F490998
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1160 | 547 | 1106 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300047322|Ga0495680_0131585|Ga0495680_0131585_111_605 |
| Length | 164 |
| Sequence | LFGPRLDDPAGIGEGAVTITFENLNTGDSIDGPQFAVSRESIRLFCDASLDYNPLHLDDDYMKGSFGKTNFGGIIMHGMNNFGLISRMITDWAYPAGAIHRRLETRWVKPVRPGDVIQPTGIVKSKQTTANSRWVLIDVMVRNQNDEKVATGEAMVEFPLEAAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 10 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 11 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 12 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 13 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 14 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 15 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 16 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 17 | 2791355199 | |||
| 18 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 19 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 20 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 21 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 22 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 23 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 24 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 25 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 26 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 27 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 28 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 29 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 30 | 2904699407 | |||
| 31 | 2906610324 | |||
| 32 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 33 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 34 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 35 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 36 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 37 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 38 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 39 | 2922425934 | |||
| 40 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 41 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 42 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 43 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 44 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 45 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 46 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 47 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 48 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 49 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 51 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 52 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 53 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 62 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 104 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 107 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 112 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 113 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 119 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 120 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 121 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 123 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 124 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 125 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 126 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 127 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 130 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 131 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 132 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 137 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 138 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 139 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 140 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 141 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 143 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 144 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 145 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 158 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 161 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 162 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 174 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 179 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 240 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 249 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 250 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 252 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 253 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 258 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 259 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 260 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 274 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 276 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 286 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 288 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 290 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 293 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 294 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 295 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 300 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 303 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 312 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 313 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 314 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 315 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 316 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 319 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 407 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 408 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 409 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 410 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 411 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 418 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 419 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 420 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 421 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 422 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 423 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 424 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 425 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 426 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 427 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 428 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 429 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 430 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 462 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 463 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 466 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 469 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 474 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 477 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 478 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 482 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 484 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 485 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 487 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 488 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 489 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 490 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 491 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 492 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 493 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 494 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 495 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 496 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 498 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 499 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 500 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 501 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 502 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 503 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 504 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 506 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 507 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 508 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 509 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 511 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 513 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 514 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 515 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 516 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 517 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 518 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 519 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 520 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 522 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 523 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 524 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 525 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 526 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 527 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 528 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 529 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 530 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 531 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 532 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 533 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 534 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 535 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 536 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 537 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 539 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 541 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 542 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 543 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 544 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 545 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 546 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 547 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.67 |
