F490990

General Info

Members Datasets Scaffolds Average Seq Length
1160 353 2320 326

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10173363|Ga0207702_101733631
Length 349
Sequence VRTPSYAGLHGWAKKADNMPDTILVVVEQREGKLNRVSWETITAGQAIAAATGWSLEAAVVGSGVNSIASEVAGKKVAKVYDIESPKLEPYTPDALAAGLKQFLESRQPKLVLMPHTYQVRDFVPKLATAMGRTVISDCIGFQHEGGKLVFTRQMFQGKLAADVSFTSDAPWFVTFQNGAFRGDKAEAGAAAAAVETVNVEIADGVIRNKPQEVFKEAKQAVDLTQAEIIVAVGRGIKEQKNIEIAKNLADALGGDLAASRPICDSGWLPMDRQIGSSGQTVAPKLYLALGISGAIQHIVGMKGSRAIIAVNKDSEAPIFEIADYAVVGNLFDIVPPLIEEVKKVKAGG

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
140 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
349 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
350 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.91
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 15.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10173363 3300026078 Bacteria 1980
2 MBSR1b_contig_175413 2162886012 Bacteria 1632
3 JGI24752J21851_1001100 3300001976 Bacteria 3706
4 JGI24743J22301_10004790 3300001991 Bacteria 2224
5 JGI24034J26672_10002560 3300002239 Unclassified 2500
6 JGI24751J29686_10000704 3300002459 Bacteria 8154
7 JGI25406J46586_10006285 3300003203 Bacteria 5480
8 rootL2_10275660 3300003322 Bacteria 2715
9 Ga0058863_10071160 3300004799 Bacteria 3018
10 Ga0058861_10063203 3300004800 Bacteria 2565
11 Ga0058862_12859213 3300004803 Bacteria 3198
12 Ga0065712_10086452 3300005290 Bacteria 2601
13 Ga0065707_10004371 3300005295 Bacteria 3617
14 Ga0070658_10026605 3300005327 Unclassified 4642
15 Ga0070658_10200115 3300005327 Unclassified 1685
16 Ga0070676_10283478 3300005328 Bacteria 1117
17 Ga0070683_100014673 3300005329 Bacteria 6862
18 Ga0070683_100035951 3300005329 Bacteria 4531
19 Ga0070683_100049622 3300005329 Bacteria 3883
20 Ga0070683_100073338 3300005329 Unclassified 3196
21 Ga0070690_100136925 3300005330 Bacteria 1659
22 Ga0070670_100017910 3300005331 Bacteria 6081
23 Ga0070670_100028745 3300005331 Bacteria 4786
24 Ga0070670_100185509 3300005331 Bacteria 1806
25 Ga0070670_100219703 3300005331 Bacteria 1653
26 Ga0068869_100002638 3300005334 Bacteria 10837
27 Ga0068869_100011661 3300005334 Bacteria 5774
28 Ga0068869_100108457 3300005334 Bacteria 2109
29 Ga0068869_100270622 3300005334 Bacteria 1363
30 Ga0070666_10062094 3300005335 Unclassified 2530
31 Ga0070680_100002009 3300005336 Bacteria 14989
32 Ga0070680_100045686 3300005336 Bacteria 3561
33 Ga0070682_100009784 3300005337 Bacteria 5428
34 Ga0070682_100026601 3300005337 Bacteria 3464
35 Ga0070682_100188497 3300005337 Unclassified 1446
36 Ga0068868_100001549 3300005338 Bacteria 15707
37 Ga0068868_100002221 3300005338 Bacteria 13412
38 Ga0068868_100005847 3300005338 Bacteria 8671
39 Ga0068868_100026930 3300005338 Bacteria 4383
40 Ga0068868_100041733 3300005338 Bacteria 3575
41 Ga0068868_100049830 3300005338 Unclassified 3287
42 Ga0070660_100108420 3300005339 Unclassified 2207
43 Ga0070660_100116335 3300005339 Bacteria 2132
44 Ga0070689_100001794 3300005340 Bacteria 13790
45 Ga0070689_100211075 3300005340 Bacteria 1589
46 Ga0070689_100255251 3300005340 Bacteria 1448
47 Ga0070689_100316094 3300005340 Bacteria 1303
48 Ga0070689_100378163 3300005340 Bacteria 1193
49 Ga0070687_100124473 3300005343 Bacteria 1479
50 Ga0070687_100170452 3300005343 Bacteria 1295
51 Ga0070661_100005410 3300005344 Bacteria 8804
52 Ga0070661_100023061 3300005344 Unclassified 4460
53 Ga0070661_100051750 3300005344 Unclassified 3006
54 Ga0070668_100379771 3300005347 Bacteria 1202
55 Ga0070669_100026243 3300005353 Bacteria 4190
56 Ga0070669_100084244 3300005353 Unclassified 2372
57 Ga0070675_100000540 3300005354 Bacteria 25910
58 Ga0070675_100119228 3300005354 Bacteria 2241
59 Ga0070675_100306670 3300005354 Bacteria 1400
60 Ga0070675_100334793 3300005354 Bacteria 1340
61 Ga0070671_100263159 3300005355 Unclassified 1466
62 Ga0070671_100444554 3300005355 Bacteria 1112
63 Ga0070674_100014116 3300005356 Bacteria 4959
64 Ga0070673_100017192 3300005364 Bacteria 5135
65 Ga0070688_100039145 3300005365 Unclassified 2900
66 Ga0070659_100060263 3300005366 Unclassified 2997
67 Ga0070659_100311291 3300005366 Bacteria 1315
68 Ga0070667_100024129 3300005367 Bacteria 5050
69 Ga0070709_10000305 3300005434 Bacteria 31117
70 Ga0070709_10012180 3300005434 Unclassified 4809
71 Ga0070709_10019978 3300005434 Unclassified 3882
72 Ga0070709_10038707 3300005434 Bacteria 2922
73 Ga0070709_10080178 3300005434 Unclassified 2128
74 Ga0070709_10113547 3300005434 Unclassified 1824
75 Ga0070709_10136093 3300005434 Bacteria 1683
76 Ga0070709_10178317 3300005434 Bacteria 1490
77 Ga0070714_100000183 3300005435 Bacteria 49970
78 Ga0070714_100026899 3300005435 Unclassified 4758
79 Ga0070714_100076345 3300005435 Unclassified 2909
80 Ga0070714_100121156 3300005435 Bacteria 2327
81 Ga0070714_100136572 3300005435 Bacteria 2197
82 Ga0070714_100210082 3300005435 Bacteria 1784
83 Ga0070714_100238223 3300005435 Bacteria 1679
84 Ga0070714_100249898 3300005435 Unclassified 1639
85 Ga0070714_100366743 3300005435 Unclassified 1355
86 Ga0070713_100000922 3300005436 Bacteria 18743
87 Ga0070713_100005356 3300005436 Bacteria 8760
88 Ga0070713_100007574 3300005436 Bacteria 7632
89 Ga0070713_100008454 3300005436 Bacteria 7301
90 Ga0070713_100009238 3300005436 Bacteria 7041
91 Ga0070713_100028090 3300005436 Bacteria 4439
92 Ga0070713_100058345 3300005436 Unclassified 3219
93 Ga0070713_100082674 3300005436 Unclassified 2743
94 Ga0070713_100098069 3300005436 Bacteria 2533
95 Ga0070713_100106406 3300005436 Unclassified 2438
96 Ga0070713_100110831 3300005436 Bacteria 2392
97 Ga0070713_100172013 3300005436 Bacteria 1941
98 Ga0070713_100192653 3300005436 Bacteria 1838
99 Ga0070713_100302161 3300005436 Unclassified 1473
100 Ga0070710_10043572 3300005437 Bacteria 2486
101 Ga0070710_10043877 3300005437 Unclassified 2479
102 Ga0070710_10149788 3300005437 Bacteria 1438
103 Ga0070701_10123076 3300005438 Bacteria 1464
104 Ga0070711_100001220 3300005439 Bacteria 13868
105 Ga0070711_100010822 3300005439 Bacteria 5656
106 Ga0070711_100016954 3300005439 Bacteria 4632
107 Ga0070711_100068847 3300005439 Bacteria 2488
108 Ga0070711_100110863 3300005439 Unclassified 2014
109 Ga0070711_100112889 3300005439 Bacteria 1997
110 Ga0070711_100113762 3300005439 Bacteria 1990
111 Ga0070711_100135456 3300005439 Unclassified 1840
112 Ga0070711_100423185 3300005439 Unclassified 1086
113 Ga0070694_100001871 3300005444 Bacteria 12458
114 Ga0070708_100000848 3300005445 Bacteria 23002
115 Ga0070708_100002910 3300005445 Bacteria 13306
116 Ga0070708_100009912 3300005445 Bacteria 7700
117 Ga0070708_100011561 3300005445 Bacteria 7186
118 Ga0070708_100039959 3300005445 Unclassified 4107
119 Ga0070708_100048892 3300005445 Bacteria 3741
120 Ga0070708_100079355 3300005445 Unclassified 2969
121 Ga0070663_100062859 3300005455 Unclassified 2678
122 Ga0070663_100407052 3300005455 Bacteria 1113
123 Ga0070678_100031915 3300005456 Unclassified 3639
124 Ga0070678_100075469 3300005456 Unclassified 2536
125 Ga0070678_100304677 3300005456 Bacteria 1355
126 Ga0070662_100008886 3300005457 Bacteria 6550
127 Ga0070662_100018694 3300005457 Bacteria 4692
128 Ga0070662_100253760 3300005457 Bacteria 1415
129 Ga0070681_10000692 3300005458 Bacteria 27984
130 Ga0070681_10005994 3300005458 Bacteria 11779
131 Ga0070681_10008099 3300005458 Bacteria 10281
132 Ga0070681_10021208 3300005458 Bacteria 6510
133 Ga0070681_10028494 3300005458 Bacteria 5615
134 Ga0070681_10035282 3300005458 Bacteria 5025
135 Ga0070681_10055803 3300005458 Bacteria 3932
136 Ga0070681_10058881 3300005458 Bacteria 3821
137 Ga0070681_10075687 3300005458 Unclassified 3326
138 Ga0070681_10111730 3300005458 Unclassified 2671
139 Ga0070681_10149409 3300005458 Bacteria 2264
140 Ga0070681_10165457 3300005458 Bacteria 2134
141 Ga0070681_10176878 3300005458 Bacteria 2056
142 Ga0070681_10304639 3300005458 Bacteria 1503
143 Ga0070681_10368853 3300005458 Bacteria 1346
144 Ga0070681_10539954 3300005458 Bacteria 1079
145 Ga0068867_100008095 3300005459 Bacteria 7429
146 Ga0068867_100125831 3300005459 Unclassified 1986
147 Ga0070706_100000381 3300005467 Bacteria 53192
148 Ga0070706_100000609 3300005467 Bacteria 41393
149 Ga0070706_100006382 3300005467 Bacteria 11139
150 Ga0070706_100027489 3300005467 Bacteria 5236
151 Ga0070706_100027595 3300005467 Bacteria 5225
152 Ga0070706_100061794 3300005467 Bacteria 3460
153 Ga0070706_100086089 3300005467 Unclassified 2912
154 Ga0070707_100000144 3300005468 Bacteria 67480
155 Ga0070707_100018379 3300005468 Bacteria 6577
156 Ga0070707_100054792 3300005468 Bacteria 3824
157 Ga0070707_100087255 3300005468 Bacteria 3018
158 Ga0070707_100299150 3300005468 Bacteria 1564
159 Ga0070698_100000015 3300005471 Bacteria 111813
160 Ga0070698_100000903 3300005471 Bacteria 32615
161 Ga0070698_100037349 3300005471 Bacteria 5009
162 Ga0070698_100176144 3300005471 Unclassified 2078
163 Ga0070699_100045650 3300005518 Unclassified 3792
164 Ga0070699_100195385 3300005518 Bacteria 1798
165 Ga0070699_100286249 3300005518 Bacteria 1477
166 Ga0070679_100009060 3300005530 Bacteria 9390
167 Ga0070679_100017685 3300005530 Bacteria 6901
168 Ga0070679_100036410 3300005530 Unclassified 4882
169 Ga0070679_100041797 3300005530 Bacteria 4563
170 Ga0070679_100049113 3300005530 Bacteria 4202
171 Ga0070679_100059047 3300005530 Bacteria 3823
172 Ga0070679_100068243 3300005530 Bacteria 3547
173 Ga0070679_100157163 3300005530 Unclassified 2248
174 Ga0070684_100002625 3300005535 Bacteria 13279
175 Ga0070684_100002682 3300005535 Bacteria 13145
176 Ga0070684_100007916 3300005535 Bacteria 8294
177 Ga0070684_100016155 3300005535 Bacteria 6099
178 Ga0070684_100042699 3300005535 Bacteria 3915
179 Ga0070684_100054714 3300005535 Bacteria 3477
180 Ga0070684_100127298 3300005535 Unclassified 2295
181 Ga0070684_100168906 3300005535 Bacteria 1986
182 Ga0070684_100176690 3300005535 Bacteria 1940
183 Ga0070697_100000195 3300005536 Bacteria 49351
184 Ga0070697_100001021 3300005536 Bacteria 21127
185 Ga0070697_100003101 3300005536 Bacteria 12771
186 Ga0070697_100006153 3300005536 Bacteria 9286
187 Ga0070697_100010873 3300005536 Bacteria 7108
188 Ga0070697_100026144 3300005536 Unclassified 4659
189 Ga0070697_100032232 3300005536 Bacteria 4216
190 Ga0070697_100086122 3300005536 Bacteria 2592
191 Ga0070697_100118316 3300005536 Unclassified 2214
192 Ga0068853_100004456 3300005539 Bacteria 10852
193 Ga0068853_100016340 3300005539 Bacteria 6106
194 Ga0068853_100051674 3300005539 Unclassified 3538
195 Ga0068853_100071730 3300005539 Bacteria 3017
196 Ga0068853_100093359 3300005539 Bacteria 2649
197 Ga0070672_100041331 3300005543 Bacteria 3544
198 Ga0070686_100022493 3300005544 Unclassified 3755
199 Ga0070686_100104806 3300005544 Unclassified 1916
200 Ga0070695_100070485 3300005545 Unclassified 2287
201 Ga0070696_100011056 3300005546 Bacteria 6043
202 Ga0070696_100167415 3300005546 Bacteria 1623
203 Ga0070693_100008703 3300005547 Bacteria 5021
204 Ga0070665_100027509 3300005548 Bacteria 5728
205 Ga0070665_100590653 3300005548 Bacteria 1123
206 Ga0068855_100001490 3300005563 Bacteria 29300
207 Ga0068855_100002064 3300005563 Bacteria 24891
208 Ga0068855_100004921 3300005563 Bacteria 16303
209 Ga0068855_100013622 3300005563 Bacteria 9806
210 Ga0068855_100020077 3300005563 Bacteria 8024
211 Ga0068855_100055057 3300005563 Bacteria 4673
212 Ga0068855_100108486 3300005563 Bacteria 3189
213 Ga0068855_100337298 3300005563 Bacteria 1663
214 Ga0068855_100368240 3300005563 Bacteria 1580
215 Ga0068855_100612017 3300005563 Bacteria 1174
216 Ga0070664_100017492 3300005564 Bacteria 5887
217 Ga0070664_100106944 3300005564 Bacteria 2438
218 Ga0070664_100147243 3300005564 Unclassified 2077
219 Ga0068857_100001030 3300005577 Bacteria 21530
220 Ga0068857_100003337 3300005577 Bacteria 13362
221 Ga0068857_100096591 3300005577 Unclassified 2648
222 Ga0068857_100215307 3300005577 Unclassified 1753
223 Ga0068857_100239962 3300005577 Bacteria 1659
224 Ga0068854_100004220 3300005578 Bacteria 9046
225 Ga0068854_100012031 3300005578 Bacteria 5656
226 Ga0068854_100123985 3300005578 Bacteria 1965
227 Ga0068856_100000065 3300005614 Bacteria 98683
228 Ga0068856_100000989 3300005614 Bacteria 30332
229 Ga0068856_100002496 3300005614 Bacteria 18932
230 Ga0068856_100012096 3300005614 Bacteria 8359
