F490992

General Info

Members Datasets Scaffolds Average Seq Length
1160 648 2320 250

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0318678|Ga0395905_0318678_386_1288
Length 300
Sequence MRGTVAAKPVKFNKGARSTNAPGSTNPDDIGGRPPYVCDDKWRHAMPVEIEQFMCRTDNFGVLVHDPKSGETAIIDAPEEAPILAAIKRTGWTPTLILTTHHHADHVEANLALKERFKLRIVGPEAEKAKIPGIDETVKQGSVVRLGEERIEVIETPGHTAGHVSYHLPASKVAFTADTLFALGCGRLFECKPPVMYDSLKKLAALPAQTAIYCGHEYTLANARFAVTVDPGNPLLKQRAARIEALRAANKPTLPTTIGEELSTNPFLRGHDPSIRKHLGMERASDAEVFAEIRKRKDNF

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
128 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
205 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
232 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
233 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
234 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
235 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
236 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
237 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
238 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
314 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
315 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
353 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
356 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
359 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
362 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
365 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
366 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
367 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
373 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
374 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
375 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
376 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
377 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
378 2512875024
379 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
380 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
381 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
382 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
383 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
384 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
385 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
386 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
387 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
388 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
389 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
390 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
391 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
392 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
393 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
394 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
395 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
396 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
397 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
398 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
399 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
400 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
401 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
402 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
403 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
404 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
405 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
406 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
407 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
408 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
409 2643221558 Rhizobium sp. Root149 Isolate Unclassified
410 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
411 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
412 2643221607 Rhizobium sp. Root73 Isolate Unclassified
413 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
414 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
415 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
416 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
417 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
418 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
419 2643221688 Rhizobium sp. Root482 Isolate Unclassified
420 2643221718 Rhizobium sp. Root268 Isolate Unclassified
421 2643221719 Rhizobium sp. Root274 Isolate Unclassified
422 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
423 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
424 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
425 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
426 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
427 2738541293 Rhizobium sp. GV031 Isolate Unclassified
428 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
429 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
430 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
431 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
432 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
433 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
434 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
435 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
436 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
437 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
438 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
439 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
440 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
441 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
442 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
443 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
444 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
445 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
446 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
447 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
448 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
449 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
450 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
451 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
452 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
453 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
454 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
455 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
456 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
457 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
458 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
459 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
460 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
461 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
462 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
463 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
464 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
465 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
466 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
467 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
468 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
469 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
470 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
471 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
472 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
473 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
474 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
475 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
476 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
477 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
478 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
479 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
480 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
481 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
482 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
483 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
484 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
485 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
486 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
487 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
488 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
489 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
490 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
491 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
492 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
493 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
494 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
495 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
496 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
497 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
498 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
499 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
500 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
501 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
502 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
503 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
504 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
505 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
506 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
507 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
508 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
509 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
510 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
511 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
512 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
513 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
514 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
515 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
516 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
517 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
518 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
519 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
520 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
521 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
522 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
523 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
524 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
525 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
526 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
527 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
528 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
529 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
530 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
531 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
532 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
533 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
534 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
535 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
536 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
537 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
538 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
539 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
540 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
541 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
542 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
543 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
544 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
545 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
546 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
547 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
548 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
549 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
550 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
551 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
552 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
553 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
554 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
555 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
556 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
557 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
558 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
559 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
