga0207706_10000200
1810 Ga0207706_10000904
1811 Ga0207706_10001168
1812 Ga0207706_10003074
1813 Ga0207706_10003639
1814 Ga0207706_10008292
1815 Ga0207706_10015445
1816 Ga0207706_10016651
1817 Ga0207706_10036707
1818 Ga0207706_10090804
1819 Ga0207706_10095256
1820 Ga0207706_10145010
1821 Ga0207706_10173165
1822 Ga0207706_10227721
1823 Ga0207706_10252518
1824 Ga0207706_10275983
1825 Ga0207706_10290059
1826 Ga0207686_10017230
1827 Ga0207686_10024382
1828 Ga0207709_10031799
1829 Ga0207709_10066790
1830 Ga0207709_10118424
1831 Ga0207669_10010514
1832 Ga0207669_10028380
1833 Ga0207669_10112711
1834 Ga0207704_10003953
1835 Ga0207704_10019399
1836 Ga0207704_10039360
1837 Ga0207665_10018962
1838 Ga0207691_10000743
1839 Ga0207691_10008733
1840 Ga0207691_10011096
1841 Ga0207691_10023264
1842 Ga0207691_10076123
1843 Ga0207691_10088170
1844 Ga0207691_10114833
1845 Ga0207691_10149440
1846 Ga0207691_10176534
1847 Ga0207711_10000046
1848 Ga0207711_10000180
1849 Ga0207711_10001359
1850 Ga0207711_10002324
1851 Ga0207711_10004487
1852 Ga0207711_10018147
1853 Ga0207711_10020483
1854 Ga0207711_10021803
1855 Ga0207711_10038404
1856 Ga0207689_10000372
1857 Ga0207689_10003887
1858 Ga0207689_10012648
1859 Ga0207689_10287052
1860 Ga0207661_10002690
1861 Ga0207661_10004435
1862 Ga0207661_10015252
1863 Ga0207661_10069119
1864 Ga0207679_10000150
1865 Ga0207679_10001640
1866 Ga0207679_10002544
1867 Ga0207679_10021124
1868 Ga0207679_10070120
1869 Ga0207679_10115721
1870 Ga0207679_10160847
1871 Ga0207679_10173026
1872 Ga0207679_10260987
1873 Ga0207679_10372260
1874 Ga0207667_10000443
1875 Ga0207667_10003333
1876 Ga0207667_10012934
1877 Ga0207667_10021932
1878 Ga0207667_10025695
1879 Ga0207667_10031216
1880 Ga0207667_10078617
1881 Ga0207667_10144912
1882 Ga0207667_10263510
1883 Ga0207667_10267869
1884 Ga0207667_10301942
1885 Ga0207651_10000440
1886 Ga0207651_10000948
1887 Ga0207651_10002871
1888 Ga0207651_10011648
1889 Ga0207651_10021677
1890 Ga0207651_10145045
1891 Ga0207712_10008941
1892 Ga0207668_10007965
1893 Ga0207668_10020110
1894 Ga0207668_10022332
1895 Ga0207668_10049931
1896 Ga0207668_10210660
1897 Ga0207640_10005654
1898 Ga0207640_10006004
1899 Ga0207640_10006829
1900 Ga0207640_10013558
1901 Ga0207640_10022603
1902 Ga0207640_10105811
1903 Ga0207640_10125134
1904 Ga0207640_10152519
1905 Ga0207658_10003399
1906 Ga0207658_10017854
1907 Ga0207658_10019518
1908 Ga0207658_10020213
1909 Ga0207658_10035707
1910 Ga0207658_10125603
1911 Ga0207658_10161408
1912 Ga0207658_10167734
1913 Ga0207658_10196149
1914 Ga0207658_10206033
1915 Ga0207658_10244723
1916 Ga0207677_10002330
1917 Ga0207677_10007174
1918 Ga0207677_10009152
1919 Ga0207677_10016631
1920 Ga0207677_10025806
1921 Ga0207677_10086342
1922 Ga0207677_10160019
1923 Ga0207677_10186394
1924 Ga0207677_10266936
1925 Ga0207703_10003193
1926 Ga0207703_10003515
1927 Ga0207703_10004332
1928 Ga0207703_10006456
1929 Ga0207703_10009190
1930 Ga0207703_10079764
1931 Ga0207639_10000282
1932 Ga0207639_10000575
1933 Ga0207639_10004242
1934 Ga0207639_10005382
1935 Ga0207639_10026353
1936 Ga0207639_10046502
1937 Ga0207639_10077066
1938 Ga0207639_10081743
1939 Ga0207639_10100488
1940 Ga0207639_10165280
1941 Ga0207678_10000308
1942 Ga0207678_10000922
1943 Ga0207678_10003197
1944 Ga0207678_10003750
1945 Ga0207678_10005778
1946 Ga0207678_10006486