231 Ga0068856_100023046 3300005614 Bacteria 6054
232 Ga0068856_100028145 3300005614 Bacteria 5485
233 Ga0068856_100052234 3300005614 Bacteria 4030
234 Ga0068856_100057605 3300005614 Unclassified 3836
235 Ga0068856_100120678 3300005614 Bacteria 2623
236 Ga0068856_100158414 3300005614 Bacteria 2274
237 Ga0068856_100220034 3300005614 Bacteria 1914
238 Ga0068856_100477087 3300005614 Bacteria 1268
239 Ga0070702_100009321 3300005615 Bacteria 4801
240 Ga0068852_100052092 3300005616 Unclassified 3516
241 Ga0068852_100102856 3300005616 Bacteria 2582
242 Ga0068859_100000939 3300005617 Bacteria 29832
243 Ga0068859_100005531 3300005617 Bacteria 12867
244 Ga0068859_100162576 3300005617 Bacteria 2312
245 Ga0068859_100244109 3300005617 Bacteria 1885
246 Ga0068859_100417281 3300005617 Bacteria 1438
247 Ga0068864_100000369 3300005618 Bacteria 39200
248 Ga0068864_100008228 3300005618 Bacteria 8603
249 Ga0068864_100032790 3300005618 Unclassified 4415
250 Ga0068864_100198148 3300005618 Unclassified 1844
251 Ga0068864_100243346 3300005618 Bacteria 1667
252 Ga0068866_10003414 3300005718 Bacteria 6511
253 Ga0068866_10009998 3300005718 Unclassified 4052
254 Ga0068866_10149758 3300005718 Bacteria 1350
255 Ga0068861_100009849 3300005719 Bacteria 6609
256 Ga0068861_100172783 3300005719 Bacteria 1792
257 Ga0068861_100360143 3300005719 Bacteria 1279
258 Ga0068851_10005710 3300005834 Bacteria 5658
259 Ga0068870_10000935 3300005840 Bacteria 11452
260 Ga0068863_100006532 3300005841 Bacteria 11443
261 Ga0068863_100023970 3300005841 Bacteria 5823
262 Ga0068863_100050601 3300005841 Bacteria 3938
263 Ga0068863_100160860 3300005841 Bacteria 2151
264 Ga0068858_100002175 3300005842 Bacteria 19870
265 Ga0068858_100005150 3300005842 Bacteria 12810
266 Ga0068858_100024408 3300005842 Bacteria 5633
267 Ga0068858_100027668 3300005842 Bacteria 5268
268 Ga0068858_100078685 3300005842 Bacteria 3064
269 Ga0068860_100061945 3300005843 Bacteria 3555
270 Ga0068860_100065633 3300005843 Unclassified 3446
271 Ga0068860_100091141 3300005843 Bacteria 2904
272 Ga0068860_100110187 3300005843 Bacteria 2631
273 Ga0068860_100170019 3300005843 Bacteria 2105
274 Ga0068860_100355061 3300005843 Bacteria 1443
275 Ga0068860_100488859 3300005843 Bacteria 1227
276 Ga0068862_100015615 3300005844 Bacteria 6308
277 Ga0068862_100024780 3300005844 Bacteria 5034
278 Ga0081455_10008282 3300005937 Bacteria 10834
279 Ga0081455_10301905 3300005937 Bacteria 1148
280 Ga0081540_1026668 3300005983 Unclassified 3291
281 Ga0081539_10001175 3300005985 Bacteria 47406
282 Ga0070717_10001830 3300006028 Bacteria 14861
283 Ga0070717_10002609 3300006028 Bacteria 12710
284 Ga0070717_10004387 3300006028 Bacteria 10182
285 Ga0070717_10007529 3300006028 Bacteria 8089
286 Ga0070717_10016823 3300006028 Bacteria 5676
287 Ga0070717_10035619 3300006028 Bacteria 4031
288 Ga0070717_10047746 3300006028 Bacteria 3509
289 Ga0070717_10061452 3300006028 Bacteria 3113
290 Ga0070717_10111940 3300006028 Bacteria 2329
291 Ga0070717_10165616 3300006028 Bacteria 1920
292 Ga0070717_10216772 3300006028 Bacteria 1681
293 Ga0070717_10224788 3300006028 Bacteria 1651
294 Ga0070715_10005347 3300006163 Unclassified 4276
295 Ga0070715_10018053 3300006163 Bacteria 2682
296 Ga0070715_10032661 3300006163 Bacteria 2122
297 Ga0070716_100008843 3300006173 Bacteria 5004
298 Ga0070716_100082439 3300006173 Bacteria 1923
299 Ga0070712_100001229 3300006175 Bacteria 15482
300 Ga0070712_100005202 3300006175 Bacteria 8045
301 Ga0070712_100006553 3300006175 Bacteria 7226
302 Ga0070712_100006918 3300006175 Bacteria 7067
303 Ga0070712_100007031 3300006175 Bacteria 7015
304 Ga0070712_100010851 3300006175 Bacteria 5761
305 Ga0070712_100015260 3300006175 Bacteria 4941
306 Ga0070712_100191397 3300006175 Bacteria 1601
307 Ga0097621_100000034 3300006237 Bacteria 69159
308 Ga0097621_100000908 3300006237 Bacteria 20694
309 Ga0097621_100010855 3300006237 Bacteria 6684
310 Ga0097621_100039276 3300006237 Bacteria 3801
311 Ga0097621_100049009 3300006237 Bacteria 3430
312 Ga0097621_100049426 3300006237 Unclassified 3416
313 Ga0097621_100076264 3300006237 Bacteria 2781
314 Ga0097621_100247316 3300006237 Bacteria 1561
315 Ga0097621_100444465 3300006237 Unclassified 1167
316 Ga0068871_100000233 3300006358 Bacteria 39441
317 Ga0068871_100000444 3300006358 Bacteria 28514
318 Ga0068871_100003756 3300006358 Bacteria 10457
319 Ga0068871_100005759 3300006358 Bacteria 8700
320 Ga0068871_100009308 3300006358 Bacteria 7110
321 Ga0068871_100080692 3300006358 Bacteria 2694
322 Ga0068871_100091447 3300006358 Bacteria 2536
323 Ga0068871_100252942 3300006358 Unclassified 1535
324 Ga0075428_100000607 3300006844 Bacteria 36552
325 Ga0075428_100069652 3300006844 Bacteria 3845
326 Ga0075428_100131714 3300006844 Bacteria 2719
327 Ga0075428_100224083 3300006844 Bacteria 2030
328 Ga0075431_100017181 3300006847 Bacteria 7352
329 Ga0075431_100120429 3300006847 Bacteria 2708
330 Ga0075431_100130750 3300006847 Bacteria 2589
331 Ga0075431_100210048 3300006847 Bacteria 1989
332 Ga0075431_100227038 3300006847 Bacteria 1903
333 Ga0075431_100303010 3300006847 Bacteria 1614
334 Ga0075433_10149908 3300006852 Bacteria 2074
335 Ga0075433_10171943 3300006852 Bacteria 1928
336 Ga0075434_100001079 3300006871 Bacteria 22322
337 Ga0075434_100038540 3300006871 Bacteria 4733
338 Ga0075434_100147812 3300006871 Bacteria 2370
339 Ga0075434_100188356 3300006871 Bacteria 2083
340 Ga0068865_100002230 3300006881 Bacteria 11411
341 Ga0068865_100006642 3300006881 Bacteria 7077
342 Ga0068865_100044236 3300006881 Unclassified 3047
343 Ga0075436_100001547 3300006914 Bacteria 15710
344 Ga0075436_100003577 3300006914 Bacteria 10648
345 Ga0075436_100006024 3300006914 Bacteria 8324
346 Ga0075436_100007392 3300006914 Bacteria 7513
347 Ga0075436_100080970 3300006914 Unclassified 2251
348 Ga0075436_100142659 3300006914 Bacteria 1684
349 Ga0097620_100000939 3300006931 Bacteria 29832
350 Ga0097620_100005531 3300006931 Bacteria 12867
351 Ga0097620_100162582 3300006931 Bacteria 2312
352 Ga0097620_100244113 3300006931 Bacteria 1885
353 Ga0097620_100417257 3300006931 Bacteria 1438
354 Ga0075435_100010144 3300007076 Bacteria 6879
355 Ga0099794_10144830 3300007265 Bacteria 1204
356 Ga0105251_10100663 3300009011 Unclassified 1321
357 Ga0105250_10009360 3300009092 Bacteria 4130
358 Ga0105240_10000161 3300009093 Bacteria 137359
359 Ga0105240_10006455 3300009093 Bacteria 17235
360 Ga0105240_10034509 3300009093 Bacteria 6525
361 Ga0105240_10065144 3300009093 Bacteria 4524
362 Ga0105240_10116022 3300009093 Bacteria 3231
363 Ga0105240_10128678 3300009093 Bacteria 3040
364 Ga0105240_10152642 3300009093 Unclassified 2749
365 Ga0105240_10206913 3300009093 Bacteria 2296
366 Ga0105240_10239535 3300009093 Bacteria 2104
367 Ga0105240_10322798 3300009093 Bacteria 1759
368 Ga0105240_10338304 3300009093 Bacteria 1710
369 Ga0105240_10735834 3300009093 Bacteria 1073
370 Ga0111539_10000455 3300009094 Bacteria 51281
371 Ga0111539_10026226 3300009094 Bacteria 7130
372 Ga0111539_10036740 3300009094 Bacteria 5919
373 Ga0111539_10060226 3300009094 Bacteria 4499
374 Ga0111539_10147796 3300009094 Bacteria 2751
375 Ga0111539_10214441 3300009094 Bacteria 2243
376 Ga0111539_10442945 3300009094 Bacteria 1512
377 Ga0105245_10000624 3300009098 Bacteria 32143
378 Ga0105245_10007043 3300009098 Bacteria 9863
379 Ga0105245_10041692 3300009098 Bacteria 4092
380 Ga0105245_10058681 3300009098 Bacteria 3464
381 Ga0105245_10083479 3300009098 Unclassified 2925
382 Ga0105245_10101680 3300009098 Bacteria 2661
383 Ga0105245_10281561 3300009098 Bacteria 1625
384 Ga0105247_10001507 3300009101 Bacteria 16650
385 Ga0105247_10024056 3300009101 Bacteria 3668
386 Ga0105247_10089205 3300009101 Bacteria 1955
387 Ga0105247_10093622 3300009101 Bacteria 1910
388 Ga0114129_10004180 3300009147 Bacteria 20396
389 Ga0114129_10235763 3300009147 Bacteria 2462
390 Ga0105243_10439729 3300009148 Bacteria 1221
391 Ga0105241_10002126 3300009174 Bacteria 14978
392 Ga0105241_10025623 3300009174 Bacteria 4384
393 Ga0105241_10117677 3300009174 Unclassified 2136
394 Ga0105241_10154538 3300009174 Bacteria 1880
395 Ga0105242_10016443 3300009176 Bacteria 5752
396 Ga0105242_10053867 3300009176 Bacteria 3286
397 Ga0105242_10099580 3300009176 Unclassified 2460
398 Ga0105242_10115686 3300009176 Bacteria 2293
399 Ga0105242_10188353 3300009176 Bacteria 1825
400 Ga0105242_10376543 3300009176 Unclassified 1318
401 Ga0105248_10005836 3300009177 Bacteria 13532
402 Ga0105248_10072101 3300009177 Unclassified 3882
403 Ga0105248_10081845 3300009177 Bacteria 3630
404 Ga0105248_10091853 3300009177 Unclassified 3419
405 Ga0105248_10112311 3300009177 Bacteria 3073
406 Ga0105248_10270875 3300009177 Bacteria 1912
407 Ga0105237_10008538 3300009545 Bacteria 11072
408 Ga0105237_10019697 3300009545 Bacteria 6965
409 Ga0105237_10029884 3300009545 Bacteria 5535
410 Ga0105237_10151073 3300009545 Bacteria 2319
411 Ga0105237_10164956 3300009545 Bacteria 2214
412 Ga0105238_10000464 3300009551 Bacteria 42663
413 Ga0105238_10016655 3300009551 Bacteria 7446
414 Ga0105238_10049855 3300009551 Bacteria 4215
415 Ga0105238_10091729 3300009551 Bacteria 3025
416 Ga0105238_10155748 3300009551 Bacteria 2260
417 Ga0105238_10200457 3300009551 Unclassified 1971
418 Ga0105249_10004737 3300009553 Bacteria 11742
419 Ga0105249_10090776 3300009553 Bacteria 2857
420 Ga0105249_10100646 3300009553 Bacteria 2718
421 Ga0105249_10406595 3300009553 Bacteria 1393
422 Ga0105239_10053632 3300010375 Bacteria 4422
423 Ga0105239_10054173 3300010375 Bacteria 4399
424 Ga0105239_10086301 3300010375 Bacteria 3459
425 Ga0105239_10248862 3300010375 Unclassified 1996
426 Ga0105246_10001854 3300011119 Bacteria 12705
427 Ga0105246_10034407 3300011119 Unclassified 3376
428 Ga0105246_10070999 3300011119 Bacteria 2451
429 Ga0157373_10001119 3300013100 Bacteria 20585
430 Ga0157373_10017190 3300013100 Bacteria 5267
431 Ga0157373_10043524 3300013100 Unclassified 3207
432 Ga0157373_10049631 3300013100 Bacteria 2990
433 Ga0157373_10058555 3300013100 Unclassified 2731
434 Ga0157373_10177962 3300013100 Bacteria 1497
435 Ga0157371_10012556 3300013102 Bacteria 6470
436 Ga0157371_10013207 3300013102 Bacteria 6286
437 Ga0157370_10016231 3300013104 Bacteria 7545
438 Ga0157370_10158393 3300013104 Bacteria 2107
439 Ga0157370_10289527 3300013104 Bacteria 1513
440 Ga0157370_10469306 3300013104 Bacteria 1157
441 Ga0157369_10000264 3300013105 Bacteria 70855
442 Ga0157369_10010181 3300013105 Bacteria 10729
443 Ga0157369_10014322 3300013105 Bacteria 8957
444 Ga0157369_10078699 3300013105 Bacteria 3532
445 Ga0157369_10102065 3300013105 Bacteria 3057
446 Ga0157369_10150938 3300013105 Unclassified 2455
447 Ga0157369_10225621 3300013105 Bacteria 1960
448 Ga0157369_10256053 3300013105 Bacteria 1826
449 Ga0157369_10284298 3300013105 Bacteria 1722
450 Ga0157369_10354439 3300013105 Bacteria 1524
451 Ga0157369_10362392 3300013105 Bacteria 1505
452 Ga0157369_10365070 3300013105 Bacteria 1499
453 Ga0157369_10418488 3300013105 Bacteria 1389
454 Ga0157374_10000249 3300013296 Bacteria 49808
455 Ga0157374_10000496 3300013296 Bacteria 35685
456 Ga0157374_10001107 3300013296 Bacteria 23202
457 Ga0157374_10005920 3300013296 Bacteria 10330
458 Ga0157374_10024491 3300013296 Bacteria 5412
459 Ga0157374_10033131 3300013296 Bacteria 4712
460 Ga0157374_10078774 3300013296 Bacteria 3121
461 Ga0157374_10088066 3300013296 Bacteria 2956
462 Ga0157374_10125558 3300013296 Bacteria 2480
463 Ga0157374_10229305 3300013296 Bacteria 1824
464 Ga0157378_10000008 3300013297 Bacteria 162605
465 Ga0157378_10000145 3300013297 Bacteria 66719
466 Ga0157378_10002765 3300013297 Bacteria 15636
467 Ga0157378_10003358 3300013297 Bacteria 14239
468 Ga0157378_10045872 3300013297 Bacteria 3884
469 Ga0157378_10093841 3300013297 Unclassified 2732
470 Ga0157378_10124723 3300013297 Bacteria 2378
471 Ga0157378_10255933 3300013297 Unclassified 1678
472 Ga0163162_10000777 3300013306 Bacteria 29697
473 Ga0163162_10024543 3300013306 Bacteria 5952
474 Ga0163162_10092330 3300013306 Bacteria 3111
475 Ga0163162_10145019 3300013306 Bacteria 2490
476 Ga0163162_10288342 3300013306 Bacteria 1773
477 Ga0157372_10000436 3300013307 Bacteria 45959
478 Ga0157372_10000611 3300013307 Bacteria 39068
479 Ga0157372_10001696 3300013307 Bacteria 23852