560 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
561 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
562 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
563 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
564 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
565 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
566 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
567 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
568 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
569 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
570 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
571 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
572 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
573 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
574 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
575 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
576 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
577 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
578 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
579 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
580 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
581 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
582 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
583 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
584 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
585 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
586 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
587 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
588 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
589 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
590 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
591 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
592 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
593 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
594 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
595 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
596 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
597 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
598 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
599 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
600 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
601 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
602 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
603 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
604 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
605 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
606 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
607 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
608 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
609 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
610 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
611 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
612 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
613 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
614 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
615 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
616 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
617 3004167301 Mesorhizobium loti 582 Isolate Unclassified
618 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
619 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
620 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
621 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
622 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
623 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
624 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
625 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
626 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
627 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
628 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
629 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
630 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
631 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
632 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
633 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
634 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
635 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
636 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
637 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
638 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
639 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
640 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
641 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
642 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
643 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
644 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
645 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
646 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
647 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
648 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.95
Metatranscriptomes 0
Isolates 24.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.41
Nodule 16.98
Rhizoplane 4.05
Rhizosphere 61.03
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0318678 3300037471 Bacteria 1444
2 RicEn_C5921 2010549000 Bacteria 1966
3 JGI24741J21665_1003543 3300001915 Bacteria 3692
4 JGI24740J21852_10000006 3300001979 Bacteria 86112
5 JGI24739J22299_10025850 3300001989 Bacteria 2063
6 JGI24739J22299_10052293 3300001989 Bacteria 1314
7 JGI24739J22299_10080030 3300001989 Bacteria 1005
8 JGI24737J22298_10001726 3300001990 Bacteria 7789
9 JGI24737J22298_10004925 3300001990 Bacteria 4627
10 JGI24737J22298_10020449 3300001990 Bacteria 2113
11 JGI24743J22301_10035122 3300001991 Bacteria 996
12 JGI24735J21928_10033604 3300002067 Bacteria 1514
13 JGI24742J22300_10019233 3300002244 Bacteria 1159
14 JGI25155J39150_1000010 3300002704 Bacteria 207717
15 JGI25156J39149_1000033 3300002705 Bacteria 114688
16 JGI25156J39149_1014201 3300002705 Bacteria 1654
17 JGI25162J39368_1000413 3300002737 Bacteria 34872
18 JGI25162J39368_1000646 3300002737 Bacteria 24683
19 JGI25154J39366_1000058 3300002738 Bacteria 107363
20 JGI25157J39369_1000009 3300002741 Bacteria 207868
21 JGI25157J39369_1001464 3300002741 Bacteria 8760
22 JGI25150J39212_1000166 3300002774 Bacteria 37196
23 JGI25151J46595_10000081 3300003187 Bacteria 131317
24 JGI25165J46597_1000097 3300003214 Bacteria 161115
25 JGI25165J46597_1000675 3300003214 Bacteria 27458
26 JGI25165J46597_1001401 3300003214 Bacteria 13154
27 JGI25165J46597_1001441 3300003214 Bacteria 12657
28 JGI25165J46597_1002500 3300003214 Bacteria 5825
29 JGI25153J46596_10000008 3300003215 Bacteria 376808
30 JGI25153J46596_10003148 3300003215 Bacteria 9308
31 rootH1_10140883 3300003316 Bacteria 1052
32 rootL2_10138524 3300003322 Bacteria 3072
33 rootH1_10121837 3300003323 Bacteria 1103
34 Ga0055539_1006346 3300003752 Bacteria 1513
35 Ga0055542_1000123 3300003762 Bacteria 101557
36 Ga0055529_1000144 3300003763 Bacteria 101557
37 Ga0065704_10183305 3300005289 Bacteria 1226
38 Ga0065712_10008678 3300005290 Bacteria 2456
39 Ga0070658_10003269 3300005327 Bacteria 13381
40 Ga0070658_10141962 3300005327 Bacteria 2007
41 Ga0070676_10031441 3300005328 Bacteria 3033
42 Ga0070676_10113824 3300005328 Bacteria 1688
43 Ga0070683_100644696 3300005329 Bacteria 1014
44 Ga0070690_100011455 3300005330 Bacteria 5188
45 Ga0070670_100010583 3300005331 Bacteria 7876
46 Ga0070670_100074557 3300005331 Bacteria 2915
47 Ga0070670_100204467 3300005331 Bacteria 1716
48 Ga0070670_100399818 3300005331 Bacteria 1213
49 Ga0070677_10001076 3300005333 Bacteria 8820
50 Ga0070677_10026674 3300005333 Bacteria 2168
51 Ga0068869_100026860 3300005334 Bacteria 4009
52 Ga0068869_100299851 3300005334 Bacteria 1297
53 Ga0070666_10002899 3300005335 Bacteria 10361
54 Ga0070666_10524253 3300005335 Bacteria 860
55 Ga0070682_100307571 3300005337 Bacteria 1166
56 Ga0068868_100011585 3300005338 Bacteria 6423
57 Ga0068868_100425065 3300005338 Bacteria 1151
58 Ga0068868_100478097 3300005338 Bacteria 1088
59 Ga0070661_100012880 3300005344 Bacteria 5857
60 Ga0070661_100039558 3300005344 Bacteria 3436
61 Ga0070692_10050949 3300005345 Bacteria 2152
62 Ga0070668_100030234 3300005347 Bacteria 4118
63 Ga0070668_100059247 3300005347 Bacteria 2963
64 Ga0070669_100005417 3300005353 Bacteria 9202
65 Ga0070669_100049531 3300005353 Bacteria 3066
66 Ga0070669_100056071 3300005353 Bacteria 2889
67 Ga0070669_100381921 3300005353 Bacteria 1149
68 Ga0070669_100436731 3300005353 Bacteria 1077
69 Ga0070675_100005433 3300005354 Bacteria 9742
70 Ga0070675_100037001 3300005354 Bacteria 3974
71 Ga0070675_100152567 3300005354 Bacteria 1982
72 Ga0070675_100175280 3300005354 Bacteria 1851
73 Ga0070675_100310767 3300005354 Bacteria 1391
74 Ga0070671_100005295 3300005355 Bacteria 10294
75 Ga0070671_100009924 3300005355 Bacteria 7649
76 Ga0070671_100024555 3300005355 Bacteria 4936
77 Ga0070671_100028395 3300005355 Bacteria 4606
78 Ga0070671_100240221 3300005355 Bacteria 1537
79 Ga0070674_100014493 3300005356 Bacteria 4901
80 Ga0070674_100041864 3300005356 Bacteria 3108
81 Ga0070674_100148318 3300005356 Bacteria 1767
82 Ga0070674_100508300 3300005356 Bacteria 1005
83 Ga0070673_100034647 3300005364 Bacteria 3822
84 Ga0070673_100050071 3300005364 Bacteria 3264
85 Ga0070673_100083991 3300005364 Bacteria 2588
86 Ga0070673_100331811 3300005364 Bacteria 1346
87 Ga0070673_100379125 3300005364 Bacteria 1261
88 Ga0070659_100004654 3300005366 Bacteria 9801
89 Ga0070659_100028961 3300005366 Bacteria 4278
90 Ga0070659_100055660 3300005366 Bacteria 3118
91 Ga0070659_100135040 3300005366 Bacteria 2006
92 Ga0070667_100005560 3300005367 Bacteria 10519
93 Ga0070667_100017654 3300005367 Bacteria 5912
94 Ga0070667_100018150 3300005367 Bacteria 5833
95 Ga0070667_100056729 3300005367 Bacteria 3309
96 Ga0070667_100062434 3300005367 Bacteria 3156
97 Ga0070667_100071107 3300005367 Bacteria 2963
98 Ga0070667_100095811 3300005367 Bacteria 2559
99 Ga0070667_100129169 3300005367 Bacteria 2204
100 Ga0070667_100155926 3300005367 Bacteria 2008
101 Ga0070667_100287336 3300005367 Bacteria 1478
102 Ga0070714_100133587 3300005435 Bacteria 2219
103 Ga0070713_100092861 3300005436 Bacteria 2599
104 Ga0070705_100079635 3300005440 Bacteria 2007
105 Ga0070663_100069716 3300005455 Bacteria 2555
106 Ga0070663_100099838 3300005455 Bacteria 2164
107 Ga0070678_100000901 3300005456 Bacteria 15242
108 Ga0070662_100037539 3300005457 Bacteria 3435
109 Ga0070662_100448486 3300005457 Bacteria 1070
110 Ga0070662_100495417 3300005457 Bacteria 1019
111 Ga0068867_100053580 3300005459 Bacteria 2980
112 Ga0068867_100087387 3300005459 Bacteria 2360
113 Ga0070679_100055115 3300005530 Bacteria 3959
114 Ga0070684_100202339 3300005535 Bacteria 1809
115 Ga0070697_100001531 3300005536 Bacteria 17592
116 Ga0068853_100087401 3300005539 Bacteria 2735
117 Ga0068853_100127554 3300005539 Bacteria 2274
118 Ga0068853_100546278 3300005539 Bacteria 1097
119 Ga0068853_100581646 3300005539 Bacteria 1062
120 Ga0070672_100318414 3300005543 Bacteria 1322
121 Ga0070686_100282852 3300005544 Bacteria 1224
122 Ga0070695_100010886 3300005545 Bacteria 5434
123 Ga0070695_100395612 3300005545 Bacteria 1046
124 Ga0070696_100009165 3300005546 Bacteria 6625
125 Ga0070696_100041707 3300005546 Bacteria 3171
126 Ga0070696_100054006 3300005546 Bacteria 2798
127 Ga0070696_100263276 3300005546 Bacteria 1308
128 Ga0070693_100040246 3300005547 Bacteria 2623
129 Ga0070693_100108707 3300005547 Bacteria 1702
130 Ga0070665_100080183 3300005548 Bacteria 3269
131 Ga0070665_100101576 3300005548 Bacteria 2880
132 Ga0070665_100192191 3300005548 Bacteria 2042
133 Ga0070665_100249296 3300005548 Bacteria 1776
134 Ga0070665_100356412 3300005548 Bacteria 1469
135 Ga0068855_100146159 3300005563 Bacteria 2691
136 Ga0068855_100147657 3300005563 Bacteria 2675
137 Ga0068855_100173080 3300005563 Bacteria 2444
138 Ga0068855_100485287 3300005563 Unclassified 1345
139 Ga0070664_100023466 3300005564 Bacteria 5096
140 Ga0070664_100232017 3300005564 Bacteria 1654
141 Ga0070664_100311833 3300005564 Bacteria 1424
142 Ga0068857_100106305 3300005577 Bacteria 2520
143 Ga0068854_100093561 3300005578 Bacteria 2240
144 Ga0068854_100128742 3300005578 Bacteria 1931
145 Ga0068856_100238705 3300005614 Bacteria 1833