| Metatranscriptomes | 0 |
| Isolates | 4.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.52 |
| Nodule | 3.45 |
| Rhizoplane | 5.09 |
| Rhizosphere | 69.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10233007 | 3300001990 | Bacteria | 543 |
| 2 | JGI24744J21845_10007397 | 3300002077 | Bacteria | 2268 |
| 3 | JGI25406J46586_10000506 | 3300003203 | Bacteria | 18253 |
| 4 | JGI25406J46586_10004272 | 3300003203 | Bacteria | 6674 |
| 5 | JGI25165J46597_1008424 | 3300003214 | Bacteria | 1618 |
| 6 | rootH1_10119036 | 3300003316 | Bacteria | 1265 |
| 7 | rootH1_10048045 | 3300003323 | Bacteria | 2491 |
| 8 | JGI25404J52841_10008669 | 3300003659 | Bacteria | 2171 |
| 9 | JGI25404J52841_10022087 | 3300003659 | Bacteria | 1376 |
| 10 | Ga0055526_1021857 | 3300003771 | Bacteria | 2204 |
| 11 | Ga0055526_1043572 | 3300003771 | Bacteria | 1091 |
| 12 | JGI25405J52794_10050771 | 3300003911 | Bacteria | 889 |
| 13 | Ga0070658_10005658 | 3300005327 | Bacteria | 10131 |
| 14 | Ga0070658_10043632 | 3300005327 | Bacteria | 3622 |
| 15 | Ga0070658_10862462 | 3300005327 | Bacteria | 787 |
| 16 | Ga0070676_10276015 | 3300005328 | Bacteria | 1130 |
| 17 | Ga0070683_100010541 | 3300005329 | Bacteria | 7946 |
| 18 | Ga0070683_100089709 | 3300005329 | Bacteria | 2885 |
| 19 | Ga0070670_100667212 | 3300005331 | Bacteria | 933 |
| 20 | Ga0070670_100762094 | 3300005331 | Bacteria | 873 |
| 21 | Ga0070670_101638856 | 3300005331 | Bacteria | 592 |
| 22 | Ga0070677_10337662 | 3300005333 | Bacteria | 777 |
| 23 | Ga0068869_100230778 | 3300005334 | Bacteria | 1471 |
| 24 | Ga0068869_100640373 | 3300005334 | Bacteria | 901 |
| 25 | Ga0068869_100723311 | 3300005334 | Bacteria | 850 |
| 26 | Ga0070680_100016960 | 3300005336 | Bacteria | 5734 |
| 27 | Ga0070680_100035793 | 3300005336 | Bacteria | 4009 |
| 28 | Ga0070680_100106864 | 3300005336 | Bacteria | 2327 |
| 29 | Ga0070680_101061454 | 3300005336 | Bacteria | 700 |
| 30 | Ga0070682_100425063 | 3300005337 | Bacteria | 1011 |
| 31 | Ga0070682_100501566 | 3300005337 | Bacteria | 940 |
| 32 | Ga0070682_100527873 | 3300005337 | Bacteria | 919 |
| 33 | Ga0070660_100029340 | 3300005339 | Bacteria | 4122 |
| 34 | Ga0070660_100313429 | 3300005339 | Bacteria | 1288 |
| 35 | Ga0070660_100571368 | 3300005339 | Bacteria | 944 |
| 36 | Ga0070691_10011291 | 3300005341 | Bacteria | 4076 |
| 37 | Ga0070661_100003193 | 3300005344 | Bacteria | 11298 |
| 38 | Ga0070661_100051572 | 3300005344 | Bacteria | 3011 |
| 39 | Ga0070661_100136029 | 3300005344 | Bacteria | 1849 |
| 40 | Ga0070661_101169224 | 3300005344 | Bacteria | 643 |
| 41 | Ga0070661_101665914 | 3300005344 | Bacteria | 540 |
| 42 | Ga0070668_100099179 | 3300005347 | Bacteria | 2306 |
| 43 | Ga0070668_100127131 | 3300005347 | Bacteria | 2042 |
| 44 | Ga0070668_100944760 | 3300005347 | Bacteria | 772 |
| 45 | Ga0070668_101168006 | 3300005347 | Bacteria | 696 |
| 46 | Ga0070668_101217584 | 3300005347 | Bacteria | 683 |
| 47 | Ga0070669_100273914 | 3300005353 | Bacteria | 1350 |
| 48 | Ga0070669_100445276 | 3300005353 | Bacteria | 1067 |
| 49 | Ga0070675_100256817 | 3300005354 | Bacteria | 1530 |
| 50 | Ga0070675_100738649 | 3300005354 | Bacteria | 898 |
| 51 | Ga0070671_100181765 | 3300005355 | Bacteria | 1780 |
| 52 | Ga0070671_100184578 | 3300005355 | Bacteria | 1767 |
| 53 | Ga0070671_101555660 | 3300005355 | Bacteria | 586 |
| 54 | Ga0070674_100042736 | 3300005356 | Bacteria | 3080 |
| 55 | Ga0070674_100307190 | 3300005356 | Bacteria | 1267 |
| 56 | Ga0070674_100786466 | 3300005356 | Bacteria | 820 |
| 57 | Ga0070673_100389150 | 3300005364 | Bacteria | 1245 |
| 58 | Ga0070673_101423418 | 3300005364 | Bacteria | 653 |
| 59 | Ga0070659_100053281 | 3300005366 | Bacteria | 3184 |
| 60 | Ga0070659_100348585 | 3300005366 | Bacteria | 1242 |
| 61 | Ga0070659_100438157 | 3300005366 | Bacteria | 1107 |
| 62 | Ga0070667_100133126 | 3300005367 | Bacteria | 2171 |
| 63 | Ga0070667_100291043 | 3300005367 | Bacteria | 1469 |
| 64 | Ga0070667_101166568 | 3300005367 | Bacteria | 721 |
| 65 | Ga0070709_10148888 | 3300005434 | Bacteria | 1616 |
| 66 | Ga0070714_100291413 | 3300005435 | Bacteria | 1519 |
| 67 | Ga0070714_101018577 | 3300005435 | Bacteria | 806 |
| 68 | Ga0070714_101135693 | 3300005435 | Bacteria | 762 |
| 69 | Ga0070713_100302920 | 3300005436 | Bacteria | 1472 |
| 70 | Ga0070713_101608477 | 3300005436 | Bacteria | 631 |
| 71 | Ga0070710_10089252 | 3300005437 | Bacteria | 1815 |
| 72 | Ga0070711_100682161 | 3300005439 | Bacteria | 864 |
| 73 | Ga0070705_100222254 | 3300005440 | Bacteria | 1308 |
| 74 | Ga0070705_100332163 | 3300005440 | Bacteria | 1102 |
| 75 | Ga0070700_100085097 | 3300005441 | Bacteria | 2051 |
| 76 | Ga0070708_100493791 | 3300005445 | Bacteria | 1155 |
| 77 | Ga0070663_100331498 | 3300005455 | Bacteria | 1227 |
| 78 | Ga0070663_100503118 | 3300005455 | Bacteria | 1006 |
| 79 | Ga0070663_100749797 | 3300005455 | Bacteria | 833 |
| 80 | Ga0070663_100889621 | 3300005455 | Bacteria | 768 |
| 81 | Ga0070663_101300199 | 3300005455 | Bacteria | 641 |
| 82 | Ga0070678_100038182 | 3300005456 | Bacteria | 3379 |
| 83 | Ga0070678_100060737 | 3300005456 | Bacteria | 2783 |
| 84 | Ga0070678_100102017 | 3300005456 | Bacteria | 2225 |
| 85 | Ga0070678_100339844 | 3300005456 | Bacteria | 1288 |
| 86 | Ga0070678_100777996 | 3300005456 | Bacteria | 867 |
| 87 | Ga0070662_100083587 | 3300005457 | Bacteria | 2383 |
| 88 | Ga0070662_100086125 | 3300005457 | Bacteria | 2349 |
| 89 | Ga0070662_100320052 | 3300005457 | Bacteria | 1265 |
| 90 | Ga0070681_10082287 | 3300005458 | Bacteria | 3174 |
| 91 | Ga0070681_10269634 | 3300005458 | Bacteria | 1614 |
| 92 | Ga0070681_10482526 | 3300005458 | Bacteria | 1152 |
| 93 | Ga0070681_10734442 | 3300005458 | Bacteria | 903 |
| 94 | Ga0068867_100069826 | 3300005459 | Bacteria | 2624 |
| 95 | Ga0068867_100219687 | 3300005459 | Bacteria | 1531 |
| 96 | Ga0068867_100451852 | 3300005459 | Bacteria | 1095 |
| 97 | Ga0070706_100691910 | 3300005467 | Bacteria | 946 |
| 98 | Ga0070706_100732196 | 3300005467 | Bacteria | 916 |
| 99 | Ga0070706_102029562 | 3300005467 | Bacteria | 521 |
| 100 | Ga0070707_100272741 | 3300005468 | Bacteria | 1645 |
| 101 | Ga0070698_100120374 | 3300005471 | Bacteria | 2585 |
| 102 | Ga0070698_100379831 | 3300005471 | Bacteria | 1345 |
| 103 | Ga0070699_101068137 | 3300005518 | Bacteria | 741 |
| 104 | Ga0070699_101214952 | 3300005518 | Bacteria | 691 |
| 105 | Ga0070679_100146761 | 3300005530 | Bacteria | 2336 |
| 106 | Ga0070679_100229319 | 3300005530 | Bacteria | 1817 |
| 107 | Ga0070679_100608542 | 3300005530 | Bacteria | 1036 |
| 108 | Ga0070679_100879258 | 3300005530 | Bacteria | 839 |
| 109 | Ga0070679_101183553 | 3300005530 | Bacteria | 709 |
| 110 | Ga0070684_100010579 | 3300005535 | Bacteria | 7315 |
| 111 | Ga0070684_100159258 | 3300005535 | Bacteria | 2047 |
| 112 | Ga0070684_101303597 | 3300005535 | Bacteria | 683 |
| 113 | Ga0070697_100440006 | 3300005536 | Bacteria | 1135 |
| 114 | Ga0068853_100009893 | 3300005539 | Bacteria | 7697 |
| 115 | Ga0068853_100505327 | 3300005539 | Bacteria | 1141 |
| 116 | Ga0068853_100724445 | 3300005539 | Bacteria | 950 |
| 117 | Ga0068853_101020511 | 3300005539 | Bacteria | 797 |
| 118 | Ga0068853_101497639 | 3300005539 | Bacteria | 653 |
| 119 | Ga0070672_100130487 | 3300005543 | Bacteria | 2065 |
| 120 | Ga0070672_100256276 | 3300005543 | Bacteria | 1474 |
| 121 | Ga0070672_100520352 | 3300005543 | Bacteria | 1031 |
| 122 | Ga0070686_100071730 | 3300005544 | Bacteria | 2269 |
| 123 | Ga0070695_100188946 | 3300005545 | Bacteria | 1464 |
| 124 | Ga0070696_100268954 | 3300005546 | Bacteria | 1295 |
| 125 | Ga0070693_100327370 | 3300005547 | Bacteria | 1041 |
| 126 | Ga0070693_100553612 | 3300005547 | Bacteria | 824 |
| 127 | Ga0070693_100742460 | 3300005547 | Bacteria | 722 |
| 128 | Ga0070693_101417298 | 3300005547 | Bacteria | 541 |
| 129 | Ga0070665_100033424 | 3300005548 | Bacteria | 5175 |
| 130 | Ga0070665_100049060 | 3300005548 | Bacteria | 4237 |
| 131 | Ga0070665_100114119 | 3300005548 | Bacteria | 2704 |
| 132 | Ga0070665_100277859 | 3300005548 | Bacteria | 1676 |
| 133 | Ga0070665_100315826 | 3300005548 | Bacteria | 1566 |
| 134 | Ga0070665_100573234 | 3300005548 | Bacteria | 1141 |
| 135 | Ga0070665_100789458 | 3300005548 | Bacteria | 962 |
| 136 | Ga0070665_100838229 | 3300005548 | Bacteria | 932 |
| 137 | Ga0070665_100942965 | 3300005548 | Bacteria | 875 |
| 138 | Ga0070665_101436910 | 3300005548 | Bacteria | 699 |
| 139 | Ga0070665_101631767 | 3300005548 | Bacteria | 652 |
| 140 | Ga0070665_101645743 | 3300005548 | Bacteria | 649 |
| 141 | Ga0070665_101669511 | 3300005548 | Bacteria | 645 |
| 142 | Ga0070704_100521162 | 3300005549 | Bacteria | 1034 |
| 143 | Ga0068855_100064018 | 3300005563 | Bacteria | 4289 |
| 144 | Ga0068855_100090898 | 3300005563 | Bacteria | 3522 |
| 145 | Ga0068855_100306312 | 3300005563 | Bacteria | 1758 |
| 146 | Ga0068855_101150552 | 3300005563 | Bacteria | 809 |
| 147 | Ga0068855_101946364 | 3300005563 | Bacteria | 595 |
| 148 | Ga0068857_100401487 | 3300005577 | Bacteria | 1275 |
| 149 | Ga0068857_100959311 | 3300005577 | Bacteria | 822 |
| 150 | Ga0068857_101010887 | 3300005577 | Bacteria | 801 |
| 151 | Ga0068854_100026148 | 3300005578 | Bacteria | 4009 |
| 152 | Ga0068854_100195888 | 3300005578 | Bacteria | 1585 |
| 153 | Ga0068856_100000046 | 3300005614 | Bacteria | 109174 |
| 154 | Ga0068856_100069409 | 3300005614 | Bacteria | 3484 |
| 155 | Ga0068856_100165022 | 3300005614 | Bacteria | 2226 |
| 156 | Ga0068856_101744280 | 3300005614 | Bacteria | 635 |
| 157 | Ga0068856_101958720 | 3300005614 | Bacteria | 596 |
| 158 | Ga0070702_100900522 | 3300005615 | Bacteria | 692 |
| 159 | Ga0068852_100008117 | 3300005616 | Bacteria | 7706 |
| 160 | Ga0068852_100034471 | 3300005616 | Bacteria | 4212 |
| 161 | Ga0068852_100074065 | 3300005616 | Bacteria | 2998 |
| 162 | Ga0068852_101391280 | 3300005616 | Bacteria | 724 |
| 163 | Ga0068859_101146714 | 3300005617 | Bacteria | 856 |
| 164 | Ga0068864_100094099 | 3300005618 | Bacteria | 2647 |
| 165 | Ga0068866_10236400 | 3300005718 | Bacteria | 1110 |