480 Ga0157372_10004250 3300013307 Bacteria 15312
481 Ga0157372_10008298 3300013307 Bacteria 11043
482 Ga0157372_10019394 3300013307 Bacteria 7330
483 Ga0157372_10049516 3300013307 Bacteria 4671
484 Ga0157372_10065331 3300013307 Bacteria 4084
485 Ga0157372_10078438 3300013307 Unclassified 3732
486 Ga0157372_10122925 3300013307 Unclassified 2983
487 Ga0157372_10187711 3300013307 Bacteria 2394
488 Ga0157372_10247006 3300013307 Unclassified 2071
489 Ga0157375_10003580 3300013308 Bacteria 13482
490 Ga0157375_10015367 3300013308 Bacteria 6850
491 Ga0157375_10030491 3300013308 Bacteria 5085
492 Ga0157375_10043801 3300013308 Bacteria 4343
493 Ga0157375_10356373 3300013308 Bacteria 1629
494 Ga0163163_10020441 3300014325 Bacteria 6234
495 Ga0163163_10025274 3300014325 Bacteria 5662
496 Ga0163163_10059974 3300014325 Bacteria 3765
497 Ga0163163_10072291 3300014325 Bacteria 3438
498 Ga0163163_10110393 3300014325 Unclassified 2778
499 Ga0163163_10124386 3300014325 Bacteria 2615
500 Ga0163163_10157889 3300014325 Bacteria 2313
501 Ga0163163_10360639 3300014325 Bacteria 1510
502 Ga0163163_10387049 3300014325 Bacteria 1456
503 Ga0163163_10475204 3300014325 Bacteria 1311
504 Ga0157380_10006237 3300014326 Bacteria 8375
505 Ga0157380_10535390 3300014326 Bacteria 1146
506 Ga0182008_10044746 3300014497 Unclassified 2202
507 Ga0157377_10007969 3300014745 Bacteria 5144
508 Ga0157379_10001812 3300014968 Bacteria 17646
509 Ga0157379_10012865 3300014968 Bacteria 7318
510 Ga0157379_10026975 3300014968 Bacteria 5112
511 Ga0157379_10055120 3300014968 Bacteria 3552
512 Ga0157379_10060793 3300014968 Bacteria 3378
513 Ga0157379_10175320 3300014968 Bacteria 1936
514 Ga0157376_10004063 3300014969 Bacteria 10125
515 Ga0157376_10042115 3300014969 Unclassified 3742
516 Ga0157376_10049476 3300014969 Unclassified 3482
517 Ga0157376_10202439 3300014969 Unclassified 1828
518 Ga0157376_10272741 3300014969 Bacteria 1590
519 Ga0182006_1021588 3300015261 Unclassified 2683
520 Ga0182006_1072942 3300015261 Unclassified 1268
521 Ga0182007_10002409 3300015262 Bacteria 9337
522 Ga0182007_10039680 3300015262 Bacteria 1574
523 Ga0182005_1009264 3300015265 Unclassified 2869
524 Ga0163161_10051815 3300017792 Bacteria 2975
525 Ga0206354_10265616 3300020081 Bacteria 1731
526 Ga0213873_10020908 3300021358 Bacteria 1534
527 Ga0213872_10010735 3300021361 Bacteria 4351
528 Ga0213872_10014357 3300021361 Bacteria 3695
529 Ga0213871_10004023 3300021441 Bacteria 2899
530 Ga0224712_10026682 3300022467 Bacteria 2045
531 Ga0224712_10044458 3300022467 Bacteria 1694
532 Ga0224570_100565 3300022730 Bacteria 2931
533 Ga0224572_1000257 3300024225 Bacteria 5423
534 Ga0228598_1001074 3300024227 Bacteria 6015
535 Ga0228598_1001256 3300024227 Bacteria 5575
536 Ga0207656_10036251 3300025321 Unclassified 2069
537 Ga0207692_10063997 3300025898 Bacteria 1913
538 Ga0207642_10005304 3300025899 Bacteria 4198
539 Ga0207642_10018358 3300025899 Bacteria 2683
540 Ga0207710_10075068 3300025900 Bacteria 1557
541 Ga0207688_10003069 3300025901 Bacteria 9113
542 Ga0207647_10002063 3300025904 Bacteria 15352
543 Ga0207647_10016048 3300025904 Bacteria 5118
544 Ga0207647_10049796 3300025904 Unclassified 2597
545 Ga0207647_10098194 3300025904 Bacteria 1740
546 Ga0207685_10003074 3300025905 Unclassified 3980
547 Ga0207685_10038958 3300025905 Bacteria 1761
548 Ga0207699_10009701 3300025906 Bacteria 4805
549 Ga0207699_10012015 3300025906 Bacteria 4393
550 Ga0207699_10050642 3300025906 Unclassified 2450
551 Ga0207699_10067586 3300025906 Bacteria 2173
552 Ga0207699_10094136 3300025906 Unclassified 1887
553 Ga0207699_10146111 3300025906 Bacteria 1559
554 Ga0207699_10252550 3300025906 Bacteria 1216
555 Ga0207699_10334304 3300025906 Bacteria 1066
556 Ga0207645_10000901 3300025907 Bacteria 24637
557 Ga0207645_10006268 3300025907 Bacteria 8547
558 Ga0207643_10000172 3300025908 Bacteria 44395
559 Ga0207705_10045267 3300025909 Bacteria 3163
560 Ga0207684_10000768 3300025910 Bacteria 37301
561 Ga0207684_10005976 3300025910 Bacteria 11136
562 Ga0207684_10016448 3300025910 Bacteria 6351
563 Ga0207684_10017175 3300025910 Bacteria 6210
564 Ga0207684_10062474 3300025910 Unclassified 3163
565 Ga0207684_10094980 3300025910 Unclassified 2544
566 Ga0207684_10103525 3300025910 Bacteria 2434
567 Ga0207654_10029582 3300025911 Bacteria 3001
568 Ga0207654_10032668 3300025911 Bacteria 2878
569 Ga0207654_10057441 3300025911 Bacteria 2261
570 Ga0207707_10000266 3300025912 Bacteria 56336
571 Ga0207707_10003379 3300025912 Bacteria 14162
572 Ga0207707_10007460 3300025912 Bacteria 9528
573 Ga0207707_10011097 3300025912 Bacteria 7834
574 Ga0207707_10021147 3300025912 Bacteria 5686
575 Ga0207707_10065929 3300025912 Bacteria 3153
576 Ga0207707_10101188 3300025912 Bacteria 2518
577 Ga0207707_10177050 3300025912 Bacteria 1863
578 Ga0207695_10000693 3300025913 Bacteria 66031
579 Ga0207695_10003740 3300025913 Bacteria 21155
580 Ga0207695_10007402 3300025913 Bacteria 13995
581 Ga0207695_10016105 3300025913 Bacteria 8770
582 Ga0207695_10037550 3300025913 Bacteria 5226
583 Ga0207695_10115452 3300025913 Bacteria 2659
584 Ga0207695_10178963 3300025913 Bacteria 2042
585 Ga0207695_10373813 3300025913 Unclassified 1311
586 Ga0207695_10480551 3300025913 Bacteria 1124
587 Ga0207671_10027073 3300025914 Bacteria 4289
588 Ga0207671_10064810 3300025914 Bacteria 2716
589 Ga0207671_10133740 3300025914 Bacteria 1905
590 Ga0207693_10000067 3300025915 Bacteria 91025
591 Ga0207693_10000098 3300025915 Bacteria 77389
592 Ga0207693_10000884 3300025915 Bacteria 26840
593 Ga0207693_10001517 3300025915 Bacteria 20489
594 Ga0207693_10012227 3300025915 Bacteria 6935
595 Ga0207693_10016140 3300025915 Bacteria 5974
596 Ga0207693_10020519 3300025915 Bacteria 5255
597 Ga0207693_10044284 3300025915 Bacteria 3498
598 Ga0207693_10079310 3300025915 Bacteria 2569
599 Ga0207693_10112274 3300025915 Bacteria 2138
600 Ga0207693_10237676 3300025915 Bacteria 1430
601 Ga0207663_10007568 3300025916 Bacteria 5637
602 Ga0207663_10014875 3300025916 Bacteria 4276
603 Ga0207663_10031992 3300025916 Bacteria 3119
604 Ga0207663_10041091 3300025916 Bacteria 2816
605 Ga0207663_10087264 3300025916 Unclassified 2060
606 Ga0207663_10089454 3300025916 Unclassified 2039
607 Ga0207663_10095862 3300025916 Bacteria 1980
608 Ga0207660_10002995 3300025917 Bacteria 11061
609 Ga0207660_10061997 3300025917 Bacteria 2693
610 Ga0207660_10074438 3300025917 Unclassified 2479
611 Ga0207660_10178146 3300025917 Unclassified 1649
612 Ga0207660_10285284 3300025917 Bacteria 1311
613 Ga0207662_10002090 3300025918 Bacteria 9922
614 Ga0207662_10174525 3300025918 Bacteria 1380
615 Ga0207657_10000660 3300025919 Bacteria 36719
616 Ga0207657_10002292 3300025919 Bacteria 20729
617 Ga0207657_10016937 3300025919 Bacteria 7013
618 Ga0207649_10001125 3300025920 Bacteria 16224
619 Ga0207649_10023104 3300025920 Bacteria 3598
620 Ga0207649_10156878 3300025920 Unclassified 1573
621 Ga0207652_10001598 3300025921 Bacteria 19947
622 Ga0207652_10003545 3300025921 Bacteria 12882
623 Ga0207652_10038171 3300025921 Bacteria 4069
624 Ga0207652_10064198 3300025921 Unclassified 3177
625 Ga0207652_10106214 3300025921 Bacteria 2485
626 Ga0207652_10139802 3300025921 Unclassified 2165
627 Ga0207646_10000298 3300025922 Bacteria 67489
628 Ga0207646_10004709 3300025922 Bacteria 14704
629 Ga0207646_10045908 3300025922 Bacteria 3920
630 Ga0207646_10046574 3300025922 Bacteria 3890
631 Ga0207646_10077799 3300025922 Bacteria 2964
632 Ga0207646_10102475 3300025922 Bacteria 2566
633 Ga0207646_10320823 3300025922 Bacteria 1400
634 Ga0207681_10064112 3300025923 Bacteria 2536
635 Ga0207681_10228297 3300025923 Unclassified 1444
636 Ga0207694_10002762 3300025924 Bacteria 14177
637 Ga0207694_10029240 3300025924 Unclassified 4204
638 Ga0207694_10065154 3300025924 Bacteria 2840
639 Ga0207694_10122260 3300025924 Unclassified 2079
640 Ga0207694_10245779 3300025924 Bacteria 1463
641 Ga0207650_10000059 3300025925 Bacteria 151427
642 Ga0207659_10145002 3300025926 Bacteria 1848
643 Ga0207659_10157992 3300025926 Bacteria 1777
644 Ga0207687_10006015 3300025927 Bacteria 8029
645 Ga0207687_10009003 3300025927 Bacteria 6526
646 Ga0207687_10009700 3300025927 Bacteria 6297
647 Ga0207687_10103813 3300025927 Bacteria 2097
648 Ga0207700_10008946 3300025928 Bacteria 6234
649 Ga0207700_10015310 3300025928 Bacteria 5053
650 Ga0207700_10018505 3300025928 Bacteria 4683
651 Ga0207700_10018692 3300025928 Bacteria 4663
652 Ga0207700_10021041 3300025928 Unclassified 4446
653 Ga0207700_10024988 3300025928 Bacteria 4142
654 Ga0207700_10063197 3300025928 Unclassified 2815
655 Ga0207700_10069925 3300025928 Unclassified 2696
656 Ga0207700_10099797 3300025928 Unclassified 2312
657 Ga0207700_10144330 3300025928 Bacteria 1960
658 Ga0207700_10151979 3300025928 Unclassified 1914
659 Ga0207700_10186426 3300025928 Bacteria 1741
660 Ga0207700_10217945 3300025928 Unclassified 1616
661 Ga0207700_10296062 3300025928 Unclassified 1396
662 Ga0207664_10000212 3300025929 Bacteria 44097
663 Ga0207664_10066656 3300025929 Bacteria 2886
664 Ga0207664_10079541 3300025929 Unclassified 2661
665 Ga0207664_10138936 3300025929 Unclassified 2053
666 Ga0207664_10138971 3300025929 Unclassified 2052
667 Ga0207664_10314724 3300025929 Bacteria 1380
668 Ga0207664_10360700 3300025929 Bacteria 1288
669 Ga0207664_10448275 3300025929 Unclassified 1152
670 Ga0207690_10089161 3300025932 Unclassified 2174
671 Ga0207706_10000098 3300025933 Bacteria 91173
672 Ga0207706_10000723 3300025933 Bacteria 34501
673 Ga0207686_10069416 3300025934 Unclassified 2260
674 Ga0207686_10085966 3300025934 Bacteria 2064
675 Ga0207670_10053185 3300025936 Bacteria 2727
676 Ga0207670_10205381 3300025936 Bacteria 1499
677 Ga0207670_10326769 3300025936 Bacteria 1208
678 Ga0207704_10048954 3300025938 Bacteria 2538
679 Ga0207704_10075112 3300025938 Bacteria 2160
680 Ga0207665_10020494 3300025939 Unclassified 4345
681 Ga0207665_10037720 3300025939 Bacteria 3217
682 Ga0207665_10067103 3300025939 Bacteria 2442
683 Ga0207665_10104350 3300025939 Bacteria 1984
684 Ga0207691_10001129 3300025940 Bacteria 26514
685 Ga0207711_10004346 3300025941 Bacteria 12093
686 Ga0207711_10035400 3300025941 Bacteria 4232
687 Ga0207711_10074950 3300025941 Bacteria 2944
688 Ga0207711_10114209 3300025941 Bacteria 2405
689 Ga0207711_10143206 3300025941 Bacteria 2152
690 Ga0207689_10000353 3300025942 Bacteria 43010
691 Ga0207689_10038519 3300025942 Unclassified 3959
692 Ga0207689_10098949 3300025942 Bacteria 2396
693 Ga0207689_10141747 3300025942 Bacteria 1980
694 Ga0207661_10021989 3300025944 Bacteria 4792
695 Ga0207661_10096946 3300025944 Bacteria 2468
696 Ga0207679_10000415 3300025945 Bacteria 30616
697 Ga0207679_10031074 3300025945 Bacteria 3735
698 Ga0207679_10216949 3300025945 Bacteria 1608
699 Ga0207667_10000413 3300025949 Bacteria 57875
700 Ga0207667_10006238 3300025949 Bacteria 14469
701 Ga0207667_10012296 3300025949 Bacteria 9876
702 Ga0207667_10018332 3300025949 Bacteria 7852
703 Ga0207667_10066067 3300025949 Bacteria 3771
704 Ga0207667_10083898 3300025949 Bacteria 3299
705 Ga0207667_10148903 3300025949 Unclassified 2409
706 Ga0207667_10326491 3300025949 Bacteria 1567
707 Ga0207667_10348265 3300025949 Bacteria 1511
708 Ga0207712_10007011 3300025961 Bacteria 7108
709 Ga0207712_10142518 3300025961 Bacteria 1841
710 Ga0207712_10198434 3300025961 Bacteria 1589
711 Ga0207712_10268382 3300025961 Bacteria 1387
712 Ga0207668_10008891 3300025972 Bacteria 6007
713 Ga0207640_10060567 3300025981 Bacteria 2503
714 Ga0207640_10079021 3300025981 Unclassified 2241
715 Ga0207640_10089505 3300025981 Bacteria 2128
716 Ga0207640_10149792 3300025981 Unclassified 1712
717 Ga0207677_10001543 3300026023 Bacteria 12182
718 Ga0207677_10001745 3300026023 Bacteria 11515
719 Ga0207677_10003837 3300026023 Bacteria 7995
720 Ga0207677_10004382 3300026023 Bacteria 7564
721 Ga0207677_10011658 3300026023 Bacteria 5018
722 Ga0207677_10078138 3300026023 Bacteria 2362
723 Ga0207677_10192605 3300026023 Bacteria 1614
724 Ga0207703_10006204 3300026035 Bacteria 9564
725 Ga0207703_10007234 3300026035 Bacteria 8827
726 Ga0207703_10010063 3300026035 Bacteria 7414
727 Ga0207703_10050625 3300026035 Unclassified 3363
728 Ga0207703_10069955 3300026035 Bacteria 2896
729 Ga0207703_10105216 3300026035 Bacteria 2398