146 Ga0068852_100161447 3300005616 Bacteria 2093
147 Ga0068852_100470900 3300005616 Bacteria 1247
148 Ga0068859_100000685 3300005617 Bacteria 34047
149 Ga0068859_100046027 3300005617 Bacteria 4383
150 Ga0068864_100000847 3300005618 Bacteria 25807
151 Ga0068864_100001619 3300005618 Bacteria 18541
152 Ga0068866_10021852 3300005718 Bacteria 2953
153 Ga0068870_10052762 3300005840 Bacteria 2157
154 Ga0068863_100005917 3300005841 Bacteria 11996
155 Ga0068863_100052330 3300005841 Bacteria 3870
156 Ga0068863_100095885 3300005841 Bacteria 2816
157 Ga0068863_100133522 3300005841 Bacteria 2371
158 Ga0068863_100155976 3300005841 Bacteria 2186
159 Ga0068858_100006170 3300005842 Bacteria 11688
160 Ga0068858_100030883 3300005842 Bacteria 4976
161 Ga0068858_100482192 3300005842 Bacteria 1197
162 Ga0068860_100001106 3300005843 Bacteria 29651
163 Ga0068860_100006941 3300005843 Bacteria 11350
164 Ga0068860_100027872 3300005843 Bacteria 5439
165 Ga0068860_100081827 3300005843 Bacteria 3070
166 Ga0068860_100102330 3300005843 Bacteria 2733
167 Ga0068862_100004852 3300005844 Bacteria 11319
168 Ga0068862_100011830 3300005844 Bacteria 7206
169 Ga0068862_100041557 3300005844 Bacteria 3912
170 Ga0068862_100049303 3300005844 Bacteria 3596
171 Ga0068862_100086978 3300005844 Bacteria 2718
172 Ga0068862_100166522 3300005844 Bacteria 1970
173 Ga0068862_100512584 3300005844 Bacteria 1140
174 Ga0081455_10143058 3300005937 Bacteria 1855
175 Ga0081538_10015965 3300005981 Bacteria 5784
176 Ga0075365_10260490 3300006038 Bacteria 1219
177 Ga0075364_10000227 3300006051 Bacteria 26667
178 Ga0075364_10067821 3300006051 Bacteria 2346
179 Ga0075364_10115870 3300006051 Bacteria 1791
180 Ga0070716_100038151 3300006173 Bacteria 2659
181 Ga0070712_100092581 3300006175 Bacteria 2217
182 Ga0075367_10009415 3300006178 Bacteria 5105
183 Ga0075367_10019717 3300006178 Bacteria 3744
184 Ga0075367_10309154 3300006178 Bacteria 995
185 Ga0075367_10309781 3300006178 Bacteria 994
186 Ga0075369_10006505 3300006186 Bacteria 4417
187 Ga0097621_100122909 3300006237 Bacteria 2203
188 Ga0097621_100306773 3300006237 Bacteria 1403
189 Ga0097621_100673083 3300006237 Bacteria 951
190 Ga0075370_10025171 3300006353 Bacteria 3290
191 Ga0068871_100050133 3300006358 Bacteria 3377
192 Ga0068871_100070168 3300006358 Bacteria 2879
193 Ga0068871_100242357 3300006358 Bacteria 1568
194 Ga0075433_10022199 3300006852 Bacteria 5327
195 Ga0075434_100374441 3300006871 Bacteria 1445
196 Ga0075429_100129756 3300006880 Bacteria 2205
197 Ga0068865_100013945 3300006881 Bacteria 5097
198 Ga0068865_100632231 3300006881 Bacteria 908
199 Ga0075436_100002374 3300006914 Bacteria 13001
200 Ga0097620_100000685 3300006931 Bacteria 34047
201 Ga0097620_100046027 3300006931 Bacteria 4383
202 Ga0075435_100059435 3300007076 Bacteria 3099
203 Ga0105244_10051045 3300009036 Bacteria 2108
204 Ga0105250_10011311 3300009092 Bacteria 3703
205 Ga0105240_10000013 3300009093 Bacteria 483458
206 Ga0105240_10074658 3300009093 Bacteria 4184
207 Ga0105240_10301034 3300009093 Bacteria 1834
208 Ga0105240_10362089 3300009093 Bacteria 1642
209 Ga0111539_10010849 3300009094 Bacteria 11468
210 Ga0105245_10260059 3300009098 Bacteria 1689
211 Ga0105243_10000551 3300009148 Bacteria 37844
212 Ga0105243_10016104 3300009148 Bacteria 5657
213 Ga0105241_10001717 3300009174 Bacteria 16659
214 Ga0105241_10119740 3300009174 Bacteria 2118
215 Ga0105241_10165877 3300009174 Bacteria 1820
216 Ga0105241_10546275 3300009174 Bacteria 1039
217 Ga0105248_10001290 3300009177 Bacteria 27898
218 Ga0105248_10002158 3300009177 Bacteria 21772
219 Ga0105248_10010453 3300009177 Bacteria 10221
220 Ga0105248_10010504 3300009177 Bacteria 10196
221 Ga0105248_10161135 3300009177 Bacteria 2530
222 Ga0105248_10321561 3300009177 Bacteria 1742
223 Ga0105248_10376838 3300009177 Bacteria 1597
224 Ga0105237_10000714 3300009545 Bacteria 45945
225 Ga0105237_10012745 3300009545 Bacteria 8842
226 Ga0105237_10438365 3300009545 Bacteria 1312
227 Ga0105238_10152773 3300009551 Bacteria 2283
228 Ga0105238_10159207 3300009551 Bacteria 2233
229 Ga0105249_10004218 3300009553 Bacteria 12422
230 Ga0105249_10007828 3300009553 Bacteria 9304
231 Ga0105249_10085844 3300009553 Bacteria 2934
232 Ga0105239_10002271 3300010375 Bacteria 24544
233 Ga0105239_10054540 3300010375 Bacteria 4385
234 Ga0105239_10120300 3300010375 Bacteria 2915
235 Ga0105239_10258223 3300010375 Bacteria 1958
236 Ga0157326_1004805 3300012513 Bacteria 1423
237 Ga0157373_10182545 3300013100 Bacteria 1477
238 Ga0157373_10283485 3300013100 Bacteria 1174
239 Ga0157373_10356148 3300013100 Bacteria 1044
240 Ga0157371_10000138 3300013102 Bacteria 105621
241 Ga0157370_10000209 3300013104 Bacteria 74351
242 Ga0157370_10066706 3300013104 Bacteria 3402
243 Ga0157370_10289017 3300013104 Bacteria 1514
244 Ga0157370_10685766 3300013104 Bacteria 935
245 Ga0157370_10774647 3300013104 Bacteria 873
246 Ga0157369_10058538 3300013105 Bacteria 4156
247 Ga0157369_10131905 3300013105 Bacteria 2647
248 Ga0157369_10142769 3300013105 Bacteria 2533
249 Ga0157374_10101520 3300013296 Bacteria 2758
250 Ga0157374_10150216 3300013296 Bacteria 2265
251 Ga0163162_10037700 3300013306 Bacteria 4825
252 Ga0163162_10055061 3300013306 Bacteria 4003
253 Ga0163162_10426281 3300013306 Bacteria 1459
254 Ga0163162_10689834 3300013306 Bacteria 1143
255 Ga0157372_10274365 3300013307 Bacteria 1960
256 Ga0157372_10947099 3300013307 Bacteria 998
257 Ga0157375_10011059 3300013308 Bacteria 7958
258 Ga0157375_10050373 3300013308 Bacteria 4085
259 Ga0157375_10133989 3300013308 Bacteria 2599
260 Ga0163163_10000307 3300014325 Bacteria 48168
261 Ga0163163_10015446 3300014325 Bacteria 7059
262 Ga0157380_10037643 3300014326 Bacteria 3749
263 Ga0157380_10270272 3300014326 Bacteria 1549
264 Ga0182008_10007328 3300014497 Bacteria 6101
265 Ga0157377_10025871 3300014745 Bacteria 3134
266 Ga0157379_10029113 3300014968 Bacteria 4912
267 Ga0157379_10433576 3300014968 Bacteria 1211
268 Ga0157379_10520031 3300014968 Bacteria 1105
269 Ga0157376_10292401 3300014969 Bacteria 1539
270 Ga0182006_1046750 3300015261 Bacteria 1680
271 Ga0182007_10003947 3300015262 Bacteria 6851
272 Ga0182005_1004378 3300015265 Bacteria 4577
273 Ga0182005_1071450 3300015265 Bacteria 953
274 Ga0163161_10070128 3300017792 Bacteria 2563
275 Ga0209435_100009 3300025206 Bacteria 476614
276 Ga0209760_102687 3300025207 Bacteria 1638
277 Ga0209672_110869 3300025228 Bacteria 1207
278 Ga0207427_106993 3300025231 Bacteria 1366
279 Ga0209437_100057 3300025233 Bacteria 362922
280 Ga0209437_100107 3300025233 Bacteria 218656
281 Ga0207425_1000034 3300025245 Bacteria 227886
282 Ga0209646_1000018 3300025246 Bacteria 476716
283 Ga0209646_1012176 3300025246 Bacteria 1324
284 Ga0209646_1017240 3300025246 Bacteria 1067
285 Ga0209026_1000041 3300025250 Bacteria 275745
286 Ga0209026_1000068 3300025250 Bacteria 207601
287 Ga0209677_100297 3300025253 Bacteria 32532
288 Ga0209677_107846 3300025253 Bacteria 2179
289 Ga0209148_1000011 3300025254 Bacteria 1196503
290 Ga0209148_1000069 3300025254 Bacteria 334444
291 Ga0209148_1026352 3300025254 Bacteria 903
292 Ga0209759_1000007 3300025256 Bacteria 476614
293 Ga0209759_1000183 3300025256 Bacteria 102218
294 Ga0209129_1000094 3300025258 Bacteria 172051
295 Ga0209233_1000030 3300025261 Bacteria 636702
296 Ga0209233_1000072 3300025261 Bacteria 363074
297 Ga0209233_1000134 3300025261 Bacteria 202535
298 Ga0209233_1000353 3300025261 Bacteria 42997
299 Ga0209233_1015585 3300025261 Bacteria 2114
300 Ga0209455_1000006 3300025272 Bacteria 1196503
301 Ga0209455_1000161 3300025272 Bacteria 117353
302 Ga0209673_1004624 3300025273 Bacteria 7285
303 Ga0209025_1000184 3300025294 Bacteria 155611
304 Ga0209758_1000017 3300025297 Bacteria 754393
305 Ga0209758_1000159 3300025297 Bacteria 155588
306 Ga0209758_1022617 3300025297 Bacteria 2873
307 Ga0207697_10002198 3300025315 Bacteria 10202
308 Ga0207697_10012600 3300025315 Bacteria 3541
309 Ga0207697_10097977 3300025315 Bacteria 1248
310 Ga0207696_1009256 3300025711 Bacteria 3683
311 Ga0207682_10000505 3300025893 Bacteria 17929
312 Ga0207682_10054396 3300025893 Bacteria 1663
313 Ga0207688_10021621 3300025901 Bacteria 3518
314 Ga0207688_10148791 3300025901 Bacteria 1382
315 Ga0207680_10001044 3300025903 Bacteria 13083
316 Ga0207647_10009701 3300025904 Bacteria 6830
317 Ga0207647_10021806 3300025904 Bacteria 4266
318 Ga0207647_10091971 3300025904 Bacteria 1809
319 Ga0207647_10102083 3300025904 Bacteria 1701
320 Ga0207699_10021776 3300025906 Bacteria 3461
321 Ga0207645_10085650 3300025907 Bacteria 2024
322 Ga0207705_10000120 3300025909 Bacteria 87080
323 Ga0207705_10052688 3300025909 Bacteria 2930
324 Ga0207705_10070861 3300025909 Bacteria 2526
325 Ga0207654_10000311 3300025911 Bacteria 29351
326 Ga0207654_10095098 3300025911 Bacteria 1824
327 Ga0207707_10056195 3300025912 Bacteria 3424
328 Ga0207707_10228071 3300025912 Bacteria 1621
329 Ga0207695_10000044 3300025913 Bacteria 440819
330 Ga0207695_10128226 3300025913 Bacteria 2497
331 Ga0207695_10161967 3300025913 Bacteria 2168
332 Ga0207695_10291054 3300025913 Bacteria 1525
333 Ga0207695_10671653 3300025913 Bacteria 917
334 Ga0207671_10000364 3300025914 Bacteria 64550
335 Ga0207671_10150986 3300025914 Bacteria 1795
336 Ga0207693_10009824 3300025915 Bacteria 7788
337 Ga0207660_10035675 3300025917 Bacteria 3454
338 Ga0207662_10035883 3300025918 Bacteria 2897
339 Ga0207657_10014901 3300025919 Bacteria 7563
340 Ga0207657_10036707 3300025919 Bacteria 4384
341 Ga0207657_10083838 3300025919 Bacteria 2673
342 Ga0207657_10169016 3300025919 Bacteria 1772
343 Ga0207649_10002327 3300025920 Bacteria 10668
344 Ga0207649_10027838 3300025920 Bacteria 3322
345 Ga0207649_10036447 3300025920 Bacteria 2962
346 Ga0207649_10175370 3300025920 Bacteria 1497
347 Ga0207649_10338173 3300025920 Bacteria 1111
348 Ga0207681_10011479 3300025923 Bacteria 5444
349 Ga0207681_10183634 3300025923 Bacteria 1595
350 Ga0207694_10185088 3300025924 Bacteria 1690
351 Ga0207650_10011940 3300025925 Bacteria 5988
352 Ga0207650_10037516 3300025925 Bacteria 3532
353 Ga0207650_10152831 3300025925 Bacteria 1823
354 Ga0207650_10274799 3300025925 Bacteria 1370
355 Ga0207650_10352871 3300025925 Bacteria 1210
356 Ga0207659_10097546 3300025926 Bacteria 2208
357 Ga0207659_10424433 3300025926 Bacteria 1116
358 Ga0207659_10481286 3300025926 Bacteria 1049
359 Ga0207700_10062479 3300025928 Bacteria 2829
360 Ga0207700_10064310 3300025928 Bacteria 2794
361 Ga0207644_10000415 3300025931 Bacteria 27794
362 Ga0207644_10012673 3300025931 Bacteria 5603
363 Ga0207644_10055721 3300025931 Bacteria 2850
364 Ga0207644_10126210 3300025931 Bacteria 1953
365 Ga0207644_10194240 3300025931 Bacteria 1597
366 Ga0207644_10457223 3300025931 Bacteria 1049
367 Ga0207690_10007422 3300025932 Bacteria 6509
368 Ga0207690_10026510 3300025932 Bacteria 3649
369 Ga0207690_10238082 3300025932 Bacteria 1401
370 Ga0207706_10036166 3300025933 Bacteria 4388
371 Ga0207706_10036276 3300025933 Bacteria 4380
372 Ga0207706_10048718 3300025933 Bacteria 3747
373 Ga0207706_10058766 3300025933 Bacteria 3387
374 Ga0207706_10060688 3300025933 Bacteria 3330
375 Ga0207686_10253052 3300025934 Bacteria 1288
376 Ga0207709_10000078 3300025935 Bacteria 169141
377 Ga0207709_10064738 3300025935 Bacteria 2297
378 Ga0207670_10234862 3300025936 Bacteria 1410
379 Ga0207669_10000020 3300025937 Bacteria 105051
380 Ga0207669_10009051 3300025937 Bacteria 4717
381 Ga0207669_10032982 3300025937 Bacteria 2916
382 Ga0207704_10524415 3300025938 Bacteria 959
383 Ga0207691_10036319 3300025940 Bacteria 4565
384 Ga0207691_10102071 3300025940 Bacteria 2559
385 Ga0207691_10240642 3300025940 Bacteria 1565
386 Ga0207691_10451422 3300025940 Bacteria 1094
387 Ga0207691_10520697 3300025940 Bacteria 1009
388 Ga0207711_10000420 3300025941 Bacteria 44798
389 Ga0207711_10000831 3300025941 Bacteria 30006
390 Ga0207711_10001208 3300025941 Bacteria 24465
391 Ga0207711_10009193 3300025941 Bacteria 8255
392 Ga0207711_10279596 3300025941 Bacteria 1537
393 Ga0207689_10072695 3300025942 Bacteria 2825
394 Ga0207689_10308763 3300025942 Bacteria 1312
395 Ga0207679_10008127 3300025945 Bacteria 6676
396 Ga0207679_10091455 3300025945 Bacteria 2355
397 Ga0207679_10246930 3300025945 Bacteria 1515
398 Ga0207667_10000002 3300025949 Bacteria 895662
399 Ga0207667_10121185 3300025949 Bacteria 2695
400 Ga0207651_10025637 3300025960 Bacteria 3668
401 Ga0207651_10054717 3300025960 Bacteria 2736
402 Ga0207651_10070177 3300025960 Bacteria 2477