| 166 | Ga0068866_10477385 | 3300005718 | Bacteria | 821 |
| 167 | Ga0068861_100017186 | 3300005719 | Bacteria | 5129 |
| 168 | Ga0068861_100419799 | 3300005719 | Bacteria | 1192 |
| 169 | Ga0068861_100662571 | 3300005719 | Bacteria | 965 |
| 170 | Ga0068861_101148903 | 3300005719 | Bacteria | 748 |
| 171 | Ga0068851_10022304 | 3300005834 | Bacteria | 3082 |
| 172 | Ga0068851_10861708 | 3300005834 | Bacteria | 566 |
| 173 | Ga0068863_100157574 | 3300005841 | Bacteria | 2174 |
| 174 | Ga0068858_100041366 | 3300005842 | Bacteria | 4273 |
| 175 | Ga0068858_100647765 | 3300005842 | Bacteria | 1026 |
| 176 | Ga0068858_102352186 | 3300005842 | Bacteria | 527 |
| 177 | Ga0068860_100217289 | 3300005843 | Bacteria | 1855 |
| 178 | Ga0068860_100836871 | 3300005843 | Bacteria | 935 |
| 179 | Ga0068862_100063134 | 3300005844 | Bacteria | 3187 |
| 180 | Ga0068862_100212949 | 3300005844 | Bacteria | 1746 |
| 181 | Ga0068862_100366828 | 3300005844 | Bacteria | 1339 |
| 182 | Ga0068862_100520789 | 3300005844 | Bacteria | 1131 |
| 183 | Ga0068862_100540415 | 3300005844 | Bacteria | 1111 |
| 184 | Ga0068862_101118104 | 3300005844 | Bacteria | 784 |
| 185 | Ga0068862_101329463 | 3300005844 | Bacteria | 720 |
| 186 | Ga0081455_10000875 | 3300005937 | Bacteria | 38950 |
| 187 | Ga0081455_10011544 | 3300005937 | Bacteria | 8868 |
| 188 | Ga0081455_10028504 | 3300005937 | Bacteria | 5102 |
| 189 | Ga0081540_1001143 | 3300005983 | Bacteria | 23424 |
| 190 | Ga0081540_1002776 | 3300005983 | Bacteria | 14204 |
| 191 | Ga0081540_1003496 | 3300005983 | Bacteria | 12400 |
| 192 | Ga0081540_1004605 | 3300005983 | Bacteria | 10440 |
| 193 | Ga0081540_1005685 | 3300005983 | Bacteria | 9260 |
| 194 | Ga0081540_1065648 | 3300005983 | Bacteria | 1705 |
| 195 | Ga0081540_1144836 | 3300005983 | Bacteria | 948 |
| 196 | Ga0081539_10001572 | 3300005985 | Bacteria | 37755 |
| 197 | Ga0081539_10001606 | 3300005985 | Bacteria | 37203 |
| 198 | Ga0081539_10040265 | 3300005985 | Bacteria | 2744 |
| 199 | Ga0081539_10042367 | 3300005985 | Bacteria | 2653 |
| 200 | Ga0081539_10077341 | 3300005985 | Bacteria | 1760 |
| 201 | Ga0070717_10435202 | 3300006028 | Bacteria | 1181 |
| 202 | Ga0070717_10968685 | 3300006028 | Bacteria | 775 |
| 203 | Ga0075365_10019900 | 3300006038 | Bacteria | 4152 |
| 204 | Ga0075365_10043535 | 3300006038 | Bacteria | 2939 |
| 205 | Ga0075365_10045372 | 3300006038 | Bacteria | 2883 |
| 206 | Ga0075365_10095901 | 3300006038 | Bacteria | 2026 |
| 207 | Ga0075365_10535332 | 3300006038 | Bacteria | 828 |
| 208 | Ga0075368_10019828 | 3300006042 | Bacteria | 2540 |
| 209 | Ga0075368_10033435 | 3300006042 | Bacteria | 2000 |
| 210 | Ga0075363_100143329 | 3300006048 | Bacteria | 1346 |
| 211 | Ga0075363_100553158 | 3300006048 | Bacteria | 687 |
| 212 | Ga0075363_100563305 | 3300006048 | Bacteria | 680 |
| 213 | Ga0075364_10012790 | 3300006051 | Bacteria | 5146 |
| 214 | Ga0075364_10013014 | 3300006051 | Bacteria | 5105 |
| 215 | Ga0075364_10039069 | 3300006051 | Bacteria | 3075 |
| 216 | Ga0075364_10193964 | 3300006051 | Bacteria | 1376 |
| 217 | Ga0075364_10479953 | 3300006051 | Bacteria | 850 |
| 218 | Ga0075364_10530689 | 3300006051 | Bacteria | 805 |
| 219 | Ga0075364_10599679 | 3300006051 | Bacteria | 752 |
| 220 | Ga0075432_10082761 | 3300006058 | Bacteria | 1166 |
| 221 | Ga0070716_100141123 | 3300006173 | Bacteria | 1536 |
| 222 | Ga0070716_101051224 | 3300006173 | Bacteria | 647 |
| 223 | Ga0070712_100208218 | 3300006175 | Bacteria | 1541 |
| 224 | Ga0070712_100431807 | 3300006175 | Bacteria | 1093 |
| 225 | Ga0075362_10008329 | 3300006177 | Bacteria | 3962 |
| 226 | Ga0075362_10217222 | 3300006177 | Bacteria | 934 |
| 227 | Ga0075367_10019217 | 3300006178 | Bacteria | 3786 |
| 228 | Ga0075367_10030079 | 3300006178 | Bacteria | 3110 |
| 229 | Ga0075367_10039371 | 3300006178 | Bacteria | 2756 |
| 230 | Ga0075367_10162825 | 3300006178 | Bacteria | 1387 |
| 231 | Ga0075367_10186347 | 3300006178 | Bacteria | 1294 |
| 232 | Ga0075367_10198704 | 3300006178 | Bacteria | 1253 |
| 233 | Ga0075367_10358635 | 3300006178 | Bacteria | 920 |
| 234 | Ga0075367_10402752 | 3300006178 | Bacteria | 865 |
| 235 | Ga0075367_10452429 | 3300006178 | Bacteria | 814 |
| 236 | Ga0075369_10165435 | 3300006186 | Bacteria | 1014 |
| 237 | Ga0075366_10086400 | 3300006195 | Bacteria | 1876 |
| 238 | Ga0075366_10680381 | 3300006195 | Bacteria | 639 |
| 239 | Ga0097621_100142279 | 3300006237 | Bacteria | 2050 |
| 240 | Ga0097621_100157271 | 3300006237 | Bacteria | 1951 |
| 241 | Ga0097621_101524750 | 3300006237 | Bacteria | 634 |
| 242 | Ga0075370_10010951 | 3300006353 | Bacteria | 4755 |
| 243 | Ga0075370_10044788 | 3300006353 | Bacteria | 2501 |
| 244 | Ga0075370_10143884 | 3300006353 | Bacteria | 1395 |
| 245 | Ga0075370_10227859 | 3300006353 | Bacteria | 1102 |
| 246 | Ga0075370_10418729 | 3300006353 | Bacteria | 805 |
| 247 | Ga0075370_10535284 | 3300006353 | Bacteria | 708 |
| 248 | Ga0068871_100136505 | 3300006358 | Bacteria | 2083 |
| 249 | Ga0068871_100608175 | 3300006358 | Bacteria | 994 |
| 250 | Ga0075428_100721322 | 3300006844 | Bacteria | 1062 |
| 251 | Ga0075428_101672102 | 3300006844 | Bacteria | 665 |
| 252 | Ga0075430_100699232 | 3300006846 | Bacteria | 836 |
| 253 | Ga0075434_100198912 | 3300006871 | Bacteria | 2023 |
| 254 | Ga0068865_100123706 | 3300006881 | Bacteria | 1928 |
| 255 | Ga0068865_100169452 | 3300006881 | Bacteria | 1673 |
| 256 | Ga0075436_100484045 | 3300006914 | Bacteria | 904 |
| 257 | Ga0097620_101146701 | 3300006931 | Bacteria | 856 |
| 258 | Ga0099824_1011838 | 3300006942 | Bacteria | 9725 |
| 259 | Ga0099822_1001134 | 3300006943 | Bacteria | 29705 |
| 260 | Ga0099794_10386366 | 3300007265 | Bacteria | 730 |
| 261 | Ga0099795_10006976 | 3300007788 | Bacteria | 3121 |
| 262 | Ga0105240_10017853 | 3300009093 | Bacteria | 9546 |
| 263 | Ga0105240_10042035 | 3300009093 | Bacteria | 5827 |
| 264 | Ga0105240_10287474 | 3300009093 | Bacteria | 1886 |
| 265 | Ga0105240_11582313 | 3300009093 | Bacteria | 686 |
| 266 | Ga0111539_10347982 | 3300009094 | Bacteria | 1725 |
| 267 | Ga0105245_10096991 | 3300009098 | Bacteria | 2722 |
| 268 | Ga0105245_10306867 | 3300009098 | Bacteria | 1559 |
| 269 | Ga0105245_11349212 | 3300009098 | Bacteria | 763 |
| 270 | Ga0105247_11190414 | 3300009101 | Bacteria | 606 |
| 271 | Ga0114129_11746886 | 3300009147 | Bacteria | 758 |
| 272 | Ga0105243_10076539 | 3300009148 | Bacteria | 2719 |
| 273 | Ga0105243_10322460 | 3300009148 | Bacteria | 1408 |
| 274 | Ga0105243_10794006 | 3300009148 | Bacteria | 932 |
| 275 | Ga0105241_10440542 | 3300009174 | Bacteria | 1151 |
| 276 | Ga0105241_10751603 | 3300009174 | Bacteria | 894 |
| 277 | Ga0105242_10117957 | 3300009176 | Bacteria | 2273 |
| 278 | Ga0105248_10056731 | 3300009177 | Bacteria | 4394 |
| 279 | Ga0105248_10487616 | 3300009177 | Bacteria | 1389 |
| 280 | Ga0105248_10972242 | 3300009177 | Bacteria | 959 |
| 281 | Ga0105248_11093456 | 3300009177 | Bacteria | 901 |
| 282 | Ga0105237_10602297 | 3300009545 | Bacteria | 1106 |
| 283 | Ga0105237_10910303 | 3300009545 | Bacteria | 886 |
| 284 | Ga0105237_11405722 | 3300009545 | Bacteria | 704 |
| 285 | Ga0105238_10046886 | 3300009551 | Bacteria | 4358 |
| 286 | Ga0105238_10162102 | 3300009551 | Bacteria | 2212 |
| 287 | Ga0105238_10384696 | 3300009551 | Bacteria | 1395 |
| 288 | Ga0105238_10536984 | 3300009551 | Bacteria | 1173 |
| 289 | Ga0099796_10038063 | 3300010159 | Bacteria | 1612 |
| 290 | Ga0099796_10188623 | 3300010159 | Bacteria | 831 |
| 291 | Ga0105239_10162787 | 3300010375 | Bacteria | 2493 |
| 292 | Ga0105239_10233646 | 3300010375 | Bacteria | 2063 |
| 293 | Ga0105239_10298263 | 3300010375 | Bacteria | 1815 |
| 294 | Ga0105246_10015450 | 3300011119 | Bacteria | 4825 |
| 295 | Ga0105246_10114754 | 3300011119 | Bacteria | 1985 |
| 296 | Ga0157320_1019468 | 3300012481 | Bacteria | 607 |
| 297 | Ga0157343_1001969 | 3300012488 | Bacteria | 1074 |
| 298 | Ga0157373_10322265 | 3300013100 | Bacteria | 1099 |
| 299 | Ga0157371_10315200 | 3300013102 | Bacteria | 1134 |
| 300 | Ga0157370_10459580 | 3300013104 | Bacteria | 1170 |
| 301 | Ga0157369_10045792 | 3300013105 | Bacteria | 4756 |
| 302 | Ga0157369_10148152 | 3300013105 | Bacteria | 2481 |
| 303 | Ga0157369_10246117 | 3300013105 | Bacteria | 1867 |
| 304 | Ga0157374_10646477 | 3300013296 | Bacteria | 1069 |
| 305 | Ga0157374_11377052 | 3300013296 | Bacteria | 728 |
| 306 | Ga0157378_10017846 | 3300013297 | Bacteria | 6229 |
| 307 | Ga0157378_10533822 | 3300013297 | Bacteria | 1176 |
| 308 | Ga0163162_10011437 | 3300013306 | Bacteria | 8654 |
| 309 | Ga0163162_10642947 | 3300013306 | Bacteria | 1185 |
| 310 | Ga0157372_10172877 | 3300013307 | Bacteria | 2499 |
| 311 | Ga0157372_10706717 | 3300013307 | Bacteria | 1173 |
| 312 | Ga0157372_10820382 | 3300013307 | Bacteria | 1080 |
| 313 | Ga0157375_10136992 | 3300013308 | Bacteria | 2573 |
| 314 | Ga0157375_10337975 | 3300013308 | Bacteria | 1671 |
| 315 | Ga0157375_10346570 | 3300013308 | Bacteria | 1651 |
| 316 | Ga0157375_11248409 | 3300013308 | Bacteria | 872 |
| 317 | Ga0157375_12662694 | 3300013308 | Bacteria | 598 |
| 318 | Ga0163163_10483232 | 3300014325 | Bacteria | 1300 |
| 319 | Ga0163163_10637323 | 3300014325 | Bacteria | 1129 |
| 320 | Ga0163163_11002986 | 3300014325 | Bacteria | 898 |
| 321 | Ga0163163_11640623 | 3300014325 | Bacteria | 704 |
| 322 | Ga0157380_10561856 | 3300014326 | Bacteria | 1121 |
| 323 | Ga0157380_11152948 | 3300014326 | Bacteria | 817 |
| 324 | Ga0157380_11366433 | 3300014326 | Bacteria | 758 |
| 325 | Ga0182008_10286369 | 3300014497 | Bacteria | 859 |
| 326 | Ga0157377_10095417 | 3300014745 | Bacteria | 1763 |
| 327 | Ga0157377_10408514 | 3300014745 | Bacteria | 927 |
| 328 | Ga0157379_10091450 | 3300014968 | Bacteria | 2729 |
| 329 | Ga0157379_10194278 | 3300014968 | Bacteria | 1834 |
| 330 | Ga0157379_11160540 | 3300014968 | Bacteria | 742 |
| 331 | Ga0157379_11844811 | 3300014968 | Bacteria | 595 |
| 332 | Ga0157379_12602923 | 3300014968 | Bacteria | 507 |
| 333 | Ga0157376_11714591 | 3300014969 | Bacteria | 664 |
| 334 | Ga0163161_10415592 | 3300017792 | Bacteria | 1081 |
| 335 | Ga0163161_10465117 | 3300017792 | Bacteria | 1024 |
| 336 | Ga0163161_10822153 | 3300017792 | Bacteria | 782 |
| 337 | Ga0213874_10071243 | 3300021377 | Bacteria | 1109 |
| 338 | Ga0209233_1010989 | 3300025261 | Bacteria | 2683 |