730 Ga0207703_10373062 3300026035 Bacteria 1318
731 Ga0207639_10016209 3300026041 Bacteria 5266
732 Ga0207639_10038468 3300026041 Unclassified 3559
733 Ga0207639_10077952 3300026041 Bacteria 2614
734 Ga0207678_10000581 3300026067 Bacteria 33440
735 Ga0207678_10006094 3300026067 Bacteria 10728
736 Ga0207708_10353370 3300026075 Bacteria 1206
737 Ga0207702_10000209 3300026078 Bacteria 69358
738 Ga0207702_10001199 3300026078 Bacteria 26302
739 Ga0207702_10003037 3300026078 Bacteria 15597
740 Ga0207702_10055790 3300026078 Bacteria 3352
741 Ga0207702_10073539 3300026078 Unclassified 2948
742 Ga0207702_10099952 3300026078 Unclassified 2558
743 Ga0207702_10222748 3300026078 Bacteria 1758
744 Ga0207702_10313036 3300026078 Unclassified 1493
745 Ga0207702_10396022 3300026078 Bacteria 1331
746 Ga0207702_10432168 3300026078 Bacteria 1275
747 Ga0207641_10000025 3300026088 Bacteria 247727
748 Ga0207641_10008027 3300026088 Bacteria 8749
749 Ga0207641_10020912 3300026088 Bacteria 5379
750 Ga0207641_10059041 3300026088 Bacteria 3266
751 Ga0207641_10063347 3300026088 Bacteria 3158
752 Ga0207641_10068485 3300026088 Bacteria 3044
753 Ga0207648_10003458 3300026089 Bacteria 16561
754 Ga0207648_10047694 3300026089 Bacteria 3753
755 Ga0207676_10000252 3300026095 Bacteria 46432
756 Ga0207676_10002695 3300026095 Bacteria 12631
757 Ga0207676_10008202 3300026095 Bacteria 7432
758 Ga0207676_10032451 3300026095 Bacteria 3935
759 Ga0207674_10000162 3300026116 Bacteria 79631
760 Ga0207674_10003030 3300026116 Bacteria 20822
761 Ga0207674_10042580 3300026116 Bacteria 4688
762 Ga0207674_10078029 3300026116 Bacteria 3317
763 Ga0207674_10127467 3300026116 Unclassified 2510
764 Ga0207674_10214815 3300026116 Bacteria 1872
765 Ga0207675_100017450 3300026118 Bacteria 6700
766 Ga0207675_100027963 3300026118 Bacteria 5251
767 Ga0207675_100078474 3300026118 Bacteria 3094
768 Ga0207683_10001306 3300026121 Bacteria 22515
769 Ga0207683_10083016 3300026121 Unclassified 2847
770 Ga0207698_10029146 3300026142 Bacteria 3948
771 Ga0207428_10000435 3300027907 Bacteria 51355
772 Ga0207428_10000846 3300027907 Bacteria 34463
773 Ga0207428_10041335 3300027907 Bacteria 3733
774 Ga0265356_1000857 3300028017 Bacteria 4995
775 Ga0268266_10010266 3300028379 Bacteria 8199
776 Ga0268264_10025084 3300028381 Unclassified 4872
777 Ga0268264_10050987 3300028381 Bacteria 3447
778 Ga0268264_10063001 3300028381 Bacteria 3116
779 Ga0268264_10066451 3300028381 Bacteria 3041
780 Ga0268264_10096896 3300028381 Bacteria 2556
781 Ga0268264_10307434 3300028381 Bacteria 1495
782 Ga0265338_10004251 3300028800 Bacteria 19463
783 Ga0265338_10024675 3300028800 Bacteria 6135
784 Ga0265338_10148870 3300028800 Unclassified 1821
785 Ga0265338_10196671 3300028800 Bacteria 1524
786 Ga0265762_1000116 3300030760 Bacteria 11753
787 Ga0265762_1001781 3300030760 Bacteria 3913
788 Ga0265760_10002278 3300031090 Bacteria 5612
789 Ga0265760_10002457 3300031090 Bacteria 5408
790 Ga0265760_10018115 3300031090 Bacteria 2025
791 Ga0265330_10005484 3300031235 Bacteria 6330
792 Ga0265325_10025527 3300031241 Bacteria 3207
793 Ga0265325_10047993 3300031241 Unclassified 2208
794 Ga0265339_10018777 3300031249 Bacteria 4071
795 Ga0265339_10019646 3300031249 Bacteria 3963
796 Ga0265339_10159198 3300031249 Bacteria 1137
797 Ga0265316_10041782 3300031344 Bacteria 3667
798 Ga0265316_10048446 3300031344 Bacteria 3354
799 Ga0265316_10113095 3300031344 Bacteria 2055
800 Ga0307408_100012830 3300031548 Bacteria 5558
801 Ga0307408_100110828 3300031548 Bacteria 2108
802 Ga0307408_100152467 3300031548 Bacteria 1826
803 Ga0307408_100194934 3300031548 Bacteria 1635
804 Ga0307408_100287197 3300031548 Bacteria 1372
805 Ga0265314_10004435 3300031711 Bacteria 13025
806 Ga0265314_10080937 3300031711 Bacteria 2142
807 Ga0265314_10169979 3300031711 Bacteria 1317
808 Ga0265342_10061692 3300031712 Bacteria 2208
809 Ga0307405_10036139 3300031731 Bacteria 2957
810 Ga0307405_10077866 3300031731 Bacteria 2156
811 Ga0307410_10004067 3300031852 Bacteria 7481
812 Ga0307410_10135625 3300031852 Bacteria 1814
813 Ga0307406_10081672 3300031901 Bacteria 2150
814 Ga0307407_10156535 3300031903 Bacteria 1487
815 Ga0307407_10181292 3300031903 Bacteria 1396
816 Ga0307412_10046266 3300031911 Bacteria 2850
817 Ga0307409_100030864 3300031995 Bacteria 3858
818 Ga0307416_100003885 3300032002 Bacteria 8894
819 Ga0307416_100040415 3300032002 Bacteria 3623
820 Ga0307416_100047412 3300032002 Bacteria 3401
821 Ga0307416_100061300 3300032002 Bacteria 3069
822 Ga0307416_100081440 3300032002 Bacteria 2737
823 Ga0307416_100117482 3300032002 Bacteria 2361
824 Ga0307416_100354754 3300032002 Bacteria 1486
825 Ga0307416_100463725 3300032002 Bacteria 1323
826 Ga0307411_10006952 3300032005 Bacteria 5711
827 Ga0307411_10125471 3300032005 Bacteria 1866
828 Ga0307411_10282574 3300032005 Bacteria 1322
829 Ga0307415_100010919 3300032126 Bacteria 5168
830 Ga0307415_100503072 3300032126 Bacteria 1060
831 Ga0316212_1003932 3300033547 Bacteria 2157
832 Ga0373926_0017457 3300035083 Bacteria 2463
833 Ga0373923_0001393 3300035111 Bacteria 6891
834 Ga0373923_0038824 3300035111 Bacteria 1953
835 Ga0373923_0090879 3300035111 Unclassified 1335
836 Ga0373936_0000319 3300035113 Bacteria 16274
837 Ga0373936_0090408 3300035113 Bacteria 1283
838 Ga0373945_0001313 3300035116 Bacteria 7543
839 Ga0373945_0060547 3300035116 Bacteria 1412
840 Ga0373956_0007158 3300035119 Bacteria 4491
841 Ga0373956_0073444 3300035119 Unclassified 1563
842 Ga0373943_0000016 3300035170 Bacteria 58099
843 Ga0373943_0016294 3300035170 Bacteria 3387
844 Ga0373943_0040390 3300035170 Bacteria 2252
845 Ga0373946_0019422 3300035171 Bacteria 2618
846 Ga0373924_0000248 3300035410 Bacteria 16512
847 Ga0373924_0003372 3300035410 Bacteria 5486
848 Ga0373924_0031217 3300035410 Bacteria 2141
849 Ga0373931_0007410 3300035691 Bacteria 5167
850 Ga0373931_0032147 3300035691 Bacteria 2714
851 Ga0373931_0045293 3300035691 Unclassified 2323
852 Ga0373935_0000864 3300035692 Bacteria 16342
853 Ga0373935_0003124 3300035692 Bacteria 9554
854 Ga0373935_0006632 3300035692 Bacteria 6916
855 Ga0373935_0010148 3300035692 Bacteria 5641
856 Ga0373935_0032320 3300035692 Unclassified 3252
857 Ga0373927_0000034 3300035695 Bacteria 103921
858 Ga0373927_0058122 3300035695 Unclassified 2501
859 Ga0373927_0072792 3300035695 Unclassified 2225
860 Ga0373927_0078965 3300035695 Bacteria 2131
861 Ga0373927_0111053 3300035695 Bacteria 1786
862 Ga0373933_0015818 3300035724 Bacteria 4210
863 Ga0373947_0000035 3300035725 Bacteria 68883
864 Ga0373947_0017382 3300035725 Bacteria 4137
865 Ga0373947_0039779 3300035725 Bacteria 2799
866 Ga0373947_0087873 3300035725 Bacteria 1934
867 Ga0373937_0000090 3300036401 Bacteria 84561
868 Ga0373937_0049245 3300036401 Bacteria 3859
869 Ga0373937_0076551 3300036401 Bacteria 3090
870 Ga0373937_0440853 3300036401 Unclassified 1236
871 Ga0373937_0647934 3300036401 Bacteria 1002
872 Ga0373925_0000714 3300037068 Bacteria 31008
873 Ga0373925_0005732 3300037068 Bacteria 9234
874 Ga0373925_0006084 3300037068 Bacteria 8925
875 Ga0373925_0021655 3300037068 Bacteria 4685
876 Ga0373925_0048158 3300037068 Bacteria 3175
877 Ga0373925_0127295 3300037068 Bacteria 1983
878 Ga0373925_0178622 3300037068 Unclassified 1679
879 Ga0373925_0226782 3300037068 Bacteria 1493
880 Ga0395900_0460942 3300037418 Bacteria 1226
881 Ga0395898_0049727 3300037466 Bacteria 4107
882 Ga0395898_0177640 3300037466 Bacteria 2035
883 Ga0395905_0003951 3300037471 Bacteria 15596
884 Ga0395905_0026624 3300037471 Bacteria 5452
885 Ga0395905_0070863 3300037471 Bacteria 3267
886 Ga0395905_0090299 3300037471 Bacteria 2872
887 Ga0395905_0092192 3300037471 Unclassified 2841
888 Ga0436364_0366631 3300037853 Bacteria 1687
889 Ga0395901_0219459 3300038443 Unclassified 1988
890 Ga0436360_0174134 3300039438 Unclassified 3345
891 Ga0436361_0534152 3300039447 Bacteria 2191
892 Ga0436361_0620753 3300039447 Bacteria 4828
893 Ga0436361_0635090 3300039447 Bacteria 20791
894 Ga0436361_0706896 3300039447 Bacteria 2278
895 Ga0436363_0375979 3300039450 Bacteria 2267
896 Ga0436363_1252730 3300039450 Bacteria 2815
897 Ga0436363_1383135 3300039450 Unclassified 2016
898 Ga0436363_1663027 3300039450 Bacteria 1869
899 Ga0436362_0906121 3300039453 Bacteria 1536
900 Ga0436362_1104320 3300039453 Bacteria 2121
901 Ga0436362_1148430 3300039453 Bacteria 7068
902 Ga0451853_2499464 3300041512 Bacteria 1342
903 Ga0439462_0031366 3300042015 Bacteria 1407
904 Ga0451577_0001555 3300042876 Bacteria 30103
905 Ga0451577_0113458 3300042876 Bacteria 2426
906 Ga0466969_0056413 3300044656 Bacteria 1918
907 Ga0466963_0005503 3300044694 Bacteria 7414
908 Ga0466963_0049233 3300044694 Unclassified 2786
909 Ga0466963_0049475 3300044694 Bacteria 2780
910 Ga0453684_0000289 3300044712 Bacteria 215476
911 Ga0453684_0019897 3300044712 Bacteria 10181
912 Ga0466957_0018353 3300044842 Bacteria 4108
913 Ga0466957_0095683 3300044842 Bacteria 1865
914 Ga0466957_0132345 3300044842 Bacteria 1599
915 Ga0466959_0033530 3300045049 Unclassified 3797
916 Ga0466959_0035415 3300045049 Bacteria 3692
917 Ga0466959_0209135 3300045049 Bacteria 1356
918 Ga0451576_0035560 3300045051 Bacteria 5283
919 Ga0451576_0420030 3300045051 Bacteria 1403
920 Ga0451576_0531076 3300045051 Bacteria 1236
921 Ga0466958_0026948 3300045836 Bacteria 3398
922 Ga0466958_0147300 3300045836 Unclassified 1484
923 Ga0466967_0055328 3300045976 Bacteria 3495
924 Ga0466967_0114172 3300045976 Bacteria 2486
925 Ga0495592_0139215 3300046454 Bacteria 1690
926 Ga0495629_0021849 3300046459 Bacteria 4566
927 Ga0495629_0077853 3300046459 Bacteria 2315
928 Ga0495580_0000354 3300046472 Bacteria 37390
929 Ga0495580_0001606 3300046472 Bacteria 19867
930 Ga0495580_0002290 3300046472 Bacteria 16705
931 Ga0495580_0004272 3300046472 Bacteria 12014
932 Ga0495580_0004478 3300046472 Bacteria 11736
933 Ga0495580_0019736 3300046472 Bacteria 5004
934 Ga0495580_0022694 3300046472 Bacteria 4614
935 Ga0495580_0023751 3300046472 Bacteria 4497
936 Ga0495580_0025920 3300046472 Unclassified 4279
937 Ga0495580_0046482 3300046472 Bacteria 3079
938 Ga0495580_0051886 3300046472 Bacteria 2898
939 Ga0495580_0078652 3300046472 Bacteria 2300
940 Ga0495580_0092740 3300046472 Bacteria 2102
941 Ga0495580_0098837 3300046472 Unclassified 2030
942 Ga0495580_0132859 3300046472 Bacteria 1726
943 Ga0495664_0049533 3300046477 Unclassified 2494
944 Ga0495594_0008908 3300046499 Bacteria 5175
945 Ga0495630_0001984 3300046517 Bacteria 14253
946 Ga0495630_0011837 3300046517 Bacteria 6322
947 Ga0495630_0026718 3300046517 Bacteria 4276
948 Ga0495630_0074146 3300046517 Unclassified 2563
949 Ga0495630_0120901 3300046517 Bacteria 1987
950 Ga0495666_0112078 3300046526 Unclassified 1281
951 Ga0495665_0014305 3300046531 Unclassified 4281
952 Ga0495587_0077896 3300046536 Bacteria 1924
953 Ga0495667_0043718 3300046559 Bacteria 2968
954 Ga0495635_0179857 3300046663 Unclassified 1438
955 Ga0495657_0220848 3300046675 Unclassified 1149
956 Ga0495599_0060721 3300046678 Bacteria 2364
957 Ga0495623_0039822 3300046679 Bacteria 3002
958 Ga0495658_0013179 3300046683 Bacteria 4206
959 Ga0495658_0035332 3300046683 Unclassified 2749
960 Ga0495669_0000991 3300046684 Bacteria 11866
961 Ga0495669_0002685 3300046684 Bacteria 7283
962 Ga0495669_0074677 3300046684 Bacteria 1550
963 Ga0495613_0000670 3300046689 Bacteria 27111
964 Ga0495613_0177997 3300046689 Bacteria 1507
965 Ga0495613_0178872 3300046689 Bacteria 1503
966 Ga0495613_0202417 3300046689 Bacteria 1399
967 Ga0495600_0016234 3300046809 Bacteria 4722
968 Ga0495600_0126297 3300046809 Bacteria 1664
969 Ga0495600_0133668 3300046809 Bacteria 1612
970 Ga0495581_0029073 3300047315 Bacteria 3204
971 Ga0495604_0028162 3300047317 Bacteria 4469
972 Ga0495604_0032592 3300047317 Unclassified 4129
973 Ga0495604_0042957 3300047317 Bacteria 3541
974 Ga0495636_0048202 3300047318 Bacteria 1780
975 Ga0495674_0016645 3300047319 Bacteria 6860
976 Ga0495674_0078187 3300047319 Bacteria 2843
977 Ga0495672_0055485 3300047320 Bacteria 2312
978 Ga0495675_0013233 3300047444 Bacteria 5207
979 Ga0495675_0090400 3300047444 Bacteria 1922
980 Ga0495677_0090568 3300047445 Bacteria 1152
981 Ga0495684_0009482 3300047471 Bacteria 7511
982 Ga0495684_0187855 3300047471 Bacteria 1529
983 Ga0495602_0103606 3300048088 Bacteria 2329