403 Ga0207651_10107522 3300025960 Bacteria 2085
404 Ga0207712_10006333 3300025961 Bacteria 7467
405 Ga0207712_10009058 3300025961 Bacteria 6296
406 Ga0207668_10021001 3300025972 Bacteria 4158
407 Ga0207668_10034891 3300025972 Bacteria 3345
408 Ga0207668_10132672 3300025972 Bacteria 1904
409 Ga0207668_10474230 3300025972 Bacteria 1072
410 Ga0207640_10024794 3300025981 Bacteria 3623
411 Ga0207640_10066121 3300025981 Bacteria 2415
412 Ga0207640_10098241 3300025981 Bacteria 2046
413 Ga0207640_10163001 3300025981 Bacteria 1652
414 Ga0207640_10225962 3300025981 Bacteria 1436
415 Ga0207640_10508429 3300025981 Bacteria 1005
416 Ga0207640_10636544 3300025981 Bacteria 907
417 Ga0207658_10002673 3300025986 Bacteria 12909
418 Ga0207658_10003158 3300025986 Bacteria 11766
419 Ga0207658_10004510 3300025986 Bacteria 9674
420 Ga0207658_10005394 3300025986 Bacteria 8777
421 Ga0207658_10008350 3300025986 Bacteria 7050
422 Ga0207658_10075648 3300025986 Bacteria 2562
423 Ga0207658_10090891 3300025986 Bacteria 2367
424 Ga0207658_10255031 3300025986 Bacteria 1492
425 Ga0207658_10257368 3300025986 Bacteria 1486
426 Ga0207677_10013551 3300026023 Bacteria 4730
427 Ga0207677_10026347 3300026023 Bacteria 3644
428 Ga0207677_10320142 3300026023 Bacteria 1288
429 Ga0207677_10376784 3300026023 Bacteria 1197
430 Ga0207703_10001930 3300026035 Bacteria 18356
431 Ga0207703_10026334 3300026035 Bacteria 4576
432 Ga0207703_10443046 3300026035 Bacteria 1212
433 Ga0207639_10019145 3300026041 Bacteria 4877
434 Ga0207639_10031653 3300026041 Bacteria 3889
435 Ga0207639_10041332 3300026041 Bacteria 3448
436 Ga0207639_10136010 3300026041 Bacteria 2041
437 Ga0207639_10278875 3300026041 Bacteria 1469
438 Ga0207678_10020955 3300026067 Bacteria 5729
439 Ga0207678_10027969 3300026067 Bacteria 4923
440 Ga0207678_10070358 3300026067 Bacteria 3000
441 Ga0207678_10077444 3300026067 Bacteria 2848
442 Ga0207678_10134935 3300026067 Bacteria 2106
443 Ga0207678_10383139 3300026067 Bacteria 1216
444 Ga0207702_10007220 3300026078 Bacteria 9502
445 Ga0207702_10220615 3300026078 Bacteria 1767
446 Ga0207702_10367799 3300026078 Bacteria 1380
447 Ga0207702_10852214 3300026078 Bacteria 902
448 Ga0207641_10000502 3300026088 Bacteria 44127
449 Ga0207641_10026879 3300026088 Bacteria 4751
450 Ga0207641_10036006 3300026088 Bacteria 4129
451 Ga0207641_10153245 3300026088 Bacteria 2089
452 Ga0207648_10022723 3300026089 Bacteria 5627
453 Ga0207648_10069064 3300026089 Bacteria 3079
454 Ga0207648_10086868 3300026089 Bacteria 2729
455 Ga0207676_10002138 3300026095 Bacteria 14289
456 Ga0207676_10008921 3300026095 Bacteria 7134
457 Ga0207676_10173314 3300026095 Bacteria 1882
458 Ga0207674_10027655 3300026116 Bacteria 5995
459 Ga0207674_10220450 3300026116 Bacteria 1845
460 Ga0207675_100960816 3300026118 Bacteria 872
461 Ga0207683_10002005 3300026121 Bacteria 18010
462 Ga0207683_10009381 3300026121 Bacteria 8336
463 Ga0207683_10058347 3300026121 Bacteria 3389
464 Ga0207683_10389478 3300026121 Bacteria 1281
465 Ga0207698_10074132 3300026142 Bacteria 2713
466 Ga0207698_10136911 3300026142 Bacteria 2103
467 Ga0268266_10012670 3300028379 Bacteria 7286
468 Ga0268266_10018787 3300028379 Bacteria 5890
469 Ga0268266_10175377 3300028379 Bacteria 1948
470 Ga0268266_10179426 3300028379 Bacteria 1927
471 Ga0268266_10339001 3300028379 Bacteria 1411
472 Ga0268266_10368214 3300028379 Bacteria 1353
473 Ga0268265_10002045 3300028380 Bacteria 15816
474 Ga0268265_10005103 3300028380 Bacteria 9002
475 Ga0268265_10021534 3300028380 Bacteria 4518
476 Ga0268265_10199063 3300028380 Bacteria 1736
477 Ga0268265_10371302 3300028380 Bacteria 1313
478 Ga0268265_10552286 3300028380 Bacteria 1093
479 Ga0268265_10692766 3300028380 Bacteria 984
480 Ga0268264_10000410 3300028381 Bacteria 60680
481 Ga0268264_10000418 3300028381 Bacteria 59942
482 Ga0268264_10004427 3300028381 Bacteria 11983
483 Ga0268264_10041454 3300028381 Bacteria 3808
484 Ga0268264_10049649 3300028381 Bacteria 3491
485 Ga0316182_1126955 3300030745 Bacteria 2686
486 Ga0265328_10000400 3300031239 Bacteria 20303
487 Ga0265327_10111503 3300031251 Bacteria 1306
488 Ga0307408_100121195 3300031548 Bacteria 2026
489 Ga0307408_100245351 3300031548 Bacteria 1474
490 Ga0316575_10000462 3300031665 Bacteria 11643
491 Ga0316579_10053979 3300031691 Bacteria 1884
492 Ga0307405_10053655 3300031731 Bacteria 2512
493 Ga0307405_10383920 3300031731 Bacteria 1094
494 Ga0307405_10505245 3300031731 Bacteria 970
495 Ga0307413_10017198 3300031824 Bacteria 3760
496 Ga0307413_10033805 3300031824 Bacteria 2916
497 Ga0307413_10053410 3300031824 Bacteria 2446
498 Ga0307413_10072017 3300031824 Bacteria 2180
499 Ga0307413_10611722 3300031824 Bacteria 893
500 Ga0307413_10620786 3300031824 Bacteria 887
501 Ga0307410_10001216 3300031852 Bacteria 11451
502 Ga0307410_10003555 3300031852 Bacteria 7846
503 Ga0307410_10036507 3300031852 Bacteria 3201
504 Ga0307410_10041136 3300031852 Bacteria 3046
505 Ga0307410_10042014 3300031852 Bacteria 3019
506 Ga0307406_10004003 3300031901 Bacteria 8013
507 Ga0307406_10029958 3300031901 Bacteria 3299
508 Ga0307406_10241186 3300031901 Bacteria 1356
509 Ga0307406_10246473 3300031901 Bacteria 1343
510 Ga0307407_10020279 3300031903 Bacteria 3402
511 Ga0307407_10070824 3300031903 Bacteria 2074
512 Ga0307407_10220039 3300031903 Bacteria 1283
513 Ga0307412_10005208 3300031911 Bacteria 7290
514 Ga0307412_10083018 3300031911 Bacteria 2220
515 Ga0307412_10125584 3300031911 Bacteria 1855
516 Ga0307412_10248769 3300031911 Bacteria 1379
517 Ga0307409_100020317 3300031995 Bacteria 4523
518 Ga0307409_100044599 3300031995 Bacteria 3341
519 Ga0307409_100055437 3300031995 Bacteria 3060
520 Ga0307409_100383993 3300031995 Bacteria 1336
521 Ga0307416_100177028 3300032002 Bacteria 1994
522 Ga0307416_100394604 3300032002 Bacteria 1419
523 Ga0307414_10005548 3300032004 Bacteria 6959
524 Ga0307414_10050064 3300032004 Bacteria 2892
525 Ga0307414_10059036 3300032004 Bacteria 2706
526 Ga0307414_10213311 3300032004 Bacteria 1579
527 Ga0307414_10234079 3300032004 Bacteria 1516
528 Ga0307414_10397994 3300032004 Bacteria 1195
529 Ga0307411_10001404 3300032005 Bacteria 9790
530 Ga0307411_10002297 3300032005 Bacteria 8376
531 Ga0307411_10062011 3300032005 Bacteria 2492
532 Ga0307411_10077171 3300032005 Bacteria 2280
533 Ga0307411_10199709 3300032005 Bacteria 1534
534 Ga0307411_10200077 3300032005 Bacteria 1533
535 Ga0307411_10218389 3300032005 Bacteria 1477
536 Ga0307411_10294194 3300032005 Bacteria 1299
537 Ga0307415_100209555 3300032126 Bacteria 1553
538 Ga0373935_0056241 3300035692 Bacteria 2508
539 Ga0373935_0347864 3300035692 Bacteria 1056
540 Ga0373927_0000019 3300035695 Bacteria 139754
541 Ga0316582_0168187 3300036647 Bacteria 1487
542 Ga0316584_0062902 3300036712 Bacteria 2779
543 Ga0373925_0001010 3300037068 Bacteria 25444
544 Ga0373925_0178597 3300037068 Bacteria 1679
545 Ga0395899_0000288 3300037312 Bacteria 64881
546 Ga0395899_0062521 3300037312 Bacteria 2742
547 Ga0395899_0254140 3300037312 Bacteria 1205
548 Ga0395900_0000246 3300037418 Bacteria 85104
549 Ga0395900_0003041 3300037418 Bacteria 18271
550 Ga0395900_0125626 3300037418 Bacteria 2631
551 Ga0395900_0144558 3300037418 Bacteria 2433
552 Ga0395900_0171188 3300037418 Bacteria 2211
553 Ga0395900_0334197 3300037418 Bacteria 1492
554 Ga0395900_0418140 3300037418 Bacteria 1302
555 Ga0395900_0538065 3300037418 Bacteria 1114
556 Ga0395898_0000447 3300037466 Bacteria 85103
557 Ga0395898_0489804 3300037466 Bacteria 1170
558 Ga0395898_0832015 3300037466 Bacteria 863
559 Ga0395905_0000228 3300037471 Bacteria 85103
560 Ga0395905_0002055 3300037471 Bacteria 22979
561 Ga0395905_0015256 3300037471 Bacteria 7305
562 Ga0395905_0019543 3300037471 Bacteria 6420
563 Ga0395905_0030456 3300037471 Bacteria 5085
564 Ga0395905_0033143 3300037471 Bacteria 4854
565 Ga0395905_0089712 3300037471 Bacteria 2881
566 Ga0395905_0130833 3300037471 Bacteria 2360
567 Ga0395905_0148896 3300037471 Bacteria 2202
568 Ga0395905_0154177 3300037471 Bacteria 2161
569 Ga0395905_0315803 3300037471 Bacteria 1452
570 Ga0436364_0575430 3300037853 Bacteria 1568
571 Ga0395901_0000167 3300038443 Bacteria 85844
572 Ga0395901_0023795 3300038443 Bacteria 6281
573 Ga0395901_0038175 3300038443 Bacteria 4968
574 Ga0395901_0069941 3300038443 Bacteria 3656
575 Ga0395901_0482284 3300038443 Bacteria 1264
576 Ga0395901_0556178 3300038443 Bacteria 1162
577 Ga0436365_1317782 3300039437 Bacteria 2217
578 Ga0436365_1906995 3300039437 Bacteria 1055
579 Ga0436360_0223865 3300039438 Bacteria 2164
580 Ga0436361_0909211 3300039447 Bacteria 3196
581 Ga0436363_1504724 3300039450 Bacteria 1304
582 Ga0439466_0035629 3300041411 Bacteria 1683
583 Ga0439466_0043093 3300041411 Bacteria 1500
584 Ga0439465_0009333 3300041413 Bacteria 3091
585 Ga0439432_047628 3300042006 Bacteria 1344
586 Ga0439449_0016313 3300042007 Bacteria 2792
587 Ga0439462_0021801 3300042015 Bacteria 1675
588 Ga0450914_000066 3300042118 Bacteria 2872
589 Ga0450890_005866 3300042127 Bacteria 1580
590 Ga0450889_000164 3300042144 Bacteria 6977
591 Ga0439464_0001132 3300042439 Bacteria 6173
592 Ga0466972_0037315 3300044658 Bacteria 2376
593 Ga0466960_0133528 3300044901 Bacteria 1312
594 Ga0466959_0043155 3300045049 Bacteria 3326
595 Ga0466958_0021058 3300045836 Bacteria 3807
596 Ga0466967_0693516 3300045976 Bacteria 1008
597 Ga0495629_0210565 3300046459 Bacteria 1343
598 Ga0495638_0000978 3300046460 Bacteria 28781
599 Ga0495638_0024075 3300046460 Bacteria 3974
600 Ga0495605_0005182 3300046474 Bacteria 7593
601 Ga0495585_0002615 3300046492 Bacteria 12702
602 Ga0495585_0005045 3300046492 Bacteria 8416
603 Ga0495585_0060178 3300046492 Bacteria 2091
604 Ga0495596_0071481 3300046500 Bacteria 1347
605 Ga0495607_0091605 3300046501 Bacteria 1646
606 Ga0495583_0003310 3300046506 Bacteria 12484
607 Ga0495583_0011178 3300046506 Bacteria 5172
608 Ga0495583_0021181 3300046506 Bacteria 3349
609 Ga0495583_0164009 3300046506 Bacteria 915
610 Ga0495606_0000963 3300046507 Bacteria 42128
611 Ga0495606_0016331 3300046507 Bacteria 5667
612 Ga0495606_0121693 3300046507 Bacteria 1562
613 Ga0495616_0015461 3300046513 Bacteria 4246
614 Ga0495616_0066743 3300046513 Bacteria 1750
615 Ga0495620_0080955 3300046515 Bacteria 1314
616 Ga0495631_0001352 3300046518 Bacteria 14999
617 Ga0495631_0042268 3300046518 Bacteria 2015
618 Ga0495632_0014024 3300046519 Bacteria 4549
619 Ga0495643_0104652 3300046522 Bacteria 1446
620 Ga0495648_0000782 3300046524 Bacteria 33902
621 Ga0495648_0080295 3300046524 Bacteria 1859
622 Ga0495663_0006090 3300046525 Bacteria 3336
623 Ga0495654_0000296 3300046530 Bacteria 44716
624 Ga0495587_0268631 3300046536 Bacteria 957
625 Ga0495609_0040002 3300046538 Bacteria 2110
626 Ga0495621_0037811 3300046539 Bacteria 1680
627 Ga0495597_0038339 3300046542 Bacteria 2148
628 Ga0495633_0005249 3300046558 Bacteria 7988
629 Ga0495668_0000080 3300046616 Bacteria 157259
630 Ga0495668_0016292 3300046616 Bacteria 4320
631 Ga0495611_0006470 3300046648 Bacteria 4991
632 Ga0495625_0000819 3300046660 Bacteria 42876
633 Ga0495625_0012968 3300046660 Bacteria 6725
634 Ga0495625_0032281 3300046660 Bacteria 3885
635 Ga0495625_0054954 3300046660 Bacteria 2842
636 Ga0495625_0064035 3300046660 Bacteria 2595
637 Ga0495625_0142379 3300046660 Bacteria 1617
638 Ga0495625_0146525 3300046660 Bacteria 1589
639 Ga0495635_0296620 3300046663 Bacteria 1084
640 Ga0495661_0207327 3300046665 Bacteria 1023
641 Ga0495669_0000011 3300046684 Bacteria 158720
642 Ga0495669_0001712 3300046684 Bacteria 8984
643 Ga0495613_0159806 3300046689 Bacteria 1604
644 Ga0495670_0034506 3300046691 Bacteria 2520
645 Ga0495670_0078577 3300046691 Bacteria 1678
646 Ga0495649_0021504 3300046694 Bacteria 3613
647 Ga0495660_0038136 3300046810 Bacteria 2673
648 Ga0495660_0084593 3300046810 Bacteria 1659
649 Ga0495604_0076923 3300047317 Bacteria 2509
650 Ga0495636_0032155 3300047318 Bacteria 2152
651 Ga0495672_0052903 3300047320 Bacteria 2383
652 Ga0495683_0006885 3300047323 Bacteria 6180
653 Ga0495683_0046681 3300047323 Bacteria 2174
654 Ga0495687_000684 3300047443 Bacteria 38434
655 Ga0495687_002397 3300047443 Bacteria 15119
656 Ga0495687_060961 3300047443 Bacteria 1554
657 Ga0495677_0041230 3300047445 Bacteria 1689
658 Ga0495673_0088949 3300047469 Bacteria 1265
659 Ga0495681_0018299 3300047470 Bacteria 3863
660 Ga0495681_0026759 3300047470 Bacteria 2995
661 Ga0495686_0077522 3300047472 Bacteria 2035
662 Ga0495626_0179131 3300048091 Bacteria 879
663 Ga0496100_0284405 3300048903 Bacteria 1234
