F490992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1160 | 648 | 2320 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0318678|Ga0395905_0318678_386_1288 |
| Length | 300 |
| Sequence | MRGTVAAKPVKFNKGARSTNAPGSTNPDDIGGRPPYVCDDKWRHAMPVEIEQFMCRTDNFGVLVHDPKSGETAIIDAPEEAPILAAIKRTGWTPTLILTTHHHADHVEANLALKERFKLRIVGPEAEKAKIPGIDETVKQGSVVRLGEERIEVIETPGHTAGHVSYHLPASKVAFTADTLFALGCGRLFECKPPVMYDSLKKLAALPAQTAIYCGHEYTLANARFAVTVDPGNPLLKQRAARIEALRAANKPTLPTTIGEELSTNPFLRGHDPSIRKHLGMERASDAEVFAEIRKRKDNF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 205 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 220 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 229 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 232 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 233 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 234 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 235 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 236 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 237 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 238 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 239 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 303 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 304 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 305 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 306 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 309 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 354 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 355 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 356 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 360 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 362 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 363 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 365 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 367 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 368 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 373 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 374 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 375 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 376 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 377 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 378 | 2512875024 | |||
| 379 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 380 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 381 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 382 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 383 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 384 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 385 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 386 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 387 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 388 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 389 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 390 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 391 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 392 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 393 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 394 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 395 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 396 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 397 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 398 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 399 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 400 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 401 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 402 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 403 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 404 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 405 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 406 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 407 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 408 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 409 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 410 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 411 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 412 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 413 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 414 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 415 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 416 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 417 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 418 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 419 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 420 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 421 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 422 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 423 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 424 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 425 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 426 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 427 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 428 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 429 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 430 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 431 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 432 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 433 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 434 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 435 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 436 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 437 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 438 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 439 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 440 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 441 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 442 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 443 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 444 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 445 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 446 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 447 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 448 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 449 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 450 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 451 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 452 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 453 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 454 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 455 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 456 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 457 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 458 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 459 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 460 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 461 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 462 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 463 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 464 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 465 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 466 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 467 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 468 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 469 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 470 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 471 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 472 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 473 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 474 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 475 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 476 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 477 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 478 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 479 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 480 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 481 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 482 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 483 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 484 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 485 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 486 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 487 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 488 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 489 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 490 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 491 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 492 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 493 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 494 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 495 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 496 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 497 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 498 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 499 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 500 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 501 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 502 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 503 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 504 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 505 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 506 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 507 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 508 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 509 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 510 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 511 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 512 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 513 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 514 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 515 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 516 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 517 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 518 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 519 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 520 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 521 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 522 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 523 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 524 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 525 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 526 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 527 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 528 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 529 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 530 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 531 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 532 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 533 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 534 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 535 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 536 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 537 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 538 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 539 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 540 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 541 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 542 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 543 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 544 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 545 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 546 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 547 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 548 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 549 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 550 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 551 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 552 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 553 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 554 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 555 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 556 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 557 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 558 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 559 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 560 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 561 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 562 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 563 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 564 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 565 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 566 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 567 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 568 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 569 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 570 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 571 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 572 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 573 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 574 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 575 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 576 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 577 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 578 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 579 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 580 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 581 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 582 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 583 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 584 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 585 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 586 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 587 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 588 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 589 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 590 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 591 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 592 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 593 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 594 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 595 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 596 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 597 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 598 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 599 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 600 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 601 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 602 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 603 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 604 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 605 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 606 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 607 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 608 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 609 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 610 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 611 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 612 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 613 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 614 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 615 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 616 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 617 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 618 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 619 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 620 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 621 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 622 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 623 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 624 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 625 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 626 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 627 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 628 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 629 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 630 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 631 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 632 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 633 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 634 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 635 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 636 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 637 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 638 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 639 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 640 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 641 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 642 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 643 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 644 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 645 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 646 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 647 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 648 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.95 |