984 Ga0495614_0108478 3300048089 Unclassified 1218
985 Ga0496100_0038130 3300048903 Bacteria 3043
986 Ga0496101_0057320 3300048904 Bacteria 2818
987 Ga0496101_0109408 3300048904 Bacteria 2079
988 Ga0496101_0243345 3300048904 Bacteria 1400
989 Ga0496101_0281897 3300048904 Bacteria 1299
990 Ga0496102_0002608 3300048905 Bacteria 15350
991 Ga0496102_0026380 3300048905 Bacteria 5182
992 Ga0496102_0028897 3300048905 Bacteria 4956
993 Ga0496102_0042036 3300048905 Unclassified 4142
994 Ga0496102_0107895 3300048905 Unclassified 2593
995 Ga0496102_0224927 3300048905 Bacteria 1769
996 Ga0496103_0063905 3300048906 Bacteria 2293
997 Ga0496103_0137086 3300048906 Unclassified 1564
998 Ga0496104_0008792 3300048907 Bacteria 8978
999 Ga0496104_0091926 3300048907 Bacteria 2901
1000 Ga0496104_0163570 3300048907 Bacteria 2134
1001 Ga0496104_0299112 3300048907 Bacteria 1521
1002 Ga0496104_0326605 3300048907 Unclassified 1447
1003 Ga0496104_0457469 3300048907 Bacteria 1188
1004 Ga0496105_0000584 3300048908 Bacteria 24242
1005 Ga0496105_0053823 3300048908 Bacteria 3324
1006 Ga0496106_0085428 3300048909 Bacteria 2430
1007 Ga0496106_0353486 3300048909 Bacteria 1180
1008 Ga0496107_0139938 3300048910 Bacteria 1789
1009 Ga0496108_0000203 3300048911 Bacteria 54921
1010 Ga0496108_0135570 3300048911 Bacteria 2118
1011 Ga0496108_0306696 3300048911 Unclassified 1383
1012 Ga0496109_0000080 3300048912 Bacteria 100056
1013 Ga0496109_0000228 3300048912 Bacteria 54849
1014 Ga0496109_0031502 3300048912 Bacteria 4759
1015 Ga0496110_0000145 3300048913 Bacteria 41800
1016 Ga0496110_0023501 3300048913 Bacteria 5244
1017 Ga0496110_0076017 3300048913 Bacteria 2985
1018 Ga0496110_0179781 3300048913 Unclassified 1921
1019 Ga0496110_0479489 3300048913 Bacteria 1133
1020 Ga0496111_0003439 3300048914 Bacteria 9791
1021 Ga0496111_0060610 3300048914 Unclassified 2743
1022 Ga0496111_0115526 3300048914 Bacteria 1979
1023 Ga0496111_0187711 3300048914 Bacteria 1537
1024 Ga0496112_0000048 3300048915 Bacteria 84789
1025 Ga0496112_0001123 3300048915 Bacteria 19904
1026 Ga0496112_0002435 3300048915 Bacteria 14999
1027 Ga0496112_0004578 3300048915 Bacteria 11754
1028 Ga0496112_0006190 3300048915 Bacteria 10470
1029 Ga0496112_0008072 3300048915 Bacteria 9398
1030 Ga0496112_0063880 3300048915 Bacteria 3632
1031 Ga0496112_0129203 3300048915 Bacteria 2498
1032 Ga0496112_0173849 3300048915 Bacteria 2119
1033 Ga0496112_0212238 3300048915 Bacteria 1893
1034 Ga0496113_0001316 3300048916 Bacteria 13730
1035 Ga0496113_0002647 3300048916 Bacteria 10487
1036 Ga0496114_0021153 3300048917 Bacteria 5289
1037 Ga0496115_0051371 3300048918 Bacteria 3306
1038 Ga0496115_0086899 3300048918 Bacteria 2552
1039 Ga0496115_0260447 3300048918 Bacteria 1426
1040 Ga0496115_0357787 3300048918 Bacteria 1190
1041 Ga0496115_0471910 3300048918 Unclassified 1011
1042 Ga0496126_0006296 3300048929 Bacteria 13254
1043 Ga0501031_0038147 3300049568 Bacteria 3136
1044 Ga0501031_0065791 3300049568 Bacteria 2362
1045 Ga0501032_0018387 3300049569 Bacteria 4897
1046 Ga0501034_0013627 3300049571 Bacteria 8363
1047 Ga0501034_0040164 3300049571 Bacteria 4737
1048 Ga0501034_0072287 3300049571 Bacteria 3458
1049 Ga0501034_0305587 3300049571 Bacteria 1526
1050 Ga0501036_0030799 3300049572 Bacteria 4533
1051 Ga0501036_0062073 3300049572 Bacteria 3165
1052 Ga0501036_0194759 3300049572 Bacteria 1705
1053 Ga0501036_0395569 3300049572 Bacteria 1153
1054 Ga0501037_0108903 3300049573 Bacteria 1996
1055 Ga0501038_0034756 3300049574 Bacteria 4429
1056 Ga0501038_0057722 3300049574 Bacteria 3332
1057 Ga0501038_0057746 3300049574 Bacteria 3331
1058 Ga0501039_0003109 3300049575 Bacteria 12405
1059 Ga0501039_0089362 3300049575 Bacteria 2401
1060 Ga0501040_0201743 3300049576 Bacteria 1412
1061 Ga0501041_0072689 3300049577 Bacteria 2113
1062 Ga0501041_0205129 3300049577 Bacteria 1236
1063 Ga0501042_0014107 3300049578 Bacteria 5449
1064 Ga0501043_0015240 3300049579 Bacteria 6020
1065 Ga0501043_0243822 3300049579 Bacteria 1385
1066 Ga0501046_0028314 3300049580 Bacteria 4564
1067 Ga0501046_0029522 3300049580 Bacteria 4457
1068 Ga0501047_0017959 3300049581 Bacteria 6779
1069 Ga0501047_0061399 3300049581 Bacteria 3626
1070 Ga0501047_0287344 3300049581 Bacteria 1488
1071 Ga0501047_0400480 3300049581 Bacteria 1205
1072 Ga0501048_0090923 3300049582 Bacteria 2153
1073 Ga0501048_0135043 3300049582 Bacteria 1743
1074 Ga0501048_0335269 3300049582 Bacteria 1078
1075 Ga0501068_0019437 3300049584 Bacteria 3945
1076 Ga0501068_0056767 3300049584 Bacteria 2373
1077 Ga0501070_0141430 3300049586 Bacteria 1987
1078 Ga0501071_0016257 3300049587 Bacteria 5116
1079 Ga0501071_0138459 3300049587 Bacteria 1812
1080 Ga0501072_0068282 3300049588 Bacteria 2806
1081 Ga0501072_0070436 3300049588 Bacteria 2762
1082 Ga0501072_0076605 3300049588 Bacteria 2646
1083 Ga0501072_0187445 3300049588 Bacteria 1650
1084 Ga0501073_0097468 3300049589 Bacteria 2042
1085 Ga0501074_0140727 3300049590 Bacteria 1726
1086 Ga0501075_0000178 3300049591 Bacteria 33062
1087 Ga0501075_0031140 3300049591 Bacteria 3958
1088 Ga0501075_0044998 3300049591 Bacteria 3312
1089 Ga0501075_0048456 3300049591 Bacteria 3193
1090 Ga0501076_0411308 3300049592 Bacteria 1113
1091 Ga0501079_0022743 3300049741 Bacteria 4811
1092 Ga0501079_0108957 3300049741 Bacteria 2151
1093 Ga0501079_0215736 3300049741 Bacteria 1499
1094 Ga0501080_0066274 3300049742 Bacteria 3358
1095 Ga0501080_0102524 3300049742 Bacteria 2654
1096 Ga0501081_0396110 3300049743 Bacteria 1022
1097 Ga0501083_0001858 3300049744 Bacteria 14484
1098 Ga0501083_0006674 3300049744 Bacteria 8187
1099 Ga0501083_0215208 3300049744 Bacteria 1252
1100 Ga0501035_0120812 3300049822 Bacteria 2290
1101 Ga0501044_0033918 3300049823 Bacteria 5358
1102 Ga0501045_0010280 3300049824 Bacteria 6555
1103 Ga0501045_0188994 3300049824 Bacteria 1535
1104 nmdc:mga05p37_234728_c1 3300050507 Bacteria 2208
1105 nmdc:mga05p37_403642_c1 3300050507 Bacteria 1595
1106 nmdc:mga05p37_55969_c1 3300050507 Bacteria 4855
1107 nmdc:mga05p37_7249_c1 3300050507 Bacteria 3068
1108 nmdc:mga05p37_7276_c1 3300050507 Bacteria 13060
1109 nmdc:mga05p37_98700_c1 3300050507 Bacteria 3597
1110 nmdc:mga06r32_13473_c1 3300050510 Bacteria 7408
1111 nmdc:mga06r32_135894_c1 3300050510 Bacteria 2433
1112 nmdc:mga06r32_141739_c1 3300050510 Bacteria 2380
1113 nmdc:mga06r32_304824_c1 3300050510 Bacteria 1578
1114 nmdc:mga08y16_10941_c1 3300050511 Bacteria 9530
1115 nmdc:mga08y16_12992_c1 3300050511 Bacteria 8762
1116 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
1117 nmdc:mga08y16_217501_c1 3300050511 Bacteria 1978
1118 nmdc:mga08y16_240155_c1 3300050511 Bacteria 1873
1119 nmdc:mga08y16_300757_c1 3300050511 Bacteria 1654
1120 nmdc:mga0n895_12161_c1 3300050512 Bacteria 7705
1121 nmdc:mga0n895_22018_c1 3300050512 Bacteria 5971
1122 nmdc:mga0n895_37706_c1 3300050512 Bacteria 4678
1123 nmdc:mga0rr50_189626_c1 3300050513 Bacteria 1684
1124 nmdc:mga0rr50_2479_c1 3300050513 Bacteria 10422
1125 nmdc:mga0rr50_52962_c1 3300050513 Unclassified 3017
1126 nmdc:mga0rr50_7501_c1 3300050513 Bacteria 6732
1127 nmdc:mga08x19_1403_c1 3300050514 Bacteria 14894
1128 nmdc:mga08x19_18118_c1 3300050514 Bacteria 4314
1129 nmdc:mga08x19_24788_c1 3300050514 Bacteria 3732
1130 nmdc:mga08x19_7007_c1 3300050514 Bacteria 6693
1131 nmdc:mga08x19_74010_c1 3300050514 Bacteria 2225
1132 nmdc:mga0a205_312391_c1 3300050515 Bacteria 1444
1133 nmdc:mga0a205_358808_c1 3300050515 Bacteria 1324
1134 nmdc:mga0a205_46822_c1 3300050515 Bacteria 4171
1135 nmdc:mga0a205_57878_c1 3300050515 Bacteria 3743
1136 nmdc:mga0a205_61308_c1 3300050515 Bacteria 3633
1137 Ga0495601_0001213 3300053077 Bacteria 14137
1138 Ga0495601_0004055 3300053077 Bacteria 8445
1139 Ga0495612_0025640 3300053078 Bacteria 2368
1140 Ga0495612_0113032 3300053078 Bacteria 1164
1141 Ga0495595_0098264 3300053084 Bacteria 1411
1142 Ga0495619_0022944 3300053085 Bacteria 3995
1143 Ga0500555_003375 3300053103 Bacteria 4553
1144 Ga0500556_0006751 3300053104 Bacteria 3263
1145 Ga0500616_0000358 3300053153 Bacteria 64893
1146 Ga0501084_0008312 3300054114 Bacteria 8565
1147 Ga0501084_0055804 3300054114 Unclassified 3305
1148 Ga0590071_002424 3300059421 Bacteria 4687
1149 Ga0590075_005018 3300059424 Bacteria 3129
1150 Ga0587073_0005958 3300059492 Unclassified 1849
1151 Ga0587091_009615 3300059511 Unclassified 1461
1152 Ga0501082_0016755 3300060353 Bacteria 6310
1153 Ga0501082_0019066 3300060353 Bacteria 5911
1154 Ga0501082_0124815 3300060353 Bacteria 2232
1155 Ga0501082_0149188 3300060353 Bacteria 2030
1156 Ga0501082_0190359 3300060353 Bacteria 1785
1157 Ga0501082_0216432 3300060353 Bacteria 1667
1158 Ga0501082_0369400 3300060353 Bacteria 1251
1159 Ga0501082_0436636 3300060353 Bacteria 1143
1160 Ga0530510_0286292 3300061734 Bacteria 1232
1161 Ga0207702_10173363
1162 MBSR1b_contig_175413
1163 JGI24752J21851_1001100
1164 JGI24743J22301_10004790
1165 JGI24034J26672_10002560
1166 JGI24751J29686_10000704
1167 JGI25406J46586_10006285
1168 rootL2_10275660
1169 Ga0058863_10071160
1170 Ga0058861_10063203
1171 Ga0058862_12859213
1172 Ga0065712_10086452
1173 Ga0065707_10004371
1174 Ga0070658_10026605
1175 Ga0070658_10200115
1176 Ga0070676_10283478
1177 Ga0070683_100014673
1178 Ga0070683_100035951
1179 Ga0070683_100049622
1180 Ga0070683_100073338
1181 Ga0070690_100136925
1182 Ga0070670_100017910
1183 Ga0070670_100028745
1184 Ga0070670_100185509
1185 Ga0070670_100219703
1186 Ga0068869_100002638
1187 Ga0068869_100011661
1188 Ga0068869_100108457
1189 Ga0068869_100270622
1190 Ga0070666_10062094
1191 Ga0070680_100002009
1192 Ga0070680_100045686
1193 Ga0070682_100009784
1194 Ga0070682_100026601
1195 Ga0070682_100188497
1196 Ga0068868_100001549
1197 Ga0068868_100002221
1198 Ga0068868_100005847
1199 Ga0068868_100026930
1200 Ga0068868_100041733
1201 Ga0068868_100049830
1202 Ga0070660_100108420
1203 Ga0070660_100116335
1204 Ga0070689_100001794
1205 Ga0070689_100211075
1206 Ga0070689_100255251
1207 Ga0070689_100316094
1208 Ga0070689_100378163
1209 Ga0070687_100124473
1210 Ga0070687_100170452
1211 Ga0070661_100005410
1212 Ga0070661_100023061
1213 Ga0070661_100051750
1214 Ga0070668_100379771
1215 Ga0070669_100026243
1216 Ga0070669_100084244
1217 Ga0070675_100000540
1218 Ga0070675_100119228
1219 Ga0070675_100306670
1220 Ga0070675_100334793
1221 Ga0070671_100263159
1222 Ga0070671_100444554
1223 Ga0070674_100014116
1224 Ga0070673_100017192
1225 Ga0070688_100039145
1226 Ga0070659_100060263
1227 Ga0070659_100311291
1228 Ga0070667_100024129
1229 Ga0070709_10000305
1230 Ga0070709_10012180
1231 Ga0070709_10019978
1232 Ga0070709_10038707
1233 Ga0070709_10080178
1234 Ga0070709_10113547
1235 Ga0070709_10136093
1236 Ga0070709_10178317
1237 Ga0070714_100000183
1238 Ga0070714_100026899
1239 Ga0070714_100076345
1240 Ga0070714_100121156
1241 Ga0070714_100136572
1242 Ga0070714_100210082
1243 Ga0070714_100238223
1244 Ga0070714_100249898
1245 Ga0070714_100366743
1246 Ga0070713_100000922
1247 Ga0070713_100005356
1248 Ga0070713_100007574
1249 Ga0070713_100008454
1250 Ga0070713_100009238
1251 Ga0070713_100028090
1252 Ga0070713_100058345
1253 Ga0070713_100082674
1254 Ga0070713_100098069
1255 Ga0070713_100106406
1256 Ga0070713_100110831
1257 Ga0070713_100172013
1258 Ga0070713_100192653
1259 Ga0070713_100302161
1260 Ga0070710_10043572
1261 Ga0070710_10043877
1262 Ga0070710_10149788
1263 Ga0070701_10123076
1264 Ga0070711_100001220
1265 Ga0070711_100010822
1266 Ga0070711_100016954
1267 Ga0070711_100068847
1268 Ga0070711_100110863
1269 Ga0070711_100112889
1270 Ga0070711_100113762
1271 Ga0070711_100135456
1272 Ga0070711_100423185
1273 Ga0070694_100001871
1274 Ga0070708_100000848
1275 Ga0070708_100002910
1276 Ga0070708_100009912
1277 Ga0070708_100011561
1278 Ga0070708_100039959
1279 Ga0070708_100048892
1280 Ga0070708_100079355
1281 Ga0070663_100062859
1282 Ga0070663_100407052
1283 Ga0070678_100031915
1284 Ga0070678_100075469
1285 Ga0070678_100304677
1286 Ga0070662_100008886
1287 Ga0070662_100018694
1288 Ga0070662_100253760
1289 Ga0070681_10000692
1290 Ga0070681_10005994
1291 Ga0070681_10008099
1292 Ga0070681_10021208
1293 Ga0070681_10028494
1294 Ga0070681_10035282
1295 Ga0070681_10055803
1296 Ga0070681_10058881
1297 Ga0070681_10075687
1298 Ga0070681_10111730
1299 Ga0070681_10149409
1300 Ga0070681_10165457
1301 Ga0070681_10176878