| 339 | Ga0209233_1014231 | 3300025261 | Bacteria | 2248 |
| 340 | Ga0209130_1047183 | 3300025284 | Bacteria | 800 |
| 341 | Ga0209564_1000503 | 3300025295 | Bacteria | 64437 |
| 342 | Ga0209564_1005251 | 3300025295 | Bacteria | 7478 |
| 343 | Ga0209758_1014122 | 3300025297 | Bacteria | 4279 |
| 344 | Ga0207697_10039080 | 3300025315 | Bacteria | 1947 |
| 345 | Ga0207656_10101145 | 3300025321 | Bacteria | 1322 |
| 346 | Ga0207688_10376705 | 3300025901 | Bacteria | 877 |
| 347 | Ga0207680_10420424 | 3300025903 | Bacteria | 946 |
| 348 | Ga0207680_10781339 | 3300025903 | Bacteria | 685 |
| 349 | Ga0207685_10061554 | 3300025905 | Bacteria | 1488 |
| 350 | Ga0207685_10091468 | 3300025905 | Bacteria | 1282 |
| 351 | Ga0207699_10007971 | 3300025906 | Bacteria | 5201 |
| 352 | Ga0207645_10111250 | 3300025907 | Bacteria | 1773 |
| 353 | Ga0207645_10230001 | 3300025907 | Bacteria | 1224 |
| 354 | Ga0207705_10041505 | 3300025909 | Bacteria | 3301 |
| 355 | Ga0207705_10107411 | 3300025909 | Bacteria | 2059 |
| 356 | Ga0207705_10114003 | 3300025909 | Bacteria | 1999 |
| 357 | Ga0207705_10336965 | 3300025909 | Bacteria | 1161 |
| 358 | Ga0207705_11223407 | 3300025909 | Bacteria | 576 |
| 359 | Ga0207684_11136267 | 3300025910 | Bacteria | 649 |
| 360 | Ga0207654_10003986 | 3300025911 | Bacteria | 7435 |
| 361 | Ga0207707_10003157 | 3300025912 | Bacteria | 14629 |
| 362 | Ga0207707_10004597 | 3300025912 | Bacteria | 12121 |
| 363 | Ga0207707_10056424 | 3300025912 | Bacteria | 3417 |
| 364 | Ga0207707_10508970 | 3300025912 | Bacteria | 1026 |
| 365 | Ga0207707_10801975 | 3300025912 | Bacteria | 784 |
| 366 | Ga0207695_10155249 | 3300025913 | Bacteria | 2224 |
| 367 | Ga0207695_10298911 | 3300025913 | Bacteria | 1501 |
| 368 | Ga0207671_10161433 | 3300025914 | Bacteria | 1736 |
| 369 | Ga0207671_11246706 | 3300025914 | Bacteria | 580 |
| 370 | Ga0207693_10017732 | 3300025915 | Bacteria | 5676 |
| 371 | Ga0207693_10071814 | 3300025915 | Bacteria | 2710 |
| 372 | Ga0207693_10224131 | 3300025915 | Bacteria | 1477 |
| 373 | Ga0207663_10098660 | 3300025916 | Bacteria | 1956 |
| 374 | Ga0207660_10200256 | 3300025917 | Bacteria | 1559 |
| 375 | Ga0207660_10437082 | 3300025917 | Bacteria | 1057 |
| 376 | Ga0207660_10791322 | 3300025917 | Bacteria | 774 |
| 377 | Ga0207662_10053614 | 3300025918 | Bacteria | 2403 |
| 378 | Ga0207657_10004638 | 3300025919 | Bacteria | 14521 |
| 379 | Ga0207657_10108856 | 3300025919 | Bacteria | 2291 |
| 380 | Ga0207657_10144087 | 3300025919 | Bacteria | 1944 |
| 381 | Ga0207652_10012904 | 3300025921 | Bacteria | 6758 |
| 382 | Ga0207652_10060805 | 3300025921 | Bacteria | 3260 |
| 383 | Ga0207652_10190884 | 3300025921 | Bacteria | 1843 |
| 384 | Ga0207646_10654392 | 3300025922 | Bacteria | 941 |
| 385 | Ga0207681_10221169 | 3300025923 | Bacteria | 1465 |
| 386 | Ga0207681_10468987 | 3300025923 | Bacteria | 1027 |
| 387 | Ga0207681_11224201 | 3300025923 | Bacteria | 631 |
| 388 | Ga0207694_10013152 | 3300025924 | Bacteria | 6232 |
| 389 | Ga0207694_10428082 | 3300025924 | Bacteria | 1103 |
| 390 | Ga0207694_10610583 | 3300025924 | Bacteria | 917 |
| 391 | Ga0207650_10224192 | 3300025925 | Bacteria | 1514 |
| 392 | Ga0207659_10278845 | 3300025926 | Bacteria | 1366 |
| 393 | Ga0207687_10072669 | 3300025927 | Bacteria | 2461 |
| 394 | Ga0207687_10156541 | 3300025927 | Bacteria | 1744 |
| 395 | Ga0207687_10681491 | 3300025927 | Bacteria | 871 |
| 396 | Ga0207700_10200263 | 3300025928 | Bacteria | 1682 |
| 397 | Ga0207664_10936273 | 3300025929 | Bacteria | 777 |
| 398 | Ga0207644_10255998 | 3300025931 | Bacteria | 1398 |
| 399 | Ga0207706_10140389 | 3300025933 | Bacteria | 2125 |
| 400 | Ga0207706_10211712 | 3300025933 | Bacteria | 1699 |
| 401 | Ga0207686_10243384 | 3300025934 | Bacteria | 1310 |
| 402 | Ga0207709_10538518 | 3300025935 | Bacteria | 917 |
| 403 | Ga0207669_10461817 | 3300025937 | Bacteria | 1008 |
| 404 | Ga0207704_10235996 | 3300025938 | Bacteria | 1363 |
| 405 | Ga0207704_10590247 | 3300025938 | Bacteria | 908 |
| 406 | Ga0207704_11299616 | 3300025938 | Bacteria | 622 |
| 407 | Ga0207665_10036445 | 3300025939 | Bacteria | 3271 |
| 408 | Ga0207665_10149387 | 3300025939 | Bacteria | 1672 |
| 409 | Ga0207665_10811469 | 3300025939 | Bacteria | 740 |
| 410 | Ga0207691_10112935 | 3300025940 | Bacteria | 2415 |
| 411 | Ga0207691_10382807 | 3300025940 | Bacteria | 1201 |
| 412 | Ga0207711_10132016 | 3300025941 | Bacteria | 2240 |
| 413 | Ga0207711_10141498 | 3300025941 | Bacteria | 2165 |
| 414 | Ga0207689_10188832 | 3300025942 | Bacteria | 1700 |
| 415 | Ga0207661_10041449 | 3300025944 | Bacteria | 3624 |
| 416 | Ga0207661_10146271 | 3300025944 | Bacteria | 2039 |
| 417 | Ga0207679_10830824 | 3300025945 | Bacteria | 843 |
| 418 | Ga0207679_11167435 | 3300025945 | Bacteria | 706 |
| 419 | Ga0207667_10177738 | 3300025949 | Bacteria | 2186 |
| 420 | Ga0207667_10232071 | 3300025949 | Bacteria | 1889 |
| 421 | Ga0207667_10293674 | 3300025949 | Bacteria | 1660 |
| 422 | Ga0207667_10398955 | 3300025949 | Bacteria | 1400 |
| 423 | Ga0207651_10437235 | 3300025960 | Bacteria | 1120 |
| 424 | Ga0207651_11462327 | 3300025960 | Bacteria | 615 |
| 425 | Ga0207668_10093773 | 3300025972 | Bacteria | 2212 |
| 426 | Ga0207668_10100667 | 3300025972 | Bacteria | 2146 |
| 427 | Ga0207668_10216683 | 3300025972 | Bacteria | 1534 |
| 428 | Ga0207668_10712321 | 3300025972 | Bacteria | 883 |
| 429 | Ga0207668_11587980 | 3300025972 | Bacteria | 590 |
| 430 | Ga0207640_10014821 | 3300025981 | Bacteria | 4497 |
| 431 | Ga0207640_10123664 | 3300025981 | Bacteria | 1858 |
| 432 | Ga0207658_10068710 | 3300025986 | Bacteria | 2674 |
| 433 | Ga0207658_10417121 | 3300025986 | Bacteria | 1183 |
| 434 | Ga0207658_10708564 | 3300025986 | Bacteria | 910 |
| 435 | Ga0207658_10879491 | 3300025986 | Bacteria | 815 |
| 436 | Ga0207677_10009584 | 3300026023 | Bacteria | 5450 |
| 437 | Ga0207677_10502184 | 3300026023 | Bacteria | 1049 |
| 438 | Ga0207703_10198335 | 3300026035 | Bacteria | 1782 |
| 439 | Ga0207639_10187226 | 3300026041 | Bacteria | 1765 |
| 440 | Ga0207639_10187856 | 3300026041 | Bacteria | 1763 |
| 441 | Ga0207639_10799146 | 3300026041 | Bacteria | 879 |
| 442 | Ga0207639_10910572 | 3300026041 | Bacteria | 822 |
| 443 | Ga0207678_10008062 | 3300026067 | Bacteria | 9289 |
| 444 | Ga0207678_10091019 | 3300026067 | Bacteria | 2607 |
| 445 | Ga0207678_10145389 | 3300026067 | Bacteria | 2024 |
| 446 | Ga0207678_10254536 | 3300026067 | Bacteria | 1504 |
| 447 | Ga0207678_10311791 | 3300026067 | Bacteria | 1353 |
| 448 | Ga0207708_10070207 | 3300026075 | Bacteria | 2682 |
| 449 | Ga0207708_10172260 | 3300026075 | Bacteria | 1715 |
| 450 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 451 | Ga0207702_10268410 | 3300026078 | Bacteria | 1609 |
| 452 | Ga0207702_10294459 | 3300026078 | Bacteria | 1538 |
| 453 | Ga0207702_10888642 | 3300026078 | Bacteria | 883 |
| 454 | Ga0207702_10938663 | 3300026078 | Bacteria | 858 |
| 455 | Ga0207641_10196970 | 3300026088 | Bacteria | 1855 |
| 456 | Ga0207641_10370945 | 3300026088 | Bacteria | 1368 |
| 457 | Ga0207648_10445355 | 3300026089 | Bacteria | 1179 |
| 458 | Ga0207648_10515576 | 3300026089 | Bacteria | 1095 |
| 459 | Ga0207674_10012960 | 3300026116 | Bacteria | 9298 |
| 460 | Ga0207674_10180724 | 3300026116 | Bacteria | 2061 |
| 461 | Ga0207674_11097033 | 3300026116 | Bacteria | 765 |
| 462 | Ga0207674_11349153 | 3300026116 | Bacteria | 683 |
| 463 | Ga0207675_100023943 | 3300026118 | Bacteria | 5678 |
| 464 | Ga0207675_100301927 | 3300026118 | Bacteria | 1559 |
| 465 | Ga0207683_10044272 | 3300026121 | Bacteria | 3891 |
| 466 | Ga0207683_10129878 | 3300026121 | Bacteria | 2265 |
| 467 | Ga0207683_10142278 | 3300026121 | Bacteria | 2162 |
| 468 | Ga0207683_10836774 | 3300026121 | Bacteria | 854 |
| 469 | Ga0207698_10022118 | 3300026142 | Bacteria | 4411 |
| 470 | Ga0207698_10071295 | 3300026142 | Bacteria | 2757 |
| 471 | Ga0207698_10275330 | 3300026142 | Bacteria | 1554 |
| 472 | Ga0207698_10319619 | 3300026142 | Bacteria | 1453 |
| 473 | Ga0207698_10673861 | 3300026142 | Bacteria | 1027 |
| 474 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 475 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 476 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 477 | Ga0209179_1089550 | 3300027512 | Bacteria | 682 |
| 478 | Ga0209588_1051632 | 3300027671 | Bacteria | 1330 |
| 479 | Ga0209813_10093866 | 3300027866 | Bacteria | 1011 |
| 480 | Ga0209813_10100369 | 3300027866 | Bacteria | 984 |
| 481 | Ga0209813_10228056 | 3300027866 | Bacteria | 700 |
| 482 | Ga0268266_10002572 | 3300028379 | Bacteria | 19242 |
| 483 | Ga0268266_10016539 | 3300028379 | Bacteria | 6306 |
| 484 | Ga0268266_10038384 | 3300028379 | Bacteria | 4077 |
| 485 | Ga0268266_10524305 | 3300028379 | Bacteria | 1133 |
| 486 | Ga0268266_10939677 | 3300028379 | Bacteria | 836 |
| 487 | Ga0268264_10381065 | 3300028381 | Bacteria | 1350 |
| 488 | Ga0265334_10033792 | 3300028573 | Bacteria | 2033 |
| 489 | Ga0307517_10000542 | 3300028786 | Bacteria | 64617 |
| 490 | Ga0307517_10121928 | 3300028786 | Bacteria | 1923 |
| 491 | Ga0307517_10328433 | 3300028786 | Bacteria | 842 |
| 492 | Ga0307515_10011730 | 3300028794 | Bacteria | 16583 |
| 493 | Ga0307515_10150467 | 3300028794 | Bacteria | 2436 |
| 494 | Ga0307515_10416529 | 3300028794 | Bacteria | 965 |
| 495 | Ga0307515_10514596 | 3300028794 | Bacteria | 807 |
| 496 | Ga0265332_10038362 | 3300031238 | Bacteria | 2076 |
| 497 | Ga0265325_10001890 | 3300031241 | Bacteria | 14468 |
| 498 | Ga0265325_10023051 | 3300031241 | Bacteria | 3404 |
| 499 | Ga0265329_10202263 | 3300031242 | Bacteria | 654 |
| 500 | Ga0265340_10267492 | 3300031247 | Bacteria | 761 |
| 501 | Ga0265331_10055236 | 3300031250 | Bacteria | 1889 |
| 502 | Ga0265327_10078082 | 3300031251 | Bacteria | 1641 |
| 503 | Ga0265316_10385129 | 3300031344 | Bacteria | 1011 |
| 504 | Ga0307513_10094041 | 3300031456 | Bacteria | 3044 |
| 505 | Ga0307513_10312420 | 3300031456 | Bacteria | 1333 |
| 506 | Ga0307509_10022374 | 3300031507 | Bacteria | 7127 |
| 507 | Ga0307408_100688655 | 3300031548 | Bacteria | 918 |
| 508 | Ga0307408_100798699 | 3300031548 | Bacteria | 856 |
| 509 | Ga0265313_10052638 | 3300031595 | Bacteria | 1942 |
| 510 | Ga0265313_10076962 | 3300031595 | Bacteria | 1524 |
| 511 | Ga0307508_10054533 | 3300031616 | Bacteria | 3544 |