664 Ga0496101_0142979 3300048904 Bacteria 1825
665 Ga0496102_0000213 3300048905 Bacteria 76751
666 Ga0496102_0013947 3300048905 Bacteria 6975
667 Ga0496102_0155087 3300048905 Bacteria 2153
668 Ga0496102_0233622 3300048905 Bacteria 1733
669 Ga0496102_0284691 3300048905 Bacteria 1558
670 Ga0496102_0384891 3300048905 Bacteria 1320
671 Ga0496103_0001102 3300048906 Bacteria 18819
672 Ga0496103_0015441 3300048906 Bacteria 4544
673 Ga0496103_0211328 3300048906 Bacteria 1248
674 Ga0496104_0041322 3300048907 Bacteria 4324
675 Ga0496104_0053309 3300048907 Bacteria 3820
676 Ga0496105_0010188 3300048908 Bacteria 7386
677 Ga0496105_0013563 3300048908 Bacteria 6473
678 Ga0496106_0186999 3300048909 Bacteria 1646
679 Ga0496107_0017579 3300048910 Bacteria 5030
680 Ga0496107_0107364 3300048910 Bacteria 2051
681 Ga0496108_0001490 3300048911 Bacteria 18506
682 Ga0496108_0006149 3300048911 Bacteria 9711
683 Ga0496108_0383643 3300048911 Bacteria 1227
684 Ga0496108_0783865 3300048911 Bacteria 823
685 Ga0496109_0000610 3300048912 Bacteria 29899
686 Ga0496109_0003373 3300048912 Bacteria 13363
687 Ga0496109_0160531 3300048912 Bacteria 2106
688 Ga0496110_0040525 3300048913 Bacteria 4058
689 Ga0496110_0047828 3300048913 Bacteria 3747
690 Ga0496110_0165155 3300048913 Bacteria 2008
691 Ga0496110_0297284 3300048913 Bacteria 1471
692 Ga0496111_0019440 3300048914 Bacteria 4718
693 Ga0496111_0020827 3300048914 Bacteria 4571
694 Ga0496112_0016625 3300048915 Bacteria 6897
695 Ga0496112_0036131 3300048915 Bacteria 4817
696 Ga0496112_0327314 3300048915 Bacteria 1476
697 Ga0496113_0001927 3300048916 Bacteria 11871
698 Ga0496113_0011007 3300048916 Bacteria 6011
699 Ga0496113_0099782 3300048916 Bacteria 2249
700 Ga0496113_0279895 3300048916 Bacteria 1334
701 Ga0496114_0057231 3300048917 Bacteria 3254
702 Ga0496114_0064085 3300048917 Bacteria 3077
703 Ga0496114_0186076 3300048917 Bacteria 1815
704 Ga0496115_0000030 3300048918 Bacteria 138328
705 Ga0496115_0019252 3300048918 Bacteria 5251
706 Ga0496115_0054849 3300048918 Bacteria 3201
707 Ga0496116_0004303 3300048919 Bacteria 13628
708 Ga0496116_0013189 3300048919 Bacteria 6685
709 Ga0496116_0034869 3300048919 Bacteria 3541
710 Ga0496116_0103211 3300048919 Bacteria 1697
711 Ga0496116_0128039 3300048919 Bacteria 1453
712 Ga0496117_0001842 3300048920 Bacteria 28637
713 Ga0496117_0018264 3300048920 Bacteria 5819
714 Ga0496117_0024164 3300048920 Bacteria 4815
715 Ga0496118_0000207 3300048921 Bacteria 102753
716 Ga0496118_0003544 3300048921 Bacteria 19513
717 Ga0496118_0126826 3300048921 Bacteria 1649
718 Ga0496118_0143359 3300048921 Bacteria 1509
719 Ga0496119_0020775 3300048922 Bacteria 4771
720 Ga0496119_0050772 3300048922 Bacteria 2553
721 Ga0496119_0088442 3300048922 Bacteria 1766
722 Ga0496120_0002681 3300048923 Bacteria 17483
723 Ga0496120_0023582 3300048923 Bacteria 3850
724 Ga0496120_0134929 3300048923 Bacteria 1259
725 Ga0496121_0001274 3300048924 Bacteria 43406
726 Ga0496121_0004072 3300048924 Bacteria 20075
727 Ga0496121_0081432 3300048924 Bacteria 2562
728 Ga0496121_0185515 3300048924 Bacteria 1496
729 Ga0496122_0013200 3300048925 Bacteria 8108
730 Ga0496122_0020390 3300048925 Bacteria 5992
731 Ga0496122_0031506 3300048925 Bacteria 4411
732 Ga0496122_0052396 3300048925 Bacteria 3089
733 Ga0496122_0053444 3300048925 Bacteria 3045
734 Ga0496122_0069960 3300048925 Bacteria 2510
735 Ga0496123_0008958 3300048926 Bacteria 9096
736 Ga0496123_0039206 3300048926 Bacteria 3316
737 Ga0496123_0043471 3300048926 Bacteria 3085
738 Ga0496123_0127351 3300048926 Bacteria 1418
739 Ga0496124_0001058 3300048927 Bacteria 43458
740 Ga0496124_0009124 3300048927 Bacteria 10246
741 Ga0496124_0010128 3300048927 Bacteria 9597
742 Ga0496124_0059174 3300048927 Bacteria 3219
743 Ga0496124_0078985 3300048927 Bacteria 2710
744 Ga0496125_0001207 3300048928 Bacteria 38864
745 Ga0496125_0005193 3300048928 Bacteria 14622
746 Ga0496125_0011707 3300048928 Bacteria 8749
747 Ga0496125_0061256 3300048928 Bacteria 3019
748 Ga0496125_0134782 3300048928 Bacteria 1730
749 Ga0496126_0001895 3300048929 Bacteria 30168
750 Ga0496126_0064058 3300048929 Bacteria 3293
751 Ga0496126_0101060 3300048929 Bacteria 2523
752 Ga0496126_0426266 3300048929 Bacteria 1071
753 Ga0495678_006569 3300049459 Bacteria 6167
754 Ga0495678_025882 3300049459 Bacteria 2513
755 Ga0495682_0038316 3300049460 Bacteria 1762
756 Ga0501300_014461 3300049523 Bacteria 1151
757 Ga0501031_0008288 3300049568 Bacteria 6760
758 Ga0501031_0023956 3300049568 Bacteria 3980
759 Ga0501032_0000001 3300049569 Bacteria 422097
760 Ga0501032_0000017 3300049569 Bacteria 158303
761 Ga0501032_0193969 3300049569 Bacteria 1327
762 Ga0501033_0000029 3300049570 Bacteria 158294
763 Ga0501033_0000830 3300049570 Bacteria 28206
764 Ga0501033_0002867 3300049570 Bacteria 14451
765 Ga0501033_0036868 3300049570 Bacteria 3662
766 Ga0501033_0072134 3300049570 Bacteria 2536
767 Ga0501033_0375415 3300049570 Bacteria 994
768 Ga0501034_0000036 3300049571 Bacteria 239274
769 Ga0501034_0000102 3300049571 Bacteria 158302
770 Ga0501034_0015348 3300049571 Bacteria 7872
771 Ga0501034_0071549 3300049571 Bacteria 3477
772 Ga0501034_0162497 3300049571 Bacteria 2203
773 Ga0501034_0186186 3300049571 Bacteria 2040
774 Ga0501034_0201676 3300049571 Bacteria 1947
775 Ga0501034_0237918 3300049571 Bacteria 1768
776 Ga0501034_0284278 3300049571 Bacteria 1593
777 Ga0501036_0000011 3300049572 Bacteria 158302
778 Ga0501036_0000180 3300049572 Bacteria 41669
779 Ga0501037_0000015 3300049573 Bacteria 161311
780 Ga0501037_0000017 3300049573 Bacteria 157276
781 Ga0501038_0000016 3300049574 Bacteria 159150
782 Ga0501038_0000036 3300049574 Bacteria 124766
783 Ga0501038_0016245 3300049574 Bacteria 6750
784 Ga0501039_0000011 3300049575 Bacteria 245124
785 Ga0501039_0000023 3300049575 Bacteria 158026
786 Ga0501039_0185817 3300049575 Bacteria 1634
787 Ga0501039_0412033 3300049575 Bacteria 1061
788 Ga0501040_0004290 3300049576 Bacteria 9267
789 Ga0501043_0000105 3300049579 Bacteria 78189
790 Ga0501043_0000423 3300049579 Bacteria 38075
791 Ga0501043_0161322 3300049579 Bacteria 1751
792 Ga0501043_0168649 3300049579 Bacteria 1709
793 Ga0501043_0254048 3300049579 Bacteria 1353
794 Ga0501046_0038983 3300049580 Bacteria 3809
795 Ga0501046_0049874 3300049580 Bacteria 3309
796 Ga0501047_0002449 3300049581 Bacteria 17717
797 Ga0501047_0027147 3300049581 Bacteria 5514
798 Ga0501047_0061955 3300049581 Bacteria 3609
799 Ga0501047_0150345 3300049581 Bacteria 2205
800 Ga0501047_0173111 3300049581 Bacteria 2027
801 Ga0501047_0702789 3300049581 Bacteria 828
802 Ga0501048_0007590 3300049582 Bacteria 8224
803 Ga0501067_0005711 3300049583 Bacteria 6906
804 Ga0501067_0021763 3300049583 Bacteria 3548
805 Ga0501067_0130046 3300049583 Bacteria 1401
806 Ga0501068_0028598 3300049584 Bacteria 3297
807 Ga0501069_0071079 3300049585 Bacteria 1950
808 Ga0501069_0164579 3300049585 Bacteria 1278
809 Ga0501070_0000648 3300049586 Bacteria 32010
810 Ga0501070_0003968 3300049586 Bacteria 12731
811 Ga0501070_0014269 3300049586 Bacteria 6687
812 Ga0501070_0064322 3300049586 Bacteria 3038
813 Ga0501070_0092448 3300049586 Bacteria 2504
814 Ga0501073_0061124 3300049589 Bacteria 2629
815 Ga0501073_0255943 3300049589 Bacteria 1208
816 Ga0501077_0058762 3300049593 Bacteria 2441
817 Ga0501080_0000711 3300049742 Bacteria 26756
818 Ga0501080_0005920 3300049742 Bacteria 10953
819 Ga0501080_0026665 3300049742 Bacteria 5369
820 Ga0501083_0020004 3300049744 Bacteria 4658
821 Ga0501280_005531 3300049776 Bacteria 1806
822 Ga0501035_0000028 3300049822 Bacteria 179195
823 Ga0501035_0000038 3300049822 Bacteria 158818
824 Ga0501035_0004286 3300049822 Bacteria 13543
825 Ga0501035_0004759 3300049822 Bacteria 12888
826 Ga0501035_0028976 3300049822 Bacteria 5050
827 Ga0501044_0000046 3300049823 Bacteria 146812
828 Ga0501044_0015506 3300049823 Bacteria 8208
829 Ga0501044_0029697 3300049823 Bacteria 5764
830 Ga0501044_0037710 3300049823 Bacteria 5050
831 Ga0501044_0060165 3300049823 Bacteria 3890
832 nmdc:mga03n38_99417_c1 3300050490 Bacteria 1401
833 nmdc:mga00v17_27_c1 3300050491 Bacteria 33804
834 nmdc:mga0yw44_113987_c1 3300050492 Bacteria 1735
835 nmdc:mga0yw44_359795_c1 3300050492 Bacteria 981
836 nmdc:mga0yw44_94848_c1 3300050492 Bacteria 1892
837 nmdc:mga0k408_517955_c1 3300050493 Bacteria 706
838 nmdc:mga06z11_142342_c1 3300050494 Bacteria 1357
839 nmdc:mga06z11_264878_c1 3300050494 Bacteria 1015
840 nmdc:mga06z11_32902_c1 3300050494 Bacteria 2532
841 nmdc:mga07m45_67034_c1 3300050496 Bacteria 2040
842 nmdc:mga05p37_522229_c1 3300050507 Bacteria 1358
843 nmdc:mga09592_586221_c1 3300050508 Bacteria 956
844 nmdc:mga0rr50_29874_c1 3300050513 Bacteria 3850
845 nmdc:mga0rr50_318165_c1 3300050513 Bacteria 1304
846 nmdc:mga08x19_6_c2 3300050514 Bacteria 52011
847 nmdc:mga0a205_7550_c1 3300050515 Bacteria 9853
848 nmdc:mga0sz30_9974_c1 3300050516 Bacteria 3630
849 Ga0500610_0000034 3300053079 Bacteria 49152
850 Ga0500610_0010483 3300053079 Bacteria 4171
851 Ga0500610_0039576 3300053079 Bacteria 2433
852 Ga0500578_0041900 3300053086 Bacteria 2940
853 Ga0500643_059263 3300053087 Bacteria 1078
854 Ga0500569_014287 3300053109 Bacteria 1962
855 Ga0500594_0001317 3300053118 Bacteria 5382
856 Ga0500618_000222 3300053125 Bacteria 44764
857 Ga0500618_038432 3300053125 Bacteria 1104
858 Ga0500642_0005333 3300053130 Bacteria 4141
859 Ga0500559_0010357 3300053136 Bacteria 4006
860 Ga0500568_0000104 3300053139 Bacteria 78075
861 Ga0500568_0000763 3300053139 Bacteria 22859
862 Ga0500568_0000803 3300053139 Bacteria 22116
863 Ga0500573_0008514 3300053140 Bacteria 5652
864 Ga0500573_0171799 3300053140 Bacteria 1171
865 Ga0500588_0044268 3300053146 Bacteria 1357
866 Ga0500616_0000220 3300053153 Bacteria 89104
867 Ga0500616_0001222 3300053153 Bacteria 25849
868 Ga0500620_000357 3300053155 Bacteria 8508
869 Ga0500627_0027408 3300053158 Bacteria 2358
870 Ga0500634_0004310 3300053161 Bacteria 6552
871 Ga0500611_006673 3300053727 Bacteria 1694
872 Ga0500611_020911 3300053727 Bacteria 1242
873 Ga0500645_000001 3300053730 Bacteria 455558
874 Ga0500645_028306 3300053730 Bacteria 1697
875 Ga0501084_0062074 3300054114 Bacteria 3128
876 Ga0501084_0089796 3300054114 Bacteria 2579
877 Ga0501082_0042260 3300060353 Bacteria 3930
878 Ga0501082_0063229 3300060353 Bacteria 3186
879 Ga0501082_0107266 3300060353 Bacteria 2416
880 Ga0466962_0121969 3300061719 Bacteria 1258
881 Ga0466962_0188923 3300061719 Bacteria 1005
882 2503199587 2503198000 Bacteria 6884444
883 2509371029 2509276018 Bacteria 6910194
884 2509394513 2509276022 Bacteria 6200534
885 2510842070 2510461069 Bacteria 5505000
886 2511133790 2510917022 Bacteria 6504556
887 2512933008 2512875016 Bacteria 6529530
888 2512961032 2512875024 Bacteria 7195110
889 2513611221 2513237090 Bacteria 7096802
890 2513929163 2513237146 Bacteria 7166346
891 2514035114 2513237164 Bacteria 7563725
892 2514417210 2513237305 Bacteria 7293571
893 2514587159 2513237351 Bacteria 6968952
894 2561466976 2558860983 Bacteria 4133860
895 2585167823 2582581283 Bacteria 6030556
896 2585228842 2582581299 Bacteria 6518058
897 2585257505 2582581304 Bacteria 5831370
898 2585271508 2582581307 Bacteria 6597605
899 2585280573 2582581308 Bacteria 7413247
900 2585327938 2582581315 Bacteria 7318924
901 2585334309 2582581316 Bacteria 7774528
902 2585531511 2585427527 Bacteria 7273426
903 2585551575 2585427530 Bacteria 7383882
904 2585563252 2585427531 Bacteria 6992870
905 2585844794 2585427594 Bacteria 6180594
906 2585907470 2585427609 Bacteria 6667127
907 2587982536 2585428125 Bacteria 6662905
908 2588519062 2588253730 Bacteria 6881675
909 2597811384 2597489875 Bacteria 7010078
910 2599420342 2599185170 Bacteria 7295545
911 2599939080 2599185301 Bacteria 6161860
912 2616296470 2615840624 Bacteria 6557588
913 2616306881 2615840626 Bacteria 7921970
914 2616557739 2615840698 Bacteria 7319877
915 2617384988 2617270742 Bacteria 6808054
916 2643771408 2643221550 Bacteria 4619371
917 2643776932 2643221551 Bacteria 3750538
918 2643795380 2643221555 Bacteria 3749717
919 2643813613 2643221558 Bacteria 5460675
920 2643836899 2643221564 Bacteria 4193379
921 2643986100 2643221595 Bacteria 6565519
922 2644050883 2643221607 Bacteria 6314006
923 2644153665 2643221627 Bacteria 6761570
924 2644205386 2643221636 Bacteria 6583769
925 2644210053 2643221637 Bacteria 5345260
926 2644240693 2643221643 Bacteria 5749658
927 2644300027 2643221653 Bacteria 4569637
928 2644483787 2643221686 Bacteria 6310811