| Metatranscriptomes | 0 |
| Isolates | 24.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.41 |
| Nodule | 16.98 |
| Rhizoplane | 4.05 |
| Rhizosphere | 61.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0318678 | 3300037471 | Bacteria | 1444 |
| 2 | RicEn_C5921 | 2010549000 | Bacteria | 1966 |
| 3 | JGI24741J21665_1003543 | 3300001915 | Bacteria | 3692 |
| 4 | JGI24740J21852_10000006 | 3300001979 | Bacteria | 86112 |
| 5 | JGI24739J22299_10025850 | 3300001989 | Bacteria | 2063 |
| 6 | JGI24739J22299_10052293 | 3300001989 | Bacteria | 1314 |
| 7 | JGI24739J22299_10080030 | 3300001989 | Bacteria | 1005 |
| 8 | JGI24737J22298_10001726 | 3300001990 | Bacteria | 7789 |
| 9 | JGI24737J22298_10004925 | 3300001990 | Bacteria | 4627 |
| 10 | JGI24737J22298_10020449 | 3300001990 | Bacteria | 2113 |
| 11 | JGI24743J22301_10035122 | 3300001991 | Bacteria | 996 |
| 12 | JGI24735J21928_10033604 | 3300002067 | Bacteria | 1514 |
| 13 | JGI24742J22300_10019233 | 3300002244 | Bacteria | 1159 |
| 14 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 15 | JGI25156J39149_1000033 | 3300002705 | Bacteria | 114688 |
| 16 | JGI25156J39149_1014201 | 3300002705 | Bacteria | 1654 |
| 17 | JGI25162J39368_1000413 | 3300002737 | Bacteria | 34872 |
| 18 | JGI25162J39368_1000646 | 3300002737 | Bacteria | 24683 |
| 19 | JGI25154J39366_1000058 | 3300002738 | Bacteria | 107363 |
| 20 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 21 | JGI25157J39369_1001464 | 3300002741 | Bacteria | 8760 |
| 22 | JGI25150J39212_1000166 | 3300002774 | Bacteria | 37196 |
| 23 | JGI25151J46595_10000081 | 3300003187 | Bacteria | 131317 |
| 24 | JGI25165J46597_1000097 | 3300003214 | Bacteria | 161115 |
| 25 | JGI25165J46597_1000675 | 3300003214 | Bacteria | 27458 |
| 26 | JGI25165J46597_1001401 | 3300003214 | Bacteria | 13154 |
| 27 | JGI25165J46597_1001441 | 3300003214 | Bacteria | 12657 |
| 28 | JGI25165J46597_1002500 | 3300003214 | Bacteria | 5825 |
| 29 | JGI25153J46596_10000008 | 3300003215 | Bacteria | 376808 |
| 30 | JGI25153J46596_10003148 | 3300003215 | Bacteria | 9308 |
| 31 | rootH1_10140883 | 3300003316 | Bacteria | 1052 |
| 32 | rootL2_10138524 | 3300003322 | Bacteria | 3072 |
| 33 | rootH1_10121837 | 3300003323 | Bacteria | 1103 |
| 34 | Ga0055539_1006346 | 3300003752 | Bacteria | 1513 |
| 35 | Ga0055542_1000123 | 3300003762 | Bacteria | 101557 |
| 36 | Ga0055529_1000144 | 3300003763 | Bacteria | 101557 |
| 37 | Ga0065704_10183305 | 3300005289 | Bacteria | 1226 |
| 38 | Ga0065712_10008678 | 3300005290 | Bacteria | 2456 |
| 39 | Ga0070658_10003269 | 3300005327 | Bacteria | 13381 |
| 40 | Ga0070658_10141962 | 3300005327 | Bacteria | 2007 |
| 41 | Ga0070676_10031441 | 3300005328 | Bacteria | 3033 |
| 42 | Ga0070676_10113824 | 3300005328 | Bacteria | 1688 |
| 43 | Ga0070683_100644696 | 3300005329 | Bacteria | 1014 |
| 44 | Ga0070690_100011455 | 3300005330 | Bacteria | 5188 |
| 45 | Ga0070670_100010583 | 3300005331 | Bacteria | 7876 |
| 46 | Ga0070670_100074557 | 3300005331 | Bacteria | 2915 |
| 47 | Ga0070670_100204467 | 3300005331 | Bacteria | 1716 |
| 48 | Ga0070670_100399818 | 3300005331 | Bacteria | 1213 |
| 49 | Ga0070677_10001076 | 3300005333 | Bacteria | 8820 |
| 50 | Ga0070677_10026674 | 3300005333 | Bacteria | 2168 |
| 51 | Ga0068869_100026860 | 3300005334 | Bacteria | 4009 |
| 52 | Ga0068869_100299851 | 3300005334 | Bacteria | 1297 |
| 53 | Ga0070666_10002899 | 3300005335 | Bacteria | 10361 |
| 54 | Ga0070666_10524253 | 3300005335 | Bacteria | 860 |
| 55 | Ga0070682_100307571 | 3300005337 | Bacteria | 1166 |
| 56 | Ga0068868_100011585 | 3300005338 | Bacteria | 6423 |
| 57 | Ga0068868_100425065 | 3300005338 | Bacteria | 1151 |
| 58 | Ga0068868_100478097 | 3300005338 | Bacteria | 1088 |
| 59 | Ga0070661_100012880 | 3300005344 | Bacteria | 5857 |
| 60 | Ga0070661_100039558 | 3300005344 | Bacteria | 3436 |
| 61 | Ga0070692_10050949 | 3300005345 | Bacteria | 2152 |
| 62 | Ga0070668_100030234 | 3300005347 | Bacteria | 4118 |
| 63 | Ga0070668_100059247 | 3300005347 | Bacteria | 2963 |
| 64 | Ga0070669_100005417 | 3300005353 | Bacteria | 9202 |
| 65 | Ga0070669_100049531 | 3300005353 | Bacteria | 3066 |
| 66 | Ga0070669_100056071 | 3300005353 | Bacteria | 2889 |
| 67 | Ga0070669_100381921 | 3300005353 | Bacteria | 1149 |
| 68 | Ga0070669_100436731 | 3300005353 | Bacteria | 1077 |
| 69 | Ga0070675_100005433 | 3300005354 | Bacteria | 9742 |
| 70 | Ga0070675_100037001 | 3300005354 | Bacteria | 3974 |
| 71 | Ga0070675_100152567 | 3300005354 | Bacteria | 1982 |
| 72 | Ga0070675_100175280 | 3300005354 | Bacteria | 1851 |
| 73 | Ga0070675_100310767 | 3300005354 | Bacteria | 1391 |
| 74 | Ga0070671_100005295 | 3300005355 | Bacteria | 10294 |
| 75 | Ga0070671_100009924 | 3300005355 | Bacteria | 7649 |
| 76 | Ga0070671_100024555 | 3300005355 | Bacteria | 4936 |
| 77 | Ga0070671_100028395 | 3300005355 | Bacteria | 4606 |
| 78 | Ga0070671_100240221 | 3300005355 | Bacteria | 1537 |
| 79 | Ga0070674_100014493 | 3300005356 | Bacteria | 4901 |
| 80 | Ga0070674_100041864 | 3300005356 | Bacteria | 3108 |
| 81 | Ga0070674_100148318 | 3300005356 | Bacteria | 1767 |
| 82 | Ga0070674_100508300 | 3300005356 | Bacteria | 1005 |
| 83 | Ga0070673_100034647 | 3300005364 | Bacteria | 3822 |
| 84 | Ga0070673_100050071 | 3300005364 | Bacteria | 3264 |
| 85 | Ga0070673_100083991 | 3300005364 | Bacteria | 2588 |
| 86 | Ga0070673_100331811 | 3300005364 | Bacteria | 1346 |
| 87 | Ga0070673_100379125 | 3300005364 | Bacteria | 1261 |
| 88 | Ga0070659_100004654 | 3300005366 | Bacteria | 9801 |
| 89 | Ga0070659_100028961 | 3300005366 | Bacteria | 4278 |
| 90 | Ga0070659_100055660 | 3300005366 | Bacteria | 3118 |
| 91 | Ga0070659_100135040 | 3300005366 | Bacteria | 2006 |
| 92 | Ga0070667_100005560 | 3300005367 | Bacteria | 10519 |
| 93 | Ga0070667_100017654 | 3300005367 | Bacteria | 5912 |
| 94 | Ga0070667_100018150 | 3300005367 | Bacteria | 5833 |
| 95 | Ga0070667_100056729 | 3300005367 | Bacteria | 3309 |
| 96 | Ga0070667_100062434 | 3300005367 | Bacteria | 3156 |
| 97 | Ga0070667_100071107 | 3300005367 | Bacteria | 2963 |
| 98 | Ga0070667_100095811 | 3300005367 | Bacteria | 2559 |
| 99 | Ga0070667_100129169 | 3300005367 | Bacteria | 2204 |
| 100 | Ga0070667_100155926 | 3300005367 | Bacteria | 2008 |
| 101 | Ga0070667_100287336 | 3300005367 | Bacteria | 1478 |
| 102 | Ga0070714_100133587 | 3300005435 | Bacteria | 2219 |
| 103 | Ga0070713_100092861 | 3300005436 | Bacteria | 2599 |
| 104 | Ga0070705_100079635 | 3300005440 | Bacteria | 2007 |
| 105 | Ga0070663_100069716 | 3300005455 | Bacteria | 2555 |
| 106 | Ga0070663_100099838 | 3300005455 | Bacteria | 2164 |
| 107 | Ga0070678_100000901 | 3300005456 | Bacteria | 15242 |
| 108 | Ga0070662_100037539 | 3300005457 | Bacteria | 3435 |
| 109 | Ga0070662_100448486 | 3300005457 | Bacteria | 1070 |
| 110 | Ga0070662_100495417 | 3300005457 | Bacteria | 1019 |
| 111 | Ga0068867_100053580 | 3300005459 | Bacteria | 2980 |
| 112 | Ga0068867_100087387 | 3300005459 | Bacteria | 2360 |
| 113 | Ga0070679_100055115 | 3300005530 | Bacteria | 3959 |
| 114 | Ga0070684_100202339 | 3300005535 | Bacteria | 1809 |
| 115 | Ga0070697_100001531 | 3300005536 | Bacteria | 17592 |
| 116 | Ga0068853_100087401 | 3300005539 | Bacteria | 2735 |
| 117 | Ga0068853_100127554 | 3300005539 | Bacteria | 2274 |
| 118 | Ga0068853_100546278 | 3300005539 | Bacteria | 1097 |
| 119 | Ga0068853_100581646 | 3300005539 | Bacteria | 1062 |
| 120 | Ga0070672_100318414 | 3300005543 | Bacteria | 1322 |
| 121 | Ga0070686_100282852 | 3300005544 | Bacteria | 1224 |
| 122 | Ga0070695_100010886 | 3300005545 | Bacteria | 5434 |
| 123 | Ga0070695_100395612 | 3300005545 | Bacteria | 1046 |
| 124 | Ga0070696_100009165 | 3300005546 | Bacteria | 6625 |
| 125 | Ga0070696_100041707 | 3300005546 | Bacteria | 3171 |
| 126 | Ga0070696_100054006 | 3300005546 | Bacteria | 2798 |
| 127 | Ga0070696_100263276 | 3300005546 | Bacteria | 1308 |
| 128 | Ga0070693_100040246 | 3300005547 | Bacteria | 2623 |
| 129 | Ga0070693_100108707 | 3300005547 | Bacteria | 1702 |
| 130 | Ga0070665_100080183 | 3300005548 | Bacteria | 3269 |
| 131 | Ga0070665_100101576 | 3300005548 | Bacteria | 2880 |
| 132 | Ga0070665_100192191 | 3300005548 | Bacteria | 2042 |
| 133 | Ga0070665_100249296 | 3300005548 | Bacteria | 1776 |
| 134 | Ga0070665_100356412 | 3300005548 | Bacteria | 1469 |
| 135 | Ga0068855_100146159 | 3300005563 | Bacteria | 2691 |
| 136 | Ga0068855_100147657 | 3300005563 | Bacteria | 2675 |
| 137 | Ga0068855_100173080 | 3300005563 | Bacteria | 2444 |
| 138 | Ga0068855_100485287 | 3300005563 | Unclassified | 1345 |
| 139 | Ga0070664_100023466 | 3300005564 | Bacteria | 5096 |
| 140 | Ga0070664_100232017 | 3300005564 | Bacteria | 1654 |
| 141 | Ga0070664_100311833 | 3300005564 | Bacteria | 1424 |
| 142 | Ga0068857_100106305 | 3300005577 | Bacteria | 2520 |
| 143 | Ga0068854_100093561 | 3300005578 | Bacteria | 2240 |
| 144 | Ga0068854_100128742 | 3300005578 | Bacteria | 1931 |
| 145 | Ga0068856_100238705 | 3300005614 | Bacteria | 1833 |
| 146 | Ga0068852_100161447 | 3300005616 | Bacteria | 2093 |
| 147 | Ga0068852_100470900 | 3300005616 | Bacteria | 1247 |
| 148 | Ga0068859_100000685 | 3300005617 | Bacteria | 34047 |
| 149 | Ga0068859_100046027 | 3300005617 | Bacteria | 4383 |
| 150 | Ga0068864_100000847 | 3300005618 | Bacteria | 25807 |
| 151 | Ga0068864_100001619 | 3300005618 | Bacteria | 18541 |
| 152 | Ga0068866_10021852 | 3300005718 | Bacteria | 2953 |
| 153 | Ga0068870_10052762 | 3300005840 | Bacteria | 2157 |
| 154 | Ga0068863_100005917 | 3300005841 | Bacteria | 11996 |
| 155 | Ga0068863_100052330 | 3300005841 | Bacteria | 3870 |
| 156 | Ga0068863_100095885 | 3300005841 | Bacteria | 2816 |
| 157 | Ga0068863_100133522 | 3300005841 | Bacteria | 2371 |
| 158 | Ga0068863_100155976 | 3300005841 | Bacteria | 2186 |
| 159 | Ga0068858_100006170 | 3300005842 | Bacteria | 11688 |
| 160 | Ga0068858_100030883 | 3300005842 | Bacteria | 4976 |
| 161 | Ga0068858_100482192 | 3300005842 | Bacteria | 1197 |
| 162 | Ga0068860_100001106 | 3300005843 | Bacteria | 29651 |
| 163 | Ga0068860_100006941 | 3300005843 | Bacteria | 11350 |
| 164 | Ga0068860_100027872 | 3300005843 | Bacteria | 5439 |
| 165 | Ga0068860_100081827 | 3300005843 | Bacteria | 3070 |
| 166 | Ga0068860_100102330 | 3300005843 | Bacteria | 2733 |
| 167 | Ga0068862_100004852 | 3300005844 | Bacteria | 11319 |
| 168 | Ga0068862_100011830 | 3300005844 | Bacteria | 7206 |
| 169 | Ga0068862_100041557 | 3300005844 | Bacteria | 3912 |
| 170 | Ga0068862_100049303 | 3300005844 | Bacteria | 3596 |
| 171 | Ga0068862_100086978 | 3300005844 | Bacteria | 2718 |
| 172 | Ga0068862_100166522 | 3300005844 | Bacteria | 1970 |
| 173 | Ga0068862_100512584 | 3300005844 | Bacteria | 1140 |
| 174 | Ga0081455_10143058 | 3300005937 | Bacteria | 1855 |
| 175 | Ga0081538_10015965 | 3300005981 | Bacteria | 5784 |
| 176 | Ga0075365_10260490 | 3300006038 | Bacteria | 1219 |
| 177 | Ga0075364_10000227 | 3300006051 | Bacteria | 26667 |
| 178 | Ga0075364_10067821 | 3300006051 | Bacteria | 2346 |
| 179 | Ga0075364_10115870 | 3300006051 | Bacteria | 1791 |
| 180 | Ga0070716_100038151 | 3300006173 | Bacteria | 2659 |
| 181 | Ga0070712_100092581 | 3300006175 | Bacteria | 2217 |
| 182 | Ga0075367_10009415 | 3300006178 | Bacteria | 5105 |
| 183 | Ga0075367_10019717 | 3300006178 | Bacteria | 3744 |
| 184 | Ga0075367_10309154 | 3300006178 | Bacteria | 995 |
| 185 | Ga0075367_10309781 | 3300006178 | Bacteria | 994 |
| 186 | Ga0075369_10006505 | 3300006186 | Bacteria | 4417 |
| 187 | Ga0097621_100122909 | 3300006237 | Bacteria | 2203 |
| 188 | Ga0097621_100306773 | 3300006237 | Bacteria | 1403 |
| 189 | Ga0097621_100673083 | 3300006237 | Bacteria | 951 |
| 190 | Ga0075370_10025171 | 3300006353 | Bacteria | 3290 |
| 191 | Ga0068871_100050133 | 3300006358 | Bacteria | 3377 |
| 192 | Ga0068871_100070168 | 3300006358 | Bacteria | 2879 |
| 193 | Ga0068871_100242357 | 3300006358 | Bacteria | 1568 |
| 194 | Ga0075433_10022199 | 3300006852 | Bacteria | 5327 |
| 195 | Ga0075434_100374441 | 3300006871 | Bacteria | 1445 |
| 196 | Ga0075429_100129756 | 3300006880 | Bacteria | 2205 |
| 197 | Ga0068865_100013945 | 3300006881 | Bacteria | 5097 |
| 198 | Ga0068865_100632231 | 3300006881 | Bacteria | 908 |
| 199 | Ga0075436_100002374 | 3300006914 | Bacteria | 13001 |
| 200 | Ga0097620_100000685 | 3300006931 | Bacteria | 34047 |
| 201 | Ga0097620_100046027 | 3300006931 | Bacteria | 4383 |
| 202 | Ga0075435_100059435 | 3300007076 | Bacteria | 3099 |
| 203 | Ga0105244_10051045 | 3300009036 | Bacteria | 2108 |
| 204 | Ga0105250_10011311 | 3300009092 | Bacteria | 3703 |
| 205 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 206 | Ga0105240_10074658 | 3300009093 | Bacteria | 4184 |
| 207 | Ga0105240_10301034 | 3300009093 | Bacteria | 1834 |
| 208 | Ga0105240_10362089 | 3300009093 | Bacteria | 1642 |
| 209 | Ga0111539_10010849 | 3300009094 | Bacteria | 11468 |
| 210 | Ga0105245_10260059 | 3300009098 | Bacteria | 1689 |
| 211 | Ga0105243_10000551 | 3300009148 | Bacteria | 37844 |
| 212 | Ga0105243_10016104 | 3300009148 | Bacteria | 5657 |
| 213 | Ga0105241_10001717 | 3300009174 | Bacteria | 16659 |
| 214 | Ga0105241_10119740 | 3300009174 | Bacteria | 2118 |
| 215 | Ga0105241_10165877 | 3300009174 | Bacteria | 1820 |
| 216 | Ga0105241_10546275 | 3300009174 | Bacteria | 1039 |
| 217 | Ga0105248_10001290 | 3300009177 | Bacteria | 27898 |