| 512 | Ga0265314_10109989 | 3300031711 | Bacteria | 1753 |
| 513 | Ga0265342_10050961 | 3300031712 | Bacteria | 2471 |
| 514 | Ga0265342_10093523 | 3300031712 | Bacteria | 1721 |
| 515 | Ga0307516_10284328 | 3300031730 | Bacteria | 1335 |
| 516 | Ga0307516_10338700 | 3300031730 | Bacteria | 1172 |
| 517 | Ga0307516_10558769 | 3300031730 | Bacteria | 798 |
| 518 | Ga0307410_11275594 | 3300031852 | Bacteria | 642 |
| 519 | Ga0307412_10154604 | 3300031911 | Bacteria | 1697 |
| 520 | Ga0307409_100353766 | 3300031995 | Bacteria | 1387 |
| 521 | Ga0307409_100534399 | 3300031995 | Bacteria | 1148 |
| 522 | Ga0307409_100994274 | 3300031995 | Bacteria | 857 |
| 523 | Ga0307416_101712059 | 3300032002 | Bacteria | 733 |
| 524 | Ga0307414_10177646 | 3300032004 | Bacteria | 1709 |
| 525 | Ga0307411_10696156 | 3300032005 | Bacteria | 885 |
| 526 | Ga0307411_11338587 | 3300032005 | Bacteria | 653 |
| 527 | Ga0307411_11484487 | 3300032005 | Bacteria | 623 |
| 528 | Ga0307507_10284262 | 3300033179 | Bacteria | 1031 |
| 529 | Ga0307510_10020603 | 3300033180 | Bacteria | 7701 |
| 530 | Ga0307510_10155674 | 3300033180 | Bacteria | 1892 |
| 531 | Ga0307510_10365855 | 3300033180 | Bacteria | 889 |
| 532 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 533 | Ga0373959_0012270 | 3300034820 | Bacteria | 1527 |
| 534 | Ga0373929_0008655 | 3300035085 | Bacteria | 1877 |
| 535 | Ga0373934_0120865 | 3300035086 | Bacteria | 1065 |
| 536 | Ga0373944_0114222 | 3300035089 | Bacteria | 925 |
| 537 | Ga0373923_0037675 | 3300035111 | Bacteria | 1979 |
| 538 | Ga0373923_0064920 | 3300035111 | Bacteria | 1557 |
| 539 | Ga0373932_0115129 | 3300035112 | Bacteria | 891 |
| 540 | Ga0373936_0027174 | 3300035113 | Bacteria | 2244 |
| 541 | Ga0373936_0048507 | 3300035113 | Bacteria | 1714 |
| 542 | Ga0373936_0066768 | 3300035113 | Bacteria | 1477 |
| 543 | Ga0373936_0139431 | 3300035113 | Bacteria | 1046 |
| 544 | Ga0373936_0489572 | 3300035113 | Bacteria | 571 |
| 545 | Ga0373945_0008608 | 3300035116 | Bacteria | 3327 |
| 546 | Ga0373945_0074838 | 3300035116 | Bacteria | 1288 |
| 547 | Ga0373953_0000606 | 3300035117 | Bacteria | 9923 |
| 548 | Ga0373953_0126273 | 3300035117 | Bacteria | 1089 |
| 549 | Ga0373954_0001041 | 3300035118 | Bacteria | 11023 |
| 550 | Ga0373954_0375706 | 3300035118 | Bacteria | 702 |
| 551 | Ga0373954_0425102 | 3300035118 | Bacteria | 657 |
| 552 | Ga0373956_0066495 | 3300035119 | Bacteria | 1639 |
| 553 | Ga0373957_0000527 | 3300035120 | Bacteria | 9628 |
| 554 | Ga0373960_0333730 | 3300035121 | Bacteria | 571 |
| 555 | Ga0373943_0008018 | 3300035170 | Bacteria | 4741 |
| 556 | Ga0373943_0121324 | 3300035170 | Bacteria | 1389 |
| 557 | Ga0373943_0293303 | 3300035170 | Bacteria | 922 |
| 558 | Ga0373955_0000535 | 3300035172 | Bacteria | 16084 |
| 559 | Ga0373955_0146440 | 3300035172 | Bacteria | 1388 |
| 560 | Ga0373924_0009724 | 3300035410 | Bacteria | 3533 |
| 561 | Ga0373924_0057699 | 3300035410 | Bacteria | 1619 |
| 562 | Ga0373931_0001627 | 3300035691 | Bacteria | 9720 |
| 563 | Ga0373931_0022393 | 3300035691 | Bacteria | 3180 |
| 564 | Ga0373931_0208701 | 3300035691 | Bacteria | 1170 |
| 565 | Ga0373931_0914010 | 3300035691 | Bacteria | 590 |
| 566 | Ga0373935_0002921 | 3300035692 | Bacteria | 9842 |
| 567 | Ga0373935_0061726 | 3300035692 | Bacteria | 2400 |
| 568 | Ga0373935_0124834 | 3300035692 | Bacteria | 1723 |
| 569 | Ga0373935_0256586 | 3300035692 | Bacteria | 1225 |
| 570 | Ga0373935_1388434 | 3300035692 | Bacteria | 525 |
| 571 | Ga0373927_0006216 | 3300035695 | Bacteria | 8153 |
| 572 | Ga0373927_0006928 | 3300035695 | Bacteria | 7697 |
| 573 | Ga0373927_0008327 | 3300035695 | Bacteria | 6982 |
| 574 | Ga0373927_0067123 | 3300035695 | Bacteria | 2321 |
| 575 | Ga0373927_0110774 | 3300035695 | Bacteria | 1788 |
| 576 | Ga0373927_0401527 | 3300035695 | Bacteria | 904 |
| 577 | Ga0373927_0461505 | 3300035695 | Bacteria | 839 |
| 578 | Ga0373933_0000017 | 3300035724 | Bacteria | 100816 |
| 579 | Ga0373933_0012317 | 3300035724 | Bacteria | 4723 |
| 580 | Ga0373947_0009619 | 3300035725 | Bacteria | 5548 |
| 581 | Ga0373947_0039668 | 3300035725 | Bacteria | 2802 |
| 582 | Ga0373947_0077884 | 3300035725 | Bacteria | 2045 |
| 583 | Ga0373937_0099008 | 3300036401 | Bacteria | 2704 |
| 584 | Ga0373925_0014356 | 3300037068 | Bacteria | 5729 |
| 585 | Ga0373925_0076473 | 3300037068 | Bacteria | 2538 |
| 586 | Ga0373925_0228550 | 3300037068 | Bacteria | 1487 |
| 587 | Ga0373925_0548489 | 3300037068 | Bacteria | 951 |
| 588 | Ga0373925_0677298 | 3300037068 | Bacteria | 850 |
| 589 | Ga0373925_0814578 | 3300037068 | Bacteria | 770 |
| 590 | Ga0395899_0083159 | 3300037312 | Bacteria | 2328 |
| 591 | Ga0395899_0690032 | 3300037312 | Bacteria | 641 |
| 592 | Ga0395900_0001282 | 3300037418 | Bacteria | 30694 |
| 593 | Ga0395900_0185512 | 3300037418 | Bacteria | 2112 |
| 594 | Ga0395900_0443041 | 3300037418 | Bacteria | 1256 |
| 595 | Ga0395898_0017060 | 3300037466 | Bacteria | 7416 |
| 596 | Ga0395898_0017739 | 3300037466 | Bacteria | 7264 |
| 597 | Ga0395898_0025002 | 3300037466 | Bacteria | 6021 |
| 598 | Ga0395905_0109478 | 3300037471 | Bacteria | 2594 |
| 599 | Ga0395905_0180823 | 3300037471 | Bacteria | 1980 |
| 600 | Ga0395905_0281840 | 3300037471 | Bacteria | 1548 |
| 601 | Ga0395905_0327977 | 3300037471 | Bacteria | 1421 |
| 602 | Ga0395905_1560150 | 3300037471 | Bacteria | 565 |
| 603 | Ga0395901_0047469 | 3300038443 | Bacteria | 4459 |
| 604 | Ga0436365_0847422 | 3300039437 | Bacteria | 1441 |
| 605 | Ga0436365_1083338 | 3300039437 | Bacteria | 982 |
| 606 | Ga0436365_1875539 | 3300039437 | Bacteria | 649 |
| 607 | Ga0436363_0502738 | 3300039450 | Bacteria | 943 |
| 608 | Ga0439465_0122313 | 3300041413 | Bacteria | 913 |
| 609 | Ga0451787_541596 | 3300041441 | Bacteria | 509 |
| 610 | Ga0451789_0084525 | 3300041443 | Bacteria | 552 |
| 611 | Ga0451789_0740288 | 3300041443 | Bacteria | 1353 |
| 612 | Ga0451791_0562369 | 3300041451 | Bacteria | 1486 |
| 613 | Ga0451793_0353251 | 3300041452 | Bacteria | 828 |
| 614 | Ga0451793_0743023 | 3300041452 | Bacteria | 647 |
| 615 | Ga0451795_0120595 | 3300041456 | Bacteria | 563 |
| 616 | Ga0451800_0174695 | 3300041459 | Bacteria | 629 |
| 617 | Ga0451837_0207973 | 3300041494 | Bacteria | 676 |
| 618 | Ga0451841_0490343 | 3300041498 | Bacteria | 538 |
| 619 | Ga0451841_1340806 | 3300041498 | Bacteria | 583 |
| 620 | Ga0451847_0001817 | 3300041503 | Bacteria | 689 |
| 621 | Ga0451849_1079513 | 3300041505 | Bacteria | 693 |
| 622 | Ga0439431_0037586 | 3300041997 | Bacteria | 1223 |
| 623 | Ga0439455_0101697 | 3300042012 | Bacteria | 795 |
| 624 | Ga0466963_0035186 | 3300044694 | Bacteria | 3262 |
| 625 | Ga0466963_0067977 | 3300044694 | Bacteria | 2392 |
| 626 | Ga0451576_0746588 | 3300045051 | Bacteria | 1028 |
| 627 | Ga0495617_083401 | 3300046452 | Bacteria | 1046 |
| 628 | Ga0495592_0011960 | 3300046454 | Bacteria | 6578 |
| 629 | Ga0495592_0043963 | 3300046454 | Bacteria | 3340 |
| 630 | Ga0495603_0000923 | 3300046455 | Bacteria | 16862 |
| 631 | Ga0495603_0008897 | 3300046455 | Bacteria | 6071 |
| 632 | Ga0495603_0029126 | 3300046455 | Bacteria | 3330 |
| 633 | Ga0495590_0203895 | 3300046457 | Bacteria | 727 |
| 634 | Ga0495591_061776 | 3300046458 | Bacteria | 994 |
| 635 | Ga0495629_0001841 | 3300046459 | Bacteria | 16607 |
| 636 | Ga0495629_0002400 | 3300046459 | Bacteria | 14408 |
| 637 | Ga0495629_0062946 | 3300046459 | Bacteria | 2591 |
| 638 | Ga0495638_0016732 | 3300046460 | Bacteria | 4902 |
| 639 | Ga0495638_0137440 | 3300046460 | Bacteria | 1429 |
| 640 | Ga0495641_0005021 | 3300046461 | Bacteria | 9123 |
| 641 | Ga0495651_0080811 | 3300046462 | Bacteria | 2454 |
| 642 | Ga0495651_0240063 | 3300046462 | Bacteria | 1243 |
| 643 | Ga0495653_0004149 | 3300046463 | Bacteria | 11724 |
| 644 | Ga0495653_0107346 | 3300046463 | Bacteria | 2012 |
| 645 | Ga0495650_0070150 | 3300046471 | Bacteria | 1377 |
| 646 | Ga0495580_0008695 | 3300046472 | Bacteria | 8051 |
| 647 | Ga0495580_0032562 | 3300046472 | Bacteria | 3761 |
| 648 | Ga0495582_0000283 | 3300046473 | Bacteria | 28312 |
| 649 | Ga0495582_0067449 | 3300046473 | Bacteria | 1977 |
| 650 | Ga0495582_0345117 | 3300046473 | Bacteria | 857 |
| 651 | Ga0495605_0126586 | 3300046474 | Bacteria | 1155 |
| 652 | Ga0495639_0000947 | 3300046475 | Bacteria | 13079 |
| 653 | Ga0495639_0044326 | 3300046475 | Bacteria | 2011 |
| 654 | Ga0495639_0099139 | 3300046475 | Bacteria | 1374 |
| 655 | Ga0495639_0128946 | 3300046475 | Bacteria | 1210 |
| 656 | Ga0495639_0183009 | 3300046475 | Bacteria | 1021 |
| 657 | Ga0495662_0001975 | 3300046476 | Bacteria | 10288 |
| 658 | Ga0495662_0236757 | 3300046476 | Bacteria | 900 |
| 659 | Ga0495662_0362510 | 3300046476 | Bacteria | 712 |
| 660 | Ga0495664_0014799 | 3300046477 | Bacteria | 4428 |
| 661 | Ga0495664_0038387 | 3300046477 | Bacteria | 2827 |
| 662 | Ga0495664_0063665 | 3300046477 | Bacteria | 2198 |
| 663 | Ga0495664_0081750 | 3300046477 | Bacteria | 1937 |
| 664 | Ga0495664_0159492 | 3300046477 | Bacteria | 1368 |
| 665 | Ga0495584_0454679 | 3300046491 | Bacteria | 651 |
| 666 | Ga0495585_0156841 | 3300046492 | Bacteria | 1183 |
| 667 | Ga0495594_0000509 | 3300046499 | Bacteria | 19796 |
| 668 | Ga0495594_0038494 | 3300046499 | Bacteria | 2612 |
| 669 | Ga0495594_0413967 | 3300046499 | Bacteria | 767 |
| 670 | Ga0495596_0152786 | 3300046500 | Bacteria | 896 |
| 671 | Ga0495596_0394139 | 3300046500 | Bacteria | 539 |
| 672 | Ga0495607_0529310 | 3300046501 | Bacteria | 520 |
| 673 | Ga0495583_0047153 | 3300046506 | Bacteria | 1984 |
| 674 | Ga0495606_0004620 | 3300046507 | Bacteria | 13639 |
| 675 | Ga0495606_0106351 | 3300046507 | Bacteria | 1699 |
| 676 | Ga0495606_0312643 | 3300046507 | Bacteria | 847 |
| 677 | Ga0495606_0377530 | 3300046507 | Bacteria | 744 |
| 678 | Ga0495606_0397170 | 3300046507 | Bacteria | 719 |
| 679 | Ga0495608_0048657 | 3300046511 | Bacteria | 2816 |
| 680 | Ga0495608_0052701 | 3300046511 | Bacteria | 2692 |
| 681 | Ga0495608_0573546 | 3300046511 | Bacteria | 679 |
| 682 | Ga0495620_0018112 | 3300046515 | Bacteria | 3493 |
| 683 | Ga0495628_0008185 | 3300046516 | Bacteria | 8992 |
| 684 | Ga0495628_0020174 | 3300046516 | Bacteria | 5501 |
| 685 | Ga0495630_0007704 | 3300046517 | Bacteria | 7702 |
| 686 | Ga0495630_0211687 | 3300046517 | Bacteria | 1479 |
| 687 | Ga0495631_0037364 | 3300046518 | Bacteria | 2164 |