929 2644496091 2643221688 Bacteria 5260751
930 2644653604 2643221718 Bacteria 5345506
931 2644658253 2643221719 Bacteria 4568197
932 2671113625 2667528174 Bacteria 6435400
933 2688596837 2687453392 Bacteria 6880454
934 2694634243 2693429783 Bacteria 7019804
935 2694637982 2693429784 Bacteria 7241525
936 2723573957 2721755686 Bacteria 7343952
937 2738805347 2738541293 Bacteria 7065685
938 2756677370 2756170246 Bacteria 7451806
939 2776270077 2775506902 Bacteria 6208009
940 2776915319 2775507049 Bacteria 6284736
941 2778173578 2775507266 Bacteria 7392367
942 2792748412 2791355123 Bacteria 8049106
943 2819243641 2818991272 Bacteria 4622173
944 2819638974 2818991453 Bacteria 7181617
945 2838030785 2838029111 Bacteria 6603031
946 2838040550 2838035591 Bacteria 7166484
947 2838668453 2838661181 Bacteria 7385261
948 2839997920 2839993093 Bacteria 5512535
949 2841737324 2841734538 Bacteria 6784580
950 2842477517 2842475841 Bacteria 6603183
951 2842488083 2842482326 Bacteria 7212537
952 2842504610 2842502639 Bacteria 6604161
953 2844009139 2844002411 Bacteria 7168230
954 2847674601 2847670302 Bacteria 6165597
955 2847690718 2847686936 Bacteria 6278406
956 2854896986 2854896431 Bacteria 5869725
957 2854917135 2854916844 Bacteria 5725939
958 2856317513 2856314179 Bacteria 6477897
959 2856322667 2856320880 Bacteria 7263508
960 2856328862 2856328259 Bacteria 6528202
961 2856343870 2856342000 Bacteria 7176905
962 2856350387 2856349417 Bacteria 6230045
963 2856366703 2856364286 Bacteria 6939991
964 2857356612 2857349434 Bacteria 7926032
965 2869165143 2869162929 Bacteria 6399702
966 2869258953 2869256925 Bacteria 6981691
967 2869285815 2869278585 Bacteria 7077053
968 2869287886 2869285874 Bacteria 6901219
969 2871435834 2871429161 Bacteria 6547891
970 2871448671 2871444079 Bacteria 6423508
971 2871465677 2871459585 Bacteria 6866887
972 2871471762 2871466892 Bacteria 6923287
973 2871479385 2871474448 Bacteria 6806570
974 2871489893 2871488783 Bacteria 6929816
975 2871498007 2871495908 Bacteria 6935695
976 2874104840 2874102143 Bacteria 6342645
977 2874111127 2874109183 Bacteria 6517025
978 2874128801 2874123672 Bacteria 7238285
979 2874141871 2874139085 Bacteria 7021506
980 2874151519 2874146452 Bacteria 7533118
981 2874159151 2874155637 Bacteria 6724144
982 2874167592 2874162495 Bacteria 6174670
983 2874175702 2874168670 Bacteria 8062617
984 2876364744 2876363079 Bacteria 6544991
985 2876370394 2876369609 Bacteria 6807521
986 2876396201 2876392853 Bacteria 6660880
987 2876405898 2876399893 Bacteria 6927900
988 2876417570 2876413966 Bacteria 6831344
989 2876426103 2876420981 Bacteria 6687741
990 2878038551 2878035449 Bacteria 6555736
991 2878739390 2878738818 Bacteria 7136951
992 2878749397 2878745973 Bacteria 6867388
993 2878754423 2878753008 Bacteria 6922523
994 2878762229 2878760144 Bacteria 6823465
995 2878769196 2878767105 Bacteria 6898628
996 2878794254 2878788777 Bacteria 6567085
997 2881149408 2881147464 Bacteria 7779814
998 2881160616 2881155292 Bacteria 6461656
999 2881166310 2881161766 Bacteria 7127907
1000 2881848364 2881845957 Bacteria 6611900
1001 2881861629 2881861095 Bacteria 7128710
1002 2882634081 2882632389 Bacteria 8154593
1003 2882919357 2882912400 Bacteria 6801539
1004 2885307738 2885305155 Bacteria 7348390
1005 2885313266 2885312484 Bacteria 6415165
1006 2885321656 2885318864 Bacteria 6729568
1007 2885327080 2885326080 Bacteria 7134805
1008 2885338424 2885334103 Bacteria 7216818
1009 2885343322 2885342637 Bacteria 7011821
1010 2885354165 2885350715 Bacteria 6787678
1011 2888337956 2888337043 Bacteria 6629336
1012 2888345257 2888343758 Bacteria 6611049
1013 2888354547 2888350351 Bacteria 7372807
1014 2889016151 2889010040 Bacteria 6749192
1015 2889018808 2889016732 Bacteria 6700763
1016 2891088939 2891088606 Bacteria 4762464
1017 2903449270 2903448605 Bacteria 7357801
1018 2903493628 2903492973 Bacteria 13473544
1019 2903497628 2903492973 Bacteria 13473544
1020 2903522520 2903521522 Bacteria 6525694
1021 2903528899 2903528002 Bacteria 6586099
1022 2903542805 2903540706 Bacteria 7062119
1023 2904580425 2904578770 Bacteria 5302906
1024 2904662977 2904659560 Bacteria 6685615
1025 2906310435 2906308376 Bacteria 6841989
1026 2906324500 2906321335 Bacteria 6579571
1027 2906333299 2906328253 Bacteria 6585166
1028 2906355140 2906354277 Bacteria 6991324
1029 2906364314 2906363423 Bacteria 6856682
1030 2906375090 2906370794 Bacteria 6881062
1031 2906385269 2906378014 Bacteria 6911440
1032 2906405645 2906401398 Bacteria 6693206
1033 2906417578 2906414383 Bacteria 6580790
1034 2919119900 2919119836 Bacteria 5208557
1035 2919410916 2919408235 Bacteria 6149349
1036 2922152114 2922151315 Bacteria 6902399
1037 2922173313 2922172374 Bacteria 6167644
1038 2924725920 2924718760 Bacteria 6331356
1039 2924731976 2924726620 Bacteria 6271473
1040 2924751282 2924748358 Bacteria 6154725
1041 2924757025 2924754689 Bacteria 6774424
1042 2924769302 2924762789 Bacteria 6561353
1043 2924776911 2924776078 Bacteria 7492003
1044 2924790189 2924784321 Bacteria 7416538
1045 2933022850 2933016740 Bacteria 6355406
1046 2937817263 2937813078 Bacteria 7783518
1047 2937825785 2937822353 Bacteria 7290551
1048 2937837560 2937836603 Bacteria 6811263
1049 2937855449 2937848649 Bacteria 6983481
1050 2937883489 2937877337 Bacteria 7246526
1051 2937896670 2937891427 Bacteria 6357007
1052 2937973532 2937972304 Bacteria 7532020
1053 2937996656 2937994558 Bacteria 7036190
1054 2938018529 2938014810 Bacteria 6700592
1055 2958041831 2958034702 Bacteria 6989922
1056 2958050362 2958041894 Bacteria 13082850
1057 2958051306 2958041894 Bacteria 13082850
1058 2958070086 2958064165 Bacteria 7158582
1059 2958073623 2958071322 Bacteria 6815895
1060 2958090656 2958084443 Bacteria 7312792
1061 2958097384 2958092219 Bacteria 6861151
1062 2958108050 2958100919 Bacteria 6800575
1063 2958116131 2958115193 Bacteria 6923548
1064 2958125330 2958122699 Bacteria 7280457
1065 2958132290 2958130278 Bacteria 6897202
1066 2958167127 2958165035 Bacteria 6906348
1067 2958177118 2958172287 Bacteria 6716688
1068 2958182104 2958179912 Bacteria 6874908
1069 2961079948 2961077736 Bacteria 7079850
1070 2961118003 2961114664 Bacteria 6680456
1071 2961132403 2961127735 Bacteria 7196641
1072 2961142377 2961136820 Bacteria 6775228
1073 2961165596 2961163497 Bacteria 6901077
1074 2961171853 2961170736 Bacteria 7072258
1075 2961184867 2961183825 Bacteria 6688536
1076 2963646200 2963644680 Bacteria 6530403
1077 2965020419 2965018300 Bacteria 6883036
1078 2965025664 2965025482 Bacteria 6532201
1079 2965047216 2965040258 Bacteria 6855979
1080 2965052914 2965047637 Bacteria 6623551
1081 2965092227 2965089291 Bacteria 6866420
1082 2965104429 2965102966 Bacteria 6800987
1083 2967996960 2967996073 Bacteria 6787468
1084 2968005021 2968003550 Bacteria 6929263
1085 2968016672 2968016561 Bacteria 7022047
1086 2968085333 2968083720 Bacteria 7351627
1087 2968091452 2968091066 Bacteria 6052692
1088 2968101991 2968097103 Bacteria 6107094
1089 2968114064 2968110612 Bacteria 6814636
1090 2968123255 2968117919 Bacteria 6536078
1091 2968129074 2968128360 Bacteria 6270294
1092 2968173998 2968171901 Bacteria 6894245
1093 2970470014 2970469710 Bacteria 6969209
1094 2970492608 2970489779 Bacteria 6517260
1095 2970504451 2970503327 Bacteria 7099517
1096 2970515192 2970510686 Bacteria 7006402
1097 2970526969 2970524798 Bacteria 6840927
1098 2970543151 2970540015 Bacteria 6977556
1099 2970557084 2970554993 Bacteria 6814252
1100 2970600432 2970593180 Bacteria 7073582
1101 2970633215 2970627176 Bacteria 6680862
1102 2977823640 2977821940 Bacteria 6906439
1103 2977831509 2977828996 Bacteria 7007971
1104 2977847552 2977843712 Bacteria 6753583
1105 2977856339 2977851361 Bacteria 6694324
1106 2977871031 2977864932 Bacteria 7534097
1107 2977899836 2977898635 Bacteria 6675551
1108 2977916456 2977915119 Bacteria 6829656
1109 2977928843 2977922695 Bacteria 6956781
1110 2977940511 2977935797 Bacteria 6252826
1111 2977943056 2977942078 Bacteria 7570577
1112 2977952228 2977950692 Bacteria 6893264
1113 2977991808 2977986579 Bacteria 6581278
1114 2979771952 2979764755 Bacteria 6610066
1115 2979776055 2979772303 Bacteria 6618277
1116 2979796464 2979793036 Bacteria 6808957
1117 2979809088 2979808191 Bacteria 7179355
1118 2987643892 2987636660 Bacteria 8088555
1119 2987657336 2987652177 Bacteria 6969023
1120 2987661604 2987659509 Bacteria 6966464
1121 2987672478 2987666974 Bacteria 6509233
1122 2989779915 2989776772 Bacteria 4843317
1123 2996315709 2996310559 Bacteria 6357320
1124 2996341312 2996336353 Bacteria 5511628
1125 2996347811 2996341866 Bacteria 6643098
1126 2996389675 2996386984 Bacteria 6978667
1127 3000141341 3000135777 Bacteria 6891109
1128 3003930825 3003930520 Bacteria 5667563
1129 3004174348 3004167301 Bacteria 8330599
1130 3004190653 3004188549 Bacteria 6952365
1131 3004208041 3004203850 Bacteria 7307914
1132 3004211488 3004211236 Bacteria 7417683
1133 3004224963 3004218560 Bacteria 7421728
1134 3004243382 3004239961 Bacteria 6892290
1135 3004253316 3004248173 Bacteria 6563236
1136 3004279739 3004275668 Bacteria 7114440
1137 3004336222 3004334049 Bacteria 8449246
1138 3005421782 3005416602 Bacteria 7064308
1139 637076090 637000159 Bacteria 7596297
1140 649871396 649633066 Bacteria 6690028
1141 8002290203 8002285264 Bacteria 6717907
1142 8004301346 8004300914 Bacteria 6132239
1143 8004315095 8004312739 Bacteria 7444653
1144 8004365989 8004361976 Bacteria 6858373
1145 8004375999 8004374579 Bacteria 6898112
1146 8004389674 8004387939 Bacteria 7049250
1147 8004448754 8004445564 Bacteria 6322258
1148 8004637980 8004633249 Bacteria 6723080
1149 8004645526 8004640170 Bacteria 6723001
1150 8004703339 8004695233 Bacteria 6731676
1151 8004704496 8004703790 Bacteria 8006957
1152 8004718071 8004714634 Bacteria 6776161
1153 8004732929 8004727605 Bacteria 6643904
1154 8005249074 8005246636 Bacteria 4933972
1155 8005319518 8005314921 Bacteria 7072929
1156 8005660670 8005658619 Bacteria 4500593
1157 8018154529 8018150411 Bacteria 5549903
1158 8054561343 8054558443 Bacteria 5204801
1159 8055435704 8055431914 Bacteria 4551896
1160 8055618818 8055617313 Bacteria 7548464
1161 Ga0395905_0318678
1162 RicEn_C5921
1163 JGI24741J21665_1003543
1164 JGI24740J21852_10000006
1165 JGI24739J22299_10025850
1166 JGI24739J22299_10052293
1167 JGI24739J22299_10080030
1168 JGI24737J22298_10001726
1169 JGI24737J22298_10004925
1170 JGI24737J22298_10020449
1171 JGI24743J22301_10035122
1172 JGI24735J21928_10033604
1173 JGI24742J22300_10019233
1174 JGI25155J39150_1000010
1175 JGI25156J39149_1000033
1176 JGI25156J39149_1014201
1177 JGI25162J39368_1000413
1178 JGI25162J39368_1000646
1179 JGI25154J39366_1000058
1180 JGI25157J39369_1000009
1181 JGI25157J39369_1001464
1182 JGI25150J39212_1000166
1183 JGI25151J46595_10000081
1184 JGI25165J46597_1000097
1185 JGI25165J46597_1000675
1186 JGI25165J46597_1001401
1187 JGI25165J46597_1001441
1188 JGI25165J46597_1002500
1189 JGI25153J46596_10000008
1190 JGI25153J46596_10003148
1191 rootH1_10140883
1192 rootL2_10138524
1193 rootH1_10121837
1194 Ga0055539_1006346
1195 Ga0055542_1000123
1196 Ga0055529_1000144
1197 Ga0065704_10183305
1198 Ga0065712_10008678
1199 Ga0070658_10003269
1200 Ga0070658_10141962
1201 Ga0070676_10031441
1202 Ga0070676_10113824
1203 Ga0070683_100644696
1204 Ga0070690_100011455
1205 Ga0070670_100010583
1206 Ga0070670_100074557
1207 Ga0070670_100204467
1208 Ga0070670_100399818
1209 Ga0070677_10001076
1210 Ga0070677_10026674
1211 Ga0068869_100026860
1212 Ga0068869_100299851
1213 Ga0070666_10002899
1214 Ga0070666_10524253
1215 Ga0070682_100307571
1216 Ga0068868_100011585
1217 Ga0068868_100425065
1218 Ga0068868_100478097
1219 Ga0070661_100012880
1220 Ga0070661_100039558
1221 Ga0070692_10050949
1222 Ga0070668_100030234
1223 Ga0070668_100059247
1224 Ga0070669_100005417
1225 Ga0070669_100049531
1226 Ga0070669_100056071
1227 Ga0070669_100381921
1228 Ga0070669_100436731
1229 Ga0070675_100005433
1230 Ga0070675_100037001
1231 Ga0070675_100152567
1232 Ga0070675_100175280
1233 Ga0070675_100310767
1234 Ga0070671_100005295
1235 Ga0070671_100009924
1236 Ga0070671_100024555
1237 Ga0070671_100028395
1238 Ga0070671_100240221
1239 Ga0070674_100014493
1240 Ga0070674_100041864
1241 Ga0070674_100148318
1242 Ga0070674_100508300
1243 Ga0070673_100034647
1244 Ga0070673_100050071
1245 Ga0070673_100083991
1246 Ga0070673_100331811
1247 Ga0070673_100379125
1248 Ga0070659_100004654
1249 Ga0070659_100028961