| 218 | Ga0105248_10002158 | 3300009177 | Bacteria | 21772 |
| 219 | Ga0105248_10010453 | 3300009177 | Bacteria | 10221 |
| 220 | Ga0105248_10010504 | 3300009177 | Bacteria | 10196 |
| 221 | Ga0105248_10161135 | 3300009177 | Bacteria | 2530 |
| 222 | Ga0105248_10321561 | 3300009177 | Bacteria | 1742 |
| 223 | Ga0105248_10376838 | 3300009177 | Bacteria | 1597 |
| 224 | Ga0105237_10000714 | 3300009545 | Bacteria | 45945 |
| 225 | Ga0105237_10012745 | 3300009545 | Bacteria | 8842 |
| 226 | Ga0105237_10438365 | 3300009545 | Bacteria | 1312 |
| 227 | Ga0105238_10152773 | 3300009551 | Bacteria | 2283 |
| 228 | Ga0105238_10159207 | 3300009551 | Bacteria | 2233 |
| 229 | Ga0105249_10004218 | 3300009553 | Bacteria | 12422 |
| 230 | Ga0105249_10007828 | 3300009553 | Bacteria | 9304 |
| 231 | Ga0105249_10085844 | 3300009553 | Bacteria | 2934 |
| 232 | Ga0105239_10002271 | 3300010375 | Bacteria | 24544 |
| 233 | Ga0105239_10054540 | 3300010375 | Bacteria | 4385 |
| 234 | Ga0105239_10120300 | 3300010375 | Bacteria | 2915 |
| 235 | Ga0105239_10258223 | 3300010375 | Bacteria | 1958 |
| 236 | Ga0157326_1004805 | 3300012513 | Bacteria | 1423 |
| 237 | Ga0157373_10182545 | 3300013100 | Bacteria | 1477 |
| 238 | Ga0157373_10283485 | 3300013100 | Bacteria | 1174 |
| 239 | Ga0157373_10356148 | 3300013100 | Bacteria | 1044 |
| 240 | Ga0157371_10000138 | 3300013102 | Bacteria | 105621 |
| 241 | Ga0157370_10000209 | 3300013104 | Bacteria | 74351 |
| 242 | Ga0157370_10066706 | 3300013104 | Bacteria | 3402 |
| 243 | Ga0157370_10289017 | 3300013104 | Bacteria | 1514 |
| 244 | Ga0157370_10685766 | 3300013104 | Bacteria | 935 |
| 245 | Ga0157370_10774647 | 3300013104 | Bacteria | 873 |
| 246 | Ga0157369_10058538 | 3300013105 | Bacteria | 4156 |
| 247 | Ga0157369_10131905 | 3300013105 | Bacteria | 2647 |
| 248 | Ga0157369_10142769 | 3300013105 | Bacteria | 2533 |
| 249 | Ga0157374_10101520 | 3300013296 | Bacteria | 2758 |
| 250 | Ga0157374_10150216 | 3300013296 | Bacteria | 2265 |
| 251 | Ga0163162_10037700 | 3300013306 | Bacteria | 4825 |
| 252 | Ga0163162_10055061 | 3300013306 | Bacteria | 4003 |
| 253 | Ga0163162_10426281 | 3300013306 | Bacteria | 1459 |
| 254 | Ga0163162_10689834 | 3300013306 | Bacteria | 1143 |
| 255 | Ga0157372_10274365 | 3300013307 | Bacteria | 1960 |
| 256 | Ga0157372_10947099 | 3300013307 | Bacteria | 998 |
| 257 | Ga0157375_10011059 | 3300013308 | Bacteria | 7958 |
| 258 | Ga0157375_10050373 | 3300013308 | Bacteria | 4085 |
| 259 | Ga0157375_10133989 | 3300013308 | Bacteria | 2599 |
| 260 | Ga0163163_10000307 | 3300014325 | Bacteria | 48168 |
| 261 | Ga0163163_10015446 | 3300014325 | Bacteria | 7059 |
| 262 | Ga0157380_10037643 | 3300014326 | Bacteria | 3749 |
| 263 | Ga0157380_10270272 | 3300014326 | Bacteria | 1549 |
| 264 | Ga0182008_10007328 | 3300014497 | Bacteria | 6101 |
| 265 | Ga0157377_10025871 | 3300014745 | Bacteria | 3134 |
| 266 | Ga0157379_10029113 | 3300014968 | Bacteria | 4912 |
| 267 | Ga0157379_10433576 | 3300014968 | Bacteria | 1211 |
| 268 | Ga0157379_10520031 | 3300014968 | Bacteria | 1105 |
| 269 | Ga0157376_10292401 | 3300014969 | Bacteria | 1539 |
| 270 | Ga0182006_1046750 | 3300015261 | Bacteria | 1680 |
| 271 | Ga0182007_10003947 | 3300015262 | Bacteria | 6851 |
| 272 | Ga0182005_1004378 | 3300015265 | Bacteria | 4577 |
| 273 | Ga0182005_1071450 | 3300015265 | Bacteria | 953 |
| 274 | Ga0163161_10070128 | 3300017792 | Bacteria | 2563 |
| 275 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 276 | Ga0209760_102687 | 3300025207 | Bacteria | 1638 |
| 277 | Ga0209672_110869 | 3300025228 | Bacteria | 1207 |
| 278 | Ga0207427_106993 | 3300025231 | Bacteria | 1366 |
| 279 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 280 | Ga0209437_100107 | 3300025233 | Bacteria | 218656 |
| 281 | Ga0207425_1000034 | 3300025245 | Bacteria | 227886 |
| 282 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 283 | Ga0209646_1012176 | 3300025246 | Bacteria | 1324 |
| 284 | Ga0209646_1017240 | 3300025246 | Bacteria | 1067 |
| 285 | Ga0209026_1000041 | 3300025250 | Bacteria | 275745 |
| 286 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 287 | Ga0209677_100297 | 3300025253 | Bacteria | 32532 |
| 288 | Ga0209677_107846 | 3300025253 | Bacteria | 2179 |
| 289 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 290 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 291 | Ga0209148_1026352 | 3300025254 | Bacteria | 903 |
| 292 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 293 | Ga0209759_1000183 | 3300025256 | Bacteria | 102218 |
| 294 | Ga0209129_1000094 | 3300025258 | Bacteria | 172051 |
| 295 | Ga0209233_1000030 | 3300025261 | Bacteria | 636702 |
| 296 | Ga0209233_1000072 | 3300025261 | Bacteria | 363074 |
| 297 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 298 | Ga0209233_1000353 | 3300025261 | Bacteria | 42997 |
| 299 | Ga0209233_1015585 | 3300025261 | Bacteria | 2114 |
| 300 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 301 | Ga0209455_1000161 | 3300025272 | Bacteria | 117353 |
| 302 | Ga0209673_1004624 | 3300025273 | Bacteria | 7285 |
| 303 | Ga0209025_1000184 | 3300025294 | Bacteria | 155611 |
| 304 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 305 | Ga0209758_1000159 | 3300025297 | Bacteria | 155588 |
| 306 | Ga0209758_1022617 | 3300025297 | Bacteria | 2873 |
| 307 | Ga0207697_10002198 | 3300025315 | Bacteria | 10202 |
| 308 | Ga0207697_10012600 | 3300025315 | Bacteria | 3541 |
| 309 | Ga0207697_10097977 | 3300025315 | Bacteria | 1248 |
| 310 | Ga0207696_1009256 | 3300025711 | Bacteria | 3683 |
| 311 | Ga0207682_10000505 | 3300025893 | Bacteria | 17929 |
| 312 | Ga0207682_10054396 | 3300025893 | Bacteria | 1663 |
| 313 | Ga0207688_10021621 | 3300025901 | Bacteria | 3518 |
| 314 | Ga0207688_10148791 | 3300025901 | Bacteria | 1382 |
| 315 | Ga0207680_10001044 | 3300025903 | Bacteria | 13083 |
| 316 | Ga0207647_10009701 | 3300025904 | Bacteria | 6830 |
| 317 | Ga0207647_10021806 | 3300025904 | Bacteria | 4266 |
| 318 | Ga0207647_10091971 | 3300025904 | Bacteria | 1809 |
| 319 | Ga0207647_10102083 | 3300025904 | Bacteria | 1701 |
| 320 | Ga0207699_10021776 | 3300025906 | Bacteria | 3461 |
| 321 | Ga0207645_10085650 | 3300025907 | Bacteria | 2024 |
| 322 | Ga0207705_10000120 | 3300025909 | Bacteria | 87080 |
| 323 | Ga0207705_10052688 | 3300025909 | Bacteria | 2930 |
| 324 | Ga0207705_10070861 | 3300025909 | Bacteria | 2526 |
| 325 | Ga0207654_10000311 | 3300025911 | Bacteria | 29351 |
| 326 | Ga0207654_10095098 | 3300025911 | Bacteria | 1824 |
| 327 | Ga0207707_10056195 | 3300025912 | Bacteria | 3424 |
| 328 | Ga0207707_10228071 | 3300025912 | Bacteria | 1621 |
| 329 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 330 | Ga0207695_10128226 | 3300025913 | Bacteria | 2497 |
| 331 | Ga0207695_10161967 | 3300025913 | Bacteria | 2168 |
| 332 | Ga0207695_10291054 | 3300025913 | Bacteria | 1525 |
| 333 | Ga0207695_10671653 | 3300025913 | Bacteria | 917 |
| 334 | Ga0207671_10000364 | 3300025914 | Bacteria | 64550 |
| 335 | Ga0207671_10150986 | 3300025914 | Bacteria | 1795 |
| 336 | Ga0207693_10009824 | 3300025915 | Bacteria | 7788 |
| 337 | Ga0207660_10035675 | 3300025917 | Bacteria | 3454 |
| 338 | Ga0207662_10035883 | 3300025918 | Bacteria | 2897 |
| 339 | Ga0207657_10014901 | 3300025919 | Bacteria | 7563 |
| 340 | Ga0207657_10036707 | 3300025919 | Bacteria | 4384 |
| 341 | Ga0207657_10083838 | 3300025919 | Bacteria | 2673 |
| 342 | Ga0207657_10169016 | 3300025919 | Bacteria | 1772 |
| 343 | Ga0207649_10002327 | 3300025920 | Bacteria | 10668 |
| 344 | Ga0207649_10027838 | 3300025920 | Bacteria | 3322 |
| 345 | Ga0207649_10036447 | 3300025920 | Bacteria | 2962 |
| 346 | Ga0207649_10175370 | 3300025920 | Bacteria | 1497 |
| 347 | Ga0207649_10338173 | 3300025920 | Bacteria | 1111 |
| 348 | Ga0207681_10011479 | 3300025923 | Bacteria | 5444 |
| 349 | Ga0207681_10183634 | 3300025923 | Bacteria | 1595 |
| 350 | Ga0207694_10185088 | 3300025924 | Bacteria | 1690 |
| 351 | Ga0207650_10011940 | 3300025925 | Bacteria | 5988 |
| 352 | Ga0207650_10037516 | 3300025925 | Bacteria | 3532 |
| 353 | Ga0207650_10152831 | 3300025925 | Bacteria | 1823 |
| 354 | Ga0207650_10274799 | 3300025925 | Bacteria | 1370 |
| 355 | Ga0207650_10352871 | 3300025925 | Bacteria | 1210 |
| 356 | Ga0207659_10097546 | 3300025926 | Bacteria | 2208 |
| 357 | Ga0207659_10424433 | 3300025926 | Bacteria | 1116 |
| 358 | Ga0207659_10481286 | 3300025926 | Bacteria | 1049 |
| 359 | Ga0207700_10062479 | 3300025928 | Bacteria | 2829 |
| 360 | Ga0207700_10064310 | 3300025928 | Bacteria | 2794 |
| 361 | Ga0207644_10000415 | 3300025931 | Bacteria | 27794 |
| 362 | Ga0207644_10012673 | 3300025931 | Bacteria | 5603 |
| 363 | Ga0207644_10055721 | 3300025931 | Bacteria | 2850 |
| 364 | Ga0207644_10126210 | 3300025931 | Bacteria | 1953 |
| 365 | Ga0207644_10194240 | 3300025931 | Bacteria | 1597 |
| 366 | Ga0207644_10457223 | 3300025931 | Bacteria | 1049 |
| 367 | Ga0207690_10007422 | 3300025932 | Bacteria | 6509 |
| 368 | Ga0207690_10026510 | 3300025932 | Bacteria | 3649 |
| 369 | Ga0207690_10238082 | 3300025932 | Bacteria | 1401 |
| 370 | Ga0207706_10036166 | 3300025933 | Bacteria | 4388 |
| 371 | Ga0207706_10036276 | 3300025933 | Bacteria | 4380 |
| 372 | Ga0207706_10048718 | 3300025933 | Bacteria | 3747 |
| 373 | Ga0207706_10058766 | 3300025933 | Bacteria | 3387 |
| 374 | Ga0207706_10060688 | 3300025933 | Bacteria | 3330 |
| 375 | Ga0207686_10253052 | 3300025934 | Bacteria | 1288 |
| 376 | Ga0207709_10000078 | 3300025935 | Bacteria | 169141 |
| 377 | Ga0207709_10064738 | 3300025935 | Bacteria | 2297 |
| 378 | Ga0207670_10234862 | 3300025936 | Bacteria | 1410 |
| 379 | Ga0207669_10000020 | 3300025937 | Bacteria | 105051 |
| 380 | Ga0207669_10009051 | 3300025937 | Bacteria | 4717 |
| 381 | Ga0207669_10032982 | 3300025937 | Bacteria | 2916 |
| 382 | Ga0207704_10524415 | 3300025938 | Bacteria | 959 |
| 383 | Ga0207691_10036319 | 3300025940 | Bacteria | 4565 |
| 384 | Ga0207691_10102071 | 3300025940 | Bacteria | 2559 |
| 385 | Ga0207691_10240642 | 3300025940 | Bacteria | 1565 |
| 386 | Ga0207691_10451422 | 3300025940 | Bacteria | 1094 |
| 387 | Ga0207691_10520697 | 3300025940 | Bacteria | 1009 |
| 388 | Ga0207711_10000420 | 3300025941 | Bacteria | 44798 |
| 389 | Ga0207711_10000831 | 3300025941 | Bacteria | 30006 |
| 390 | Ga0207711_10001208 | 3300025941 | Bacteria | 24465 |
| 391 | Ga0207711_10009193 | 3300025941 | Bacteria | 8255 |
| 392 | Ga0207711_10279596 | 3300025941 | Bacteria | 1537 |
| 393 | Ga0207689_10072695 | 3300025942 | Bacteria | 2825 |
| 394 | Ga0207689_10308763 | 3300025942 | Bacteria | 1312 |
| 395 | Ga0207679_10008127 | 3300025945 | Bacteria | 6676 |
| 396 | Ga0207679_10091455 | 3300025945 | Bacteria | 2355 |
| 397 | Ga0207679_10246930 | 3300025945 | Bacteria | 1515 |
| 398 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 399 | Ga0207667_10121185 | 3300025949 | Bacteria | 2695 |
| 400 | Ga0207651_10025637 | 3300025960 | Bacteria | 3668 |
| 401 | Ga0207651_10054717 | 3300025960 | Bacteria | 2736 |
| 402 | Ga0207651_10070177 | 3300025960 | Bacteria | 2477 |
| 403 | Ga0207651_10107522 | 3300025960 | Bacteria | 2085 |
| 404 | Ga0207712_10006333 | 3300025961 | Bacteria | 7467 |
| 405 | Ga0207712_10009058 | 3300025961 | Bacteria | 6296 |
| 406 | Ga0207668_10021001 | 3300025972 | Bacteria | 4158 |
| 407 | Ga0207668_10034891 | 3300025972 | Bacteria | 3345 |
| 408 | Ga0207668_10132672 | 3300025972 | Bacteria | 1904 |
| 409 | Ga0207668_10474230 | 3300025972 | Bacteria | 1072 |
| 410 | Ga0207640_10024794 | 3300025981 | Bacteria | 3623 |
| 411 | Ga0207640_10066121 | 3300025981 | Bacteria | 2415 |
| 412 | Ga0207640_10098241 | 3300025981 | Bacteria | 2046 |
| 413 | Ga0207640_10163001 | 3300025981 | Bacteria | 1652 |
| 414 | Ga0207640_10225962 | 3300025981 | Bacteria | 1436 |
| 415 | Ga0207640_10508429 | 3300025981 | Bacteria | 1005 |
| 416 | Ga0207640_10636544 | 3300025981 | Bacteria | 907 |
| 417 | Ga0207658_10002673 | 3300025986 | Bacteria | 12909 |
| 418 | Ga0207658_10003158 | 3300025986 | Bacteria | 11766 |
| 419 | Ga0207658_10004510 | 3300025986 | Bacteria | 9674 |
| 420 | Ga0207658_10005394 | 3300025986 | Bacteria | 8777 |
| 421 | Ga0207658_10008350 | 3300025986 | Bacteria | 7050 |
| 422 | Ga0207658_10075648 | 3300025986 | Bacteria | 2562 |
| 423 | Ga0207658_10090891 | 3300025986 | Bacteria | 2367 |
| 424 | Ga0207658_10255031 | 3300025986 | Bacteria | 1492 |
| 425 | Ga0207658_10257368 | 3300025986 | Bacteria | 1486 |
| 426 | Ga0207677_10013551 | 3300026023 | Bacteria | 4730 |
| 427 | Ga0207677_10026347 | 3300026023 | Bacteria | 3644 |
| 428 | Ga0207677_10320142 | 3300026023 | Bacteria | 1288 |
| 429 | Ga0207677_10376784 | 3300026023 | Bacteria | 1197 |
| 430 | Ga0207703_10001930 | 3300026035 | Bacteria | 18356 |
| 431 | Ga0207703_10026334 | 3300026035 | Bacteria | 4576 |
| 432 | Ga0207703_10443046 | 3300026035 | Bacteria | 1212 |
| 433 | Ga0207639_10019145 | 3300026041 | Bacteria | 4877 |
| 434 | Ga0207639_10031653 | 3300026041 | Bacteria | 3889 |
| 435 | Ga0207639_10041332 | 3300026041 | Bacteria | 3448 |
| 436 | Ga0207639_10136010 | 3300026041 | Bacteria | 2041 |
| 437 | Ga0207639_10278875 | 3300026041 | Bacteria | 1469 |
| 438 | Ga0207678_10020955 | 3300026067 | Bacteria | 5729 |
| 439 | Ga0207678_10027969 | 3300026067 | Bacteria | 4923 |
| 440 | Ga0207678_10070358 | 3300026067 | Bacteria | 3000 |
| 441 | Ga0207678_10077444 | 3300026067 | Bacteria | 2848 |
| 442 | Ga0207678_10134935 | 3300026067 | Bacteria | 2106 |
| 443 | Ga0207678_10383139 | 3300026067 | Bacteria | 1216 |
| 444 | Ga0207702_10007220 | 3300026078 | Bacteria | 9502 |
| 445 | Ga0207702_10220615 | 3300026078 | Bacteria | 1767 |
| 446 | Ga0207702_10367799 | 3300026078 | Bacteria | 1380 |
| 447 | Ga0207702_10852214 | 3300026078 | Bacteria | 902 |
| 448 | Ga0207641_10000502 | 3300026088 | Bacteria | 44127 |
| 449 | Ga0207641_10026879 | 3300026088 | Bacteria | 4751 |
| 450 | Ga0207641_10036006 | 3300026088 | Bacteria | 4129 |
| 451 | Ga0207641_10153245 | 3300026088 | Bacteria | 2089 |
| 452 | Ga0207648_10022723 | 3300026089 | Bacteria | 5627 |
| 453 | Ga0207648_10069064 | 3300026089 | Bacteria | 3079 |
| 454 | Ga0207648_10086868 | 3300026089 | Bacteria | 2729 |
| 455 | Ga0207676_10002138 | 3300026095 | Bacteria | 14289 |
| 456 | Ga0207676_10008921 | 3300026095 | Bacteria | 7134 |
| 457 | Ga0207676_10173314 | 3300026095 | Bacteria | 1882 |
| 458 | Ga0207674_10027655 | 3300026116 | Bacteria | 5995 |
| 459 | Ga0207674_10220450 | 3300026116 | Bacteria | 1845 |
| 460 | Ga0207675_100960816 | 3300026118 | Bacteria | 872 |
| 461 | Ga0207683_10002005 | 3300026121 | Bacteria | 18010 |
| 462 | Ga0207683_10009381 | 3300026121 | Bacteria | 8336 |
| 463 | Ga0207683_10058347 | 3300026121 | Bacteria | 3389 |
| 464 | Ga0207683_10389478 | 3300026121 | Bacteria | 1281 |
| 465 | Ga0207698_10074132 | 3300026142 | Bacteria | 2713 |
| 466 | Ga0207698_10136911 | 3300026142 | Bacteria | 2103 |
| 467 | Ga0268266_10012670 | 3300028379 | Bacteria | 7286 |
| 468 | Ga0268266_10018787 | 3300028379 | Bacteria | 5890 |
| 469 | Ga0268266_10175377 | 3300028379 | Bacteria | 1948 |
| 470 | Ga0268266_10179426 | 3300028379 | Bacteria | 1927 |
| 471 | Ga0268266_10339001 | 3300028379 | Bacteria | 1411 |
| 472 | Ga0268266_10368214 | 3300028379 | Bacteria | 1353 |
| 473 | Ga0268265_10002045 | 3300028380 | Bacteria | 15816 |
| 474 | Ga0268265_10005103 | 3300028380 | Bacteria | 9002 |
| 475 | Ga0268265_10021534 | 3300028380 | Bacteria | 4518 |
| 476 | Ga0268265_10199063 | 3300028380 | Bacteria | 1736 |
| 477 | Ga0268265_10371302 | 3300028380 | Bacteria | 1313 |
| 478 | Ga0268265_10552286 | 3300028380 | Bacteria | 1093 |