1302 Ga0070681_10304639
1303 Ga0070681_10368853
1304 Ga0070681_10539954
1305 Ga0068867_100008095
1306 Ga0068867_100125831
1307 Ga0070706_100000381
1308 Ga0070706_100000609
1309 Ga0070706_100006382
1310 Ga0070706_100027489
1311 Ga0070706_100027595
1312 Ga0070706_100061794
1313 Ga0070706_100086089
1314 Ga0070707_100000144
1315 Ga0070707_100018379
1316 Ga0070707_100054792
1317 Ga0070707_100087255
1318 Ga0070707_100299150
1319 Ga0070698_100000015
1320 Ga0070698_100000903
1321 Ga0070698_100037349
1322 Ga0070698_100176144
1323 Ga0070699_100045650
1324 Ga0070699_100195385
1325 Ga0070699_100286249
1326 Ga0070679_100009060
1327 Ga0070679_100017685
1328 Ga0070679_100036410
1329 Ga0070679_100041797
1330 Ga0070679_100049113
1331 Ga0070679_100059047
1332 Ga0070679_100068243
1333 Ga0070679_100157163
1334 Ga0070684_100002625
1335 Ga0070684_100002682
1336 Ga0070684_100007916
1337 Ga0070684_100016155
1338 Ga0070684_100042699
1339 Ga0070684_100054714
1340 Ga0070684_100127298
1341 Ga0070684_100168906
1342 Ga0070684_100176690
1343 Ga0070697_100000195
1344 Ga0070697_100001021
1345 Ga0070697_100003101
1346 Ga0070697_100006153
1347 Ga0070697_100010873
1348 Ga0070697_100026144
1349 Ga0070697_100032232
1350 Ga0070697_100086122
1351 Ga0070697_100118316
1352 Ga0068853_100004456
1353 Ga0068853_100016340
1354 Ga0068853_100051674
1355 Ga0068853_100071730
1356 Ga0068853_100093359
1357 Ga0070672_100041331
1358 Ga0070686_100022493
1359 Ga0070686_100104806
1360 Ga0070695_100070485
1361 Ga0070696_100011056
1362 Ga0070696_100167415
1363 Ga0070693_100008703
1364 Ga0070665_100027509
1365 Ga0070665_100590653
1366 Ga0068855_100001490
1367 Ga0068855_100002064
1368 Ga0068855_100004921
1369 Ga0068855_100013622
1370 Ga0068855_100020077
1371 Ga0068855_100055057
1372 Ga0068855_100108486
1373 Ga0068855_100337298
1374 Ga0068855_100368240
1375 Ga0068855_100612017
1376 Ga0070664_100017492
1377 Ga0070664_100106944
1378 Ga0070664_100147243
1379 Ga0068857_100001030
1380 Ga0068857_100003337
1381 Ga0068857_100096591
1382 Ga0068857_100215307
1383 Ga0068857_100239962
1384 Ga0068854_100004220
1385 Ga0068854_100012031
1386 Ga0068854_100123985
1387 Ga0068856_100000065
1388 Ga0068856_100000989
1389 Ga0068856_100002496
1390 Ga0068856_100012096
1391 Ga0068856_100023046
1392 Ga0068856_100028145
1393 Ga0068856_100052234
1394 Ga0068856_100057605
1395 Ga0068856_100120678
1396 Ga0068856_100158414
1397 Ga0068856_100220034
1398 Ga0068856_100477087
1399 Ga0070702_100009321
1400 Ga0068852_100052092
1401 Ga0068852_100102856
1402 Ga0068859_100000939
1403 Ga0068859_100005531
1404 Ga0068859_100162576
1405 Ga0068859_100244109
1406 Ga0068859_100417281
1407 Ga0068864_100000369
1408 Ga0068864_100008228
1409 Ga0068864_100032790
1410 Ga0068864_100198148
1411 Ga0068864_100243346
1412 Ga0068866_10003414
1413 Ga0068866_10009998
1414 Ga0068866_10149758
1415 Ga0068861_100009849
1416 Ga0068861_100172783
1417 Ga0068861_100360143
1418 Ga0068851_10005710
1419 Ga0068870_10000935
1420 Ga0068863_100006532
1421 Ga0068863_100023970
1422 Ga0068863_100050601
1423 Ga0068863_100160860
1424 Ga0068858_100002175
1425 Ga0068858_100005150
1426 Ga0068858_100024408
1427 Ga0068858_100027668
1428 Ga0068858_100078685
1429 Ga0068860_100061945
1430 Ga0068860_100065633
1431 Ga0068860_100091141
1432 Ga0068860_100110187
1433 Ga0068860_100170019
1434 Ga0068860_100355061
1435 Ga0068860_100488859
1436 Ga0068862_100015615
1437 Ga0068862_100024780
1438 Ga0081455_10008282
1439 Ga0081455_10301905
1440 Ga0081540_1026668
1441 Ga0081539_10001175
1442 Ga0070717_10001830
1443 Ga0070717_10002609
1444 Ga0070717_10004387
1445 Ga0070717_10007529
1446 Ga0070717_10016823
1447 Ga0070717_10035619
1448 Ga0070717_10047746
1449 Ga0070717_10061452
1450 Ga0070717_10111940
1451 Ga0070717_10165616
1452 Ga0070717_10216772
1453 Ga0070717_10224788
1454 Ga0070715_10005347
1455 Ga0070715_10018053
1456 Ga0070715_10032661
1457 Ga0070716_100008843
1458 Ga0070716_100082439
1459 Ga0070712_100001229
1460 Ga0070712_100005202
1461 Ga0070712_100006553
1462 Ga0070712_100006918
1463 Ga0070712_100007031
1464 Ga0070712_100010851
1465 Ga0070712_100015260
1466 Ga0070712_100191397
1467 Ga0097621_100000034
1468 Ga0097621_100000908
1469 Ga0097621_100010855
1470 Ga0097621_100039276
1471 Ga0097621_100049009
1472 Ga0097621_100049426
1473 Ga0097621_100076264
1474 Ga0097621_100247316
1475 Ga0097621_100444465
1476 Ga0068871_100000233
1477 Ga0068871_100000444
1478 Ga0068871_100003756
1479 Ga0068871_100005759
1480 Ga0068871_100009308
1481 Ga0068871_100080692
1482 Ga0068871_100091447
1483 Ga0068871_100252942
1484 Ga0075428_100000607
1485 Ga0075428_100069652
1486 Ga0075428_100131714
1487 Ga0075428_100224083
1488 Ga0075431_100017181
1489 Ga0075431_100120429
1490 Ga0075431_100130750
1491 Ga0075431_100210048
1492 Ga0075431_100227038
1493 Ga0075431_100303010
1494 Ga0075433_10149908
1495 Ga0075433_10171943
1496 Ga0075434_100001079
1497 Ga0075434_100038540
1498 Ga0075434_100147812
1499 Ga0075434_100188356
1500 Ga0068865_100002230
1501 Ga0068865_100006642
1502 Ga0068865_100044236
1503 Ga0075436_100001547
1504 Ga0075436_100003577
1505 Ga0075436_100006024
1506 Ga0075436_100007392
1507 Ga0075436_100080970
1508 Ga0075436_100142659
1509 Ga0097620_100000939
1510 Ga0097620_100005531
1511 Ga0097620_100162582
1512 Ga0097620_100244113
1513 Ga0097620_100417257
1514 Ga0075435_100010144
1515 Ga0099794_10144830
1516 Ga0105251_10100663
1517 Ga0105250_10009360
1518 Ga0105240_10000161
1519 Ga0105240_10006455
1520 Ga0105240_10034509
1521 Ga0105240_10065144
1522 Ga0105240_10116022
1523 Ga0105240_10128678
1524 Ga0105240_10152642
1525 Ga0105240_10206913
1526 Ga0105240_10239535
1527 Ga0105240_10322798
1528 Ga0105240_10338304
1529 Ga0105240_10735834
1530 Ga0111539_10000455
1531 Ga0111539_10026226
1532 Ga0111539_10036740
1533 Ga0111539_10060226
1534 Ga0111539_10147796
1535 Ga0111539_10214441
1536 Ga0111539_10442945
1537 Ga0105245_10000624
1538 Ga0105245_10007043
1539 Ga0105245_10041692
1540 Ga0105245_10058681
1541 Ga0105245_10083479
1542 Ga0105245_10101680
1543 Ga0105245_10281561
1544 Ga0105247_10001507
1545 Ga0105247_10024056
1546 Ga0105247_10089205
1547 Ga0105247_10093622
1548 Ga0114129_10004180
1549 Ga0114129_10235763
1550 Ga0105243_10439729
1551 Ga0105241_10002126
1552 Ga0105241_10025623
1553 Ga0105241_10117677
1554 Ga0105241_10154538
1555 Ga0105242_10016443
1556 Ga0105242_10053867
1557 Ga0105242_10099580
1558 Ga0105242_10115686
1559 Ga0105242_10188353
1560 Ga0105242_10376543
1561 Ga0105248_10005836
1562 Ga0105248_10072101
1563 Ga0105248_10081845
1564 Ga0105248_10091853
1565 Ga0105248_10112311
1566 Ga0105248_10270875
1567 Ga0105237_10008538
1568 Ga0105237_10019697
1569 Ga0105237_10029884
1570 Ga0105237_10151073
1571 Ga0105237_10164956
1572 Ga0105238_10000464
1573 Ga0105238_10016655
1574 Ga0105238_10049855
1575 Ga0105238_10091729
1576 Ga0105238_10155748
1577 Ga0105238_10200457
1578 Ga0105249_10004737
1579 Ga0105249_10090776
1580 Ga0105249_10100646
1581 Ga0105249_10406595
1582 Ga0105239_10053632
1583 Ga0105239_10054173
1584 Ga0105239_10086301
1585 Ga0105239_10248862
1586 Ga0105246_10001854
1587 Ga0105246_10034407
1588 Ga0105246_10070999
1589 Ga0157373_10001119
1590 Ga0157373_10017190
1591 Ga0157373_10043524
1592 Ga0157373_10049631
1593 Ga0157373_10058555
1594 Ga0157373_10177962
1595 Ga0157371_10012556
1596 Ga0157371_10013207
1597 Ga0157370_10016231
1598 Ga0157370_10158393
1599 Ga0157370_10289527
1600 Ga0157370_10469306
1601 Ga0157369_10000264
1602 Ga0157369_10010181
1603 Ga0157369_10014322
1604 Ga0157369_10078699
1605 Ga0157369_10102065
1606 Ga0157369_10150938
1607 Ga0157369_10225621
1608 Ga0157369_10256053
1609 Ga0157369_10284298
1610 Ga0157369_10354439
1611 Ga0157369_10362392
1612 Ga0157369_10365070
1613 Ga0157369_10418488
1614 Ga0157374_10000249
1615 Ga0157374_10000496
1616 Ga0157374_10001107
1617 Ga0157374_10005920
1618 Ga0157374_10024491
1619 Ga0157374_10033131
1620 Ga0157374_10078774
1621 Ga0157374_10088066
1622 Ga0157374_10125558
1623 Ga0157374_10229305
1624 Ga0157378_10000008
1625 Ga0157378_10000145
1626 Ga0157378_10002765
1627 Ga0157378_10003358
1628 Ga0157378_10045872
1629 Ga0157378_10093841
1630 Ga0157378_10124723
1631 Ga0157378_10255933
1632 Ga0163162_10000777
1633 Ga0163162_10024543
1634 Ga0163162_10092330
1635 Ga0163162_10145019
1636 Ga0163162_10288342
1637 Ga0157372_10000436
1638 Ga0157372_10000611
1639 Ga0157372_10001696
1640 Ga0157372_10004250
1641 Ga0157372_10008298
1642 Ga0157372_10019394
1643 Ga0157372_10049516
1644 Ga0157372_10065331
1645 Ga0157372_10078438
1646 Ga0157372_10122925
1647 Ga0157372_10187711
1648 Ga0157372_10247006
1649 Ga0157375_10003580
1650 Ga0157375_10015367
1651 Ga0157375_10030491
1652 Ga0157375_10043801
1653 Ga0157375_10356373
1654 Ga0163163_10020441
1655 Ga0163163_10025274
1656 Ga0163163_10059974
1657 Ga0163163_10072291
1658 Ga0163163_10110393
1659 Ga0163163_10124386
1660 Ga0163163_10157889
1661 Ga0163163_10360639
1662 Ga0163163_10387049
1663 Ga0163163_10475204
1664 Ga0157380_10006237
1665 Ga0157380_10535390
1666 Ga0182008_10044746
1667 Ga0157377_10007969
1668 Ga0157379_10001812
1669 Ga0157379_10012865
1670 Ga0157379_10026975
1671 Ga0157379_10055120
1672 Ga0157379_10060793
1673 Ga0157379_10175320
1674 Ga0157376_10004063
1675 Ga0157376_10042115
1676 Ga0157376_10049476
1677 Ga0157376_10202439
1678 Ga0157376_10272741
1679 Ga0182006_1021588
1680 Ga0182006_1072942
1681 Ga0182007_10002409
1682 Ga0182007_10039680
1683 Ga0182005_1009264
1684 Ga0163161_10051815
1685 Ga0206354_10265616
1686 Ga0213873_10020908
1687 Ga0213872_10010735
1688 Ga0213872_10014357
1689 Ga0213871_10004023
1690 Ga0224712_10026682
1691 Ga0224712_10044458
1692 Ga0224570_100565
1693 Ga0224572_1000257
1694 Ga0228598_1001074
1695 Ga0228598_1001256
1696 Ga0207656_10036251
1697 Ga0207692_10063997
1698 Ga0207642_10005304
1699 Ga0207642_10018358
1700 Ga0207710_10075068
1701 Ga0207688_10003069
1702 Ga0207647_10002063
1703 Ga0207647_10016048
1704 Ga0207647_10049796
1705 Ga0207647_10098194
1706 Ga0207685_10003074
1707 Ga0207685_10038958
1708 Ga0207699_10009701
1709 Ga0207699_10012015
1710 Ga0207699_10050642
1711 Ga0207699_10067586
1712 Ga0207699_10094136
1713 Ga0207699_10146111
1714 Ga0207699_10252550
1715 Ga0207699_10334304
1716 Ga0207645_10000901
1717 Ga0207645_10006268
1718 Ga0207643_10000172
1719 Ga0207705_10045267
1720 Ga0207684_10000768
1721 Ga0207684_10005976
1722 Ga0207684_10016448
1723 Ga0207684_10017175
1724 Ga0207684_10062474
1725 Ga0207684_10094980
1726 Ga0207684_10103525
1727 Ga0207654_10029582
1728 Ga0207654_10032668
1729 Ga0207654_10057441
1730 Ga0207707_10000266
1731 Ga0207707_10003379
1732 Ga0207707_10007460
1733 Ga0207707_10011097
1734 Ga0207707_10021147
1735 Ga0207707_10065929
1736 Ga0207707_10101188
1737 Ga0207707_10177050
1738 Ga0207695_10000693
1739 Ga0207695_10003740
1740 Ga0207695_10007402
1741 Ga0207695_10016105
1742 Ga0207695_10037550
1743 Ga0207695_10115452
1744 Ga0207695_10178963
1745 Ga0207695_10373813
1746 Ga0207695_10480551
1747 Ga0207671_10027073
1748 Ga0207671_10064810
1749 Ga0207671_10133740
1750 Ga0207693_10000067
1751 Ga0207693_10000098
1752 Ga0207693_10000884
1753 Ga0207693_10001517
1754 Ga0207693_10012227
1755 Ga0207693_10016140
1756 Ga0207693_10020519
1757 Ga0207693_10044284
1758 Ga0207693_10079310
1759 Ga0207693_10112274
1760 Ga0207693_10237676
1761 Ga0207663_10007568
1762 Ga0207663_10014875
1763 Ga0207663_10031992
1764 Ga0207663_10041091
1765 Ga0207663_10087264
1766 Ga0207663_10089454
1767 Ga0207663_10095862
1768 Ga0207660_10002995
1769 Ga0207660_10061997
1770 Ga0207660_10074438
1771 Ga0207660_10178146
1772 Ga0207660_10285284
1773 Ga0207662_10002090
1774 Ga0207662_10174525
1775 Ga0207657_10000660
1776 Ga0207657_10002292
1777 Ga0207657_10016937
1778 Ga0207649_10001125
1779 Ga0207649_10023104
1780 Ga0207649_10156878
1781 Ga0207652_10001598
1782 Ga0207652_10003545
1783 Ga0207652_10038171
1784 Ga0207652_10064198
1785 Ga0207652_10106214
1786 Ga0207652_10139802
1787 Ga0207646_10000298
1788 Ga0207646_10004709
1789 Ga0207646_10045908
1790 Ga0207646_10046574
1791 Ga0207646_10077799
1792 Ga0207646_10102475
1793 Ga0207646_10320823
1794 Ga0207681_10064112
1795 Ga0207681_10228297
1796 Ga0207694_10002762
1797 Ga0207694_10029240
1798 Ga0207694_10065154
1799 Ga0207694_10122260
1800 Ga0207694_10245779
1801 Ga0207650_10000059
1802 Ga0207659_10145002
1803 Ga0207659_10157992
1804 Ga0207687_10006015