1250 Ga0070659_100055660
1251 Ga0070659_100135040
1252 Ga0070667_100005560
1253 Ga0070667_100017654
1254 Ga0070667_100018150
1255 Ga0070667_100056729
1256 Ga0070667_100062434
1257 Ga0070667_100071107
1258 Ga0070667_100095811
1259 Ga0070667_100129169
1260 Ga0070667_100155926
1261 Ga0070667_100287336
1262 Ga0070714_100133587
1263 Ga0070713_100092861
1264 Ga0070705_100079635
1265 Ga0070663_100069716
1266 Ga0070663_100099838
1267 Ga0070678_100000901
1268 Ga0070662_100037539
1269 Ga0070662_100448486
1270 Ga0070662_100495417
1271 Ga0068867_100053580
1272 Ga0068867_100087387
1273 Ga0070679_100055115
1274 Ga0070684_100202339
1275 Ga0070697_100001531
1276 Ga0068853_100087401
1277 Ga0068853_100127554
1278 Ga0068853_100546278
1279 Ga0068853_100581646
1280 Ga0070672_100318414
1281 Ga0070686_100282852
1282 Ga0070695_100010886
1283 Ga0070695_100395612
1284 Ga0070696_100009165
1285 Ga0070696_100041707
1286 Ga0070696_100054006
1287 Ga0070696_100263276
1288 Ga0070693_100040246
1289 Ga0070693_100108707
1290 Ga0070665_100080183
1291 Ga0070665_100101576
1292 Ga0070665_100192191
1293 Ga0070665_100249296
1294 Ga0070665_100356412
1295 Ga0068855_100146159
1296 Ga0068855_100147657
1297 Ga0068855_100173080
1298 Ga0068855_100485287
1299 Ga0070664_100023466
1300 Ga0070664_100232017
1301 Ga0070664_100311833
1302 Ga0068857_100106305
1303 Ga0068854_100093561
1304 Ga0068854_100128742
1305 Ga0068856_100238705
1306 Ga0068852_100161447
1307 Ga0068852_100470900
1308 Ga0068859_100000685
1309 Ga0068859_100046027
1310 Ga0068864_100000847
1311 Ga0068864_100001619
1312 Ga0068866_10021852
1313 Ga0068870_10052762
1314 Ga0068863_100005917
1315 Ga0068863_100052330
1316 Ga0068863_100095885
1317 Ga0068863_100133522
1318 Ga0068863_100155976
1319 Ga0068858_100006170
1320 Ga0068858_100030883
1321 Ga0068858_100482192
1322 Ga0068860_100001106
1323 Ga0068860_100006941
1324 Ga0068860_100027872
1325 Ga0068860_100081827
1326 Ga0068860_100102330
1327 Ga0068862_100004852
1328 Ga0068862_100011830
1329 Ga0068862_100041557
1330 Ga0068862_100049303
1331 Ga0068862_100086978
1332 Ga0068862_100166522
1333 Ga0068862_100512584
1334 Ga0081455_10143058
1335 Ga0081538_10015965
1336 Ga0075365_10260490
1337 Ga0075364_10000227
1338 Ga0075364_10067821
1339 Ga0075364_10115870
1340 Ga0070716_100038151
1341 Ga0070712_100092581
1342 Ga0075367_10009415
1343 Ga0075367_10019717
1344 Ga0075367_10309154
1345 Ga0075367_10309781
1346 Ga0075369_10006505
1347 Ga0097621_100122909
1348 Ga0097621_100306773
1349 Ga0097621_100673083
1350 Ga0075370_10025171
1351 Ga0068871_100050133
1352 Ga0068871_100070168
1353 Ga0068871_100242357
1354 Ga0075433_10022199
1355 Ga0075434_100374441
1356 Ga0075429_100129756
1357 Ga0068865_100013945
1358 Ga0068865_100632231
1359 Ga0075436_100002374
1360 Ga0097620_100000685
1361 Ga0097620_100046027
1362 Ga0075435_100059435
1363 Ga0105244_10051045
1364 Ga0105250_10011311
1365 Ga0105240_10000013
1366 Ga0105240_10074658
1367 Ga0105240_10301034
1368 Ga0105240_10362089
1369 Ga0111539_10010849
1370 Ga0105245_10260059
1371 Ga0105243_10000551
1372 Ga0105243_10016104
1373 Ga0105241_10001717
1374 Ga0105241_10119740
1375 Ga0105241_10165877
1376 Ga0105241_10546275
1377 Ga0105248_10001290
1378 Ga0105248_10002158
1379 Ga0105248_10010453
1380 Ga0105248_10010504
1381 Ga0105248_10161135
1382 Ga0105248_10321561
1383 Ga0105248_10376838
1384 Ga0105237_10000714
1385 Ga0105237_10012745
1386 Ga0105237_10438365
1387 Ga0105238_10152773
1388 Ga0105238_10159207
1389 Ga0105249_10004218
1390 Ga0105249_10007828
1391 Ga0105249_10085844
1392 Ga0105239_10002271
1393 Ga0105239_10054540
1394 Ga0105239_10120300
1395 Ga0105239_10258223
1396 Ga0157326_1004805
1397 Ga0157373_10182545
1398 Ga0157373_10283485
1399 Ga0157373_10356148
1400 Ga0157371_10000138
1401 Ga0157370_10000209
1402 Ga0157370_10066706
1403 Ga0157370_10289017
1404 Ga0157370_10685766
1405 Ga0157370_10774647
1406 Ga0157369_10058538
1407 Ga0157369_10131905
1408 Ga0157369_10142769
1409 Ga0157374_10101520
1410 Ga0157374_10150216
1411 Ga0163162_10037700
1412 Ga0163162_10055061
1413 Ga0163162_10426281
1414 Ga0163162_10689834
1415 Ga0157372_10274365
1416 Ga0157372_10947099
1417 Ga0157375_10011059
1418 Ga0157375_10050373
1419 Ga0157375_10133989
1420 Ga0163163_10000307
1421 Ga0163163_10015446
1422 Ga0157380_10037643
1423 Ga0157380_10270272
1424 Ga0182008_10007328
1425 Ga0157377_10025871
1426 Ga0157379_10029113
1427 Ga0157379_10433576
1428 Ga0157379_10520031
1429 Ga0157376_10292401
1430 Ga0182006_1046750
1431 Ga0182007_10003947
1432 Ga0182005_1004378
1433 Ga0182005_1071450
1434 Ga0163161_10070128
1435 Ga0209435_100009
1436 Ga0209760_102687
1437 Ga0209672_110869
1438 Ga0207427_106993
1439 Ga0209437_100057
1440 Ga0209437_100107
1441 Ga0207425_1000034
1442 Ga0209646_1000018
1443 Ga0209646_1012176
1444 Ga0209646_1017240
1445 Ga0209026_1000041
1446 Ga0209026_1000068
1447 Ga0209677_100297
1448 Ga0209677_107846
1449 Ga0209148_1000011
1450 Ga0209148_1000069
1451 Ga0209148_1026352
1452 Ga0209759_1000007
1453 Ga0209759_1000183
1454 Ga0209129_1000094
1455 Ga0209233_1000030
1456 Ga0209233_1000072
1457 Ga0209233_1000134
1458 Ga0209233_1000353
1459 Ga0209233_1015585
1460 Ga0209455_1000006
1461 Ga0209455_1000161
1462 Ga0209673_1004624
1463 Ga0209025_1000184
1464 Ga0209758_1000017
1465 Ga0209758_1000159
1466 Ga0209758_1022617
1467 Ga0207697_10002198
1468 Ga0207697_10012600
1469 Ga0207697_10097977
1470 Ga0207696_1009256
1471 Ga0207682_10000505
1472 Ga0207682_10054396
1473 Ga0207688_10021621
1474 Ga0207688_10148791
1475 Ga0207680_10001044
1476 Ga0207647_10009701
1477 Ga0207647_10021806
1478 Ga0207647_10091971
1479 Ga0207647_10102083
1480 Ga0207699_10021776
1481 Ga0207645_10085650
1482 Ga0207705_10000120
1483 Ga0207705_10052688
1484 Ga0207705_10070861
1485 Ga0207654_10000311
1486 Ga0207654_10095098
1487 Ga0207707_10056195
1488 Ga0207707_10228071
1489 Ga0207695_10000044
1490 Ga0207695_10128226
1491 Ga0207695_10161967
1492 Ga0207695_10291054
1493 Ga0207695_10671653
1494 Ga0207671_10000364
1495 Ga0207671_10150986
1496 Ga0207693_10009824
1497 Ga0207660_10035675
1498 Ga0207662_10035883
1499 Ga0207657_10014901
1500 Ga0207657_10036707
1501 Ga0207657_10083838
1502 Ga0207657_10169016
1503 Ga0207649_10002327
1504 Ga0207649_10027838
1505 Ga0207649_10036447
1506 Ga0207649_10175370
1507 Ga0207649_10338173
1508 Ga0207681_10011479
1509 Ga0207681_10183634
1510 Ga0207694_10185088
1511 Ga0207650_10011940
1512 Ga0207650_10037516
1513 Ga0207650_10152831
1514 Ga0207650_10274799
1515 Ga0207650_10352871
1516 Ga0207659_10097546
1517 Ga0207659_10424433
1518 Ga0207659_10481286
1519 Ga0207700_10062479
1520 Ga0207700_10064310
1521 Ga0207644_10000415
1522 Ga0207644_10012673
1523 Ga0207644_10055721
1524 Ga0207644_10126210
1525 Ga0207644_10194240
1526 Ga0207644_10457223
1527 Ga0207690_10007422
1528 Ga0207690_10026510
1529 Ga0207690_10238082
1530 Ga0207706_10036166
1531 Ga0207706_10036276
1532 Ga0207706_10048718
1533 Ga0207706_10058766
1534 Ga0207706_10060688
1535 Ga0207686_10253052
1536 Ga0207709_10000078
1537 Ga0207709_10064738
1538 Ga0207670_10234862
1539 Ga0207669_10000020
1540 Ga0207669_10009051
1541 Ga0207669_10032982
1542 Ga0207704_10524415
1543 Ga0207691_10036319
1544 Ga0207691_10102071
1545 Ga0207691_10240642
1546 Ga0207691_10451422
1547 Ga0207691_10520697
1548 Ga0207711_10000420
1549 Ga0207711_10000831
1550 Ga0207711_10001208
1551 Ga0207711_10009193
1552 Ga0207711_10279596
1553 Ga0207689_10072695
1554 Ga0207689_10308763
1555 Ga0207679_10008127
1556 Ga0207679_10091455
1557 Ga0207679_10246930
1558 Ga0207667_10000002
1559 Ga0207667_10121185
1560 Ga0207651_10025637
1561 Ga0207651_10054717
1562 Ga0207651_10070177
1563 Ga0207651_10107522
1564 Ga0207712_10006333
1565 Ga0207712_10009058
1566 Ga0207668_10021001
1567 Ga0207668_10034891
1568 Ga0207668_10132672
1569 Ga0207668_10474230
1570 Ga0207640_10024794
1571 Ga0207640_10066121
1572 Ga0207640_10098241
1573 Ga0207640_10163001
1574 Ga0207640_10225962
1575 Ga0207640_10508429
1576 Ga0207640_10636544
1577 Ga0207658_10002673
1578 Ga0207658_10003158
1579 Ga0207658_10004510
1580 Ga0207658_10005394
1581 Ga0207658_10008350
1582 Ga0207658_10075648
1583 Ga0207658_10090891
1584 Ga0207658_10255031
1585 Ga0207658_10257368
1586 Ga0207677_10013551
1587 Ga0207677_10026347
1588 Ga0207677_10320142
1589 Ga0207677_10376784
1590 Ga0207703_10001930
1591 Ga0207703_10026334
1592 Ga0207703_10443046
1593 Ga0207639_10019145
1594 Ga0207639_10031653
1595 Ga0207639_10041332
1596 Ga0207639_10136010
1597 Ga0207639_10278875
1598 Ga0207678_10020955
1599 Ga0207678_10027969
1600 Ga0207678_10070358
1601 Ga0207678_10077444
1602 Ga0207678_10134935
1603 Ga0207678_10383139
1604 Ga0207702_10007220
1605 Ga0207702_10220615
1606 Ga0207702_10367799
1607 Ga0207702_10852214
1608 Ga0207641_10000502
1609 Ga0207641_10026879
1610 Ga0207641_10036006
1611 Ga0207641_10153245
1612 Ga0207648_10022723
1613 Ga0207648_10069064
1614 Ga0207648_10086868
1615 Ga0207676_10002138
1616 Ga0207676_10008921
1617 Ga0207676_10173314
1618 Ga0207674_10027655
1619 Ga0207674_10220450
1620 Ga0207675_100960816
1621 Ga0207683_10002005
1622 Ga0207683_10009381
1623 Ga0207683_10058347
1624 Ga0207683_10389478
1625 Ga0207698_10074132
1626 Ga0207698_10136911
1627 Ga0268266_10012670
1628 Ga0268266_10018787
1629 Ga0268266_10175377
1630 Ga0268266_10179426
1631 Ga0268266_10339001
1632 Ga0268266_10368214
1633 Ga0268265_10002045
1634 Ga0268265_10005103
1635 Ga0268265_10021534
1636 Ga0268265_10199063
1637 Ga0268265_10371302
1638 Ga0268265_10552286
1639 Ga0268265_10692766
1640 Ga0268264_10000410
1641 Ga0268264_10000418
1642 Ga0268264_10004427
1643 Ga0268264_10041454
1644 Ga0268264_10049649
1645 Ga0316182_1126955
1646 Ga0265328_10000400
1647 Ga0265327_10111503
1648 Ga0307408_100121195
1649 Ga0307408_100245351
1650 Ga0316575_10000462
1651 Ga0316579_10053979
1652 Ga0307405_10053655
1653 Ga0307405_10383920
1654 Ga0307405_10505245
1655 Ga0307413_10017198
1656 Ga0307413_10033805
1657 Ga0307413_10053410
1658 Ga0307413_10072017
1659 Ga0307413_10611722
1660 Ga0307413_10620786
1661 Ga0307410_10001216
1662 Ga0307410_10003555
1663 Ga0307410_10036507
1664 Ga0307410_10041136
1665 Ga0307410_10042014
1666 Ga0307406_10004003
1667 Ga0307406_10029958
1668 Ga0307406_10241186
1669 Ga0307406_10246473
1670 Ga0307407_10020279
1671 Ga0307407_10070824
1672 Ga0307407_10220039
1673 Ga0307412_10005208
1674 Ga0307412_10083018
1675 Ga0307412_10125584
1676 Ga0307412_10248769
1677 Ga0307409_100020317
1678 Ga0307409_100044599
1679 Ga0307409_100055437
1680 Ga0307409_100383993
1681 Ga0307416_100177028
1682 Ga0307416_100394604
1683 Ga0307414_10005548
1684 Ga0307414_10050064
1685 Ga0307414_10059036
1686 Ga0307414_10213311
1687 Ga0307414_10234079
1688 Ga0307414_10397994
1689 Ga0307411_10001404
1690 Ga0307411_10002297
1691 Ga0307411_10062011
1692 Ga0307411_10077171
1693 Ga0307411_10199709
1694 Ga0307411_10200077
1695 Ga0307411_10218389
1696 Ga0307411_10294194
1697 Ga0307415_100209555
1698 Ga0373935_0056241
1699 Ga0373935_0347864
1700 Ga0373927_0000019
1701 Ga0316582_0168187
1702 Ga0316584_0062902
1703 Ga0373925_0001010
1704 Ga0373925_0178597
1705 Ga0395899_0000288
1706 Ga0395899_0062521
1707 Ga0395899_0254140
1708 Ga0395900_0000246
1709 Ga0395900_0003041
1710 Ga0395900_0125626
1711 Ga0395900_0144558
1712 Ga0395900_0171188
1713 Ga0395900_0334197
1714 Ga0395900_0418140
1715 Ga0395900_0538065
1716 Ga0395898_0000447
1717 Ga0395898_0489804
1718 Ga0395898_0832015
1719 Ga0395905_0000228
1720 Ga0395905_0002055
1721 Ga0395905_0015256
1722 Ga0395905_0019543
1723 Ga0395905_0030456
1724 Ga0395905_0033143
1725 Ga0395905_0089712
1726 Ga0395905_0130833
1727 Ga0395905_0148896
1728 Ga0395905_0154177
1729 Ga0395905_0315803
1730 Ga0436364_0575430
1731 Ga0395901_0000167
1732 Ga0395901_0023795
1733 Ga0395901_0038175
1734 Ga0395901_0069941
1735 Ga0395901_0482284
1736 Ga0395901_0556178
1737 Ga0436365_1317782
1738 Ga0436365_1906995
1739 Ga0436360_0223865
1740 Ga0436361_0909211
1741 Ga0436363_1504724
1742 Ga0439466_0035629
1743 Ga0439466_0043093
1744 Ga0439465_0009333
1745 Ga0439432_047628
1746 Ga0439449_0016313
1747 Ga0439462_0021801
1748 Ga0450914_000066
1749 Ga0450890_005866
1750 Ga0450889_000164
1751 Ga0439464_0001132
1752 Ga0466972_0037315
1753 Ga0466960_0133528
1754 Ga0466959_0043155
1755 Ga0466958_0021058
1756 Ga0466967_0693516
1757 Ga0495629_0210565
1758 Ga0495638_0000978
1759 Ga0495638_0024075
1760 Ga0495605_0005182
1761 Ga0495585_0002615
1762 Ga0495585_0005045
1763 Ga0495585_0060178
1764 Ga0495596_0071481
1765 Ga0495607_0091605
1766 Ga0495583_0003310
1767 Ga0495583_0011178