| 479 | Ga0268265_10692766 | 3300028380 | Bacteria | 984 |
| 480 | Ga0268264_10000410 | 3300028381 | Bacteria | 60680 |
| 481 | Ga0268264_10000418 | 3300028381 | Bacteria | 59942 |
| 482 | Ga0268264_10004427 | 3300028381 | Bacteria | 11983 |
| 483 | Ga0268264_10041454 | 3300028381 | Bacteria | 3808 |
| 484 | Ga0268264_10049649 | 3300028381 | Bacteria | 3491 |
| 485 | Ga0316182_1126955 | 3300030745 | Bacteria | 2686 |
| 486 | Ga0265328_10000400 | 3300031239 | Bacteria | 20303 |
| 487 | Ga0265327_10111503 | 3300031251 | Bacteria | 1306 |
| 488 | Ga0307408_100121195 | 3300031548 | Bacteria | 2026 |
| 489 | Ga0307408_100245351 | 3300031548 | Bacteria | 1474 |
| 490 | Ga0316575_10000462 | 3300031665 | Bacteria | 11643 |
| 491 | Ga0316579_10053979 | 3300031691 | Bacteria | 1884 |
| 492 | Ga0307405_10053655 | 3300031731 | Bacteria | 2512 |
| 493 | Ga0307405_10383920 | 3300031731 | Bacteria | 1094 |
| 494 | Ga0307405_10505245 | 3300031731 | Bacteria | 970 |
| 495 | Ga0307413_10017198 | 3300031824 | Bacteria | 3760 |
| 496 | Ga0307413_10033805 | 3300031824 | Bacteria | 2916 |
| 497 | Ga0307413_10053410 | 3300031824 | Bacteria | 2446 |
| 498 | Ga0307413_10072017 | 3300031824 | Bacteria | 2180 |
| 499 | Ga0307413_10611722 | 3300031824 | Bacteria | 893 |
| 500 | Ga0307413_10620786 | 3300031824 | Bacteria | 887 |
| 501 | Ga0307410_10001216 | 3300031852 | Bacteria | 11451 |
| 502 | Ga0307410_10003555 | 3300031852 | Bacteria | 7846 |
| 503 | Ga0307410_10036507 | 3300031852 | Bacteria | 3201 |
| 504 | Ga0307410_10041136 | 3300031852 | Bacteria | 3046 |
| 505 | Ga0307410_10042014 | 3300031852 | Bacteria | 3019 |
| 506 | Ga0307406_10004003 | 3300031901 | Bacteria | 8013 |
| 507 | Ga0307406_10029958 | 3300031901 | Bacteria | 3299 |
| 508 | Ga0307406_10241186 | 3300031901 | Bacteria | 1356 |
| 509 | Ga0307406_10246473 | 3300031901 | Bacteria | 1343 |
| 510 | Ga0307407_10020279 | 3300031903 | Bacteria | 3402 |
| 511 | Ga0307407_10070824 | 3300031903 | Bacteria | 2074 |
| 512 | Ga0307407_10220039 | 3300031903 | Bacteria | 1283 |
| 513 | Ga0307412_10005208 | 3300031911 | Bacteria | 7290 |
| 514 | Ga0307412_10083018 | 3300031911 | Bacteria | 2220 |
| 515 | Ga0307412_10125584 | 3300031911 | Bacteria | 1855 |
| 516 | Ga0307412_10248769 | 3300031911 | Bacteria | 1379 |
| 517 | Ga0307409_100020317 | 3300031995 | Bacteria | 4523 |
| 518 | Ga0307409_100044599 | 3300031995 | Bacteria | 3341 |
| 519 | Ga0307409_100055437 | 3300031995 | Bacteria | 3060 |
| 520 | Ga0307409_100383993 | 3300031995 | Bacteria | 1336 |
| 521 | Ga0307416_100177028 | 3300032002 | Bacteria | 1994 |
| 522 | Ga0307416_100394604 | 3300032002 | Bacteria | 1419 |
| 523 | Ga0307414_10005548 | 3300032004 | Bacteria | 6959 |
| 524 | Ga0307414_10050064 | 3300032004 | Bacteria | 2892 |
| 525 | Ga0307414_10059036 | 3300032004 | Bacteria | 2706 |
| 526 | Ga0307414_10213311 | 3300032004 | Bacteria | 1579 |
| 527 | Ga0307414_10234079 | 3300032004 | Bacteria | 1516 |
| 528 | Ga0307414_10397994 | 3300032004 | Bacteria | 1195 |
| 529 | Ga0307411_10001404 | 3300032005 | Bacteria | 9790 |
| 530 | Ga0307411_10002297 | 3300032005 | Bacteria | 8376 |
| 531 | Ga0307411_10062011 | 3300032005 | Bacteria | 2492 |
| 532 | Ga0307411_10077171 | 3300032005 | Bacteria | 2280 |
| 533 | Ga0307411_10199709 | 3300032005 | Bacteria | 1534 |
| 534 | Ga0307411_10200077 | 3300032005 | Bacteria | 1533 |
| 535 | Ga0307411_10218389 | 3300032005 | Bacteria | 1477 |
| 536 | Ga0307411_10294194 | 3300032005 | Bacteria | 1299 |
| 537 | Ga0307415_100209555 | 3300032126 | Bacteria | 1553 |
| 538 | Ga0373935_0056241 | 3300035692 | Bacteria | 2508 |
| 539 | Ga0373935_0347864 | 3300035692 | Bacteria | 1056 |
| 540 | Ga0373927_0000019 | 3300035695 | Bacteria | 139754 |
| 541 | Ga0316582_0168187 | 3300036647 | Bacteria | 1487 |
| 542 | Ga0316584_0062902 | 3300036712 | Bacteria | 2779 |
| 543 | Ga0373925_0001010 | 3300037068 | Bacteria | 25444 |
| 544 | Ga0373925_0178597 | 3300037068 | Bacteria | 1679 |
| 545 | Ga0395899_0000288 | 3300037312 | Bacteria | 64881 |
| 546 | Ga0395899_0062521 | 3300037312 | Bacteria | 2742 |
| 547 | Ga0395899_0254140 | 3300037312 | Bacteria | 1205 |
| 548 | Ga0395900_0000246 | 3300037418 | Bacteria | 85104 |
| 549 | Ga0395900_0003041 | 3300037418 | Bacteria | 18271 |
| 550 | Ga0395900_0125626 | 3300037418 | Bacteria | 2631 |
| 551 | Ga0395900_0144558 | 3300037418 | Bacteria | 2433 |
| 552 | Ga0395900_0171188 | 3300037418 | Bacteria | 2211 |
| 553 | Ga0395900_0334197 | 3300037418 | Bacteria | 1492 |
| 554 | Ga0395900_0418140 | 3300037418 | Bacteria | 1302 |
| 555 | Ga0395900_0538065 | 3300037418 | Bacteria | 1114 |
| 556 | Ga0395898_0000447 | 3300037466 | Bacteria | 85103 |
| 557 | Ga0395898_0489804 | 3300037466 | Bacteria | 1170 |
| 558 | Ga0395898_0832015 | 3300037466 | Bacteria | 863 |
| 559 | Ga0395905_0000228 | 3300037471 | Bacteria | 85103 |
| 560 | Ga0395905_0002055 | 3300037471 | Bacteria | 22979 |
| 561 | Ga0395905_0015256 | 3300037471 | Bacteria | 7305 |
| 562 | Ga0395905_0019543 | 3300037471 | Bacteria | 6420 |
| 563 | Ga0395905_0030456 | 3300037471 | Bacteria | 5085 |
| 564 | Ga0395905_0033143 | 3300037471 | Bacteria | 4854 |
| 565 | Ga0395905_0089712 | 3300037471 | Bacteria | 2881 |
| 566 | Ga0395905_0130833 | 3300037471 | Bacteria | 2360 |
| 567 | Ga0395905_0148896 | 3300037471 | Bacteria | 2202 |
| 568 | Ga0395905_0154177 | 3300037471 | Bacteria | 2161 |
| 569 | Ga0395905_0315803 | 3300037471 | Bacteria | 1452 |
| 570 | Ga0436364_0575430 | 3300037853 | Bacteria | 1568 |
| 571 | Ga0395901_0000167 | 3300038443 | Bacteria | 85844 |
| 572 | Ga0395901_0023795 | 3300038443 | Bacteria | 6281 |
| 573 | Ga0395901_0038175 | 3300038443 | Bacteria | 4968 |
| 574 | Ga0395901_0069941 | 3300038443 | Bacteria | 3656 |
| 575 | Ga0395901_0482284 | 3300038443 | Bacteria | 1264 |
| 576 | Ga0395901_0556178 | 3300038443 | Bacteria | 1162 |
| 577 | Ga0436365_1317782 | 3300039437 | Bacteria | 2217 |
| 578 | Ga0436365_1906995 | 3300039437 | Bacteria | 1055 |
| 579 | Ga0436360_0223865 | 3300039438 | Bacteria | 2164 |
| 580 | Ga0436361_0909211 | 3300039447 | Bacteria | 3196 |
| 581 | Ga0436363_1504724 | 3300039450 | Bacteria | 1304 |
| 582 | Ga0439466_0035629 | 3300041411 | Bacteria | 1683 |
| 583 | Ga0439466_0043093 | 3300041411 | Bacteria | 1500 |
| 584 | Ga0439465_0009333 | 3300041413 | Bacteria | 3091 |
| 585 | Ga0439432_047628 | 3300042006 | Bacteria | 1344 |
| 586 | Ga0439449_0016313 | 3300042007 | Bacteria | 2792 |
| 587 | Ga0439462_0021801 | 3300042015 | Bacteria | 1675 |
| 588 | Ga0450914_000066 | 3300042118 | Bacteria | 2872 |
| 589 | Ga0450890_005866 | 3300042127 | Bacteria | 1580 |
| 590 | Ga0450889_000164 | 3300042144 | Bacteria | 6977 |
| 591 | Ga0439464_0001132 | 3300042439 | Bacteria | 6173 |
| 592 | Ga0466972_0037315 | 3300044658 | Bacteria | 2376 |
| 593 | Ga0466960_0133528 | 3300044901 | Bacteria | 1312 |
| 594 | Ga0466959_0043155 | 3300045049 | Bacteria | 3326 |
| 595 | Ga0466958_0021058 | 3300045836 | Bacteria | 3807 |
| 596 | Ga0466967_0693516 | 3300045976 | Bacteria | 1008 |
| 597 | Ga0495629_0210565 | 3300046459 | Bacteria | 1343 |
| 598 | Ga0495638_0000978 | 3300046460 | Bacteria | 28781 |
| 599 | Ga0495638_0024075 | 3300046460 | Bacteria | 3974 |
| 600 | Ga0495605_0005182 | 3300046474 | Bacteria | 7593 |
| 601 | Ga0495585_0002615 | 3300046492 | Bacteria | 12702 |
| 602 | Ga0495585_0005045 | 3300046492 | Bacteria | 8416 |
| 603 | Ga0495585_0060178 | 3300046492 | Bacteria | 2091 |
| 604 | Ga0495596_0071481 | 3300046500 | Bacteria | 1347 |
| 605 | Ga0495607_0091605 | 3300046501 | Bacteria | 1646 |
| 606 | Ga0495583_0003310 | 3300046506 | Bacteria | 12484 |
| 607 | Ga0495583_0011178 | 3300046506 | Bacteria | 5172 |
| 608 | Ga0495583_0021181 | 3300046506 | Bacteria | 3349 |
| 609 | Ga0495583_0164009 | 3300046506 | Bacteria | 915 |
| 610 | Ga0495606_0000963 | 3300046507 | Bacteria | 42128 |
| 611 | Ga0495606_0016331 | 3300046507 | Bacteria | 5667 |
| 612 | Ga0495606_0121693 | 3300046507 | Bacteria | 1562 |
| 613 | Ga0495616_0015461 | 3300046513 | Bacteria | 4246 |
| 614 | Ga0495616_0066743 | 3300046513 | Bacteria | 1750 |
| 615 | Ga0495620_0080955 | 3300046515 | Bacteria | 1314 |
| 616 | Ga0495631_0001352 | 3300046518 | Bacteria | 14999 |
| 617 | Ga0495631_0042268 | 3300046518 | Bacteria | 2015 |
| 618 | Ga0495632_0014024 | 3300046519 | Bacteria | 4549 |
| 619 | Ga0495643_0104652 | 3300046522 | Bacteria | 1446 |
| 620 | Ga0495648_0000782 | 3300046524 | Bacteria | 33902 |
| 621 | Ga0495648_0080295 | 3300046524 | Bacteria | 1859 |
| 622 | Ga0495663_0006090 | 3300046525 | Bacteria | 3336 |
| 623 | Ga0495654_0000296 | 3300046530 | Bacteria | 44716 |
| 624 | Ga0495587_0268631 | 3300046536 | Bacteria | 957 |
| 625 | Ga0495609_0040002 | 3300046538 | Bacteria | 2110 |
| 626 | Ga0495621_0037811 | 3300046539 | Bacteria | 1680 |
| 627 | Ga0495597_0038339 | 3300046542 | Bacteria | 2148 |
| 628 | Ga0495633_0005249 | 3300046558 | Bacteria | 7988 |
| 629 | Ga0495668_0000080 | 3300046616 | Bacteria | 157259 |
| 630 | Ga0495668_0016292 | 3300046616 | Bacteria | 4320 |
| 631 | Ga0495611_0006470 | 3300046648 | Bacteria | 4991 |
| 632 | Ga0495625_0000819 | 3300046660 | Bacteria | 42876 |
| 633 | Ga0495625_0012968 | 3300046660 | Bacteria | 6725 |
| 634 | Ga0495625_0032281 | 3300046660 | Bacteria | 3885 |
| 635 | Ga0495625_0054954 | 3300046660 | Bacteria | 2842 |
| 636 | Ga0495625_0064035 | 3300046660 | Bacteria | 2595 |
| 637 | Ga0495625_0142379 | 3300046660 | Bacteria | 1617 |
| 638 | Ga0495625_0146525 | 3300046660 | Bacteria | 1589 |
| 639 | Ga0495635_0296620 | 3300046663 | Bacteria | 1084 |
| 640 | Ga0495661_0207327 | 3300046665 | Bacteria | 1023 |
| 641 | Ga0495669_0000011 | 3300046684 | Bacteria | 158720 |
| 642 | Ga0495669_0001712 | 3300046684 | Bacteria | 8984 |
| 643 | Ga0495613_0159806 | 3300046689 | Bacteria | 1604 |
| 644 | Ga0495670_0034506 | 3300046691 | Bacteria | 2520 |
| 645 | Ga0495670_0078577 | 3300046691 | Bacteria | 1678 |
| 646 | Ga0495649_0021504 | 3300046694 | Bacteria | 3613 |
| 647 | Ga0495660_0038136 | 3300046810 | Bacteria | 2673 |
| 648 | Ga0495660_0084593 | 3300046810 | Bacteria | 1659 |
| 649 | Ga0495604_0076923 | 3300047317 | Bacteria | 2509 |
| 650 | Ga0495636_0032155 | 3300047318 | Bacteria | 2152 |
| 651 | Ga0495672_0052903 | 3300047320 | Bacteria | 2383 |
| 652 | Ga0495683_0006885 | 3300047323 | Bacteria | 6180 |
| 653 | Ga0495683_0046681 | 3300047323 | Bacteria | 2174 |
| 654 | Ga0495687_000684 | 3300047443 | Bacteria | 38434 |
| 655 | Ga0495687_002397 | 3300047443 | Bacteria | 15119 |
| 656 | Ga0495687_060961 | 3300047443 | Bacteria | 1554 |
| 657 | Ga0495677_0041230 | 3300047445 | Bacteria | 1689 |
| 658 | Ga0495673_0088949 | 3300047469 | Bacteria | 1265 |
| 659 | Ga0495681_0018299 | 3300047470 | Bacteria | 3863 |
| 660 | Ga0495681_0026759 | 3300047470 | Bacteria | 2995 |
| 661 | Ga0495686_0077522 | 3300047472 | Bacteria | 2035 |
| 662 | Ga0495626_0179131 | 3300048091 | Bacteria | 879 |
| 663 | Ga0496100_0284405 | 3300048903 | Bacteria | 1234 |
| 664 | Ga0496101_0142979 | 3300048904 | Bacteria | 1825 |
| 665 | Ga0496102_0000213 | 3300048905 | Bacteria | 76751 |
| 666 | Ga0496102_0013947 | 3300048905 | Bacteria | 6975 |
| 667 | Ga0496102_0155087 | 3300048905 | Bacteria | 2153 |
| 668 | Ga0496102_0233622 | 3300048905 | Bacteria | 1733 |
| 669 | Ga0496102_0284691 | 3300048905 | Bacteria | 1558 |
| 670 | Ga0496102_0384891 | 3300048905 | Bacteria | 1320 |
| 671 | Ga0496103_0001102 | 3300048906 | Bacteria | 18819 |
| 672 | Ga0496103_0015441 | 3300048906 | Bacteria | 4544 |
| 673 | Ga0496103_0211328 | 3300048906 | Bacteria | 1248 |
| 674 | Ga0496104_0041322 | 3300048907 | Bacteria | 4324 |
| 675 | Ga0496104_0053309 | 3300048907 | Bacteria | 3820 |
| 676 | Ga0496105_0010188 | 3300048908 | Bacteria | 7386 |
| 677 | Ga0496105_0013563 | 3300048908 | Bacteria | 6473 |
| 678 | Ga0496106_0186999 | 3300048909 | Bacteria | 1646 |
| 679 | Ga0496107_0017579 | 3300048910 | Bacteria | 5030 |
| 680 | Ga0496107_0107364 | 3300048910 | Bacteria | 2051 |
| 681 | Ga0496108_0001490 | 3300048911 | Bacteria | 18506 |
| 682 | Ga0496108_0006149 | 3300048911 | Bacteria | 9711 |
| 683 | Ga0496108_0383643 | 3300048911 | Bacteria | 1227 |
| 684 | Ga0496108_0783865 | 3300048911 | Bacteria | 823 |
| 685 | Ga0496109_0000610 | 3300048912 | Bacteria | 29899 |
| 686 | Ga0496109_0003373 | 3300048912 | Bacteria | 13363 |
| 687 | Ga0496109_0160531 | 3300048912 | Bacteria | 2106 |
| 688 | Ga0496110_0040525 | 3300048913 | Bacteria | 4058 |
| 689 | Ga0496110_0047828 | 3300048913 | Bacteria | 3747 |
| 690 | Ga0496110_0165155 | 3300048913 | Bacteria | 2008 |
| 691 | Ga0496110_0297284 | 3300048913 | Bacteria | 1471 |
| 692 | Ga0496111_0019440 | 3300048914 | Bacteria | 4718 |
| 693 | Ga0496111_0020827 | 3300048914 | Bacteria | 4571 |
| 694 | Ga0496112_0016625 | 3300048915 | Bacteria | 6897 |
| 695 | Ga0496112_0036131 | 3300048915 | Bacteria | 4817 |
| 696 | Ga0496112_0327314 | 3300048915 | Bacteria | 1476 |
| 697 | Ga0496113_0001927 | 3300048916 | Bacteria | 11871 |
| 698 | Ga0496113_0011007 | 3300048916 | Bacteria | 6011 |
| 699 | Ga0496113_0099782 | 3300048916 | Bacteria | 2249 |
| 700 | Ga0496113_0279895 | 3300048916 | Bacteria | 1334 |
| 701 | Ga0496114_0057231 | 3300048917 | Bacteria | 3254 |
| 702 | Ga0496114_0064085 | 3300048917 | Bacteria | 3077 |
| 703 | Ga0496114_0186076 | 3300048917 | Bacteria | 1815 |
| 704 | Ga0496115_0000030 | 3300048918 | Bacteria | 138328 |
| 705 | Ga0496115_0019252 | 3300048918 | Bacteria | 5251 |
| 706 | Ga0496115_0054849 | 3300048918 | Bacteria | 3201 |
| 707 | Ga0496116_0004303 | 3300048919 | Bacteria | 13628 |
| 708 | Ga0496116_0013189 | 3300048919 | Bacteria | 6685 |
| 709 | Ga0496116_0034869 | 3300048919 | Bacteria | 3541 |
| 710 | Ga0496116_0103211 | 3300048919 | Bacteria | 1697 |
| 711 | Ga0496116_0128039 | 3300048919 | Bacteria | 1453 |
| 712 | Ga0496117_0001842 | 3300048920 | Bacteria | 28637 |
| 713 | Ga0496117_0018264 | 3300048920 | Bacteria | 5819 |
| 714 | Ga0496117_0024164 | 3300048920 | Bacteria | 4815 |
| 715 | Ga0496118_0000207 | 3300048921 | Bacteria | 102753 |
| 716 | Ga0496118_0003544 | 3300048921 | Bacteria | 19513 |
| 717 | Ga0496118_0126826 | 3300048921 | Bacteria | 1649 |
| 718 | Ga0496118_0143359 | 3300048921 | Bacteria | 1509 |
| 719 | Ga0496119_0020775 | 3300048922 | Bacteria | 4771 |
| 720 | Ga0496119_0050772 | 3300048922 | Bacteria | 2553 |
| 721 | Ga0496119_0088442 | 3300048922 | Bacteria | 1766 |
| 722 | Ga0496120_0002681 | 3300048923 | Bacteria | 17483 |
| 723 | Ga0496120_0023582 | 3300048923 | Bacteria | 3850 |
| 724 | Ga0496120_0134929 | 3300048923 | Bacteria | 1259 |
| 725 | Ga0496121_0001274 | 3300048924 | Bacteria | 43406 |
| 726 | Ga0496121_0004072 | 3300048924 | Bacteria | 20075 |
| 727 | Ga0496121_0081432 | 3300048924 | Bacteria | 2562 |
| 728 | Ga0496121_0185515 | 3300048924 | Bacteria | 1496 |
| 729 | Ga0496122_0013200 | 3300048925 | Bacteria | 8108 |
| 730 | Ga0496122_0020390 | 3300048925 | Bacteria | 5992 |
| 731 | Ga0496122_0031506 | 3300048925 | Bacteria | 4411 |
| 732 | Ga0496122_0052396 | 3300048925 | Bacteria | 3089 |
| 733 | Ga0496122_0053444 | 3300048925 | Bacteria | 3045 |
| 734 | Ga0496122_0069960 | 3300048925 | Bacteria | 2510 |
| 735 | Ga0496123_0008958 | 3300048926 | Bacteria | 9096 |
| 736 | Ga0496123_0039206 | 3300048926 | Bacteria | 3316 |
| 737 | Ga0496123_0043471 | 3300048926 | Bacteria | 3085 |
| 738 | Ga0496123_0127351 | 3300048926 | Bacteria | 1418 |
| 739 | Ga0496124_0001058 | 3300048927 | Bacteria | 43458 |
| 740 | Ga0496124_0009124 | 3300048927 | Bacteria | 10246 |
| 741 | Ga0496124_0010128 | 3300048927 | Bacteria | 9597 |
| 742 | Ga0496124_0059174 | 3300048927 | Bacteria | 3219 |
| 743 | Ga0496124_0078985 | 3300048927 | Bacteria | 2710 |