1947 Ga0207678_10020582
1948 Ga0207678_10032097
1949 Ga0207678_10070332
1950 Ga0207678_10093779
1951 Ga0207678_10134952
1952 Ga0207678_10141796
1953 Ga0207702_10001142
1954 Ga0207702_10006961
1955 Ga0207702_10011481
1956 Ga0207702_10013433
1957 Ga0207702_10028125
1958 Ga0207702_10097720
1959 Ga0207702_10244568
1960 Ga0207702_10267100
1961 Ga0207702_10281323
1962 Ga0207702_10462319
1963 Ga0207641_10001374
1964 Ga0207641_10011379
1965 Ga0207641_10024227
1966 Ga0207641_10037506
1967 Ga0207641_10051069
1968 Ga0207641_10057135
1969 Ga0207641_10136515
1970 Ga0207641_10197594
1971 Ga0207641_10204559
1972 Ga0207641_10533979
1973 Ga0207648_10005163
1974 Ga0207648_10006762
1975 Ga0207648_10010607
1976 Ga0207648_10023837
1977 Ga0207648_10034713
1978 Ga0207648_10127986
1979 Ga0207676_10000345
1980 Ga0207676_10003004
1981 Ga0207676_10010005
1982 Ga0207676_10022819
1983 Ga0207676_10041875
1984 Ga0207676_10156047
1985 Ga0207676_10293230
1986 Ga0207674_10000626
1987 Ga0207674_10002709
1988 Ga0207674_10003151
1989 Ga0207674_10009232
1990 Ga0207674_10010257
1991 Ga0207674_10014114
1992 Ga0207674_10032785
1993 Ga0207674_10087334
1994 Ga0207674_10164107
1995 Ga0207674_10356270
1996 Ga0207683_10007119
1997 Ga0207683_10016962
1998 Ga0207683_10021172
1999 Ga0207683_10061758
2000 Ga0207683_10247156
2001 Ga0207698_10000784
2002 Ga0207698_10005935
2003 Ga0207698_10006585
2004 Ga0207698_10012795
2005 Ga0207698_10015102
2006 Ga0207698_10015599
2007 Ga0207698_10017902
2008 Ga0207698_10019275
2009 Ga0207698_10026612
2010 Ga0207698_10035651
2011 Ga0207698_10100464
2012 Ga0207698_10140538
2013 Ga0207698_10145087
2014 Ga0268266_10002013
2015 Ga0268266_10007932
2016 Ga0268266_10010566
2017 Ga0268266_10044073
2018 Ga0268266_10082403
2019 Ga0268266_10091553
2020 Ga0268266_10163677
2021 Ga0268265_10477990
2022 Ga0268264_10001241
2023 Ga0268264_10002725
2024 Ga0268264_10023296
2025 Ga0268264_10077953
2026 Ga0307408_100009676
2027 Ga0307408_100123111
2028 Ga0307405_10010277
2029 Ga0307405_10010987
2030 Ga0307413_10002319
2031 Ga0307413_10007106
2032 Ga0307413_10087895
2033 Ga0307413_10102039
2034 Ga0307410_10026635
2035 Ga0307410_10077375
2036 Ga0307410_10102294
2037 Ga0307410_10116739
2038 Ga0307410_10146371
2039 Ga0307410_10149796
2040 Ga0307410_10375048
2041 Ga0307406_10004669
2042 Ga0307406_10007300
2043 Ga0307406_10123787
2044 Ga0307407_10004184
2045 Ga0307407_10065349
2046 Ga0307407_10146472
2047 Ga0307407_10215088
2048 Ga0307412_10053357
2049 Ga0307412_10073040
2050 Ga0307412_10096850
2051 Ga0307412_10226562
2052 Ga0307409_100001300
2053 Ga0307409_100059765
2054 Ga0307409_100087559
2055 Ga0307409_100167999
2056 Ga0307409_100263363
2057 Ga0307416_100192187
2058 Ga0307414_10042383
2059 Ga0307414_10049770
2060 Ga0307414_10055305
2061 Ga0307414_10085465
2062 Ga0307414_10108042
2063 Ga0307414_10213137
2064 Ga0307411_10007859
2065 Ga0307411_10018510
2066 Ga0307411_10020037
2067 Ga0307411_10064942
2068 Ga0307411_10092479
2069 Ga0307411_10158276
2070 Ga0307415_100061867
2071 Ga0307415_100082575
2072 Ga0373929_0024968
2073 Ga0373951_0011121
2074 Ga0373923_0002404
2075 Ga0373953_0043019
2076 Ga0373954_0005957
2077 Ga0373956_0004932
2078 Ga0373960_0013735
2079 Ga0373960_0068676
2080 Ga0373943_0007620
2081 Ga0373946_0060311
2082 Ga0373931_0015017
2083 Ga0373931_0034447
2084 Ga0373935_0046594