| 688 | Ga0495631_0080510 | 3300046518 | Bacteria | 1405 |
| 689 | Ga0495631_0275632 | 3300046518 | Bacteria | 716 |
| 690 | Ga0495632_0048395 | 3300046519 | Bacteria | 2105 |
| 691 | Ga0495632_0102600 | 3300046519 | Bacteria | 1347 |
| 692 | Ga0495632_0336421 | 3300046519 | Bacteria | 665 |
| 693 | Ga0495632_0347077 | 3300046519 | Bacteria | 653 |
| 694 | Ga0495644_0061172 | 3300046523 | Bacteria | 1415 |
| 695 | Ga0495644_0161790 | 3300046523 | Bacteria | 858 |
| 696 | Ga0495644_0219979 | 3300046523 | Bacteria | 734 |
| 697 | Ga0495648_0003557 | 3300046524 | Bacteria | 13636 |
| 698 | Ga0495648_0127691 | 3300046524 | Bacteria | 1356 |
| 699 | Ga0495666_0165013 | 3300046526 | Bacteria | 1026 |
| 700 | Ga0495666_0555330 | 3300046526 | Bacteria | 512 |
| 701 | Ga0495652_0014821 | 3300046529 | Bacteria | 6988 |
| 702 | Ga0495652_0017676 | 3300046529 | Bacteria | 6363 |
| 703 | Ga0495652_0149151 | 3300046529 | Bacteria | 1829 |
| 704 | Ga0495652_0687473 | 3300046529 | Bacteria | 689 |
| 705 | Ga0495665_0000145 | 3300046531 | Bacteria | 34959 |
| 706 | Ga0495665_0275346 | 3300046531 | Bacteria | 864 |
| 707 | Ga0495640_0018916 | 3300046533 | Bacteria | 5095 |
| 708 | Ga0495640_0029868 | 3300046533 | Bacteria | 3907 |
| 709 | Ga0495640_0037674 | 3300046533 | Bacteria | 3409 |
| 710 | Ga0495586_0157218 | 3300046535 | Bacteria | 1281 |
| 711 | Ga0495587_0037347 | 3300046536 | Bacteria | 2917 |
| 712 | Ga0495587_0075687 | 3300046536 | Bacteria | 1954 |
| 713 | Ga0495598_0025225 | 3300046537 | Bacteria | 1619 |
| 714 | Ga0495621_0074838 | 3300046539 | Bacteria | 1253 |
| 715 | Ga0495597_0057985 | 3300046542 | Bacteria | 1693 |
| 716 | Ga0495597_0326454 | 3300046542 | Bacteria | 592 |
| 717 | Ga0495645_0001274 | 3300046543 | Bacteria | 17169 |
| 718 | Ga0495645_0005613 | 3300046543 | Bacteria | 8630 |
| 719 | Ga0495645_0111300 | 3300046543 | Bacteria | 1937 |
| 720 | Ga0495622_0035544 | 3300046557 | Bacteria | 2323 |
| 721 | Ga0495622_0111847 | 3300046557 | Bacteria | 1250 |
| 722 | Ga0495633_0140540 | 3300046558 | Bacteria | 1116 |
| 723 | Ga0495633_0178699 | 3300046558 | Bacteria | 977 |
| 724 | Ga0495667_0016196 | 3300046559 | Bacteria | 5036 |
| 725 | Ga0495667_0032991 | 3300046559 | Bacteria | 3465 |
| 726 | Ga0495656_0029999 | 3300046615 | Bacteria | 2194 |
| 727 | Ga0495656_0132030 | 3300046615 | Bacteria | 1189 |
| 728 | Ga0495656_0528793 | 3300046615 | Bacteria | 627 |
| 729 | Ga0495668_0029125 | 3300046616 | Bacteria | 3121 |
| 730 | Ga0495668_0097747 | 3300046616 | Bacteria | 1607 |
| 731 | Ga0495668_0113343 | 3300046616 | Bacteria | 1483 |
| 732 | Ga0495668_0465529 | 3300046616 | Bacteria | 696 |
| 733 | Ga0495634_0001108 | 3300046642 | Bacteria | 24957 |
| 734 | Ga0495634_0057272 | 3300046642 | Bacteria | 2602 |
| 735 | Ga0495634_0068234 | 3300046642 | Bacteria | 2350 |
| 736 | Ga0495634_0361001 | 3300046642 | Bacteria | 868 |
| 737 | Ga0495625_0092445 | 3300046660 | Bacteria | 2090 |
| 738 | Ga0495625_0190905 | 3300046660 | Bacteria | 1357 |
| 739 | Ga0495625_0401718 | 3300046660 | Bacteria | 856 |
| 740 | Ga0495625_0420253 | 3300046660 | Bacteria | 831 |
| 741 | Ga0495635_0002477 | 3300046663 | Bacteria | 12604 |
| 742 | Ga0495635_0043801 | 3300046663 | Bacteria | 3087 |
| 743 | Ga0495635_0074085 | 3300046663 | Bacteria | 2332 |
| 744 | Ga0495635_0133449 | 3300046663 | Bacteria | 1692 |
| 745 | Ga0495635_0804647 | 3300046663 | Bacteria | 605 |
| 746 | Ga0495659_0063340 | 3300046664 | Bacteria | 1370 |
| 747 | Ga0495588_0021630 | 3300046674 | Bacteria | 3172 |
| 748 | Ga0495588_0029555 | 3300046674 | Bacteria | 2750 |
| 749 | Ga0495588_0224003 | 3300046674 | Bacteria | 992 |
| 750 | Ga0495657_0003968 | 3300046675 | Bacteria | 11874 |
| 751 | Ga0495599_0002497 | 3300046678 | Bacteria | 10714 |
| 752 | Ga0495599_0010495 | 3300046678 | Bacteria | 5667 |
| 753 | Ga0495599_0235531 | 3300046678 | Bacteria | 1117 |
| 754 | Ga0495623_0016510 | 3300046679 | Bacteria | 4770 |
| 755 | Ga0495623_0138573 | 3300046679 | Bacteria | 1449 |
| 756 | Ga0495646_0002092 | 3300046680 | Bacteria | 12100 |
| 757 | Ga0495646_0060036 | 3300046680 | Bacteria | 2269 |
| 758 | Ga0495646_0087710 | 3300046680 | Bacteria | 1803 |
| 759 | Ga0495646_0093632 | 3300046680 | Bacteria | 1731 |
| 760 | Ga0495646_0149273 | 3300046680 | Bacteria | 1301 |
| 761 | Ga0495646_0409182 | 3300046680 | Bacteria | 704 |
| 762 | Ga0495647_0001082 | 3300046681 | Bacteria | 8305 |
| 763 | Ga0495658_0000547 | 3300046683 | Bacteria | 20542 |
| 764 | Ga0495658_0327171 | 3300046683 | Bacteria | 972 |
| 765 | Ga0495658_0740709 | 3300046683 | Bacteria | 630 |
| 766 | Ga0495658_0948278 | 3300046683 | Bacteria | 550 |
| 767 | Ga0495669_0067122 | 3300046684 | Bacteria | 1630 |
| 768 | Ga0495669_0204882 | 3300046684 | Bacteria | 943 |
| 769 | Ga0495613_0002250 | 3300046689 | Bacteria | 14591 |
| 770 | Ga0495613_0010590 | 3300046689 | Bacteria | 6839 |
| 771 | Ga0495613_0100697 | 3300046689 | Bacteria | 2087 |
| 772 | Ga0495613_0164925 | 3300046689 | Bacteria | 1574 |
| 773 | Ga0495624_0005060 | 3300046690 | Bacteria | 9536 |
| 774 | Ga0495624_0044293 | 3300046690 | Bacteria | 2837 |
| 775 | Ga0495670_0013233 | 3300046691 | Bacteria | 4057 |
| 776 | Ga0495671_0135727 | 3300046692 | Bacteria | 1199 |
| 777 | Ga0495671_0175425 | 3300046692 | Bacteria | 1041 |
| 778 | Ga0495649_0324637 | 3300046694 | Bacteria | 781 |
| 779 | Ga0495589_0073693 | 3300046794 | Bacteria | 1666 |
| 780 | Ga0495589_0553487 | 3300046794 | Bacteria | 524 |
| 781 | Ga0495600_0001788 | 3300046809 | Bacteria | 12015 |
| 782 | Ga0495600_0035771 | 3300046809 | Bacteria | 3227 |
| 783 | Ga0495600_0046953 | 3300046809 | Bacteria | 2817 |
| 784 | Ga0495581_0000529 | 3300047315 | Bacteria | 19610 |
| 785 | Ga0495581_0231469 | 3300047315 | Bacteria | 1081 |
| 786 | Ga0495581_0292926 | 3300047315 | Bacteria | 951 |
| 787 | Ga0495581_0338982 | 3300047315 | Bacteria | 878 |
| 788 | Ga0495581_0487189 | 3300047315 | Bacteria | 717 |
| 789 | Ga0495581_0821646 | 3300047315 | Bacteria | 533 |
| 790 | Ga0495604_0018510 | 3300047317 | Bacteria | 5578 |
| 791 | Ga0495604_0068612 | 3300047317 | Bacteria | 2690 |
| 792 | Ga0495604_0508708 | 3300047317 | Bacteria | 780 |
| 793 | Ga0495604_0535105 | 3300047317 | Bacteria | 757 |
| 794 | Ga0495636_0082983 | 3300047318 | Bacteria | 1382 |
| 795 | Ga0495674_0016431 | 3300047319 | Bacteria | 6903 |
| 796 | Ga0495674_0088724 | 3300047319 | Bacteria | 2644 |
| 797 | Ga0495674_0284234 | 3300047319 | Bacteria | 1354 |
| 798 | Ga0495674_0488460 | 3300047319 | Bacteria | 986 |
| 799 | Ga0495672_0000894 | 3300047320 | Bacteria | 31271 |
| 800 | Ga0495672_0054549 | 3300047320 | Bacteria | 2335 |
| 801 | Ga0495676_0017967 | 3300047321 | Bacteria | 6240 |
| 802 | Ga0495676_1055676 | 3300047321 | Bacteria | 517 |
| 803 | Ga0495680_0054979 | 3300047322 | Bacteria | 3088 |
| 804 | Ga0495680_0060977 | 3300047322 | Bacteria | 2903 |
| 805 | Ga0495680_0131585 | 3300047322 | Bacteria | 1838 |
| 806 | Ga0495683_0163836 | 3300047323 | Bacteria | 1026 |
| 807 | Ga0495683_0289851 | 3300047323 | Bacteria | 706 |
| 808 | Ga0495683_0339548 | 3300047323 | Bacteria | 636 |
| 809 | Ga0495675_0033442 | 3300047444 | Bacteria | 3282 |
| 810 | Ga0495675_0119823 | 3300047444 | Bacteria | 1639 |
| 811 | Ga0495677_0027527 | 3300047445 | Bacteria | 2063 |
| 812 | Ga0495677_0144654 | 3300047445 | Bacteria | 914 |
| 813 | Ga0495685_085656 | 3300047447 | Bacteria | 1047 |
| 814 | Ga0495673_0104083 | 3300047469 | Bacteria | 1143 |
| 815 | Ga0495673_0175187 | 3300047469 | Bacteria | 815 |
| 816 | Ga0495681_0147637 | 3300047470 | Bacteria | 989 |
| 817 | Ga0495681_0160804 | 3300047470 | Bacteria | 935 |
| 818 | Ga0495684_0001145 | 3300047471 | Bacteria | 21346 |
| 819 | Ga0495684_0128129 | 3300047471 | Bacteria | 1908 |
| 820 | Ga0495684_0343619 | 3300047471 | Bacteria | 1061 |
| 821 | Ga0495686_0004867 | 3300047472 | Bacteria | 10831 |
| 822 | Ga0495686_0082629 | 3300047472 | Bacteria | 1960 |
| 823 | Ga0495686_0125388 | 3300047472 | Bacteria | 1527 |
| 824 | Ga0495686_0420027 | 3300047472 | Bacteria | 715 |
| 825 | Ga0495593_0000526 | 3300047673 | Bacteria | 21677 |
| 826 | Ga0495593_0000877 | 3300047673 | Bacteria | 17432 |
| 827 | Ga0495602_0009427 | 3300048088 | Bacteria | 10154 |
| 828 | Ga0495602_0035721 | 3300048088 | Bacteria | 4632 |
| 829 | Ga0495615_0047371 | 3300048090 | Bacteria | 1095 |
| 830 | Ga0495615_0125972 | 3300048090 | Bacteria | 745 |
| 831 | Ga0495626_0045400 | 3300048091 | Bacteria | 2051 |
| 832 | Ga0496100_0190172 | 3300048903 | Bacteria | 1490 |
| 833 | Ga0496100_0406092 | 3300048903 | Bacteria | 1038 |
| 834 | Ga0496101_0245391 | 3300048904 | Bacteria | 1394 |
| 835 | Ga0496101_1305519 | 3300048904 | Bacteria | 567 |
| 836 | Ga0496102_0228667 | 3300048905 | Bacteria | 1754 |
| 837 | Ga0496102_0274253 | 3300048905 | Bacteria | 1590 |
| 838 | Ga0496102_0315501 | 3300048905 | Bacteria | 1473 |
| 839 | Ga0496102_0603491 | 3300048905 | Bacteria | 1021 |
| 840 | Ga0496102_0716835 | 3300048905 | Bacteria | 923 |
| 841 | Ga0496102_1390654 | 3300048905 | Bacteria | 621 |
| 842 | Ga0496103_0036877 | 3300048906 | Bacteria | 2995 |
| 843 | Ga0496103_0283353 | 3300048906 | Bacteria | 1066 |
| 844 | Ga0496104_0049104 | 3300048907 | Bacteria | 3979 |
| 845 | Ga0496104_0237039 | 3300048907 | Bacteria | 1736 |
| 846 | Ga0496105_0166142 | 3300048908 | Bacteria | 1810 |
| 847 | Ga0496105_0321703 | 3300048908 | Bacteria | 1240 |
| 848 | Ga0496106_0277923 | 3300048909 | Bacteria | 1341 |
| 849 | Ga0496106_0349735 | 3300048909 | Bacteria | 1187 |
| 850 | Ga0496106_0499129 | 3300048909 | Bacteria | 978 |
| 851 | Ga0496107_0135503 | 3300048910 | Bacteria | 1819 |
| 852 | Ga0496107_0286458 | 3300048910 | Bacteria | 1226 |
| 853 | Ga0496107_0406553 | 3300048910 | Bacteria | 1012 |
| 854 | Ga0496107_1166956 | 3300048910 | Bacteria | 554 |
| 855 | Ga0496108_0005832 | 3300048911 | Bacteria | 9985 |
| 856 | Ga0496108_0077649 | 3300048911 | Bacteria | 2809 |
| 857 | Ga0496108_0163680 | 3300048911 | Bacteria | 1923 |
| 858 | Ga0496109_0232105 | 3300048912 | Bacteria | 1736 |
| 859 | Ga0496109_0242080 | 3300048912 | Bacteria | 1698 |
| 860 | Ga0496109_0656360 | 3300048912 | Bacteria | 986 |
| 861 | Ga0496110_0074390 | 3300048913 | Bacteria | 3017 |
| 862 | Ga0496110_0248964 | 3300048913 | Bacteria | 1617 |
| 863 | Ga0496110_0334689 | 3300048913 | Bacteria | 1379 |