| 744 | Ga0496125_0001207 | 3300048928 | Bacteria | 38864 |
| 745 | Ga0496125_0005193 | 3300048928 | Bacteria | 14622 |
| 746 | Ga0496125_0011707 | 3300048928 | Bacteria | 8749 |
| 747 | Ga0496125_0061256 | 3300048928 | Bacteria | 3019 |
| 748 | Ga0496125_0134782 | 3300048928 | Bacteria | 1730 |
| 749 | Ga0496126_0001895 | 3300048929 | Bacteria | 30168 |
| 750 | Ga0496126_0064058 | 3300048929 | Bacteria | 3293 |
| 751 | Ga0496126_0101060 | 3300048929 | Bacteria | 2523 |
| 752 | Ga0496126_0426266 | 3300048929 | Bacteria | 1071 |
| 753 | Ga0495678_006569 | 3300049459 | Bacteria | 6167 |
| 754 | Ga0495678_025882 | 3300049459 | Bacteria | 2513 |
| 755 | Ga0495682_0038316 | 3300049460 | Bacteria | 1762 |
| 756 | Ga0501300_014461 | 3300049523 | Bacteria | 1151 |
| 757 | Ga0501031_0008288 | 3300049568 | Bacteria | 6760 |
| 758 | Ga0501031_0023956 | 3300049568 | Bacteria | 3980 |
| 759 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 760 | Ga0501032_0000017 | 3300049569 | Bacteria | 158303 |
| 761 | Ga0501032_0193969 | 3300049569 | Bacteria | 1327 |
| 762 | Ga0501033_0000029 | 3300049570 | Bacteria | 158294 |
| 763 | Ga0501033_0000830 | 3300049570 | Bacteria | 28206 |
| 764 | Ga0501033_0002867 | 3300049570 | Bacteria | 14451 |
| 765 | Ga0501033_0036868 | 3300049570 | Bacteria | 3662 |
| 766 | Ga0501033_0072134 | 3300049570 | Bacteria | 2536 |
| 767 | Ga0501033_0375415 | 3300049570 | Bacteria | 994 |
| 768 | Ga0501034_0000036 | 3300049571 | Bacteria | 239274 |
| 769 | Ga0501034_0000102 | 3300049571 | Bacteria | 158302 |
| 770 | Ga0501034_0015348 | 3300049571 | Bacteria | 7872 |
| 771 | Ga0501034_0071549 | 3300049571 | Bacteria | 3477 |
| 772 | Ga0501034_0162497 | 3300049571 | Bacteria | 2203 |
| 773 | Ga0501034_0186186 | 3300049571 | Bacteria | 2040 |
| 774 | Ga0501034_0201676 | 3300049571 | Bacteria | 1947 |
| 775 | Ga0501034_0237918 | 3300049571 | Bacteria | 1768 |
| 776 | Ga0501034_0284278 | 3300049571 | Bacteria | 1593 |
| 777 | Ga0501036_0000011 | 3300049572 | Bacteria | 158302 |
| 778 | Ga0501036_0000180 | 3300049572 | Bacteria | 41669 |
| 779 | Ga0501037_0000015 | 3300049573 | Bacteria | 161311 |
| 780 | Ga0501037_0000017 | 3300049573 | Bacteria | 157276 |
| 781 | Ga0501038_0000016 | 3300049574 | Bacteria | 159150 |
| 782 | Ga0501038_0000036 | 3300049574 | Bacteria | 124766 |
| 783 | Ga0501038_0016245 | 3300049574 | Bacteria | 6750 |
| 784 | Ga0501039_0000011 | 3300049575 | Bacteria | 245124 |
| 785 | Ga0501039_0000023 | 3300049575 | Bacteria | 158026 |
| 786 | Ga0501039_0185817 | 3300049575 | Bacteria | 1634 |
| 787 | Ga0501039_0412033 | 3300049575 | Bacteria | 1061 |
| 788 | Ga0501040_0004290 | 3300049576 | Bacteria | 9267 |
| 789 | Ga0501043_0000105 | 3300049579 | Bacteria | 78189 |
| 790 | Ga0501043_0000423 | 3300049579 | Bacteria | 38075 |
| 791 | Ga0501043_0161322 | 3300049579 | Bacteria | 1751 |
| 792 | Ga0501043_0168649 | 3300049579 | Bacteria | 1709 |
| 793 | Ga0501043_0254048 | 3300049579 | Bacteria | 1353 |
| 794 | Ga0501046_0038983 | 3300049580 | Bacteria | 3809 |
| 795 | Ga0501046_0049874 | 3300049580 | Bacteria | 3309 |
| 796 | Ga0501047_0002449 | 3300049581 | Bacteria | 17717 |
| 797 | Ga0501047_0027147 | 3300049581 | Bacteria | 5514 |
| 798 | Ga0501047_0061955 | 3300049581 | Bacteria | 3609 |
| 799 | Ga0501047_0150345 | 3300049581 | Bacteria | 2205 |
| 800 | Ga0501047_0173111 | 3300049581 | Bacteria | 2027 |
| 801 | Ga0501047_0702789 | 3300049581 | Bacteria | 828 |
| 802 | Ga0501048_0007590 | 3300049582 | Bacteria | 8224 |
| 803 | Ga0501067_0005711 | 3300049583 | Bacteria | 6906 |
| 804 | Ga0501067_0021763 | 3300049583 | Bacteria | 3548 |
| 805 | Ga0501067_0130046 | 3300049583 | Bacteria | 1401 |
| 806 | Ga0501068_0028598 | 3300049584 | Bacteria | 3297 |
| 807 | Ga0501069_0071079 | 3300049585 | Bacteria | 1950 |
| 808 | Ga0501069_0164579 | 3300049585 | Bacteria | 1278 |
| 809 | Ga0501070_0000648 | 3300049586 | Bacteria | 32010 |
| 810 | Ga0501070_0003968 | 3300049586 | Bacteria | 12731 |
| 811 | Ga0501070_0014269 | 3300049586 | Bacteria | 6687 |
| 812 | Ga0501070_0064322 | 3300049586 | Bacteria | 3038 |
| 813 | Ga0501070_0092448 | 3300049586 | Bacteria | 2504 |
| 814 | Ga0501073_0061124 | 3300049589 | Bacteria | 2629 |
| 815 | Ga0501073_0255943 | 3300049589 | Bacteria | 1208 |
| 816 | Ga0501077_0058762 | 3300049593 | Bacteria | 2441 |
| 817 | Ga0501080_0000711 | 3300049742 | Bacteria | 26756 |
| 818 | Ga0501080_0005920 | 3300049742 | Bacteria | 10953 |
| 819 | Ga0501080_0026665 | 3300049742 | Bacteria | 5369 |
| 820 | Ga0501083_0020004 | 3300049744 | Bacteria | 4658 |
| 821 | Ga0501280_005531 | 3300049776 | Bacteria | 1806 |
| 822 | Ga0501035_0000028 | 3300049822 | Bacteria | 179195 |
| 823 | Ga0501035_0000038 | 3300049822 | Bacteria | 158818 |
| 824 | Ga0501035_0004286 | 3300049822 | Bacteria | 13543 |
| 825 | Ga0501035_0004759 | 3300049822 | Bacteria | 12888 |
| 826 | Ga0501035_0028976 | 3300049822 | Bacteria | 5050 |
| 827 | Ga0501044_0000046 | 3300049823 | Bacteria | 146812 |
| 828 | Ga0501044_0015506 | 3300049823 | Bacteria | 8208 |
| 829 | Ga0501044_0029697 | 3300049823 | Bacteria | 5764 |
| 830 | Ga0501044_0037710 | 3300049823 | Bacteria | 5050 |
| 831 | Ga0501044_0060165 | 3300049823 | Bacteria | 3890 |
| 832 | nmdc:mga03n38_99417_c1 | 3300050490 | Bacteria | 1401 |
| 833 | nmdc:mga00v17_27_c1 | 3300050491 | Bacteria | 33804 |
| 834 | nmdc:mga0yw44_113987_c1 | 3300050492 | Bacteria | 1735 |
| 835 | nmdc:mga0yw44_359795_c1 | 3300050492 | Bacteria | 981 |
| 836 | nmdc:mga0yw44_94848_c1 | 3300050492 | Bacteria | 1892 |
| 837 | nmdc:mga0k408_517955_c1 | 3300050493 | Bacteria | 706 |
| 838 | nmdc:mga06z11_142342_c1 | 3300050494 | Bacteria | 1357 |
| 839 | nmdc:mga06z11_264878_c1 | 3300050494 | Bacteria | 1015 |
| 840 | nmdc:mga06z11_32902_c1 | 3300050494 | Bacteria | 2532 |
| 841 | nmdc:mga07m45_67034_c1 | 3300050496 | Bacteria | 2040 |
| 842 | nmdc:mga05p37_522229_c1 | 3300050507 | Bacteria | 1358 |
| 843 | nmdc:mga09592_586221_c1 | 3300050508 | Bacteria | 956 |
| 844 | nmdc:mga0rr50_29874_c1 | 3300050513 | Bacteria | 3850 |
| 845 | nmdc:mga0rr50_318165_c1 | 3300050513 | Bacteria | 1304 |
| 846 | nmdc:mga08x19_6_c2 | 3300050514 | Bacteria | 52011 |
| 847 | nmdc:mga0a205_7550_c1 | 3300050515 | Bacteria | 9853 |
| 848 | nmdc:mga0sz30_9974_c1 | 3300050516 | Bacteria | 3630 |
| 849 | Ga0500610_0000034 | 3300053079 | Bacteria | 49152 |
| 850 | Ga0500610_0010483 | 3300053079 | Bacteria | 4171 |
| 851 | Ga0500610_0039576 | 3300053079 | Bacteria | 2433 |
| 852 | Ga0500578_0041900 | 3300053086 | Bacteria | 2940 |
| 853 | Ga0500643_059263 | 3300053087 | Bacteria | 1078 |
| 854 | Ga0500569_014287 | 3300053109 | Bacteria | 1962 |
| 855 | Ga0500594_0001317 | 3300053118 | Bacteria | 5382 |
| 856 | Ga0500618_000222 | 3300053125 | Bacteria | 44764 |
| 857 | Ga0500618_038432 | 3300053125 | Bacteria | 1104 |
| 858 | Ga0500642_0005333 | 3300053130 | Bacteria | 4141 |
| 859 | Ga0500559_0010357 | 3300053136 | Bacteria | 4006 |
| 860 | Ga0500568_0000104 | 3300053139 | Bacteria | 78075 |
| 861 | Ga0500568_0000763 | 3300053139 | Bacteria | 22859 |
| 862 | Ga0500568_0000803 | 3300053139 | Bacteria | 22116 |
| 863 | Ga0500573_0008514 | 3300053140 | Bacteria | 5652 |
| 864 | Ga0500573_0171799 | 3300053140 | Bacteria | 1171 |
| 865 | Ga0500588_0044268 | 3300053146 | Bacteria | 1357 |
| 866 | Ga0500616_0000220 | 3300053153 | Bacteria | 89104 |
| 867 | Ga0500616_0001222 | 3300053153 | Bacteria | 25849 |
| 868 | Ga0500620_000357 | 3300053155 | Bacteria | 8508 |
| 869 | Ga0500627_0027408 | 3300053158 | Bacteria | 2358 |
| 870 | Ga0500634_0004310 | 3300053161 | Bacteria | 6552 |
| 871 | Ga0500611_006673 | 3300053727 | Bacteria | 1694 |
| 872 | Ga0500611_020911 | 3300053727 | Bacteria | 1242 |
| 873 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 874 | Ga0500645_028306 | 3300053730 | Bacteria | 1697 |
| 875 | Ga0501084_0062074 | 3300054114 | Bacteria | 3128 |
| 876 | Ga0501084_0089796 | 3300054114 | Bacteria | 2579 |
| 877 | Ga0501082_0042260 | 3300060353 | Bacteria | 3930 |
| 878 | Ga0501082_0063229 | 3300060353 | Bacteria | 3186 |
| 879 | Ga0501082_0107266 | 3300060353 | Bacteria | 2416 |
| 880 | Ga0466962_0121969 | 3300061719 | Bacteria | 1258 |
| 881 | Ga0466962_0188923 | 3300061719 | Bacteria | 1005 |
| 882 | 2503199587 | 2503198000 | Bacteria | 6884444 |
| 883 | 2509371029 | 2509276018 | Bacteria | 6910194 |
| 884 | 2509394513 | 2509276022 | Bacteria | 6200534 |
| 885 | 2510842070 | 2510461069 | Bacteria | 5505000 |
| 886 | 2511133790 | 2510917022 | Bacteria | 6504556 |
| 887 | 2512933008 | 2512875016 | Bacteria | 6529530 |
| 888 | 2512961032 | 2512875024 | Bacteria | 7195110 |
| 889 | 2513611221 | 2513237090 | Bacteria | 7096802 |
| 890 | 2513929163 | 2513237146 | Bacteria | 7166346 |
| 891 | 2514035114 | 2513237164 | Bacteria | 7563725 |
| 892 | 2514417210 | 2513237305 | Bacteria | 7293571 |
| 893 | 2514587159 | 2513237351 | Bacteria | 6968952 |
| 894 | 2561466976 | 2558860983 | Bacteria | 4133860 |
| 895 | 2585167823 | 2582581283 | Bacteria | 6030556 |
| 896 | 2585228842 | 2582581299 | Bacteria | 6518058 |
| 897 | 2585257505 | 2582581304 | Bacteria | 5831370 |
| 898 | 2585271508 | 2582581307 | Bacteria | 6597605 |
| 899 | 2585280573 | 2582581308 | Bacteria | 7413247 |
| 900 | 2585327938 | 2582581315 | Bacteria | 7318924 |
| 901 | 2585334309 | 2582581316 | Bacteria | 7774528 |
| 902 | 2585531511 | 2585427527 | Bacteria | 7273426 |
| 903 | 2585551575 | 2585427530 | Bacteria | 7383882 |
| 904 | 2585563252 | 2585427531 | Bacteria | 6992870 |
| 905 | 2585844794 | 2585427594 | Bacteria | 6180594 |
| 906 | 2585907470 | 2585427609 | Bacteria | 6667127 |
| 907 | 2587982536 | 2585428125 | Bacteria | 6662905 |
| 908 | 2588519062 | 2588253730 | Bacteria | 6881675 |
| 909 | 2597811384 | 2597489875 | Bacteria | 7010078 |
| 910 | 2599420342 | 2599185170 | Bacteria | 7295545 |
| 911 | 2599939080 | 2599185301 | Bacteria | 6161860 |
| 912 | 2616296470 | 2615840624 | Bacteria | 6557588 |
| 913 | 2616306881 | 2615840626 | Bacteria | 7921970 |
| 914 | 2616557739 | 2615840698 | Bacteria | 7319877 |
| 915 | 2617384988 | 2617270742 | Bacteria | 6808054 |
| 916 | 2643771408 | 2643221550 | Bacteria | 4619371 |
| 917 | 2643776932 | 2643221551 | Bacteria | 3750538 |
| 918 | 2643795380 | 2643221555 | Bacteria | 3749717 |
| 919 | 2643813613 | 2643221558 | Bacteria | 5460675 |
| 920 | 2643836899 | 2643221564 | Bacteria | 4193379 |
| 921 | 2643986100 | 2643221595 | Bacteria | 6565519 |
| 922 | 2644050883 | 2643221607 | Bacteria | 6314006 |
| 923 | 2644153665 | 2643221627 | Bacteria | 6761570 |
| 924 | 2644205386 | 2643221636 | Bacteria | 6583769 |
| 925 | 2644210053 | 2643221637 | Bacteria | 5345260 |
| 926 | 2644240693 | 2643221643 | Bacteria | 5749658 |
| 927 | 2644300027 | 2643221653 | Bacteria | 4569637 |
| 928 | 2644483787 | 2643221686 | Bacteria | 6310811 |
| 929 | 2644496091 | 2643221688 | Bacteria | 5260751 |
| 930 | 2644653604 | 2643221718 | Bacteria | 5345506 |
| 931 | 2644658253 | 2643221719 | Bacteria | 4568197 |
| 932 | 2671113625 | 2667528174 | Bacteria | 6435400 |
| 933 | 2688596837 | 2687453392 | Bacteria | 6880454 |
| 934 | 2694634243 | 2693429783 | Bacteria | 7019804 |
| 935 | 2694637982 | 2693429784 | Bacteria | 7241525 |
| 936 | 2723573957 | 2721755686 | Bacteria | 7343952 |
| 937 | 2738805347 | 2738541293 | Bacteria | 7065685 |
| 938 | 2756677370 | 2756170246 | Bacteria | 7451806 |
| 939 | 2776270077 | 2775506902 | Bacteria | 6208009 |
| 940 | 2776915319 | 2775507049 | Bacteria | 6284736 |
| 941 | 2778173578 | 2775507266 | Bacteria | 7392367 |
| 942 | 2792748412 | 2791355123 | Bacteria | 8049106 |
| 943 | 2819243641 | 2818991272 | Bacteria | 4622173 |
| 944 | 2819638974 | 2818991453 | Bacteria | 7181617 |
| 945 | 2838030785 | 2838029111 | Bacteria | 6603031 |
| 946 | 2838040550 | 2838035591 | Bacteria | 7166484 |
| 947 | 2838668453 | 2838661181 | Bacteria | 7385261 |
| 948 | 2839997920 | 2839993093 | Bacteria | 5512535 |
| 949 | 2841737324 | 2841734538 | Bacteria | 6784580 |
| 950 | 2842477517 | 2842475841 | Bacteria | 6603183 |
| 951 | 2842488083 | 2842482326 | Bacteria | 7212537 |
| 952 | 2842504610 | 2842502639 | Bacteria | 6604161 |
| 953 | 2844009139 | 2844002411 | Bacteria | 7168230 |
| 954 | 2847674601 | 2847670302 | Bacteria | 6165597 |
| 955 | 2847690718 | 2847686936 | Bacteria | 6278406 |
| 956 | 2854896986 | 2854896431 | Bacteria | 5869725 |
| 957 | 2854917135 | 2854916844 | Bacteria | 5725939 |
| 958 | 2856317513 | 2856314179 | Bacteria | 6477897 |
| 959 | 2856322667 | 2856320880 | Bacteria | 7263508 |
| 960 | 2856328862 | 2856328259 | Bacteria | 6528202 |
| 961 | 2856343870 | 2856342000 | Bacteria | 7176905 |
| 962 | 2856350387 | 2856349417 | Bacteria | 6230045 |
| 963 | 2856366703 | 2856364286 | Bacteria | 6939991 |
| 964 | 2857356612 | 2857349434 | Bacteria | 7926032 |
| 965 | 2869165143 | 2869162929 | Bacteria | 6399702 |
| 966 | 2869258953 | 2869256925 | Bacteria | 6981691 |
| 967 | 2869285815 | 2869278585 | Bacteria | 7077053 |
| 968 | 2869287886 | 2869285874 | Bacteria | 6901219 |
| 969 | 2871435834 | 2871429161 | Bacteria | 6547891 |
| 970 | 2871448671 | 2871444079 | Bacteria | 6423508 |
| 971 | 2871465677 | 2871459585 | Bacteria | 6866887 |
| 972 | 2871471762 | 2871466892 | Bacteria | 6923287 |
| 973 | 2871479385 | 2871474448 | Bacteria | 6806570 |
| 974 | 2871489893 | 2871488783 | Bacteria | 6929816 |
| 975 | 2871498007 | 2871495908 | Bacteria | 6935695 |
| 976 | 2874104840 | 2874102143 | Bacteria | 6342645 |
| 977 | 2874111127 | 2874109183 | Bacteria | 6517025 |
| 978 | 2874128801 | 2874123672 | Bacteria | 7238285 |
| 979 | 2874141871 | 2874139085 | Bacteria | 7021506 |
| 980 | 2874151519 | 2874146452 | Bacteria | 7533118 |
| 981 | 2874159151 | 2874155637 | Bacteria | 6724144 |
| 982 | 2874167592 | 2874162495 | Bacteria | 6174670 |
| 983 | 2874175702 | 2874168670 | Bacteria | 8062617 |
| 984 | 2876364744 | 2876363079 | Bacteria | 6544991 |
| 985 | 2876370394 | 2876369609 | Bacteria | 6807521 |
| 986 | 2876396201 | 2876392853 | Bacteria | 6660880 |
| 987 | 2876405898 | 2876399893 | Bacteria | 6927900 |
| 988 | 2876417570 | 2876413966 | Bacteria | 6831344 |
| 989 | 2876426103 | 2876420981 | Bacteria | 6687741 |
| 990 | 2878038551 | 2878035449 | Bacteria | 6555736 |
| 991 | 2878739390 | 2878738818 | Bacteria | 7136951 |
| 992 | 2878749397 | 2878745973 | Bacteria | 6867388 |
| 993 | 2878754423 | 2878753008 | Bacteria | 6922523 |
| 994 | 2878762229 | 2878760144 | Bacteria | 6823465 |
| 995 | 2878769196 | 2878767105 | Bacteria | 6898628 |
| 996 | 2878794254 | 2878788777 | Bacteria | 6567085 |
| 997 | 2881149408 | 2881147464 | Bacteria | 7779814 |
| 998 | 2881160616 | 2881155292 | Bacteria | 6461656 |
| 999 | 2881166310 | 2881161766 | Bacteria | 7127907 |
| 1000 | 2881848364 | 2881845957 | Bacteria | 6611900 |
| 1001 | 2881861629 | 2881861095 | Bacteria | 7128710 |
| 1002 | 2882634081 | 2882632389 | Bacteria | 8154593 |
| 1003 | 2882919357 | 2882912400 | Bacteria | 6801539 |
| 1004 | 2885307738 | 2885305155 | Bacteria | 7348390 |
| 1005 | 2885313266 | 2885312484 | Bacteria | 6415165 |
| 1006 | 2885321656 | 2885318864 | Bacteria | 6729568 |
| 1007 | 2885327080 | 2885326080 | Bacteria | 7134805 |
| 1008 | 2885338424 | 2885334103 | Bacteria | 7216818 |
| 1009 | 2885343322 | 2885342637 | Bacteria | 7011821 |
| 1010 | 2885354165 | 2885350715 | Bacteria | 6787678 |
| 1011 | 2888337956 | 2888337043 | Bacteria | 6629336 |
| 1012 | 2888345257 | 2888343758 | Bacteria | 6611049 |
| 1013 | 2888354547 | 2888350351 | Bacteria | 7372807 |
| 1014 | 2889016151 | 2889010040 | Bacteria | 6749192 |
| 1015 | 2889018808 | 2889016732 | Bacteria | 6700763 |