2085 Ga0373933_0023071
2086 Ga0373937_0006891
2087 Ga0395899_0000154
2088 Ga0395899_0004539
2089 Ga0395899_0005481
2090 Ga0395899_0044297
2091 Ga0395899_0060832
2092 Ga0395899_0205936
2093 Ga0395899_0214948
2094 Ga0395899_0375849
2095 Ga0395900_0000693
2096 Ga0395900_0008741
2097 Ga0395900_0013334
2098 Ga0395900_0017712
2099 Ga0395900_0017735
2100 Ga0395900_0018640
2101 Ga0395900_0019949
2102 Ga0395900_0024041
2103 Ga0395900_0032829
2104 Ga0395900_0035424
2105 Ga0395900_0053893
2106 Ga0395900_0093293
2107 Ga0395900_0125103
2108 Ga0395900_0128521
2109 Ga0395900_0137501
2110 Ga0395900_0141068
2111 Ga0395900_0235903
2112 Ga0395900_0381375
2113 Ga0395900_0531919
2114 Ga0395900_0542004
2115 Ga0395898_0000219
2116 Ga0395898_0003150
2117 Ga0395898_0011525
2118 Ga0395898_0028917
2119 Ga0395898_0044222
2120 Ga0395898_0139632
2121 Ga0395898_0161645
2122 Ga0395898_0391789
2123 Ga0395898_0457929
2124 Ga0395898_0492332
2125 Ga0395898_0576639
2126 Ga0395905_0000092
2127 Ga0395905_0000094
2128 Ga0395905_0000852
2129 Ga0395905_0002924
2130 Ga0395905_0003007
2131 Ga0395905_0006376
2132 Ga0395905_0007325
2133 Ga0395905_0016407
2134 Ga0395905_0023273
2135 Ga0395905_0030575
2136 Ga0395905_0035913
2137 Ga0395905_0036031
2138 Ga0395905_0043579
2139 Ga0395905_0047189
2140 Ga0395905_0053649
2141 Ga0395905_0059302
2142 Ga0395905_0061719
2143 Ga0395905_0065621
2144 Ga0395905_0090231
2145 Ga0395905_0103498
2146 Ga0395905_0110229
2147 Ga0395905_0113367
2148 Ga0395905_0206945
2149 Ga0395905_0220395
2150 Ga0395905_0434003
2151 Ga0395905_0453377
2152 Ga0395901_0000188
2153 Ga0395901_0000507
2154 Ga0395901_0001734
2155 Ga0395901_0003296
2156 Ga0395901_0009770
2157 Ga0395901_0015074
2158 Ga0395901_0021001
2159 Ga0395901_0080704
2160 Ga0395901_0141591
2161 Ga0395901_0151762
2162 Ga0395901_0162705
2163 Ga0395901_0307023
2164 Ga0395901_0415575
2165 Ga0395901_0450227
2166 Ga0395901_0616340
2167 Ga0439465_0028344
2168 Ga0450890_007831
2169 Ga0450905_001689
2170 Ga0450889_000128
2171 Ga0439464_0002724
2172 Ga0466969_0011352
2173 Ga0466969_0066701
2174 Ga0466969_0093978
2175 Ga0466972_0027065
2176 Ga0466965_0010766
2177 Ga0466966_0013181
2178 Ga0466966_0020457
2179 Ga0466966_0023239
2180 Ga0466966_0040569
2181 Ga0466966_0064060
2182 Ga0466966_0124432
2183 Ga0466961_0004087
2184 Ga0466961_0013315
2185 Ga0466961_0026732
2186 Ga0466961_0041344
2187 Ga0466961_0047785
2188 Ga0466963_0004916
2189 Ga0466963_0007678
2190 Ga0466963_0027267
2191 Ga0466963_0093375
2192 Ga0466963_0103123
2193 Ga0466963_0165658
2194 Ga0466963_0250873
2195 Ga0466963_0302683
2196 Ga0466964_0004752
2197 Ga0466968_0002299
2198 Ga0466970_0009898
2199 Ga0466970_0134557
2200 Ga0466957_0000920
2201 Ga0466957_0005624
2202 Ga0466957_0242026
2203 Ga0466959_0009503
2204 Ga0466959_0158921
2205 Ga0466959_0214622
2206 Ga0466959_0269973
2207 Ga0466958_0011152
2208 Ga0466958_0074060
2209 Ga0466958_0094865
2210 Ga0466967_0000246
2211 Ga0466967_0001231
2212 Ga0466967_0003991
2213 Ga0466967_0018065
2214 Ga0466967_0018752
2215 Ga0466967_0020581
2216 Ga0466967_0037216
2217 Ga0466967_0054765
2218 Ga0466967_0084834
2219 Ga0466967_0114513
2220 Ga0466967_0129264
2221 Ga0466967_0136466
2222 Ga0466967_0190063
2223 Ga0466967_0220014
2224 Ga0466967_0363593
2225 Ga0466967_0525538
2226 Ga0466967_0611840
2227 Ga0495580_0073098
2228 Ga0495583_0034431
2229 Ga0495663_0019794