1768 Ga0495583_0021181
1769 Ga0495583_0164009
1770 Ga0495606_0000963
1771 Ga0495606_0016331
1772 Ga0495606_0121693
1773 Ga0495616_0015461
1774 Ga0495616_0066743
1775 Ga0495620_0080955
1776 Ga0495631_0001352
1777 Ga0495631_0042268
1778 Ga0495632_0014024
1779 Ga0495643_0104652
1780 Ga0495648_0000782
1781 Ga0495648_0080295
1782 Ga0495663_0006090
1783 Ga0495654_0000296
1784 Ga0495587_0268631
1785 Ga0495609_0040002
1786 Ga0495621_0037811
1787 Ga0495597_0038339
1788 Ga0495633_0005249
1789 Ga0495668_0000080
1790 Ga0495668_0016292
1791 Ga0495611_0006470
1792 Ga0495625_0000819
1793 Ga0495625_0012968
1794 Ga0495625_0032281
1795 Ga0495625_0054954
1796 Ga0495625_0064035
1797 Ga0495625_0142379
1798 Ga0495625_0146525
1799 Ga0495635_0296620
1800 Ga0495661_0207327
1801 Ga0495669_0000011
1802 Ga0495669_0001712
1803 Ga0495613_0159806
1804 Ga0495670_0034506
1805 Ga0495670_0078577
1806 Ga0495649_0021504
1807 Ga0495660_0038136
1808 Ga0495660_0084593
1809 Ga0495604_0076923
1810 Ga0495636_0032155
1811 Ga0495672_0052903
1812 Ga0495683_0006885
1813 Ga0495683_0046681
1814 Ga0495687_000684
1815 Ga0495687_002397
1816 Ga0495687_060961
1817 Ga0495677_0041230
1818 Ga0495673_0088949
1819 Ga0495681_0018299
1820 Ga0495681_0026759
1821 Ga0495686_0077522
1822 Ga0495626_0179131
1823 Ga0496100_0284405
1824 Ga0496101_0142979
1825 Ga0496102_0000213
1826 Ga0496102_0013947
1827 Ga0496102_0155087
1828 Ga0496102_0233622
1829 Ga0496102_0284691
1830 Ga0496102_0384891
1831 Ga0496103_0001102
1832 Ga0496103_0015441
1833 Ga0496103_0211328
1834 Ga0496104_0041322
1835 Ga0496104_0053309
1836 Ga0496105_0010188
1837 Ga0496105_0013563
1838 Ga0496106_0186999
1839 Ga0496107_0017579
1840 Ga0496107_0107364
1841 Ga0496108_0001490
1842 Ga0496108_0006149
1843 Ga0496108_0383643
1844 Ga0496108_0783865
1845 Ga0496109_0000610
1846 Ga0496109_0003373
1847 Ga0496109_0160531
1848 Ga0496110_0040525
1849 Ga0496110_0047828
1850 Ga0496110_0165155
1851 Ga0496110_0297284
1852 Ga0496111_0019440
1853 Ga0496111_0020827
1854 Ga0496112_0016625
1855 Ga0496112_0036131
1856 Ga0496112_0327314
1857 Ga0496113_0001927
1858 Ga0496113_0011007
1859 Ga0496113_0099782
1860 Ga0496113_0279895
1861 Ga0496114_0057231
1862 Ga0496114_0064085
1863 Ga0496114_0186076
1864 Ga0496115_0000030
1865 Ga0496115_0019252
1866 Ga0496115_0054849
1867 Ga0496116_0004303
1868 Ga0496116_0013189
1869 Ga0496116_0034869
1870 Ga0496116_0103211
1871 Ga0496116_0128039
1872 Ga0496117_0001842
1873 Ga0496117_0018264
1874 Ga0496117_0024164
1875 Ga0496118_0000207
1876 Ga0496118_0003544
1877 Ga0496118_0126826
1878 Ga0496118_0143359
1879 Ga0496119_0020775
1880 Ga0496119_0050772
1881 Ga0496119_0088442
1882 Ga0496120_0002681
1883 Ga0496120_0023582
1884 Ga0496120_0134929
1885 Ga0496121_0001274
1886 Ga0496121_0004072
1887 Ga0496121_0081432
1888 Ga0496121_0185515
1889 Ga0496122_0013200
1890 Ga0496122_0020390
1891 Ga0496122_0031506
1892 Ga0496122_0052396
1893 Ga0496122_0053444
1894 Ga0496122_0069960
1895 Ga0496123_0008958
1896 Ga0496123_0039206
1897 Ga0496123_0043471
1898 Ga0496123_0127351
1899 Ga0496124_0001058
1900 Ga0496124_0009124
1901 Ga0496124_0010128
1902 Ga0496124_0059174
1903 Ga0496124_0078985
1904 Ga0496125_0001207
1905 Ga0496125_0005193
1906 Ga0496125_0011707
1907 Ga0496125_0061256
1908 Ga0496125_0134782
1909 Ga0496126_0001895
1910 Ga0496126_0064058
1911 Ga0496126_0101060
1912 Ga0496126_0426266
1913 Ga0495678_006569
1914 Ga0495678_025882
1915 Ga0495682_0038316
1916 Ga0501300_014461
1917 Ga0501031_0008288
1918 Ga0501031_0023956
1919 Ga0501032_0000001
1920 Ga0501032_0000017
1921 Ga0501032_0193969
1922 Ga0501033_0000029
1923 Ga0501033_0000830
1924 Ga0501033_0002867
1925 Ga0501033_0036868
1926 Ga0501033_0072134
1927 Ga0501033_0375415
1928 Ga0501034_0000036
1929 Ga0501034_0000102
1930 Ga0501034_0015348
1931 Ga0501034_0071549
1932 Ga0501034_0162497
1933 Ga0501034_0186186
1934 Ga0501034_0201676
1935 Ga0501034_0237918
1936 Ga0501034_0284278
1937 Ga0501036_0000011
1938 Ga0501036_0000180
1939 Ga0501037_0000015
1940 Ga0501037_0000017
1941 Ga0501038_0000016
1942 Ga0501038_0000036
1943 Ga0501038_0016245
1944 Ga0501039_0000011
1945 Ga0501039_0000023
1946 Ga0501039_0185817
1947 Ga0501039_0412033
1948 Ga0501040_0004290
1949 Ga0501043_0000105
1950 Ga0501043_0000423
1951 Ga0501043_0161322
1952 Ga0501043_0168649
1953 Ga0501043_0254048
1954 Ga0501046_0038983
1955 Ga0501046_0049874
1956 Ga0501047_0002449
1957 Ga0501047_0027147
1958 Ga0501047_0061955
1959 Ga0501047_0150345
1960 Ga0501047_0173111
1961 Ga0501047_0702789
1962 Ga0501048_0007590
1963 Ga0501067_0005711
1964 Ga0501067_0021763
1965 Ga0501067_0130046
1966 Ga0501068_0028598
1967 Ga0501069_0071079
1968 Ga0501069_0164579
1969 Ga0501070_0000648
1970 Ga0501070_0003968
1971 Ga0501070_0014269
1972 Ga0501070_0064322
1973 Ga0501070_0092448
1974 Ga0501073_0061124
1975 Ga0501073_0255943
1976 Ga0501077_0058762
1977 Ga0501080_0000711
1978 Ga0501080_0005920
1979 Ga0501080_0026665
1980 Ga0501083_0020004
1981 Ga0501280_005531
1982 Ga0501035_0000028
1983 Ga0501035_0000038
1984 Ga0501035_0004286
1985 Ga0501035_0004759
1986 Ga0501035_0028976
1987 Ga0501044_0000046
1988 Ga0501044_0015506
1989 Ga0501044_0029697
1990 Ga0501044_0037710
1991 Ga0501044_0060165
1992 nmdc:mga03n38_99417_c1
1993 nmdc:mga00v17_27_c1
1994 nmdc:mga0yw44_113987_c1
1995 nmdc:mga0yw44_359795_c1
1996 nmdc:mga0yw44_94848_c1
1997 nmdc:mga0k408_517955_c1
1998 nmdc:mga06z11_142342_c1
1999 nmdc:mga06z11_264878_c1
2000 nmdc:mga06z11_32902_c1
2001 nmdc:mga07m45_67034_c1
2002 nmdc:mga05p37_522229_c1
2003 nmdc:mga09592_586221_c1
2004 nmdc:mga0rr50_29874_c1
2005 nmdc:mga0rr50_318165_c1
2006 nmdc:mga08x19_6_c2
2007 nmdc:mga0a205_7550_c1
2008 nmdc:mga0sz30_9974_c1
2009 Ga0500610_0000034
2010 Ga0500610_0010483
2011 Ga0500610_0039576
2012 Ga0500578_0041900
2013 Ga0500643_059263
2014 Ga0500569_014287
2015 Ga0500594_0001317
2016 Ga0500618_000222
2017 Ga0500618_038432
2018 Ga0500642_0005333
2019 Ga0500559_0010357
2020 Ga0500568_0000104
2021 Ga0500568_0000763
2022 Ga0500568_0000803
2023 Ga0500573_0008514
2024 Ga0500573_0171799
2025 Ga0500588_0044268
2026 Ga0500616_0000220
2027 Ga0500616_0001222
2028 Ga0500620_000357
2029 Ga0500627_0027408
2030 Ga0500634_0004310
2031 Ga0500611_006673
2032 Ga0500611_020911
2033 Ga0500645_000001
2034 Ga0500645_028306
2035 Ga0501084_0062074
2036 Ga0501084_0089796
2037 Ga0501082_0042260
2038 Ga0501082_0063229
2039 Ga0501082_0107266
2040 Ga0466962_0121969
2041 Ga0466962_0188923
2042 2503199587
2043 2509371029
2044 2509394513
2045 2510842070
2046 2511133790
2047 2512933008
2048 2512961032
2049 2513611221
2050 2513929163
2051 2514035114
2052 2514417210
2053 2514587159
2054 2561466976
2055 2585167823
2056 2585228842
2057 2585257505
2058 2585271508
2059 2585280573
2060 2585327938
2061 2585334309
2062 2585531511
2063 2585551575
2064 2585563252
2065 2585844794
2066 2585907470
2067 2587982536
2068 2588519062
2069 2597811384
2070 2599420342
2071 2599939080
2072 2616296470
2073 2616306881
2074 2616557739
2075 2617384988
2076 2643771408
2077 2643776932
2078 2643795380
2079 2643813613
2080 2643836899
2081 2643986100
2082 2644050883
2083 2644153665
2084 2644205386
2085 2644210053
2086 2644240693
2087 2644300027
2088 2644483787
2089 2644496091
2090 2644653604
2091 2644658253
2092 2671113625
2093 2688596837
2094 2694634243
2095 2694637982
2096 2723573957
2097 2738805347
2098 2756677370
2099 2776270077
2100 2776915319
2101 2778173578
2102 2792748412
2103 2819243641
2104 2819638974
2105 2838030785
2106 2838040550
2107 2838668453
2108 2839997920
2109 2841737324
2110 2842477517
2111 2842488083
2112 2842504610
2113 2844009139
2114 2847674601
2115 2847690718
2116 2854896986
2117 2854917135
2118 2856317513
2119 2856322667
2120 2856328862
2121 2856343870
2122 2856350387
2123 2856366703
2124 2857356612
2125 2869165143
2126 2869258953
2127 2869285815
2128 2869287886
2129 2871435834
2130 2871448671
2131 2871465677
2132 2871471762
2133 2871479385
2134 2871489893
2135 2871498007
2136 2874104840
2137 2874111127
2138 2874128801
2139 2874141871
2140 2874151519
2141 2874159151
2142 2874167592
2143 2874175702
2144 2876364744
2145 2876370394
2146 2876396201
2147 2876405898
2148 2876417570
2149 2876426103
2150 2878038551
2151 2878739390
2152 2878749397
2153 2878754423
2154 2878762229
2155 2878769196
2156 2878794254
2157 2881149408
2158 2881160616
2159 2881166310
2160 2881848364
2161 2881861629
2162 2882634081
2163 2882919357
2164 2885307738
2165 2885313266
2166 2885321656
2167 2885327080
2168 2885338424
2169 2885343322
2170 2885354165
2171 2888337956
2172 2888345257
2173 2888354547
2174 2889016151
2175 2889018808
2176 2891088939
2177 2903449270
2178 2903493628
2179 2903497628
2180 2903522520
2181 2903528899
2182 2903542805
2183 2904580425
2184 2904662977
2185 2906310435
2186 2906324500
2187 2906333299
2188 2906355140
2189 2906364314
2190 2906375090
2191 2906385269
2192 2906405645
2193 2906417578
2194 2919119900
2195 2919410916
2196 2922152114
2197 2922173313
2198 2924725920
2199 2924731976
2200 2924751282
2201 2924757025
2202 2924769302
2203 2924776911
2204 2924790189
2205 2933022850
2206 2937817263
2207 2937825785
2208 2937837560
2209 2937855449
2210 2937883489
2211 2937896670
2212 2937973532
2213 2937996656
2214 2938018529
2215 2958041831
2216 2958050362
2217 2958051306
2218 2958070086
2219 2958073623
2220 2958090656
2221 2958097384
2222 2958108050
2223 2958116131
2224 2958125330
2225 2958132290
2226 2958167127
2227 2958177118
2228 2958182104
2229 2961079948
2230 2961118003
2231 2961132403
2232 2961142377
2233 2961165596
2234 2961171853
2235 2961184867
2236 2963646200
2237 2965020419
2238 2965025664
2239 2965047216
2240 2965052914
2241 2965092227
2242 2965104429
2243 2967996960
2244 2968005021
2245 2968016672
2246 2968085333
2247 2968091452
2248 2968101991
2249 2968114064
2250 2968123255
2251 2968129074
2252 2968173998
2253 2970470014
2254 2970492608
2255 2970504451
2256 2970515192
2257 2970526969
2258 2970543151
2259 2970557084
2260 2970600432
2261 2970633215
2262 2977823640
2263 2977831509
2264 2977847552
2265 2977856339
2266 2977871031
2267 2977899836
2268 2977916456
2269 2977928843
2270 2977940511
2271 2977943056
2272 2977952228
2273 2977991808
2274 2979771952
2275 2979776055
2276 2979796464
2277 2979809088
2278 2987643892
2279 2987657336
2280 2987661604
2281 2987672478
2282 2989779915
2283 2996315709
2284 2996341312
2285 2996347811
2286 2996389675
2287 3000141341
2288 3003930825
2289 3004174348
2290 3004190653
2291 3004208041
2292 3004211488
2293 3004224963
2294 3004243382
2295 3004253316
2296 3004279739
2297 3004336222
2298 3005421782
2299 637076090
2300 649871396
2301 8002290203
2302 8004301346
2303 8004315095
2304 8004365989
2305 8004375999
2306 8004389674
2307 8004448754
2308 8004637980
2309 8004645526
2310 8004703339
2311 8004704496
2312 8004718071
2313 8004732929
2314 8005249074
2315 8005319518
2316 8005660670
2317 8018154529
2318 8054561343
2319 8055435704
2320 8055618818

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16123

HAGH_C

Hydroxyacylglutathione hydrolase C-terminus

217

300

0.97

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

61

216

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.9827 5 256
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.9713 5 256
8ewo-assembly2.cif.gz_B crystal structure of putative glyoxylase ii from pseudomonas aeruginosa 0.9583 4 256
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.9563 3 256
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.9546 5 256
ID Description Score Start End Superfamily
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.986 5 256 3.60.15.10
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9745 5 256 3.60.15.10
2obwA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9555 3 256 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9535 5 256 3.60.15.10
2obwA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9518 3 256 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A353G0Q3-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 1.002 1 256 GO:0004416
GO:0019243
GO:0046872
AF-A0A3S2X9U1-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 1.002 1 256 GO:0004416
GO:0019243
GO:0046872
AF-A0A4R3A461-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 1.002 1 256 GO:0004416
GO:0019243
GO:0046872
AF-Q2K3M6-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 1.002 1 256 GO:0004416
GO:0019243
GO:0046872
AF-A0A3R9BMM3-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 1.001 1 256 GO:0004416
GO:0019243
GO:0046872

Map