| 1016 | 2891088939 | 2891088606 | Bacteria | 4762464 |
| 1017 | 2903449270 | 2903448605 | Bacteria | 7357801 |
| 1018 | 2903493628 | 2903492973 | Bacteria | 13473544 |
| 1019 | 2903497628 | 2903492973 | Bacteria | 13473544 |
| 1020 | 2903522520 | 2903521522 | Bacteria | 6525694 |
| 1021 | 2903528899 | 2903528002 | Bacteria | 6586099 |
| 1022 | 2903542805 | 2903540706 | Bacteria | 7062119 |
| 1023 | 2904580425 | 2904578770 | Bacteria | 5302906 |
| 1024 | 2904662977 | 2904659560 | Bacteria | 6685615 |
| 1025 | 2906310435 | 2906308376 | Bacteria | 6841989 |
| 1026 | 2906324500 | 2906321335 | Bacteria | 6579571 |
| 1027 | 2906333299 | 2906328253 | Bacteria | 6585166 |
| 1028 | 2906355140 | 2906354277 | Bacteria | 6991324 |
| 1029 | 2906364314 | 2906363423 | Bacteria | 6856682 |
| 1030 | 2906375090 | 2906370794 | Bacteria | 6881062 |
| 1031 | 2906385269 | 2906378014 | Bacteria | 6911440 |
| 1032 | 2906405645 | 2906401398 | Bacteria | 6693206 |
| 1033 | 2906417578 | 2906414383 | Bacteria | 6580790 |
| 1034 | 2919119900 | 2919119836 | Bacteria | 5208557 |
| 1035 | 2919410916 | 2919408235 | Bacteria | 6149349 |
| 1036 | 2922152114 | 2922151315 | Bacteria | 6902399 |
| 1037 | 2922173313 | 2922172374 | Bacteria | 6167644 |
| 1038 | 2924725920 | 2924718760 | Bacteria | 6331356 |
| 1039 | 2924731976 | 2924726620 | Bacteria | 6271473 |
| 1040 | 2924751282 | 2924748358 | Bacteria | 6154725 |
| 1041 | 2924757025 | 2924754689 | Bacteria | 6774424 |
| 1042 | 2924769302 | 2924762789 | Bacteria | 6561353 |
| 1043 | 2924776911 | 2924776078 | Bacteria | 7492003 |
| 1044 | 2924790189 | 2924784321 | Bacteria | 7416538 |
| 1045 | 2933022850 | 2933016740 | Bacteria | 6355406 |
| 1046 | 2937817263 | 2937813078 | Bacteria | 7783518 |
| 1047 | 2937825785 | 2937822353 | Bacteria | 7290551 |
| 1048 | 2937837560 | 2937836603 | Bacteria | 6811263 |
| 1049 | 2937855449 | 2937848649 | Bacteria | 6983481 |
| 1050 | 2937883489 | 2937877337 | Bacteria | 7246526 |
| 1051 | 2937896670 | 2937891427 | Bacteria | 6357007 |
| 1052 | 2937973532 | 2937972304 | Bacteria | 7532020 |
| 1053 | 2937996656 | 2937994558 | Bacteria | 7036190 |
| 1054 | 2938018529 | 2938014810 | Bacteria | 6700592 |
| 1055 | 2958041831 | 2958034702 | Bacteria | 6989922 |
| 1056 | 2958050362 | 2958041894 | Bacteria | 13082850 |
| 1057 | 2958051306 | 2958041894 | Bacteria | 13082850 |
| 1058 | 2958070086 | 2958064165 | Bacteria | 7158582 |
| 1059 | 2958073623 | 2958071322 | Bacteria | 6815895 |
| 1060 | 2958090656 | 2958084443 | Bacteria | 7312792 |
| 1061 | 2958097384 | 2958092219 | Bacteria | 6861151 |
| 1062 | 2958108050 | 2958100919 | Bacteria | 6800575 |
| 1063 | 2958116131 | 2958115193 | Bacteria | 6923548 |
| 1064 | 2958125330 | 2958122699 | Bacteria | 7280457 |
| 1065 | 2958132290 | 2958130278 | Bacteria | 6897202 |
| 1066 | 2958167127 | 2958165035 | Bacteria | 6906348 |
| 1067 | 2958177118 | 2958172287 | Bacteria | 6716688 |
| 1068 | 2958182104 | 2958179912 | Bacteria | 6874908 |
| 1069 | 2961079948 | 2961077736 | Bacteria | 7079850 |
| 1070 | 2961118003 | 2961114664 | Bacteria | 6680456 |
| 1071 | 2961132403 | 2961127735 | Bacteria | 7196641 |
| 1072 | 2961142377 | 2961136820 | Bacteria | 6775228 |
| 1073 | 2961165596 | 2961163497 | Bacteria | 6901077 |
| 1074 | 2961171853 | 2961170736 | Bacteria | 7072258 |
| 1075 | 2961184867 | 2961183825 | Bacteria | 6688536 |
| 1076 | 2963646200 | 2963644680 | Bacteria | 6530403 |
| 1077 | 2965020419 | 2965018300 | Bacteria | 6883036 |
| 1078 | 2965025664 | 2965025482 | Bacteria | 6532201 |
| 1079 | 2965047216 | 2965040258 | Bacteria | 6855979 |
| 1080 | 2965052914 | 2965047637 | Bacteria | 6623551 |
| 1081 | 2965092227 | 2965089291 | Bacteria | 6866420 |
| 1082 | 2965104429 | 2965102966 | Bacteria | 6800987 |
| 1083 | 2967996960 | 2967996073 | Bacteria | 6787468 |
| 1084 | 2968005021 | 2968003550 | Bacteria | 6929263 |
| 1085 | 2968016672 | 2968016561 | Bacteria | 7022047 |
| 1086 | 2968085333 | 2968083720 | Bacteria | 7351627 |
| 1087 | 2968091452 | 2968091066 | Bacteria | 6052692 |
| 1088 | 2968101991 | 2968097103 | Bacteria | 6107094 |
| 1089 | 2968114064 | 2968110612 | Bacteria | 6814636 |
| 1090 | 2968123255 | 2968117919 | Bacteria | 6536078 |
| 1091 | 2968129074 | 2968128360 | Bacteria | 6270294 |
| 1092 | 2968173998 | 2968171901 | Bacteria | 6894245 |
| 1093 | 2970470014 | 2970469710 | Bacteria | 6969209 |
| 1094 | 2970492608 | 2970489779 | Bacteria | 6517260 |
| 1095 | 2970504451 | 2970503327 | Bacteria | 7099517 |
| 1096 | 2970515192 | 2970510686 | Bacteria | 7006402 |
| 1097 | 2970526969 | 2970524798 | Bacteria | 6840927 |
| 1098 | 2970543151 | 2970540015 | Bacteria | 6977556 |
| 1099 | 2970557084 | 2970554993 | Bacteria | 6814252 |
| 1100 | 2970600432 | 2970593180 | Bacteria | 7073582 |
| 1101 | 2970633215 | 2970627176 | Bacteria | 6680862 |
| 1102 | 2977823640 | 2977821940 | Bacteria | 6906439 |
| 1103 | 2977831509 | 2977828996 | Bacteria | 7007971 |
| 1104 | 2977847552 | 2977843712 | Bacteria | 6753583 |
| 1105 | 2977856339 | 2977851361 | Bacteria | 6694324 |
| 1106 | 2977871031 | 2977864932 | Bacteria | 7534097 |
| 1107 | 2977899836 | 2977898635 | Bacteria | 6675551 |
| 1108 | 2977916456 | 2977915119 | Bacteria | 6829656 |
| 1109 | 2977928843 | 2977922695 | Bacteria | 6956781 |
| 1110 | 2977940511 | 2977935797 | Bacteria | 6252826 |
| 1111 | 2977943056 | 2977942078 | Bacteria | 7570577 |
| 1112 | 2977952228 | 2977950692 | Bacteria | 6893264 |
| 1113 | 2977991808 | 2977986579 | Bacteria | 6581278 |
| 1114 | 2979771952 | 2979764755 | Bacteria | 6610066 |
| 1115 | 2979776055 | 2979772303 | Bacteria | 6618277 |
| 1116 | 2979796464 | 2979793036 | Bacteria | 6808957 |
| 1117 | 2979809088 | 2979808191 | Bacteria | 7179355 |
| 1118 | 2987643892 | 2987636660 | Bacteria | 8088555 |
| 1119 | 2987657336 | 2987652177 | Bacteria | 6969023 |
| 1120 | 2987661604 | 2987659509 | Bacteria | 6966464 |
| 1121 | 2987672478 | 2987666974 | Bacteria | 6509233 |
| 1122 | 2989779915 | 2989776772 | Bacteria | 4843317 |
| 1123 | 2996315709 | 2996310559 | Bacteria | 6357320 |
| 1124 | 2996341312 | 2996336353 | Bacteria | 5511628 |
| 1125 | 2996347811 | 2996341866 | Bacteria | 6643098 |
| 1126 | 2996389675 | 2996386984 | Bacteria | 6978667 |
| 1127 | 3000141341 | 3000135777 | Bacteria | 6891109 |
| 1128 | 3003930825 | 3003930520 | Bacteria | 5667563 |
| 1129 | 3004174348 | 3004167301 | Bacteria | 8330599 |
| 1130 | 3004190653 | 3004188549 | Bacteria | 6952365 |
| 1131 | 3004208041 | 3004203850 | Bacteria | 7307914 |
| 1132 | 3004211488 | 3004211236 | Bacteria | 7417683 |
| 1133 | 3004224963 | 3004218560 | Bacteria | 7421728 |
| 1134 | 3004243382 | 3004239961 | Bacteria | 6892290 |
| 1135 | 3004253316 | 3004248173 | Bacteria | 6563236 |
| 1136 | 3004279739 | 3004275668 | Bacteria | 7114440 |
| 1137 | 3004336222 | 3004334049 | Bacteria | 8449246 |
| 1138 | 3005421782 | 3005416602 | Bacteria | 7064308 |
| 1139 | 637076090 | 637000159 | Bacteria | 7596297 |
| 1140 | 649871396 | 649633066 | Bacteria | 6690028 |
| 1141 | 8002290203 | 8002285264 | Bacteria | 6717907 |
| 1142 | 8004301346 | 8004300914 | Bacteria | 6132239 |
| 1143 | 8004315095 | 8004312739 | Bacteria | 7444653 |
| 1144 | 8004365989 | 8004361976 | Bacteria | 6858373 |
| 1145 | 8004375999 | 8004374579 | Bacteria | 6898112 |
| 1146 | 8004389674 | 8004387939 | Bacteria | 7049250 |
| 1147 | 8004448754 | 8004445564 | Bacteria | 6322258 |
| 1148 | 8004637980 | 8004633249 | Bacteria | 6723080 |
| 1149 | 8004645526 | 8004640170 | Bacteria | 6723001 |
| 1150 | 8004703339 | 8004695233 | Bacteria | 6731676 |
| 1151 | 8004704496 | 8004703790 | Bacteria | 8006957 |
| 1152 | 8004718071 | 8004714634 | Bacteria | 6776161 |
| 1153 | 8004732929 | 8004727605 | Bacteria | 6643904 |
| 1154 | 8005249074 | 8005246636 | Bacteria | 4933972 |
| 1155 | 8005319518 | 8005314921 | Bacteria | 7072929 |
| 1156 | 8005660670 | 8005658619 | Bacteria | 4500593 |
| 1157 | 8018154529 | 8018150411 | Bacteria | 5549903 |
| 1158 | 8054561343 | 8054558443 | Bacteria | 5204801 |
| 1159 | 8055435704 | 8055431914 | Bacteria | 4551896 |
| 1160 | 8055618818 | 8055617313 | Bacteria | 7548464 |
| 1161 | Ga0395905_0318678 | |||
| 1162 | RicEn_C5921 | |||
| 1163 | JGI24741J21665_1003543 | |||
| 1164 | JGI24740J21852_10000006 | |||
| 1165 | JGI24739J22299_10025850 | |||
| 1166 | JGI24739J22299_10052293 | |||
| 1167 | JGI24739J22299_10080030 | |||
| 1168 | JGI24737J22298_10001726 | |||
| 1169 | JGI24737J22298_10004925 | |||
| 1170 | JGI24737J22298_10020449 | |||
| 1171 | JGI24743J22301_10035122 | |||
| 1172 | JGI24735J21928_10033604 | |||
| 1173 | JGI24742J22300_10019233 | |||
| 1174 | JGI25155J39150_1000010 | |||
| 1175 | JGI25156J39149_1000033 | |||
| 1176 | JGI25156J39149_1014201 | |||
| 1177 | JGI25162J39368_1000413 | |||
| 1178 | JGI25162J39368_1000646 | |||
| 1179 | JGI25154J39366_1000058 | |||
| 1180 | JGI25157J39369_1000009 | |||
| 1181 | JGI25157J39369_1001464 | |||
| 1182 | JGI25150J39212_1000166 | |||
| 1183 | JGI25151J46595_10000081 | |||
| 1184 | JGI25165J46597_1000097 | |||
| 1185 | JGI25165J46597_1000675 | |||
| 1186 | JGI25165J46597_1001401 | |||
| 1187 | JGI25165J46597_1001441 | |||
| 1188 | JGI25165J46597_1002500 | |||
| 1189 | JGI25153J46596_10000008 | |||
| 1190 | JGI25153J46596_10003148 | |||
| 1191 | rootH1_10140883 | |||
| 1192 | rootL2_10138524 | |||
| 1193 | rootH1_10121837 | |||
| 1194 | Ga0055539_1006346 | |||
| 1195 | Ga0055542_1000123 | |||
| 1196 | Ga0055529_1000144 | |||
| 1197 | Ga0065704_10183305 | |||
| 1198 | Ga0065712_10008678 | |||
| 1199 | Ga0070658_10003269 | |||
| 1200 | Ga0070658_10141962 | |||
| 1201 | Ga0070676_10031441 | |||
| 1202 | Ga0070676_10113824 | |||
| 1203 | Ga0070683_100644696 | |||
| 1204 | Ga0070690_100011455 | |||
| 1205 | Ga0070670_100010583 | |||
| 1206 | Ga0070670_100074557 | |||
| 1207 | Ga0070670_100204467 | |||
| 1208 | Ga0070670_100399818 | |||
| 1209 | Ga0070677_10001076 | |||
| 1210 | Ga0070677_10026674 | |||
| 1211 | Ga0068869_100026860 | |||
| 1212 | Ga0068869_100299851 | |||
| 1213 | Ga0070666_10002899 | |||
| 1214 | Ga0070666_10524253 | |||
| 1215 | Ga0070682_100307571 | |||
| 1216 | Ga0068868_100011585 | |||
| 1217 | Ga0068868_100425065 | |||
| 1218 | Ga0068868_100478097 | |||
| 1219 | Ga0070661_100012880 | |||
| 1220 | Ga0070661_100039558 | |||
| 1221 | Ga0070692_10050949 | |||
| 1222 | Ga0070668_100030234 | |||
| 1223 | Ga0070668_100059247 | |||
| 1224 | Ga0070669_100005417 | |||
| 1225 | Ga0070669_100049531 | |||
| 1226 | Ga0070669_100056071 | |||
| 1227 | Ga0070669_100381921 | |||
| 1228 | Ga0070669_100436731 | |||
| 1229 | Ga0070675_100005433 | |||
| 1230 | Ga0070675_100037001 | |||
| 1231 | Ga0070675_100152567 | |||
| 1232 | Ga0070675_100175280 | |||
| 1233 | Ga0070675_100310767 | |||
| 1234 | Ga0070671_100005295 | |||
| 1235 | Ga0070671_100009924 | |||
| 1236 | Ga0070671_100024555 | |||
| 1237 | Ga0070671_100028395 | |||
| 1238 | Ga0070671_100240221 | |||
| 1239 | Ga0070674_100014493 | |||
| 1240 | Ga0070674_100041864 | |||
| 1241 | Ga0070674_100148318 | |||
| 1242 | Ga0070674_100508300 | |||
| 1243 | Ga0070673_100034647 | |||
| 1244 | Ga0070673_100050071 | |||
| 1245 | Ga0070673_100083991 | |||
| 1246 | Ga0070673_100331811 | |||
| 1247 | Ga0070673_100379125 | |||
| 1248 | Ga0070659_100004654 | |||
| 1249 | Ga0070659_100028961 | |||
| 1250 | Ga0070659_100055660 | |||
| 1251 | Ga0070659_100135040 | |||
| 1252 | Ga0070667_100005560 | |||
| 1253 | Ga0070667_100017654 | |||
| 1254 | Ga0070667_100018150 | |||
| 1255 | Ga0070667_100056729 | |||
| 1256 | Ga0070667_100062434 | |||
| 1257 | Ga0070667_100071107 | |||
| 1258 | Ga0070667_100095811 | |||
| 1259 | Ga0070667_100129169 | |||
| 1260 | Ga0070667_100155926 | |||
| 1261 | Ga0070667_100287336 | |||
| 1262 | Ga0070714_100133587 | |||
| 1263 | Ga0070713_100092861 | |||
| 1264 | Ga0070705_100079635 | |||
| 1265 | Ga0070663_100069716 | |||
| 1266 | Ga0070663_100099838 | |||
| 1267 | Ga0070678_100000901 | |||
| 1268 | Ga0070662_100037539 | |||
| 1269 | Ga0070662_100448486 | |||
| 1270 | Ga0070662_100495417 | |||
| 1271 | Ga0068867_100053580 | |||
| 1272 | Ga0068867_100087387 | |||
| 1273 | Ga0070679_100055115 | |||
| 1274 | Ga0070684_100202339 | |||
| 1275 | Ga0070697_100001531 | |||
| 1276 | Ga0068853_100087401 | |||
| 1277 | Ga0068853_100127554 | |||
| 1278 | Ga0068853_100546278 | |||
| 1279 | Ga0068853_100581646 | |||
| 1280 | Ga0070672_100318414 | |||
| 1281 | Ga0070686_100282852 | |||
| 1282 | Ga0070695_100010886 | |||
| 1283 | Ga0070695_100395612 | |||
| 1284 | Ga0070696_100009165 | |||
| 1285 | Ga0070696_100041707 | |||
| 1286 | Ga0070696_100054006 | |||
| 1287 | Ga0070696_100263276 | |||
| 1288 | Ga0070693_100040246 | |||
| 1289 | Ga0070693_100108707 | |||
| 1290 | Ga0070665_100080183 | |||
| 1291 | Ga0070665_100101576 | |||
| 1292 | Ga0070665_100192191 | |||
| 1293 | Ga0070665_100249296 | |||
| 1294 | Ga0070665_100356412 | |||
| 1295 | Ga0068855_100146159 | |||
| 1296 | Ga0068855_100147657 | |||
| 1297 | Ga0068855_100173080 | |||
| 1298 | Ga0068855_100485287 | |||
| 1299 | Ga0070664_100023466 | |||
| 1300 | Ga0070664_100232017 | |||
| 1301 | Ga0070664_100311833 | |||
| 1302 | Ga0068857_100106305 | |||
| 1303 | Ga0068854_100093561 | |||
| 1304 | Ga0068854_100128742 | |||
| 1305 | Ga0068856_100238705 | |||
| 1306 | Ga0068852_100161447 | |||
| 1307 | Ga0068852_100470900 | |||
| 1308 | Ga0068859_100000685 | |||
| 1309 | Ga0068859_100046027 | |||
| 1310 | Ga0068864_100000847 | |||
| 1311 | Ga0068864_100001619 | |||
| 1312 | Ga0068866_10021852 | |||
| 1313 | Ga0068870_10052762 | |||
| 1314 | Ga0068863_100005917 | |||
| 1315 | Ga0068863_100052330 | |||
| 1316 | Ga0068863_100095885 | |||
| 1317 | Ga0068863_100133522 | |||
| 1318 | Ga0068863_100155976 | |||
| 1319 | Ga0068858_100006170 | |||
| 1320 | Ga0068858_100030883 | |||
| 1321 | Ga0068858_100482192 | |||
| 1322 | Ga0068860_100001106 | |||
| 1323 | Ga0068860_100006941 | |||
| 1324 | Ga0068860_100027872 | |||
| 1325 | Ga0068860_100081827 | |||
| 1326 | Ga0068860_100102330 | |||
| 1327 | Ga0068862_100004852 | |||
| 1328 | Ga0068862_100011830 | |||
| 1329 | Ga0068862_100041557 | |||
| 1330 | Ga0068862_100049303 | |||
| 1331 | Ga0068862_100086978 | |||
| 1332 | Ga0068862_100166522 | |||
| 1333 | Ga0068862_100512584 | |||
| 1334 | Ga0081455_10143058 | |||
| 1335 | Ga0081538_10015965 | |||
| 1336 | Ga0075365_10260490 | |||
| 1337 | Ga0075364_10000227 | |||
| 1338 | Ga0075364_10067821 | |||
| 1339 | Ga0075364_10115870 | |||
| 1340 | Ga0070716_100038151 | |||
| 1341 | Ga0070712_100092581 | |||
| 1342 | Ga0075367_10009415 | |||
| 1343 | Ga0075367_10019717 | |||
| 1344 | Ga0075367_10309154 | |||
| 1345 | Ga0075367_10309781 | |||
| 1346 | Ga0075369_10006505 | |||
| 1347 | Ga0097621_100122909 | |||
| 1348 | Ga0097621_100306773 | |||
| 1349 | Ga0097621_100673083 | |||
| 1350 | Ga0075370_10025171 | |||
| 1351 | Ga0068871_100050133 | |||
| 1352 | Ga0068871_100070168 | |||
| 1353 | Ga0068871_100242357 | |||
| 1354 | Ga0075433_10022199 | |||
| 1355 | Ga0075434_100374441 | |||
| 1356 | Ga0075429_100129756 | |||
| 1357 | Ga0068865_100013945 | |||
| 1358 | Ga0068865_100632231 | |||
| 1359 | Ga0075436_100002374 | |||
| 1360 | Ga0097620_100000685 | |||
| 1361 | Ga0097620_100046027 | |||
| 1362 | Ga0075435_100059435 | |||
| 1363 | Ga0105244_10051045 | |||
| 1364 | Ga0105250_10011311 | |||
| 1365 | Ga0105240_10000013 | |||
| 1366 | Ga0105240_10074658 | |||
| 1367 | Ga0105240_10301034 | |||
| 1368 | Ga0105240_10362089 | |||
| 1369 | Ga0111539_10010849 | |||
| 1370 | Ga0105245_10260059 | |||
| 1371 | Ga0105243_10000551 | |||
| 1372 | Ga0105243_10016104 | |||
| 1373 | Ga0105241_10001717 | |||
| 1374 | Ga0105241_10119740 | |||
| 1375 | Ga0105241_10165877 | |||