1805 Ga0207687_10009003
1806 Ga0207687_10009700
1807 Ga0207687_10103813
1808 Ga0207700_10008946
1809 Ga0207700_10015310
1810 Ga0207700_10018505
1811 Ga0207700_10018692
1812 Ga0207700_10021041
1813 Ga0207700_10024988
1814 Ga0207700_10063197
1815 Ga0207700_10069925
1816 Ga0207700_10099797
1817 Ga0207700_10144330
1818 Ga0207700_10151979
1819 Ga0207700_10186426
1820 Ga0207700_10217945
1821 Ga0207700_10296062
1822 Ga0207664_10000212
1823 Ga0207664_10066656
1824 Ga0207664_10079541
1825 Ga0207664_10138936
1826 Ga0207664_10138971
1827 Ga0207664_10314724
1828 Ga0207664_10360700
1829 Ga0207664_10448275
1830 Ga0207690_10089161
1831 Ga0207706_10000098
1832 Ga0207706_10000723
1833 Ga0207686_10069416
1834 Ga0207686_10085966
1835 Ga0207670_10053185
1836 Ga0207670_10205381
1837 Ga0207670_10326769
1838 Ga0207704_10048954
1839 Ga0207704_10075112
1840 Ga0207665_10020494
1841 Ga0207665_10037720
1842 Ga0207665_10067103
1843 Ga0207665_10104350
1844 Ga0207691_10001129
1845 Ga0207711_10004346
1846 Ga0207711_10035400
1847 Ga0207711_10074950
1848 Ga0207711_10114209
1849 Ga0207711_10143206
1850 Ga0207689_10000353
1851 Ga0207689_10038519
1852 Ga0207689_10098949
1853 Ga0207689_10141747
1854 Ga0207661_10021989
1855 Ga0207661_10096946
1856 Ga0207679_10000415
1857 Ga0207679_10031074
1858 Ga0207679_10216949
1859 Ga0207667_10000413
1860 Ga0207667_10006238
1861 Ga0207667_10012296
1862 Ga0207667_10018332
1863 Ga0207667_10066067
1864 Ga0207667_10083898
1865 Ga0207667_10148903
1866 Ga0207667_10326491
1867 Ga0207667_10348265
1868 Ga0207712_10007011
1869 Ga0207712_10142518
1870 Ga0207712_10198434
1871 Ga0207712_10268382
1872 Ga0207668_10008891
1873 Ga0207640_10060567
1874 Ga0207640_10079021
1875 Ga0207640_10089505
1876 Ga0207640_10149792
1877 Ga0207677_10001543
1878 Ga0207677_10001745
1879 Ga0207677_10003837
1880 Ga0207677_10004382
1881 Ga0207677_10011658
1882 Ga0207677_10078138
1883 Ga0207677_10192605
1884 Ga0207703_10006204
1885 Ga0207703_10007234
1886 Ga0207703_10010063
1887 Ga0207703_10050625
1888 Ga0207703_10069955
1889 Ga0207703_10105216
1890 Ga0207703_10373062
1891 Ga0207639_10016209
1892 Ga0207639_10038468
1893 Ga0207639_10077952
1894 Ga0207678_10000581
1895 Ga0207678_10006094
1896 Ga0207708_10353370
1897 Ga0207702_10000209
1898 Ga0207702_10001199
1899 Ga0207702_10003037
1900 Ga0207702_10055790
1901 Ga0207702_10073539
1902 Ga0207702_10099952
1903 Ga0207702_10222748
1904 Ga0207702_10313036
1905 Ga0207702_10396022
1906 Ga0207702_10432168
1907 Ga0207641_10000025
1908 Ga0207641_10008027
1909 Ga0207641_10020912
1910 Ga0207641_10059041
1911 Ga0207641_10063347
1912 Ga0207641_10068485
1913 Ga0207648_10003458
1914 Ga0207648_10047694
1915 Ga0207676_10000252
1916 Ga0207676_10002695
1917 Ga0207676_10008202
1918 Ga0207676_10032451
1919 Ga0207674_10000162
1920 Ga0207674_10003030
1921 Ga0207674_10042580
1922 Ga0207674_10078029
1923 Ga0207674_10127467
1924 Ga0207674_10214815
1925 Ga0207675_100017450
1926 Ga0207675_100027963
1927 Ga0207675_100078474
1928 Ga0207683_10001306
1929 Ga0207683_10083016
1930 Ga0207698_10029146
1931 Ga0207428_10000435
1932 Ga0207428_10000846
1933 Ga0207428_10041335
1934 Ga0265356_1000857
1935 Ga0268266_10010266
1936 Ga0268264_10025084
1937 Ga0268264_10050987
1938 Ga0268264_10063001
1939 Ga0268264_10066451
1940 Ga0268264_10096896
1941 Ga0268264_10307434
1942 Ga0265338_10004251
1943 Ga0265338_10024675
1944 Ga0265338_10148870
1945 Ga0265338_10196671
1946 Ga0265762_1000116
1947 Ga0265762_1001781
1948 Ga0265760_10002278
1949 Ga0265760_10002457
1950 Ga0265760_10018115
1951 Ga0265330_10005484
1952 Ga0265325_10025527
1953 Ga0265325_10047993
1954 Ga0265339_10018777
1955 Ga0265339_10019646
1956 Ga0265339_10159198
1957 Ga0265316_10041782
1958 Ga0265316_10048446
1959 Ga0265316_10113095
1960 Ga0307408_100012830
1961 Ga0307408_100110828
1962 Ga0307408_100152467
1963 Ga0307408_100194934
1964 Ga0307408_100287197
1965 Ga0265314_10004435
1966 Ga0265314_10080937
1967 Ga0265314_10169979
1968 Ga0265342_10061692
1969 Ga0307405_10036139
1970 Ga0307405_10077866
1971 Ga0307410_10004067
1972 Ga0307410_10135625
1973 Ga0307406_10081672
1974 Ga0307407_10156535
1975 Ga0307407_10181292
1976 Ga0307412_10046266
1977 Ga0307409_100030864
1978 Ga0307416_100003885
1979 Ga0307416_100040415
1980 Ga0307416_100047412
1981 Ga0307416_100061300
1982 Ga0307416_100081440
1983 Ga0307416_100117482
1984 Ga0307416_100354754
1985 Ga0307416_100463725
1986 Ga0307411_10006952
1987 Ga0307411_10125471
1988 Ga0307411_10282574
1989 Ga0307415_100010919
1990 Ga0307415_100503072
1991 Ga0316212_1003932
1992 Ga0373926_0017457
1993 Ga0373923_0001393
1994 Ga0373923_0038824
1995 Ga0373923_0090879
1996 Ga0373936_0000319
1997 Ga0373936_0090408
1998 Ga0373945_0001313
1999 Ga0373945_0060547
2000 Ga0373956_0007158
2001 Ga0373956_0073444
2002 Ga0373943_0000016
2003 Ga0373943_0016294
2004 Ga0373943_0040390
2005 Ga0373946_0019422
2006 Ga0373924_0000248
2007 Ga0373924_0003372
2008 Ga0373924_0031217
2009 Ga0373931_0007410
2010 Ga0373931_0032147
2011 Ga0373931_0045293
2012 Ga0373935_0000864
2013 Ga0373935_0003124
2014 Ga0373935_0006632
2015 Ga0373935_0010148
2016 Ga0373935_0032320
2017 Ga0373927_0000034
2018 Ga0373927_0058122
2019 Ga0373927_0072792
2020 Ga0373927_0078965
2021 Ga0373927_0111053
2022 Ga0373933_0015818
2023 Ga0373947_0000035
2024 Ga0373947_0017382
2025 Ga0373947_0039779
2026 Ga0373947_0087873
2027 Ga0373937_0000090
2028 Ga0373937_0049245
2029 Ga0373937_0076551
2030 Ga0373937_0440853
2031 Ga0373937_0647934
2032 Ga0373925_0000714
2033 Ga0373925_0005732
2034 Ga0373925_0006084
2035 Ga0373925_0021655
2036 Ga0373925_0048158
2037 Ga0373925_0127295
2038 Ga0373925_0178622
2039 Ga0373925_0226782
2040 Ga0395900_0460942
2041 Ga0395898_0049727
2042 Ga0395898_0177640
2043 Ga0395905_0003951
2044 Ga0395905_0026624
2045 Ga0395905_0070863
2046 Ga0395905_0090299
2047 Ga0395905_0092192
2048 Ga0436364_0366631
2049 Ga0395901_0219459
2050 Ga0436360_0174134
2051 Ga0436361_0534152
2052 Ga0436361_0620753
2053 Ga0436361_0635090
2054 Ga0436361_0706896
2055 Ga0436363_0375979
2056 Ga0436363_1252730
2057 Ga0436363_1383135
2058 Ga0436363_1663027
2059 Ga0436362_0906121
2060 Ga0436362_1104320
2061 Ga0436362_1148430
2062 Ga0451853_2499464
2063 Ga0439462_0031366
2064 Ga0451577_0001555
2065 Ga0451577_0113458
2066 Ga0466969_0056413
2067 Ga0466963_0005503
2068 Ga0466963_0049233
2069 Ga0466963_0049475
2070 Ga0453684_0000289
2071 Ga0453684_0019897
2072 Ga0466957_0018353
2073 Ga0466957_0095683
2074 Ga0466957_0132345
2075 Ga0466959_0033530
2076 Ga0466959_0035415
2077 Ga0466959_0209135
2078 Ga0451576_0035560
2079 Ga0451576_0420030
2080 Ga0451576_0531076
2081 Ga0466958_0026948
2082 Ga0466958_0147300
2083 Ga0466967_0055328
2084 Ga0466967_0114172
2085 Ga0495592_0139215
2086 Ga0495629_0021849
2087 Ga0495629_0077853
2088 Ga0495580_0000354
2089 Ga0495580_0001606
2090 Ga0495580_0002290
2091 Ga0495580_0004272
2092 Ga0495580_0004478
2093 Ga0495580_0019736
2094 Ga0495580_0022694
2095 Ga0495580_0023751
2096 Ga0495580_0025920
2097 Ga0495580_0046482
2098 Ga0495580_0051886
2099 Ga0495580_0078652
2100 Ga0495580_0092740
2101 Ga0495580_0098837
2102 Ga0495580_0132859
2103 Ga0495664_0049533
2104 Ga0495594_0008908
2105 Ga0495630_0001984
2106 Ga0495630_0011837
2107 Ga0495630_0026718
2108 Ga0495630_0074146
2109 Ga0495630_0120901
2110 Ga0495666_0112078
2111 Ga0495665_0014305
2112 Ga0495587_0077896
2113 Ga0495667_0043718
2114 Ga0495635_0179857
2115 Ga0495657_0220848
2116 Ga0495599_0060721
2117 Ga0495623_0039822
2118 Ga0495658_0013179
2119 Ga0495658_0035332
2120 Ga0495669_0000991
2121 Ga0495669_0002685
2122 Ga0495669_0074677
2123 Ga0495613_0000670
2124 Ga0495613_0177997
2125 Ga0495613_0178872
2126 Ga0495613_0202417
2127 Ga0495600_0016234
2128 Ga0495600_0126297
2129 Ga0495600_0133668
2130 Ga0495581_0029073
2131 Ga0495604_0028162
2132 Ga0495604_0032592
2133 Ga0495604_0042957
2134 Ga0495636_0048202
2135 Ga0495674_0016645
2136 Ga0495674_0078187
2137 Ga0495672_0055485
2138 Ga0495675_0013233
2139 Ga0495675_0090400
2140 Ga0495677_0090568
2141 Ga0495684_0009482
2142 Ga0495684_0187855
2143 Ga0495602_0103606
2144 Ga0495614_0108478
2145 Ga0496100_0038130
2146 Ga0496101_0057320
2147 Ga0496101_0109408
2148 Ga0496101_0243345
2149 Ga0496101_0281897
2150 Ga0496102_0002608
2151 Ga0496102_0026380
2152 Ga0496102_0028897
2153 Ga0496102_0042036
2154 Ga0496102_0107895
2155 Ga0496102_0224927
2156 Ga0496103_0063905
2157 Ga0496103_0137086
2158 Ga0496104_0008792
2159 Ga0496104_0091926
2160 Ga0496104_0163570
2161 Ga0496104_0299112
2162 Ga0496104_0326605
2163 Ga0496104_0457469
2164 Ga0496105_0000584
2165 Ga0496105_0053823
2166 Ga0496106_0085428
2167 Ga0496106_0353486
2168 Ga0496107_0139938
2169 Ga0496108_0000203
2170 Ga0496108_0135570
2171 Ga0496108_0306696
2172 Ga0496109_0000080
2173 Ga0496109_0000228
2174 Ga0496109_0031502
2175 Ga0496110_0000145
2176 Ga0496110_0023501
2177 Ga0496110_0076017
2178 Ga0496110_0179781
2179 Ga0496110_0479489
2180 Ga0496111_0003439
2181 Ga0496111_0060610
2182 Ga0496111_0115526
2183 Ga0496111_0187711
2184 Ga0496112_0000048
2185 Ga0496112_0001123
2186 Ga0496112_0002435
2187 Ga0496112_0004578
2188 Ga0496112_0006190
2189 Ga0496112_0008072
2190 Ga0496112_0063880
2191 Ga0496112_0129203
2192 Ga0496112_0173849
2193 Ga0496112_0212238
2194 Ga0496113_0001316
2195 Ga0496113_0002647
2196 Ga0496114_0021153
2197 Ga0496115_0051371
2198 Ga0496115_0086899
2199 Ga0496115_0260447
2200 Ga0496115_0357787
2201 Ga0496115_0471910
2202 Ga0496126_0006296
2203 Ga0501031_0038147
2204 Ga0501031_0065791
2205 Ga0501032_0018387
2206 Ga0501034_0013627
2207 Ga0501034_0040164
2208 Ga0501034_0072287
2209 Ga0501034_0305587
2210 Ga0501036_0030799
2211 Ga0501036_0062073
2212 Ga0501036_0194759
2213 Ga0501036_0395569
2214 Ga0501037_0108903
2215 Ga0501038_0034756
2216 Ga0501038_0057722
2217 Ga0501038_0057746
2218 Ga0501039_0003109
2219 Ga0501039_0089362
2220 Ga0501040_0201743
2221 Ga0501041_0072689
2222 Ga0501041_0205129
2223 Ga0501042_0014107
2224 Ga0501043_0015240
2225 Ga0501043_0243822
2226 Ga0501046_0028314
2227 Ga0501046_0029522
2228 Ga0501047_0017959
2229 Ga0501047_0061399
2230 Ga0501047_0287344
2231 Ga0501047_0400480
2232 Ga0501048_0090923
2233 Ga0501048_0135043
2234 Ga0501048_0335269
2235 Ga0501068_0019437
2236 Ga0501068_0056767
2237 Ga0501070_0141430
2238 Ga0501071_0016257
2239 Ga0501071_0138459
2240 Ga0501072_0068282
2241 Ga0501072_0070436
2242 Ga0501072_0076605
2243 Ga0501072_0187445
2244 Ga0501073_0097468
2245 Ga0501074_0140727
2246 Ga0501075_0000178
2247 Ga0501075_0031140
2248 Ga0501075_0044998
2249 Ga0501075_0048456
2250 Ga0501076_0411308
2251 Ga0501079_0022743
2252 Ga0501079_0108957
2253 Ga0501079_0215736
2254 Ga0501080_0066274
2255 Ga0501080_0102524
2256 Ga0501081_0396110
2257 Ga0501083_0001858
2258 Ga0501083_0006674
2259 Ga0501083_0215208
2260 Ga0501035_0120812
2261 Ga0501044_0033918
2262 Ga0501045_0010280
2263 Ga0501045_0188994
2264 nmdc:mga05p37_234728_c1
2265 nmdc:mga05p37_403642_c1
2266 nmdc:mga05p37_55969_c1
2267 nmdc:mga05p37_7249_c1
2268 nmdc:mga05p37_7276_c1
2269 nmdc:mga05p37_98700_c1
2270 nmdc:mga06r32_13473_c1
2271 nmdc:mga06r32_135894_c1
2272 nmdc:mga06r32_141739_c1
2273 nmdc:mga06r32_304824_c1
2274 nmdc:mga08y16_10941_c1
2275 nmdc:mga08y16_12992_c1
2276 nmdc:mga08y16_12_c1
2277 nmdc:mga08y16_217501_c1
2278 nmdc:mga08y16_240155_c1
2279 nmdc:mga08y16_300757_c1
2280 nmdc:mga0n895_12161_c1
2281 nmdc:mga0n895_22018_c1
2282 nmdc:mga0n895_37706_c1
2283 nmdc:mga0rr50_189626_c1
2284 nmdc:mga0rr50_2479_c1
2285 nmdc:mga0rr50_52962_c1
2286 nmdc:mga0rr50_7501_c1
2287 nmdc:mga08x19_1403_c1
2288 nmdc:mga08x19_18118_c1
2289 nmdc:mga08x19_24788_c1
2290 nmdc:mga08x19_7007_c1
2291 nmdc:mga08x19_74010_c1
2292 nmdc:mga0a205_312391_c1
2293 nmdc:mga0a205_358808_c1
2294 nmdc:mga0a205_46822_c1
2295 nmdc:mga0a205_57878_c1
2296 nmdc:mga0a205_61308_c1
2297 Ga0495601_0001213
2298 Ga0495601_0004055
2299 Ga0495612_0025640
2300 Ga0495612_0113032
2301 Ga0495595_0098264
2302 Ga0495619_0022944
2303 Ga0500555_003375
2304 Ga0500556_0006751
2305 Ga0500616_0000358
2306 Ga0501084_0008312
2307 Ga0501084_0055804
2308 Ga0590071_002424
2309 Ga0590075_005018
2310 Ga0587073_0005958
2311 Ga0587091_009615
2312 Ga0501082_0016755
2313 Ga0501082_0019066
2314 Ga0501082_0124815
2315 Ga0501082_0149188
2316 Ga0501082_0190359
2317 Ga0501082_0216432
2318 Ga0501082_0369400
2319 Ga0501082_0436636
2320 Ga0530510_0286292