| 864 | Ga0496110_0383326 | 3300048913 | Bacteria | 1281 |
| 865 | Ga0496110_0620058 | 3300048913 | Bacteria | 980 |
| 866 | Ga0496110_1206726 | 3300048913 | Bacteria | 665 |
| 867 | Ga0496111_0056466 | 3300048914 | Bacteria | 2841 |
| 868 | Ga0496111_0090509 | 3300048914 | Bacteria | 2241 |
| 869 | Ga0496111_0160257 | 3300048914 | Bacteria | 1670 |
| 870 | Ga0496111_1353757 | 3300048914 | Bacteria | 500 |
| 871 | Ga0496112_0000023 | 3300048915 | Bacteria | 156144 |
| 872 | Ga0496112_0128266 | 3300048915 | Bacteria | 2507 |
| 873 | Ga0496112_0360407 | 3300048915 | Bacteria | 1396 |
| 874 | Ga0496112_0399061 | 3300048915 | Bacteria | 1315 |
| 875 | Ga0496112_1497246 | 3300048915 | Bacteria | 589 |
| 876 | Ga0496113_0063748 | 3300048916 | Bacteria | 2785 |
| 877 | Ga0496113_1359157 | 3300048916 | Bacteria | 551 |
| 878 | Ga0496115_0108177 | 3300048918 | Bacteria | 2283 |
| 879 | Ga0496115_0123052 | 3300048918 | Bacteria | 2135 |
| 880 | Ga0496115_0286332 | 3300048918 | Bacteria | 1352 |
| 881 | Ga0496116_0007011 | 3300048919 | Bacteria | 10089 |
| 882 | Ga0496116_0250958 | 3300048919 | Bacteria | 881 |
| 883 | Ga0496117_0233888 | 3300048920 | Bacteria | 1013 |
| 884 | Ga0496117_0413288 | 3300048920 | Bacteria | 677 |
| 885 | Ga0496117_0525460 | 3300048920 | Bacteria | 568 |
| 886 | Ga0496118_0067018 | 3300048921 | Bacteria | 2617 |
| 887 | Ga0496118_0129349 | 3300048921 | Bacteria | 1625 |
| 888 | Ga0496119_0363954 | 3300048922 | Bacteria | 697 |
| 889 | Ga0496120_0190582 | 3300048923 | Bacteria | 1000 |
| 890 | Ga0496121_0013014 | 3300048924 | Bacteria | 8989 |
| 891 | Ga0496121_0014373 | 3300048924 | Bacteria | 8405 |
| 892 | Ga0496121_0091052 | 3300048924 | Bacteria | 2382 |
| 893 | Ga0496121_0182304 | 3300048924 | Bacteria | 1514 |
| 894 | Ga0496121_0339226 | 3300048924 | Bacteria | 1005 |
| 895 | Ga0496121_0388225 | 3300048924 | Bacteria | 918 |
| 896 | Ga0496122_0033823 | 3300048925 | Bacteria | 4197 |
| 897 | Ga0496122_0084789 | 3300048925 | Bacteria | 2189 |
| 898 | Ga0496122_0196896 | 3300048925 | Bacteria | 1182 |
| 899 | Ga0496123_0103219 | 3300048926 | Bacteria | 1652 |
| 900 | Ga0496124_0201315 | 3300048927 | Bacteria | 1514 |
| 901 | Ga0496124_0218488 | 3300048927 | Bacteria | 1435 |
| 902 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 903 | Ga0496125_0004699 | 3300048928 | Bacteria | 15565 |
| 904 | Ga0496126_0020218 | 3300048929 | Bacteria | 6533 |
| 905 | Ga0496126_0036489 | 3300048929 | Bacteria | 4596 |
| 906 | Ga0496126_0075786 | 3300048929 | Bacteria | 2985 |
| 907 | Ga0496126_0123538 | 3300048929 | Bacteria | 2242 |
| 908 | Ga0496126_0373350 | 3300048929 | Bacteria | 1162 |
| 909 | Ga0496126_0464960 | 3300048929 | Bacteria | 1016 |
| 910 | Ga0495678_135871 | 3300049459 | Bacteria | 810 |
| 911 | Ga0495682_0039370 | 3300049460 | Bacteria | 1735 |
| 912 | Ga0501031_0017619 | 3300049568 | Bacteria | 4643 |
| 913 | Ga0501032_0000030 | 3300049569 | Bacteria | 130405 |
| 914 | Ga0501033_0001069 | 3300049570 | Bacteria | 24919 |
| 915 | Ga0501033_0479227 | 3300049570 | Bacteria | 862 |
| 916 | Ga0501034_0000117 | 3300049571 | Bacteria | 144865 |
| 917 | Ga0501036_0000033 | 3300049572 | Bacteria | 88546 |
| 918 | Ga0501036_1092299 | 3300049572 | Bacteria | 652 |
| 919 | Ga0501037_0000090 | 3300049573 | Bacteria | 85021 |
| 920 | Ga0501038_0001923 | 3300049574 | Bacteria | 19177 |
| 921 | Ga0501038_0587592 | 3300049574 | Bacteria | 844 |
| 922 | Ga0501039_0000343 | 3300049575 | Bacteria | 33369 |
| 923 | Ga0501040_1343336 | 3300049576 | Bacteria | 519 |
| 924 | Ga0501042_0318617 | 3300049578 | Bacteria | 1123 |
| 925 | Ga0501042_0479340 | 3300049578 | Bacteria | 903 |
| 926 | Ga0501043_0001280 | 3300049579 | Bacteria | 22065 |
| 927 | Ga0501046_0000078 | 3300049580 | Bacteria | 102826 |
| 928 | Ga0501046_0589643 | 3300049580 | Bacteria | 789 |
| 929 | Ga0501047_0001617 | 3300049581 | Bacteria | 21972 |
| 930 | Ga0501047_0219789 | 3300049581 | Bacteria | 1756 |
| 931 | Ga0501048_0000235 | 3300049582 | Bacteria | 36704 |
| 932 | Ga0501048_0046128 | 3300049582 | Bacteria | 3112 |
| 933 | Ga0501067_0000299 | 3300049583 | Bacteria | 27211 |
| 934 | Ga0501067_0015314 | 3300049583 | Bacteria | 4244 |
| 935 | Ga0501068_0001611 | 3300049584 | Bacteria | 12020 |
| 936 | Ga0501069_0070531 | 3300049585 | Bacteria | 1957 |
| 937 | Ga0501069_0198636 | 3300049585 | Bacteria | 1162 |
| 938 | Ga0501070_0016001 | 3300049586 | Bacteria | 6303 |
| 939 | Ga0501070_0042040 | 3300049586 | Bacteria | 3806 |
| 940 | Ga0501070_0765201 | 3300049586 | Bacteria | 760 |
| 941 | Ga0501071_0070512 | 3300049587 | Bacteria | 2546 |
| 942 | Ga0501072_0000414 | 3300049588 | Bacteria | 30504 |
| 943 | Ga0501073_0000209 | 3300049589 | Bacteria | 38645 |
| 944 | Ga0501074_0000441 | 3300049590 | Bacteria | 24796 |
| 945 | Ga0501074_0272240 | 3300049590 | Bacteria | 1204 |
| 946 | Ga0501076_0531103 | 3300049592 | Bacteria | 970 |
| 947 | Ga0501079_0025908 | 3300049741 | Bacteria | 4498 |
| 948 | Ga0501080_0000567 | 3300049742 | Bacteria | 29245 |
| 949 | Ga0501083_0002984 | 3300049744 | Bacteria | 11751 |
| 950 | Ga0501035_0008484 | 3300049822 | Bacteria | 9568 |
| 951 | Ga0501035_0302631 | 3300049822 | Bacteria | 1347 |
| 952 | Ga0501044_0000304 | 3300049823 | Bacteria | 61877 |
| 953 | Ga0501044_0197185 | 3300049823 | Bacteria | 1973 |
| 954 | Ga0501045_0040887 | 3300049824 | Bacteria | 3372 |
| 955 | nmdc:mga03683_25565_c1 | 3300050489 | Bacteria | 2321 |
| 956 | nmdc:mga03683_37660_c1 | 3300050489 | Bacteria | 1972 |
| 957 | nmdc:mga03n38_23610_c1 | 3300050490 | Bacteria | 2505 |
| 958 | nmdc:mga03n38_2731_c1 | 3300050490 | Bacteria | 5524 |
| 959 | nmdc:mga03n38_345885_c1 | 3300050490 | Bacteria | 808 |
| 960 | nmdc:mga03n38_492990_c1 | 3300050490 | Bacteria | 687 |
| 961 | nmdc:mga00v17_21925_c1 | 3300050491 | Bacteria | 3679 |
| 962 | nmdc:mga00v17_2278_c1 | 3300050491 | Bacteria | 9845 |
| 963 | nmdc:mga00v17_355299_c1 | 3300050491 | Bacteria | 953 |
| 964 | nmdc:mga0yw44_1075814_c1 | 3300050492 | Bacteria | 544 |
| 965 | nmdc:mga0yw44_14035_c1 | 3300050492 | Bacteria | 4239 |
| 966 | nmdc:mga0yw44_591053_c1 | 3300050492 | Bacteria | 754 |
| 967 | nmdc:mga0yw44_610427_c1 | 3300050492 | Bacteria | 741 |
| 968 | nmdc:mga0yw44_77641_c1 | 3300050492 | Bacteria | 2075 |
| 969 | nmdc:mga0k408_131452_c1 | 3300050493 | Bacteria | 1486 |
| 970 | nmdc:mga0k408_157311_c1 | 3300050493 | Bacteria | 1013 |
| 971 | nmdc:mga0k408_290290_c1 | 3300050493 | Bacteria | 976 |
| 972 | nmdc:mga0k408_450689_c1 | 3300050493 | Bacteria | 764 |
| 973 | nmdc:mga06z11_123811_c1 | 3300050494 | Bacteria | 1445 |
| 974 | nmdc:mga06z11_210473_c1 | 3300050494 | Bacteria | 1133 |
| 975 | nmdc:mga06z11_755090_c1 | 3300050494 | Bacteria | 593 |
| 976 | nmdc:mga06z11_77693_c1 | 3300050494 | Bacteria | 1773 |
| 977 | nmdc:mga06z11_7845_c1 | 3300050494 | Bacteria | 4416 |
| 978 | nmdc:mga06z11_964168_c1 | 3300050494 | Bacteria | 520 |
| 979 | nmdc:mga04h51_111053_c1 | 3300050495 | Bacteria | 1011 |
| 980 | nmdc:mga04h51_14733_c1 | 3300050495 | Bacteria | 1844 |
| 981 | nmdc:mga07m45_10213_c1 | 3300050496 | Bacteria | 4896 |
| 982 | nmdc:mga07m45_260018_c1 | 3300050496 | Bacteria | 1010 |
| 983 | nmdc:mga07m45_306879_c1 | 3300050496 | Bacteria | 923 |
| 984 | nmdc:mga07m45_466221_c1 | 3300050496 | Bacteria | 732 |
| 985 | nmdc:mga08y16_2070819_c1 | 3300050511 | Bacteria | 517 |
| 986 | nmdc:mga08y16_54346_c1 | 3300050511 | Bacteria | 4184 |
| 987 | nmdc:mga0n895_1646812_c1 | 3300050512 | Bacteria | 605 |
| 988 | nmdc:mga0n895_218891_c1 | 3300050512 | Bacteria | 1933 |
| 989 | nmdc:mga0rr50_472846_c1 | 3300050513 | Bacteria | 1064 |
| 990 | nmdc:mga08x19_349411_c1 | 3300050514 | Bacteria | 1032 |
| 991 | nmdc:mga0sz30_40347_c1 | 3300050516 | Bacteria | 1962 |
| 992 | nmdc:mga0sz30_420904_c1 | 3300050516 | Bacteria | 599 |
| 993 | nmdc:mga0sz30_54642_c1 | 3300050516 | Bacteria | 1699 |
| 994 | Ga0495601_0018722 | 3300053077 | Bacteria | 4215 |
| 995 | Ga0495601_0021234 | 3300053077 | Bacteria | 3974 |
| 996 | Ga0495601_0170570 | 3300053077 | Bacteria | 1422 |
| 997 | Ga0495601_0257654 | 3300053077 | Bacteria | 1139 |
| 998 | Ga0495612_0015857 | 3300053078 | Bacteria | 3020 |
| 999 | Ga0495612_0070130 | 3300053078 | Bacteria | 1460 |
| 1000 | Ga0500610_0128034 | 3300053079 | Bacteria | 1294 |
| 1001 | Ga0500610_0277187 | 3300053079 | Bacteria | 755 |
| 1002 | Ga0500635_0009036 | 3300053080 | Bacteria | 2752 |
| 1003 | Ga0495655_0019706 | 3300053083 | Bacteria | 1502 |
| 1004 | Ga0495655_0066392 | 3300053083 | Bacteria | 998 |
| 1005 | Ga0495595_0001351 | 3300053084 | Bacteria | 9525 |
| 1006 | Ga0495595_0005676 | 3300053084 | Bacteria | 5052 |
| 1007 | Ga0495619_0204408 | 3300053085 | Bacteria | 1367 |
| 1008 | Ga0495619_0277073 | 3300053085 | Bacteria | 1162 |
| 1009 | Ga0495619_1088320 | 3300053085 | Bacteria | 532 |
| 1010 | Ga0500578_0237796 | 3300053086 | Bacteria | 1101 |
| 1011 | Ga0500644_0163297 | 3300053088 | Bacteria | 901 |
| 1012 | Ga0500644_0316851 | 3300053088 | Bacteria | 670 |
| 1013 | Ga0500581_177134 | 3300053089 | Bacteria | 972 |
| 1014 | Ga0500651_0012461 | 3300053093 | Bacteria | 5156 |
| 1015 | Ga0500651_0031822 | 3300053093 | Bacteria | 3323 |
| 1016 | Ga0500651_0161567 | 3300053093 | Bacteria | 1339 |
| 1017 | Ga0500651_0248473 | 3300053093 | Bacteria | 1035 |
| 1018 | Ga0500566_0000128 | 3300053094 | Bacteria | 38564 |
| 1019 | Ga0500566_0003981 | 3300053094 | Bacteria | 8821 |
| 1020 | Ga0500566_0009422 | 3300053094 | Bacteria | 5771 |
| 1021 | Ga0500640_000168 | 3300053095 | Bacteria | 13302 |
| 1022 | Ga0500640_033975 | 3300053095 | Bacteria | 2239 |
| 1023 | Ga0500641_0003698 | 3300053096 | Bacteria | 5399 |
| 1024 | Ga0500641_0013736 | 3300053096 | Bacteria | 2978 |
| 1025 | Ga0500648_246944 | 3300053097 | Bacteria | 844 |
| 1026 | Ga0500650_0009359 | 3300053098 | Bacteria | 3928 |
| 1027 | Ga0500554_023397 | 3300053102 | Bacteria | 1737 |
| 1028 | Ga0500554_039363 | 3300053102 | Bacteria | 1443 |
| 1029 | Ga0500554_315860 | 3300053102 | Bacteria | 503 |
| 1030 | Ga0500555_039621 | 3300053103 | Bacteria | 1315 |
| 1031 | Ga0500556_0000045 | 3300053104 | Bacteria | 130653 |
| 1032 | Ga0500556_0250891 | 3300053104 | Bacteria | 697 |
| 1033 | Ga0500569_162679 | 3300053109 | Bacteria | 755 |
| 1034 | Ga0500572_000620 | 3300053111 | Bacteria | 11912 |
| 1035 | Ga0500572_040917 | 3300053111 | Bacteria | 1343 |