| 1376 | Ga0105241_10546275 | |||
| 1377 | Ga0105248_10001290 | |||
| 1378 | Ga0105248_10002158 | |||
| 1379 | Ga0105248_10010453 | |||
| 1380 | Ga0105248_10010504 | |||
| 1381 | Ga0105248_10161135 | |||
| 1382 | Ga0105248_10321561 | |||
| 1383 | Ga0105248_10376838 | |||
| 1384 | Ga0105237_10000714 | |||
| 1385 | Ga0105237_10012745 | |||
| 1386 | Ga0105237_10438365 | |||
| 1387 | Ga0105238_10152773 | |||
| 1388 | Ga0105238_10159207 | |||
| 1389 | Ga0105249_10004218 | |||
| 1390 | Ga0105249_10007828 | |||
| 1391 | Ga0105249_10085844 | |||
| 1392 | Ga0105239_10002271 | |||
| 1393 | Ga0105239_10054540 | |||
| 1394 | Ga0105239_10120300 | |||
| 1395 | Ga0105239_10258223 | |||
| 1396 | Ga0157326_1004805 | |||
| 1397 | Ga0157373_10182545 | |||
| 1398 | Ga0157373_10283485 | |||
| 1399 | Ga0157373_10356148 | |||
| 1400 | Ga0157371_10000138 | |||
| 1401 | Ga0157370_10000209 | |||
| 1402 | Ga0157370_10066706 | |||
| 1403 | Ga0157370_10289017 | |||
| 1404 | Ga0157370_10685766 | |||
| 1405 | Ga0157370_10774647 | |||
| 1406 | Ga0157369_10058538 | |||
| 1407 | Ga0157369_10131905 | |||
| 1408 | Ga0157369_10142769 | |||
| 1409 | Ga0157374_10101520 | |||
| 1410 | Ga0157374_10150216 | |||
| 1411 | Ga0163162_10037700 | |||
| 1412 | Ga0163162_10055061 | |||
| 1413 | Ga0163162_10426281 | |||
| 1414 | Ga0163162_10689834 | |||
| 1415 | Ga0157372_10274365 | |||
| 1416 | Ga0157372_10947099 | |||
| 1417 | Ga0157375_10011059 | |||
| 1418 | Ga0157375_10050373 | |||
| 1419 | Ga0157375_10133989 | |||
| 1420 | Ga0163163_10000307 | |||
| 1421 | Ga0163163_10015446 | |||
| 1422 | Ga0157380_10037643 | |||
| 1423 | Ga0157380_10270272 | |||
| 1424 | Ga0182008_10007328 | |||
| 1425 | Ga0157377_10025871 | |||
| 1426 | Ga0157379_10029113 | |||
| 1427 | Ga0157379_10433576 | |||
| 1428 | Ga0157379_10520031 | |||
| 1429 | Ga0157376_10292401 | |||
| 1430 | Ga0182006_1046750 | |||
| 1431 | Ga0182007_10003947 | |||
| 1432 | Ga0182005_1004378 | |||
| 1433 | Ga0182005_1071450 | |||
| 1434 | Ga0163161_10070128 | |||
| 1435 | Ga0209435_100009 | |||
| 1436 | Ga0209760_102687 | |||
| 1437 | Ga0209672_110869 | |||
| 1438 | Ga0207427_106993 | |||
| 1439 | Ga0209437_100057 | |||
| 1440 | Ga0209437_100107 | |||
| 1441 | Ga0207425_1000034 | |||
| 1442 | Ga0209646_1000018 | |||
| 1443 | Ga0209646_1012176 | |||
| 1444 | Ga0209646_1017240 | |||
| 1445 | Ga0209026_1000041 | |||
| 1446 | Ga0209026_1000068 | |||
| 1447 | Ga0209677_100297 | |||
| 1448 | Ga0209677_107846 | |||
| 1449 | Ga0209148_1000011 | |||
| 1450 | Ga0209148_1000069 | |||
| 1451 | Ga0209148_1026352 | |||
| 1452 | Ga0209759_1000007 | |||
| 1453 | Ga0209759_1000183 | |||
| 1454 | Ga0209129_1000094 | |||
| 1455 | Ga0209233_1000030 | |||
| 1456 | Ga0209233_1000072 | |||
| 1457 | Ga0209233_1000134 | |||
| 1458 | Ga0209233_1000353 | |||
| 1459 | Ga0209233_1015585 | |||
| 1460 | Ga0209455_1000006 | |||
| 1461 | Ga0209455_1000161 | |||
| 1462 | Ga0209673_1004624 | |||
| 1463 | Ga0209025_1000184 | |||
| 1464 | Ga0209758_1000017 | |||
| 1465 | Ga0209758_1000159 | |||
| 1466 | Ga0209758_1022617 | |||
| 1467 | Ga0207697_10002198 | |||
| 1468 | Ga0207697_10012600 | |||
| 1469 | Ga0207697_10097977 | |||
| 1470 | Ga0207696_1009256 | |||
| 1471 | Ga0207682_10000505 | |||
| 1472 | Ga0207682_10054396 | |||
| 1473 | Ga0207688_10021621 | |||
| 1474 | Ga0207688_10148791 | |||
| 1475 | Ga0207680_10001044 | |||
| 1476 | Ga0207647_10009701 | |||
| 1477 | Ga0207647_10021806 | |||
| 1478 | Ga0207647_10091971 | |||
| 1479 | Ga0207647_10102083 | |||
| 1480 | Ga0207699_10021776 | |||
| 1481 | Ga0207645_10085650 | |||
| 1482 | Ga0207705_10000120 | |||
| 1483 | Ga0207705_10052688 | |||
| 1484 | Ga0207705_10070861 | |||
| 1485 | Ga0207654_10000311 | |||
| 1486 | Ga0207654_10095098 | |||
| 1487 | Ga0207707_10056195 | |||
| 1488 | Ga0207707_10228071 | |||
| 1489 | Ga0207695_10000044 | |||
| 1490 | Ga0207695_10128226 | |||
| 1491 | Ga0207695_10161967 | |||
| 1492 | Ga0207695_10291054 | |||
| 1493 | Ga0207695_10671653 | |||
| 1494 | Ga0207671_10000364 | |||
| 1495 | Ga0207671_10150986 | |||
| 1496 | Ga0207693_10009824 | |||
| 1497 | Ga0207660_10035675 | |||
| 1498 | Ga0207662_10035883 | |||
| 1499 | Ga0207657_10014901 | |||
| 1500 | Ga0207657_10036707 | |||
| 1501 | Ga0207657_10083838 | |||
| 1502 | Ga0207657_10169016 | |||
| 1503 | Ga0207649_10002327 | |||
| 1504 | Ga0207649_10027838 | |||
| 1505 | Ga0207649_10036447 | |||
| 1506 | Ga0207649_10175370 | |||
| 1507 | Ga0207649_10338173 | |||
| 1508 | Ga0207681_10011479 | |||
| 1509 | Ga0207681_10183634 | |||
| 1510 | Ga0207694_10185088 | |||
| 1511 | Ga0207650_10011940 | |||
| 1512 | Ga0207650_10037516 | |||
| 1513 | Ga0207650_10152831 | |||
| 1514 | Ga0207650_10274799 | |||
| 1515 | Ga0207650_10352871 | |||
| 1516 | Ga0207659_10097546 | |||
| 1517 | Ga0207659_10424433 | |||
| 1518 | Ga0207659_10481286 | |||
| 1519 | Ga0207700_10062479 | |||
| 1520 | Ga0207700_10064310 | |||
| 1521 | Ga0207644_10000415 | |||
| 1522 | Ga0207644_10012673 | |||
| 1523 | Ga0207644_10055721 | |||
| 1524 | Ga0207644_10126210 | |||
| 1525 | Ga0207644_10194240 | |||
| 1526 | Ga0207644_10457223 | |||
| 1527 | Ga0207690_10007422 | |||
| 1528 | Ga0207690_10026510 | |||
| 1529 | Ga0207690_10238082 | |||
| 1530 | Ga0207706_10036166 | |||
| 1531 | Ga0207706_10036276 | |||
| 1532 | Ga0207706_10048718 | |||
| 1533 | Ga0207706_10058766 | |||
| 1534 | Ga0207706_10060688 | |||
| 1535 | Ga0207686_10253052 | |||
| 1536 | Ga0207709_10000078 | |||
| 1537 | Ga0207709_10064738 | |||
| 1538 | Ga0207670_10234862 | |||
| 1539 | Ga0207669_10000020 | |||
| 1540 | Ga0207669_10009051 | |||
| 1541 | Ga0207669_10032982 | |||
| 1542 | Ga0207704_10524415 | |||
| 1543 | Ga0207691_10036319 | |||
| 1544 | Ga0207691_10102071 | |||
| 1545 | Ga0207691_10240642 | |||
| 1546 | Ga0207691_10451422 | |||
| 1547 | Ga0207691_10520697 | |||
| 1548 | Ga0207711_10000420 | |||
| 1549 | Ga0207711_10000831 | |||
| 1550 | Ga0207711_10001208 | |||
| 1551 | Ga0207711_10009193 | |||
| 1552 | Ga0207711_10279596 | |||
| 1553 | Ga0207689_10072695 | |||
| 1554 | Ga0207689_10308763 | |||
| 1555 | Ga0207679_10008127 | |||
| 1556 | Ga0207679_10091455 | |||
| 1557 | Ga0207679_10246930 | |||
| 1558 | Ga0207667_10000002 | |||
| 1559 | Ga0207667_10121185 | |||
| 1560 | Ga0207651_10025637 | |||
| 1561 | Ga0207651_10054717 | |||
| 1562 | Ga0207651_10070177 | |||
| 1563 | Ga0207651_10107522 | |||
| 1564 | Ga0207712_10006333 | |||
| 1565 | Ga0207712_10009058 | |||
| 1566 | Ga0207668_10021001 | |||
| 1567 | Ga0207668_10034891 | |||
| 1568 | Ga0207668_10132672 | |||
| 1569 | Ga0207668_10474230 | |||
| 1570 | Ga0207640_10024794 | |||
| 1571 | Ga0207640_10066121 | |||
| 1572 | Ga0207640_10098241 | |||
| 1573 | Ga0207640_10163001 | |||
| 1574 | Ga0207640_10225962 | |||
| 1575 | Ga0207640_10508429 | |||
| 1576 | Ga0207640_10636544 | |||
| 1577 | Ga0207658_10002673 | |||
| 1578 | Ga0207658_10003158 | |||
| 1579 | Ga0207658_10004510 | |||
| 1580 | Ga0207658_10005394 | |||
| 1581 | Ga0207658_10008350 | |||
| 1582 | Ga0207658_10075648 | |||
| 1583 | Ga0207658_10090891 | |||
| 1584 | Ga0207658_10255031 | |||
| 1585 | Ga0207658_10257368 | |||
| 1586 | Ga0207677_10013551 | |||
| 1587 | Ga0207677_10026347 | |||
| 1588 | Ga0207677_10320142 | |||
| 1589 | Ga0207677_10376784 | |||
| 1590 | Ga0207703_10001930 | |||
| 1591 | Ga0207703_10026334 | |||
| 1592 | Ga0207703_10443046 | |||
| 1593 | Ga0207639_10019145 | |||
| 1594 | Ga0207639_10031653 | |||
| 1595 | Ga0207639_10041332 | |||
| 1596 | Ga0207639_10136010 | |||
| 1597 | Ga0207639_10278875 | |||
| 1598 | Ga0207678_10020955 | |||
| 1599 | Ga0207678_10027969 | |||
| 1600 | Ga0207678_10070358 | |||
| 1601 | Ga0207678_10077444 | |||
| 1602 | Ga0207678_10134935 | |||
| 1603 | Ga0207678_10383139 | |||
| 1604 | Ga0207702_10007220 | |||
| 1605 | Ga0207702_10220615 | |||
| 1606 | Ga0207702_10367799 | |||
| 1607 | Ga0207702_10852214 | |||
| 1608 | Ga0207641_10000502 | |||
| 1609 | Ga0207641_10026879 | |||
| 1610 | Ga0207641_10036006 | |||
| 1611 | Ga0207641_10153245 | |||
| 1612 | Ga0207648_10022723 | |||
| 1613 | Ga0207648_10069064 | |||
| 1614 | Ga0207648_10086868 | |||
| 1615 | Ga0207676_10002138 | |||
| 1616 | Ga0207676_10008921 | |||
| 1617 | Ga0207676_10173314 | |||
| 1618 | Ga0207674_10027655 | |||
| 1619 | Ga0207674_10220450 | |||
| 1620 | Ga0207675_100960816 | |||
| 1621 | Ga0207683_10002005 | |||
| 1622 | Ga0207683_10009381 | |||
| 1623 | Ga0207683_10058347 | |||
| 1624 | Ga0207683_10389478 | |||
| 1625 | Ga0207698_10074132 | |||
| 1626 | Ga0207698_10136911 | |||
| 1627 | Ga0268266_10012670 | |||
| 1628 | Ga0268266_10018787 | |||
| 1629 | Ga0268266_10175377 | |||
| 1630 | Ga0268266_10179426 | |||
| 1631 | Ga0268266_10339001 | |||
| 1632 | Ga0268266_10368214 | |||
| 1633 | Ga0268265_10002045 | |||
| 1634 | Ga0268265_10005103 | |||
| 1635 | Ga0268265_10021534 | |||
| 1636 | Ga0268265_10199063 | |||
| 1637 | Ga0268265_10371302 | |||
| 1638 | Ga0268265_10552286 | |||
| 1639 | Ga0268265_10692766 | |||
| 1640 | Ga0268264_10000410 | |||
| 1641 | Ga0268264_10000418 | |||
| 1642 | Ga0268264_10004427 | |||
| 1643 | Ga0268264_10041454 | |||
| 1644 | Ga0268264_10049649 | |||
| 1645 | Ga0316182_1126955 | |||
| 1646 | Ga0265328_10000400 | |||
| 1647 | Ga0265327_10111503 | |||
| 1648 | Ga0307408_100121195 | |||
| 1649 | Ga0307408_100245351 | |||
| 1650 | Ga0316575_10000462 | |||
| 1651 | Ga0316579_10053979 | |||
| 1652 | Ga0307405_10053655 | |||
| 1653 | Ga0307405_10383920 | |||
| 1654 | Ga0307405_10505245 | |||
| 1655 | Ga0307413_10017198 | |||
| 1656 | Ga0307413_10033805 | |||
| 1657 | Ga0307413_10053410 | |||
| 1658 | Ga0307413_10072017 | |||
| 1659 | Ga0307413_10611722 | |||
| 1660 | Ga0307413_10620786 | |||
| 1661 | Ga0307410_10001216 | |||
| 1662 | Ga0307410_10003555 | |||
| 1663 | Ga0307410_10036507 | |||
| 1664 | Ga0307410_10041136 | |||
| 1665 | Ga0307410_10042014 | |||
| 1666 | Ga0307406_10004003 | |||
| 1667 | Ga0307406_10029958 | |||
| 1668 | Ga0307406_10241186 | |||
| 1669 | Ga0307406_10246473 | |||
| 1670 | Ga0307407_10020279 | |||
| 1671 | Ga0307407_10070824 | |||
| 1672 | Ga0307407_10220039 | |||
| 1673 | Ga0307412_10005208 | |||
| 1674 | Ga0307412_10083018 | |||
| 1675 | Ga0307412_10125584 | |||
| 1676 | Ga0307412_10248769 | |||
| 1677 | Ga0307409_100020317 | |||
| 1678 | Ga0307409_100044599 | |||
| 1679 | Ga0307409_100055437 | |||
| 1680 | Ga0307409_100383993 | |||
| 1681 | Ga0307416_100177028 | |||
| 1682 | Ga0307416_100394604 | |||
| 1683 | Ga0307414_10005548 | |||
| 1684 | Ga0307414_10050064 | |||
| 1685 | Ga0307414_10059036 | |||
| 1686 | Ga0307414_10213311 | |||
| 1687 | Ga0307414_10234079 | |||
| 1688 | Ga0307414_10397994 | |||
| 1689 | Ga0307411_10001404 | |||
| 1690 | Ga0307411_10002297 | |||
| 1691 | Ga0307411_10062011 | |||
| 1692 | Ga0307411_10077171 | |||
| 1693 | Ga0307411_10199709 | |||
| 1694 | Ga0307411_10200077 | |||
| 1695 | Ga0307411_10218389 | |||
| 1696 | Ga0307411_10294194 | |||
| 1697 | Ga0307415_100209555 | |||
| 1698 | Ga0373935_0056241 | |||
| 1699 | Ga0373935_0347864 | |||
| 1700 | Ga0373927_0000019 | |||
| 1701 | Ga0316582_0168187 | |||
| 1702 | Ga0316584_0062902 | |||
| 1703 | Ga0373925_0001010 | |||
| 1704 | Ga0373925_0178597 | |||
| 1705 | Ga0395899_0000288 | |||
| 1706 | Ga0395899_0062521 | |||
| 1707 | Ga0395899_0254140 | |||
| 1708 | Ga0395900_0000246 | |||
| 1709 | Ga0395900_0003041 | |||
| 1710 | Ga0395900_0125626 | |||
| 1711 | Ga0395900_0144558 | |||
| 1712 | Ga0395900_0171188 | |||
| 1713 | Ga0395900_0334197 | |||
| 1714 | Ga0395900_0418140 | |||
| 1715 | Ga0395900_0538065 | |||
| 1716 | Ga0395898_0000447 | |||
| 1717 | Ga0395898_0489804 | |||
| 1718 | Ga0395898_0832015 | |||
| 1719 | Ga0395905_0000228 | |||
| 1720 | Ga0395905_0002055 | |||
| 1721 | Ga0395905_0015256 | |||
| 1722 | Ga0395905_0019543 | |||
| 1723 | Ga0395905_0030456 | |||
| 1724 | Ga0395905_0033143 | |||
| 1725 | Ga0395905_0089712 | |||
| 1726 | Ga0395905_0130833 | |||
| 1727 | Ga0395905_0148896 | |||
| 1728 | Ga0395905_0154177 | |||
| 1729 | Ga0395905_0315803 | |||
| 1730 | Ga0436364_0575430 | |||
| 1731 | Ga0395901_0000167 | |||
| 1732 | Ga0395901_0023795 | |||
| 1733 | Ga0395901_0038175 | |||
| 1734 | Ga0395901_0069941 | |||
| 1735 | Ga0395901_0482284 | |||
| 1736 | Ga0395901_0556178 | |||
| 1737 | Ga0436365_1317782 | |||
| 1738 | Ga0436365_1906995 | |||
| 1739 | Ga0436360_0223865 | |||
| 1740 | Ga0436361_0909211 | |||
| 1741 | Ga0436363_1504724 | |||
| 1742 | Ga0439466_0035629 | |||
| 1743 | Ga0439466_0043093 | |||
| 1744 | Ga0439465_0009333 | |||
| 1745 | Ga0439432_047628 | |||
| 1746 | Ga0439449_0016313 | |||
| 1747 | Ga0439462_0021801 | |||
| 1748 | Ga0450914_000066 | |||
| 1749 | Ga0450890_005866 | |||
| 1750 | Ga0450889_000164 | |||
| 1751 | Ga0439464_0001132 | |||
| 1752 | Ga0466972_0037315 | |||
| 1753 | Ga0466960_0133528 | |||
| 1754 | Ga0466959_0043155 | |||
| 1755 | Ga0466958_0021058 | |||
| 1756 | Ga0466967_0693516 | |||
| 1757 | Ga0495629_0210565 | |||
| 1758 | Ga0495638_0000978 | |||
| 1759 | Ga0495638_0024075 | |||
| 1760 | Ga0495605_0005182 | |||
| 1761 | Ga0495585_0002615 | |||
| 1762 | Ga0495585_0005045 | |||
| 1763 | Ga0495585_0060178 | |||
| 1764 | Ga0495596_0071481 | |||
| 1765 | Ga0495607_0091605 | |||
| 1766 | Ga0495583_0003310 | |||
| 1767 | Ga0495583_0011178 | |||
| 1768 | Ga0495583_0021181 | |||
| 1769 | Ga0495583_0164009 | |||
| 1770 | Ga0495606_0000963 | |||
| 1771 | Ga0495606_0016331 | |||
| 1772 | Ga0495606_0121693 | |||
| 1773 | Ga0495616_0015461 | |||
| 1774 | Ga0495616_0066743 | |||
| 1775 | Ga0495620_0080955 | |||
| 1776 | Ga0495631_0001352 | |||
| 1777 | Ga0495631_0042268 | |||
| 1778 | Ga0495632_0014024 | |||
| 1779 | Ga0495643_0104652 | |||
| 1780 | Ga0495648_0000782 | |||
| 1781 | Ga0495648_0080295 | |||
| 1782 | Ga0495663_0006090 | |||
| 1783 | Ga0495654_0000296 | |||
| 1784 | Ga0495587_0268631 | |||
| 1785 | Ga0495609_0040002 | |||
| 1786 | Ga0495621_0037811 | |||
| 1787 | Ga0495597_0038339 | |||
| 1788 | Ga0495633_0005249 | |||
| 1789 | Ga0495668_0000080 | |||
| 1790 | Ga0495668_0016292 | |||
| 1791 | Ga0495611_0006470 | |||
| 1792 | Ga0495625_0000819 | |||
| 1793 | Ga0495625_0012968 | |||
| 1794 | Ga0495625_0032281 | |||
| 1795 | Ga0495625_0054954 | |||
| 1796 | Ga0495625_0064035 | |||
| 1797 | Ga0495625_0142379 | |||
| 1798 | Ga0495625_0146525 | |||
| 1799 | Ga0495635_0296620 | |||
| 1800 | Ga0495661_0207327 | |||
| 1801 | Ga0495669_0000011 | |||
| 1802 | Ga0495669_0001712 | |||
| 1803 | Ga0495613_0159806 | |||
| 1804 | Ga0495670_0034506 | |||
| 1805 | Ga0495670_0078577 | |||
| 1806 | Ga0495649_0021504 | |||
| 1807 | Ga0495660_0038136 | |||
| 1808 | Ga0495660_0084593 | |||
| 1809 | Ga0495604_0076923 | |||
| 1810 | Ga0495636_0032155 | |||
| 1811 | Ga0495672_0052903 | |||
| 1812 | Ga0495683_0006885 | |||
| 1813 | Ga0495683_0046681 | |||
| 1814 | Ga0495687_000684 | |||
| 1815 | Ga0495687_002397 | |||
| 1816 | Ga0495687_060961 | |||
| 1817 | Ga0495677_0041230 | |||
| 1818 | Ga0495673_0088949 | |||
| 1819 | Ga0495681_0018299 | |||
| 1820 | Ga0495681_0026759 | |||
| 1821 | Ga0495686_0077522 | |||
| 1822 | Ga0495626_0179131 | |||
| 1823 | Ga0496100_0284405 | |||
| 1824 | Ga0496101_0142979 | |||
| 1825 | Ga0496102_0000213 | |||
| 1826 | Ga0496102_0013947 | |||
| 1827 | Ga0496102_0155087 | |||
| 1828 | Ga0496102_0233622 | |||
| 1829 | Ga0496102_0284691 | |||
| 1830 | Ga0496102_0384891 | |||
| 1831 | Ga0496103_0001102 | |||
| 1832 | Ga0496103_0015441 | |||
| 1833 | Ga0496103_0211328 | |||
| 1834 | Ga0496104_0041322 | |||
| 1835 | Ga0496104_0053309 | |||
| 1836 | Ga0496105_0010188 | |||
| 1837 | Ga0496105_0013563 | |||
| 1838 | Ga0496106_0186999 | |||
| 1839 | Ga0496107_0017579 | |||
| 1840 | Ga0496107_0107364 | |||
| 1841 | Ga0496108_0001490 | |||
| 1842 | Ga0496108_0006149 | |||