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

223

303

0.99

PF01012

ETF

Electron transfer flavoprotein domain

23

203

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8811 1 193
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.8739 1 193
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8681 1 193
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.8606 1 193
3ih5-assembly1.cif.gz_B crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron 0.8217 2 197
ID Description Score Start End Superfamily
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.97 204 327 3.40.50.1220
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9577 197 322 3.40.50.1220
af_Q46907_159_286_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9319 204 327 3.40.50.1220
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9291 197 322 3.40.50.1220
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9058 204 327 3.40.50.1220
ID Description Score Start End GO Terms
AF-X0S2B0-F1-model_v4 Electron transfer flavoprotein alpha subunit C-terminal domain-containing protein 0.9809 204 326 GO:0009055
GO:0033539
GO:0050660
AF-A0A382AUL2-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.977 1 176 GO:0009055
GO:0033539
GO:0050660
AF-A0A2N2ZBZ4-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9748 214 326 GO:0009055
GO:0033539
GO:0050660
AF-A0A1C5DSN9-F1-model_v4 Electron transfer flavoprotein alpha subunit apoprotein 0.9739 203 327 GO:0009055
GO:0033539
GO:0050660
AF-S7U661-F1-model_v4 Electron transfer flavoprotein alpha subunit 0.9738 219 325 GO:0009055
GO:0033539
GO:0050660

Map