2230 Ga0495598_0000109
2231 Ga0495621_0000006
2232 Ga0495668_0004223
2233 Ga0495668_0012923
2234 Ga0495625_0058802
2235 Ga0495647_0023421
2236 Ga0495669_0001413
2237 Ga0495669_0011162
2238 Ga0495669_0013009
2239 Ga0495669_0013659
2240 Ga0495669_0023292
2241 Ga0495670_0000226
2242 Ga0495685_033696
2243 Ga0495602_0015737
2244 Ga0496100_0003020
2245 Ga0496101_0001518
2246 Ga0496101_0022576
2247 Ga0496102_0044340
2248 Ga0496102_0045428
2249 Ga0496102_0070593
2250 Ga0496103_0003133
2251 Ga0496103_0007254
2252 Ga0496103_0082776
2253 Ga0496103_0172261
2254 Ga0496104_0090460
2255 Ga0496105_0227975
2256 Ga0496106_0019463
2257 Ga0496106_0019602
2258 Ga0496106_0206728
2259 Ga0496107_0003029
2260 Ga0496107_0149276
2261 Ga0496107_0158998
2262 Ga0496108_0004268
2263 Ga0496108_0004494
2264 Ga0496108_0004878
2265 Ga0496108_0011132
2266 Ga0496108_0027216
2267 Ga0496109_0006265
2268 Ga0496109_0008390
2269 Ga0496109_0026963
2270 Ga0496109_0051055
2271 Ga0496109_0106753
2272 Ga0496109_0354194
2273 Ga0496110_0001279
2274 Ga0496110_0008312
2275 Ga0496110_0011989
2276 Ga0496110_0308768
2277 Ga0496111_0002691
2278 Ga0496111_0004231
2279 Ga0496112_0001065
2280 Ga0496112_0002740
2281 Ga0496112_0011703
2282 Ga0496112_0022237
2283 Ga0496112_0039720
2284 Ga0496112_0083959
2285 Ga0496113_0001345
2286 Ga0496113_0001792
2287 Ga0496113_0001999
2288 Ga0496113_0006128
2289 Ga0496113_0008616
2290 Ga0496113_0039654
2291 Ga0496113_0117793
2292 Ga0496114_0000019
2293 Ga0496114_0027902
2294 Ga0496115_0000301
2295 Ga0496115_0140274
2296 Ga0501068_0220107
2297 Ga0501069_0134706
2298 Ga0501074_0074628
2299 Ga0501216_006499
2300 Ga0501217_009026
2301 Ga0501224_004458
2302 Ga0501233_008903
2303 Ga0501239_004212
2304 Ga0501249_013088
2305 Ga0501221_003635
2306 Ga0501225_0012601
2307 Ga0501079_0233885
2308 Ga0501080_0039090
2309 Ga0501263_001699
2310 Ga0501268_004038
2311 Ga0501268_006720
2312 Ga0501270_000394
2313 Ga0501035_0130630
2314 nmdc:mga0a205_3422_c1
2315 Ga0500658_0000044
2316 Ga0466962_0023416
2317 Ga0466962_0057631
2318 2896430650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

140

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8021 148 229
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.7943 148 230
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7844 148 229
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7205 151 229
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7152 151 229
ID Description Score Start End Superfamily
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7717 153 229 1.20.81.30
af_P58368_346_501_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6185 75 160 1.10.1760.20
af_Q9JHZ2_346_492_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5778 75 164 1.10.1760.20
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.5389 153 229 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.5225 151 275 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A2V8UQF4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8382 84 229 GO:0016020
AF-A0A7K3FMF5-F1-model_v4 deleted 0.7954 40 234
AF-A0A520WXH9-F1-model_v4 Pilus assembly protein TadB 0.761 1 212 GO:0005886
AF-A0A520WXH9-F1-model_v4 Pilus assembly protein TadB 0.7476 1 212 GO:0005886
AF-A0A2V8UQF4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.7395 84 229 GO:0016020

Map