| 1843 | Ga0496108_0383643 | |||
| 1844 | Ga0496108_0783865 | |||
| 1845 | Ga0496109_0000610 | |||
| 1846 | Ga0496109_0003373 | |||
| 1847 | Ga0496109_0160531 | |||
| 1848 | Ga0496110_0040525 | |||
| 1849 | Ga0496110_0047828 | |||
| 1850 | Ga0496110_0165155 | |||
| 1851 | Ga0496110_0297284 | |||
| 1852 | Ga0496111_0019440 | |||
| 1853 | Ga0496111_0020827 | |||
| 1854 | Ga0496112_0016625 | |||
| 1855 | Ga0496112_0036131 | |||
| 1856 | Ga0496112_0327314 | |||
| 1857 | Ga0496113_0001927 | |||
| 1858 | Ga0496113_0011007 | |||
| 1859 | Ga0496113_0099782 | |||
| 1860 | Ga0496113_0279895 | |||
| 1861 | Ga0496114_0057231 | |||
| 1862 | Ga0496114_0064085 | |||
| 1863 | Ga0496114_0186076 | |||
| 1864 | Ga0496115_0000030 | |||
| 1865 | Ga0496115_0019252 | |||
| 1866 | Ga0496115_0054849 | |||
| 1867 | Ga0496116_0004303 | |||
| 1868 | Ga0496116_0013189 | |||
| 1869 | Ga0496116_0034869 | |||
| 1870 | Ga0496116_0103211 | |||
| 1871 | Ga0496116_0128039 | |||
| 1872 | Ga0496117_0001842 | |||
| 1873 | Ga0496117_0018264 | |||
| 1874 | Ga0496117_0024164 | |||
| 1875 | Ga0496118_0000207 | |||
| 1876 | Ga0496118_0003544 | |||
| 1877 | Ga0496118_0126826 | |||
| 1878 | Ga0496118_0143359 | |||
| 1879 | Ga0496119_0020775 | |||
| 1880 | Ga0496119_0050772 | |||
| 1881 | Ga0496119_0088442 | |||
| 1882 | Ga0496120_0002681 | |||
| 1883 | Ga0496120_0023582 | |||
| 1884 | Ga0496120_0134929 | |||
| 1885 | Ga0496121_0001274 | |||
| 1886 | Ga0496121_0004072 | |||
| 1887 | Ga0496121_0081432 | |||
| 1888 | Ga0496121_0185515 | |||
| 1889 | Ga0496122_0013200 | |||
| 1890 | Ga0496122_0020390 | |||
| 1891 | Ga0496122_0031506 | |||
| 1892 | Ga0496122_0052396 | |||
| 1893 | Ga0496122_0053444 | |||
| 1894 | Ga0496122_0069960 | |||
| 1895 | Ga0496123_0008958 | |||
| 1896 | Ga0496123_0039206 | |||
| 1897 | Ga0496123_0043471 | |||
| 1898 | Ga0496123_0127351 | |||
| 1899 | Ga0496124_0001058 | |||
| 1900 | Ga0496124_0009124 | |||
| 1901 | Ga0496124_0010128 | |||
| 1902 | Ga0496124_0059174 | |||
| 1903 | Ga0496124_0078985 | |||
| 1904 | Ga0496125_0001207 | |||
| 1905 | Ga0496125_0005193 | |||
| 1906 | Ga0496125_0011707 | |||
| 1907 | Ga0496125_0061256 | |||
| 1908 | Ga0496125_0134782 | |||
| 1909 | Ga0496126_0001895 | |||
| 1910 | Ga0496126_0064058 | |||
| 1911 | Ga0496126_0101060 | |||
| 1912 | Ga0496126_0426266 | |||
| 1913 | Ga0495678_006569 | |||
| 1914 | Ga0495678_025882 | |||
| 1915 | Ga0495682_0038316 | |||
| 1916 | Ga0501300_014461 | |||
| 1917 | Ga0501031_0008288 | |||
| 1918 | Ga0501031_0023956 | |||
| 1919 | Ga0501032_0000001 | |||
| 1920 | Ga0501032_0000017 | |||
| 1921 | Ga0501032_0193969 | |||
| 1922 | Ga0501033_0000029 | |||
| 1923 | Ga0501033_0000830 | |||
| 1924 | Ga0501033_0002867 | |||
| 1925 | Ga0501033_0036868 | |||
| 1926 | Ga0501033_0072134 | |||
| 1927 | Ga0501033_0375415 | |||
| 1928 | Ga0501034_0000036 | |||
| 1929 | Ga0501034_0000102 | |||
| 1930 | Ga0501034_0015348 | |||
| 1931 | Ga0501034_0071549 | |||
| 1932 | Ga0501034_0162497 | |||
| 1933 | Ga0501034_0186186 | |||
| 1934 | Ga0501034_0201676 | |||
| 1935 | Ga0501034_0237918 | |||
| 1936 | Ga0501034_0284278 | |||
| 1937 | Ga0501036_0000011 | |||
| 1938 | Ga0501036_0000180 | |||
| 1939 | Ga0501037_0000015 | |||
| 1940 | Ga0501037_0000017 | |||
| 1941 | Ga0501038_0000016 | |||
| 1942 | Ga0501038_0000036 | |||
| 1943 | Ga0501038_0016245 | |||
| 1944 | Ga0501039_0000011 | |||
| 1945 | Ga0501039_0000023 | |||
| 1946 | Ga0501039_0185817 | |||
| 1947 | Ga0501039_0412033 | |||
| 1948 | Ga0501040_0004290 | |||
| 1949 | Ga0501043_0000105 | |||
| 1950 | Ga0501043_0000423 | |||
| 1951 | Ga0501043_0161322 | |||
| 1952 | Ga0501043_0168649 | |||
| 1953 | Ga0501043_0254048 | |||
| 1954 | Ga0501046_0038983 | |||
| 1955 | Ga0501046_0049874 | |||
| 1956 | Ga0501047_0002449 | |||
| 1957 | Ga0501047_0027147 | |||
| 1958 | Ga0501047_0061955 | |||
| 1959 | Ga0501047_0150345 | |||
| 1960 | Ga0501047_0173111 | |||
| 1961 | Ga0501047_0702789 | |||
| 1962 | Ga0501048_0007590 | |||
| 1963 | Ga0501067_0005711 | |||
| 1964 | Ga0501067_0021763 | |||
| 1965 | Ga0501067_0130046 | |||
| 1966 | Ga0501068_0028598 | |||
| 1967 | Ga0501069_0071079 | |||
| 1968 | Ga0501069_0164579 | |||
| 1969 | Ga0501070_0000648 | |||
| 1970 | Ga0501070_0003968 | |||
| 1971 | Ga0501070_0014269 | |||
| 1972 | Ga0501070_0064322 | |||
| 1973 | Ga0501070_0092448 | |||
| 1974 | Ga0501073_0061124 | |||
| 1975 | Ga0501073_0255943 | |||
| 1976 | Ga0501077_0058762 | |||
| 1977 | Ga0501080_0000711 | |||
| 1978 | Ga0501080_0005920 | |||
| 1979 | Ga0501080_0026665 | |||
| 1980 | Ga0501083_0020004 | |||
| 1981 | Ga0501280_005531 | |||
| 1982 | Ga0501035_0000028 | |||
| 1983 | Ga0501035_0000038 | |||
| 1984 | Ga0501035_0004286 | |||
| 1985 | Ga0501035_0004759 | |||
| 1986 | Ga0501035_0028976 | |||
| 1987 | Ga0501044_0000046 | |||
| 1988 | Ga0501044_0015506 | |||
| 1989 | Ga0501044_0029697 | |||
| 1990 | Ga0501044_0037710 | |||
| 1991 | Ga0501044_0060165 | |||
| 1992 | nmdc:mga03n38_99417_c1 | |||
| 1993 | nmdc:mga00v17_27_c1 | |||
| 1994 | nmdc:mga0yw44_113987_c1 | |||
| 1995 | nmdc:mga0yw44_359795_c1 | |||
| 1996 | nmdc:mga0yw44_94848_c1 | |||
| 1997 | nmdc:mga0k408_517955_c1 | |||
| 1998 | nmdc:mga06z11_142342_c1 | |||
| 1999 | nmdc:mga06z11_264878_c1 | |||
| 2000 | nmdc:mga06z11_32902_c1 | |||
| 2001 | nmdc:mga07m45_67034_c1 | |||
| 2002 | nmdc:mga05p37_522229_c1 | |||
| 2003 | nmdc:mga09592_586221_c1 | |||
| 2004 | nmdc:mga0rr50_29874_c1 | |||
| 2005 | nmdc:mga0rr50_318165_c1 | |||
| 2006 | nmdc:mga08x19_6_c2 | |||
| 2007 | nmdc:mga0a205_7550_c1 | |||
| 2008 | nmdc:mga0sz30_9974_c1 | |||
| 2009 | Ga0500610_0000034 | |||
| 2010 | Ga0500610_0010483 | |||
| 2011 | Ga0500610_0039576 | |||
| 2012 | Ga0500578_0041900 | |||
| 2013 | Ga0500643_059263 | |||
| 2014 | Ga0500569_014287 | |||
| 2015 | Ga0500594_0001317 | |||
| 2016 | Ga0500618_000222 | |||
| 2017 | Ga0500618_038432 | |||
| 2018 | Ga0500642_0005333 | |||
| 2019 | Ga0500559_0010357 | |||
| 2020 | Ga0500568_0000104 | |||
| 2021 | Ga0500568_0000763 | |||
| 2022 | Ga0500568_0000803 | |||
| 2023 | Ga0500573_0008514 | |||
| 2024 | Ga0500573_0171799 | |||
| 2025 | Ga0500588_0044268 | |||
| 2026 | Ga0500616_0000220 | |||
| 2027 | Ga0500616_0001222 | |||
| 2028 | Ga0500620_000357 | |||
| 2029 | Ga0500627_0027408 | |||
| 2030 | Ga0500634_0004310 | |||
| 2031 | Ga0500611_006673 | |||
| 2032 | Ga0500611_020911 | |||
| 2033 | Ga0500645_000001 | |||
| 2034 | Ga0500645_028306 | |||
| 2035 | Ga0501084_0062074 | |||
| 2036 | Ga0501084_0089796 | |||
| 2037 | Ga0501082_0042260 | |||
| 2038 | Ga0501082_0063229 | |||
| 2039 | Ga0501082_0107266 | |||
| 2040 | Ga0466962_0121969 | |||
| 2041 | Ga0466962_0188923 | |||
| 2042 | 2503199587 | |||
| 2043 | 2509371029 | |||
| 2044 | 2509394513 | |||
| 2045 | 2510842070 | |||
| 2046 | 2511133790 | |||
| 2047 | 2512933008 | |||
| 2048 | 2512961032 | |||
| 2049 | 2513611221 | |||
| 2050 | 2513929163 | |||
| 2051 | 2514035114 | |||
| 2052 | 2514417210 | |||
| 2053 | 2514587159 | |||
| 2054 | 2561466976 | |||
| 2055 | 2585167823 | |||
| 2056 | 2585228842 | |||
| 2057 | 2585257505 | |||
| 2058 | 2585271508 | |||
| 2059 | 2585280573 | |||
| 2060 | 2585327938 | |||
| 2061 | 2585334309 | |||
| 2062 | 2585531511 | |||
| 2063 | 2585551575 | |||
| 2064 | 2585563252 | |||
| 2065 | 2585844794 | |||
| 2066 | 2585907470 | |||
| 2067 | 2587982536 | |||
| 2068 | 2588519062 | |||
| 2069 | 2597811384 | |||
| 2070 | 2599420342 | |||
| 2071 | 2599939080 | |||
| 2072 | 2616296470 | |||
| 2073 | 2616306881 | |||
| 2074 | 2616557739 | |||
| 2075 | 2617384988 | |||
| 2076 | 2643771408 | |||
| 2077 | 2643776932 | |||
| 2078 | 2643795380 | |||
| 2079 | 2643813613 | |||
| 2080 | 2643836899 | |||
| 2081 | 2643986100 | |||
| 2082 | 2644050883 | |||
| 2083 | 2644153665 | |||
| 2084 | 2644205386 | |||
| 2085 | 2644210053 | |||
| 2086 | 2644240693 | |||
| 2087 | 2644300027 | |||
| 2088 | 2644483787 | |||
| 2089 | 2644496091 | |||
| 2090 | 2644653604 | |||
| 2091 | 2644658253 | |||
| 2092 | 2671113625 | |||
| 2093 | 2688596837 | |||
| 2094 | 2694634243 | |||
| 2095 | 2694637982 | |||
| 2096 | 2723573957 | |||
| 2097 | 2738805347 | |||
| 2098 | 2756677370 | |||
| 2099 | 2776270077 | |||
| 2100 | 2776915319 | |||
| 2101 | 2778173578 | |||
| 2102 | 2792748412 | |||
| 2103 | 2819243641 | |||
| 2104 | 2819638974 | |||
| 2105 | 2838030785 | |||
| 2106 | 2838040550 | |||
| 2107 | 2838668453 | |||
| 2108 | 2839997920 | |||
| 2109 | 2841737324 | |||
| 2110 | 2842477517 | |||
| 2111 | 2842488083 | |||
| 2112 | 2842504610 | |||
| 2113 | 2844009139 | |||
| 2114 | 2847674601 | |||
| 2115 | 2847690718 | |||
| 2116 | 2854896986 | |||
| 2117 | 2854917135 | |||
| 2118 | 2856317513 | |||
| 2119 | 2856322667 | |||
| 2120 | 2856328862 | |||
| 2121 | 2856343870 | |||
| 2122 | 2856350387 | |||
| 2123 | 2856366703 | |||
| 2124 | 2857356612 | |||
| 2125 | 2869165143 | |||
| 2126 | 2869258953 | |||
| 2127 | 2869285815 | |||
| 2128 | 2869287886 | |||
| 2129 | 2871435834 | |||
| 2130 | 2871448671 | |||
| 2131 | 2871465677 | |||
| 2132 | 2871471762 | |||
| 2133 | 2871479385 | |||
| 2134 | 2871489893 | |||
| 2135 | 2871498007 | |||
| 2136 | 2874104840 | |||
| 2137 | 2874111127 | |||
| 2138 | 2874128801 | |||
| 2139 | 2874141871 | |||
| 2140 | 2874151519 | |||
| 2141 | 2874159151 | |||
| 2142 | 2874167592 | |||
| 2143 | 2874175702 | |||
| 2144 | 2876364744 | |||
| 2145 | 2876370394 | |||
| 2146 | 2876396201 | |||
| 2147 | 2876405898 | |||
| 2148 | 2876417570 | |||
| 2149 | 2876426103 | |||
| 2150 | 2878038551 | |||
| 2151 | 2878739390 | |||
| 2152 | 2878749397 | |||
| 2153 | 2878754423 | |||
| 2154 | 2878762229 | |||
| 2155 | 2878769196 | |||
| 2156 | 2878794254 | |||
| 2157 | 2881149408 | |||
| 2158 | 2881160616 | |||
| 2159 | 2881166310 | |||
| 2160 | 2881848364 | |||
| 2161 | 2881861629 | |||
| 2162 | 2882634081 | |||
| 2163 | 2882919357 | |||
| 2164 | 2885307738 | |||
| 2165 | 2885313266 | |||
| 2166 | 2885321656 | |||
| 2167 | 2885327080 | |||
| 2168 | 2885338424 | |||
| 2169 | 2885343322 | |||
| 2170 | 2885354165 | |||
| 2171 | 2888337956 | |||
| 2172 | 2888345257 | |||
| 2173 | 2888354547 | |||
| 2174 | 2889016151 | |||
| 2175 | 2889018808 | |||
| 2176 | 2891088939 | |||
| 2177 | 2903449270 | |||
| 2178 | 2903493628 | |||
| 2179 | 2903497628 | |||
| 2180 | 2903522520 | |||
| 2181 | 2903528899 | |||
| 2182 | 2903542805 | |||
| 2183 | 2904580425 | |||
| 2184 | 2904662977 | |||
| 2185 | 2906310435 | |||
| 2186 | 2906324500 | |||
| 2187 | 2906333299 | |||
| 2188 | 2906355140 | |||
| 2189 | 2906364314 | |||
| 2190 | 2906375090 | |||
| 2191 | 2906385269 | |||
| 2192 | 2906405645 | |||
| 2193 | 2906417578 | |||
| 2194 | 2919119900 | |||
| 2195 | 2919410916 | |||
| 2196 | 2922152114 | |||
| 2197 | 2922173313 | |||
| 2198 | 2924725920 | |||
| 2199 | 2924731976 | |||
| 2200 | 2924751282 | |||
| 2201 | 2924757025 | |||
| 2202 | 2924769302 | |||
| 2203 | 2924776911 | |||
| 2204 | 2924790189 | |||
| 2205 | 2933022850 | |||
| 2206 | 2937817263 | |||
| 2207 | 2937825785 | |||
| 2208 | 2937837560 | |||
| 2209 | 2937855449 | |||
| 2210 | 2937883489 | |||
| 2211 | 2937896670 | |||
| 2212 | 2937973532 | |||
| 2213 | 2937996656 | |||
| 2214 | 2938018529 | |||
| 2215 | 2958041831 | |||
| 2216 | 2958050362 | |||
| 2217 | 2958051306 | |||
| 2218 | 2958070086 | |||
| 2219 | 2958073623 | |||
| 2220 | 2958090656 | |||
| 2221 | 2958097384 | |||
| 2222 | 2958108050 | |||
| 2223 | 2958116131 | |||
| 2224 | 2958125330 | |||
| 2225 | 2958132290 | |||
| 2226 | 2958167127 | |||
| 2227 | 2958177118 | |||
| 2228 | 2958182104 | |||
| 2229 | 2961079948 | |||
| 2230 | 2961118003 | |||
| 2231 | 2961132403 | |||
| 2232 | 2961142377 | |||
| 2233 | 2961165596 | |||
| 2234 | 2961171853 | |||
| 2235 | 2961184867 | |||
| 2236 | 2963646200 | |||
| 2237 | 2965020419 | |||
| 2238 | 2965025664 | |||
| 2239 | 2965047216 | |||
| 2240 | 2965052914 | |||
| 2241 | 2965092227 | |||
| 2242 | 2965104429 | |||
| 2243 | 2967996960 | |||
| 2244 | 2968005021 | |||
| 2245 | 2968016672 | |||
| 2246 | 2968085333 | |||
| 2247 | 2968091452 | |||
| 2248 | 2968101991 | |||
| 2249 | 2968114064 | |||
| 2250 | 2968123255 | |||
| 2251 | 2968129074 | |||
| 2252 | 2968173998 | |||
| 2253 | 2970470014 | |||
| 2254 | 2970492608 | |||
| 2255 | 2970504451 | |||
| 2256 | 2970515192 | |||
| 2257 | 2970526969 | |||
| 2258 | 2970543151 | |||
| 2259 | 2970557084 | |||
| 2260 | 2970600432 | |||
| 2261 | 2970633215 | |||
| 2262 | 2977823640 | |||
| 2263 | 2977831509 | |||
| 2264 | 2977847552 | |||
| 2265 | 2977856339 | |||
| 2266 | 2977871031 | |||
| 2267 | 2977899836 | |||
| 2268 | 2977916456 | |||
| 2269 | 2977928843 | |||
| 2270 | 2977940511 | |||
| 2271 | 2977943056 | |||
| 2272 | 2977952228 | |||
| 2273 | 2977991808 | |||
| 2274 | 2979771952 | |||
| 2275 | 2979776055 | |||
| 2276 | 2979796464 | |||
| 2277 | 2979809088 | |||
| 2278 | 2987643892 | |||
| 2279 | 2987657336 | |||
| 2280 | 2987661604 | |||
| 2281 | 2987672478 | |||
| 2282 | 2989779915 | |||
| 2283 | 2996315709 | |||
| 2284 | 2996341312 | |||
| 2285 | 2996347811 | |||
| 2286 | 2996389675 | |||
| 2287 | 3000141341 | |||
| 2288 | 3003930825 | |||
| 2289 | 3004174348 | |||
| 2290 | 3004190653 | |||
| 2291 | 3004208041 | |||
| 2292 | 3004211488 | |||
| 2293 | 3004224963 | |||
| 2294 | 3004243382 | |||
| 2295 | 3004253316 | |||
| 2296 | 3004279739 | |||
| 2297 | 3004336222 | |||
| 2298 | 3005421782 | |||
| 2299 | 637076090 | |||
| 2300 | 649871396 | |||
| 2301 | 8002290203 | |||
| 2302 | 8004301346 | |||
| 2303 | 8004315095 | |||
| 2304 | 8004365989 | |||
| 2305 | 8004375999 | |||
| 2306 | 8004389674 | |||
| 2307 | 8004448754 | |||
| 2308 | 8004637980 | |||
| 2309 | 8004645526 | |||
| 2310 | 8004703339 | |||
| 2311 | 8004704496 | |||
| 2312 | 8004718071 | |||
| 2313 | 8004732929 | |||
| 2314 | 8005249074 | |||
| 2315 | 8005319518 | |||
| 2316 | 8005660670 | |||
| 2317 | 8018154529 | |||
| 2318 | 8054561343 | |||
| 2319 | 8055435704 | |||
| 2320 | 8055618818 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xm8-assembly2.cif.gz_B | x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 | 0.9827 | 5 | 256 |
| 1xm8-assembly2.cif.gz_B | x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 | 0.9713 | 5 | 256 |
| 8ewo-assembly2.cif.gz_B | crystal structure of putative glyoxylase ii from pseudomonas aeruginosa | 0.9583 | 4 | 256 |
| 2qed-assembly1.cif.gz_A | crystal structure of salmonella thyphimurium lt2 glyoxalase ii | 0.9563 | 3 | 256 |
| 6s0i-assembly1.cif.gz_A | crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site | 0.9546 | 5 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MD49_73_326_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.986 | 5 | 256 | 3.60.15.10 |
| af_I1MD49_73_326_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9745 | 5 | 256 | 3.60.15.10 |
| 2obwA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9555 | 3 | 256 | 3.60.15.10 |
| af_Q8N490_119_385_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9535 | 5 | 256 | 3.60.15.10 |
| 2obwA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9518 | 3 | 256 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353G0Q3-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 1.002 | 1 | 256 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A3S2X9U1-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 1.002 | 1 | 256 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A4R3A461-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 1.002 | 1 | 256 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-Q2K3M6-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 1.002 | 1 | 256 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A3R9BMM3-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 1.001 | 1 | 256 |
GO:0004416
GO:0019243 GO:0046872 |