| 1036 | Ga0500591_120068 | 3300053115 | Bacteria | 1082 |
| 1037 | Ga0500592_000231 | 3300053116 | Bacteria | 10183 |
| 1038 | Ga0500593_021146 | 3300053117 | Bacteria | 2864 |
| 1039 | Ga0500594_0129753 | 3300053118 | Bacteria | 797 |
| 1040 | Ga0500595_000398 | 3300053119 | Bacteria | 27905 |
| 1041 | Ga0500595_021448 | 3300053119 | Bacteria | 2304 |
| 1042 | Ga0500607_011628 | 3300053121 | Bacteria | 5198 |
| 1043 | Ga0500607_099110 | 3300053121 | Bacteria | 1450 |
| 1044 | Ga0500608_041088 | 3300053122 | Bacteria | 2218 |
| 1045 | Ga0500608_060870 | 3300053122 | Bacteria | 1805 |
| 1046 | Ga0500614_001536 | 3300053123 | Bacteria | 5475 |
| 1047 | Ga0500614_017335 | 3300053123 | Bacteria | 1627 |
| 1048 | Ga0500617_138974 | 3300053124 | Bacteria | 977 |
| 1049 | Ga0500618_002192 | 3300053125 | Bacteria | 7647 |
| 1050 | Ga0500618_118601 | 3300053125 | Bacteria | 599 |
| 1051 | Ga0500623_258140 | 3300053127 | Bacteria | 574 |
| 1052 | Ga0500628_143850 | 3300053129 | Bacteria | 663 |
| 1053 | Ga0500642_0000024 | 3300053130 | Bacteria | 134373 |
| 1054 | Ga0500652_000963 | 3300053131 | Bacteria | 9516 |
| 1055 | Ga0500658_0045660 | 3300053134 | Bacteria | 1771 |
| 1056 | Ga0500658_0214615 | 3300053134 | Bacteria | 881 |
| 1057 | Ga0500559_0000051 | 3300053136 | Bacteria | 91468 |
| 1058 | Ga0500559_0013716 | 3300053136 | Bacteria | 3427 |
| 1059 | Ga0500559_0045348 | 3300053136 | Bacteria | 1924 |
| 1060 | Ga0500564_039855 | 3300053138 | Bacteria | 2163 |
| 1061 | Ga0500568_0004072 | 3300053139 | Bacteria | 7914 |
| 1062 | Ga0500577_0081679 | 3300053142 | Bacteria | 1290 |
| 1063 | Ga0500579_127333 | 3300053143 | Bacteria | 1207 |
| 1064 | Ga0500586_000623 | 3300053145 | Bacteria | 7202 |
| 1065 | Ga0500586_040909 | 3300053145 | Bacteria | 1572 |
| 1066 | Ga0500590_025192 | 3300053148 | Bacteria | 3088 |
| 1067 | Ga0500590_133908 | 3300053148 | Bacteria | 1143 |
| 1068 | Ga0500590_138224 | 3300053148 | Bacteria | 1117 |
| 1069 | Ga0500603_000356 | 3300053150 | Bacteria | 11934 |
| 1070 | Ga0500603_052018 | 3300053150 | Bacteria | 1123 |
| 1071 | Ga0500604_0194807 | 3300053151 | Bacteria | 696 |
| 1072 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 1073 | Ga0500616_0159686 | 3300053153 | Bacteria | 1035 |
| 1074 | Ga0500619_185859 | 3300053154 | Bacteria | 700 |
| 1075 | Ga0500620_001931 | 3300053155 | Bacteria | 4012 |
| 1076 | Ga0500622_0002139 | 3300053156 | Bacteria | 14682 |
| 1077 | Ga0500624_011437 | 3300053157 | Bacteria | 1296 |
| 1078 | Ga0500624_072423 | 3300053157 | Bacteria | 676 |
| 1079 | Ga0500627_0177519 | 3300053158 | Bacteria | 958 |
| 1080 | Ga0500630_025238 | 3300053159 | Bacteria | 2933 |
| 1081 | Ga0500633_0013325 | 3300053160 | Bacteria | 2301 |
| 1082 | Ga0500634_0041699 | 3300053161 | Bacteria | 2492 |
| 1083 | Ga0500634_0184765 | 3300053161 | Bacteria | 933 |
| 1084 | Ga0500638_000751 | 3300053162 | Bacteria | 8810 |
| 1085 | Ga0500638_039001 | 3300053162 | Bacteria | 2306 |
| 1086 | Ga0500638_063626 | 3300053162 | Bacteria | 1770 |
| 1087 | Ga0500638_094515 | 3300053162 | Bacteria | 1402 |
| 1088 | Ga0500639_000125 | 3300053163 | Bacteria | 36885 |
| 1089 | Ga0500636_0000249 | 3300053177 | Bacteria | 29583 |
| 1090 | Ga0500636_0002084 | 3300053177 | Bacteria | 11042 |
| 1091 | Ga0500636_0354281 | 3300053177 | Bacteria | 699 |
| 1092 | Ga0500637_0000118 | 3300053178 | Bacteria | 28882 |
| 1093 | Ga0500637_0219892 | 3300053178 | Bacteria | 1074 |
| 1094 | Ga0500637_0226791 | 3300053178 | Bacteria | 1053 |
| 1095 | Ga0500637_0414618 | 3300053178 | Bacteria | 695 |
| 1096 | Ga0500567_098423 | 3300053723 | Bacteria | 1221 |
| 1097 | Ga0500645_090029 | 3300053730 | Bacteria | 870 |
| 1098 | Ga0500609_016844 | 3300053731 | Bacteria | 992 |
| 1099 | Ga0500596_000129 | 3300053735 | Bacteria | 11049 |
| 1100 | Ga0500596_011038 | 3300053735 | Bacteria | 1386 |
| 1101 | Ga0500601_005462 | 3300053737 | Bacteria | 1391 |
| 1102 | Ga0500601_015500 | 3300053737 | Bacteria | 866 |
| 1103 | Ga0501084_0102518 | 3300054114 | Bacteria | 2403 |
| 1104 | Ga0500661_000042 | 3300055283 | Bacteria | 19485 |
| 1105 | Ga0500661_003202 | 3300055283 | Bacteria | 3080 |
| 1106 | Ga0501082_0103155 | 3300060353 | Bacteria | 2467 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005842 | Ga0068858_102352186 | Ga0068858_1023521862 | 112 |
| 2 | 3300005719 | Ga0068861_101148903 | Ga0068861_1011489032 | 129 |
| 3 | 3300005539 | Ga0068853_101497639 | Ga0068853_1014976392 | 130 |
| 4 | 3300005563 | Ga0068855_101150552 | Ga0068855_1011505521 | 130 |
| 5 | 3300037466 | Ga0395898_0017739 | Ga0395898_0017739_2854_3285 | 132 |
| 6 | 3300005327 | Ga0070658_10043632 | Ga0070658_100436323 | 134 |
| 7 | 3300005344 | Ga0070661_101665914 | Ga0070661_1016659141 | 134 |
| 8 | 3300025909 | Ga0207705_10041505 | Ga0207705_100415053 | 134 |
| 9 | 3300031911 | Ga0307412_10154604 | Ga0307412_101546043 | 134 |
| 10 | 3300046524 | Ga0495648_0003557 | Ga0495648_0003557_692_1147 | 134 |
| 11 | 3300048929 | Ga0496126_0464960 | Ga0496126_0464960_58_498 | 134 |
| 12 | 3300005436 | Ga0070713_101608477 | Ga0070713_1016084771 | 135 |
| 13 | 3300048929 | Ga0496126_0036489 | Ga0496126_0036489_3119_3568 | 135 |
| 14 | 3300053161 | Ga0500634_0041699 | Ga0500634_0041699_705_1145 | 135 |
| 15 | 3300005458 | Ga0070681_10734442 | Ga0070681_107344422 | 136 |
| 16 | 3300013308 | Ga0157375_10337975 | Ga0157375_103379751 | 136 |
| 17 | 3300025912 | Ga0207707_10508970 | Ga0207707_105089701 | 136 |
| 18 | 3300037418 | Ga0395900_0185512 | Ga0395900_0185512_331_780 | 136 |
| 19 | 3300005331 | Ga0070670_100762094 | Ga0070670_1007620941 | 137 |
| 20 | 3300005337 | Ga0070682_100501566 | Ga0070682_1005015662 | 137 |
| 21 | 3300005842 | Ga0068858_100041366 | Ga0068858_1000413662 | 137 |
| 22 | 3300006173 | Ga0070716_100141123 | Ga0070716_1001411232 | 137 |
| 23 | 3300006173 | Ga0070716_101051224 | Ga0070716_1010512242 | 137 |
| 24 | 3300006195 | Ga0075366_10680381 | Ga0075366_106803812 | 137 |
| 25 | 3300006237 | Ga0097621_100157271 | Ga0097621_1001572711 | 137 |
| 26 | 3300006358 | Ga0068871_100608175 | Ga0068871_1006081752 | 137 |
| 27 | 3300009177 | Ga0105248_10972242 | Ga0105248_109722421 | 137 |
| 28 | 3300014968 | Ga0157379_11844811 | Ga0157379_118448112 | 137 |
| 29 | 3300025939 | Ga0207665_10036445 | Ga0207665_100364452 | 137 |
| 30 | 3300026088 | Ga0207641_10196970 | Ga0207641_101969702 | 137 |
| 31 | 3300027866 | Ga0209813_10228056 | Ga0209813_102280561 | 137 |
| 32 | 3300028786 | Ga0307517_10000542 | Ga0307517_1000054264 | 137 |
| 33 | 3300031456 | Ga0307513_10312420 | Ga0307513_103124201 | 137 |
| 34 | 3300031616 | Ga0307508_10054533 | Ga0307508_100545332 | 137 |
| 35 | 3300034820 | Ga0373959_0012270 | Ga0373959_0012270_331_765 | 137 |
| 36 | 3300035085 | Ga0373929_0008655 | Ga0373929_0008655_433_867 | 137 |
| 37 | 3300035112 | Ga0373932_0115129 | Ga0373932_0115129_290_724 | 137 |
| 38 | 3300035691 | Ga0373931_0001627 | Ga0373931_0001627_1399_1833 | 137 |
| 39 | 3300047323 | Ga0495683_0289851 | Ga0495683_0289851_115_549 | 137 |
| 40 | 3300048904 | Ga0496101_0245391 | Ga0496101_0245391_155_589 | 137 |
| 41 | 3300048906 | Ga0496103_0036877 | Ga0496103_0036877_62_496 | 137 |
| 42 | 3300048908 | Ga0496105_0166142 | Ga0496105_0166142_32_466 | 137 |
| 43 | 3300048909 | Ga0496106_0277923 | Ga0496106_0277923_659_1093 | 137 |
| 44 | 3300048911 | Ga0496108_0005832 | Ga0496108_0005832_151_585 | 137 |
| 45 | 3300048914 | Ga0496111_0090509 | Ga0496111_0090509_748_1182 | 137 |
| 46 | 3300048915 | Ga0496112_0128266 | Ga0496112_0128266_560_994 | 137 |
| 47 | 3300048916 | Ga0496113_0063748 | Ga0496113_0063748_169_603 | 137 |
| 48 | 3300048916 | Ga0496113_1359157 | Ga0496113_1359157_68_520 | 137 |
| 49 | 3300048918 | Ga0496115_0286332 | Ga0496115_0286332_845_1318 | 137 |
| 50 | 3300050494 | nmdc:mga06z11_123811_c1 | nmdc:mga06z11_123811_c1_578_1012 | 137 |
| 51 | 3300053077 | Ga0495601_0170570 | Ga0495601_0170570_675_1109 | 137 |
| 52 | 3300053084 | Ga0495595_0005676 | Ga0495595_0005676_3960_4394 | 137 |
| 53 | 3300053085 | Ga0495619_0204408 | Ga0495619_0204408_276_710 | 137 |
| 54 | 3300025939 | Ga0207665_10811469 | Ga0207665_108114692 | 138 |
| 55 | 3300031241 | Ga0265325_10001890 | Ga0265325_100018902 | 138 |
| 56 | 3300031595 | Ga0265313_10052638 | Ga0265313_100526383 | 138 |
| 57 | 3300041505 | Ga0451849_1079513 | Ga0451849_1079513_87_536 | 138 |
| 58 | 3300047317 | Ga0495604_0535105 | Ga0495604_0535105_37_474 | 138 |
| 59 | 3300005337 | Ga0070682_100425063 | Ga0070682_1004250631 | 139 |
| 60 | 3300005458 | Ga0070681_10082287 | Ga0070681_100822872 | 139 |
| 61 | 3300005530 | Ga0070679_100879258 | Ga0070679_1008792581 | 139 |
| 62 | 3300005539 | Ga0068853_100724445 | Ga0068853_1007244452 | 139 |
| 63 | 3300005547 | Ga0070693_100742460 | Ga0070693_1007424601 | 139 |
| 64 | 3300005614 | Ga0068856_101744280 | Ga0068856_1017442802 | 139 |
| 65 | 3300006237 | Ga0097621_100142279 | Ga0097621_1001422793 | 139 |
| 66 | 3300009093 | Ga0105240_10287474 | Ga0105240_102874742 | 139 |
| 67 | 3300009551 | Ga0105238_10162102 | Ga0105238_101621023 | 139 |
| 68 | 3300010159 | Ga0099796_10038063 | Ga0099796_100380632 | 139 |
| 69 | 3300013307 | Ga0157372_10706717 | Ga0157372_107067172 | 139 |
| 70 | 3300025912 | Ga0207707_10004597 | Ga0207707_1000459711 | 139 |
| 71 | 3300025913 | Ga0207695_10298911 | Ga0207695_102989113 | 139 |
| 72 | 3300025921 | Ga0207652_10012904 | Ga0207652_100129048 | 139 |
| 73 | 3300026041 | Ga0207639_10910572 | Ga0207639_109105722 | 139 |
| 74 | 3300026078 | Ga0207702_10268410 | Ga0207702_102684103 | 139 |
| 75 | 3300037068 | Ga0373925_0677298 | Ga0373925_0677298_153_587 | 139 |
| 76 | 3300048906 | Ga0496103_0283353 | Ga0496103_0283353_397_831 | 139 |
| 77 | 3300006038 | Ga0075365_10019900 | Ga0075365_100199004 | 140 |
| 78 | 3300006042 | Ga0075368_10033435 | Ga0075368_100334352 | 140 |
| 79 | 3300006051 | Ga0075364_10013014 | Ga0075364_100130148 | 140 |
| 80 | 3300006177 | Ga0075362_10008329 | Ga0075362_100083296 | 140 |
| 81 | 3300025315 | Ga0207697_10039080 | Ga0207697_100390802 | 140 |
| 82 | 3300027866 | Ga0209813_10093866 | Ga0209813_100938662 | 140 |
| 83 | 3300035111 | Ga0373923_0037675 | Ga0373923_0037675_759_1196 | 140 |
| 84 | 3300035113 | Ga0373936_0139431 | Ga0373936_0139431_559_996 | 140 |
| 85 | 3300035117 | Ga0373953_0126273 | Ga0373953_0126273_522_959 | 140 |
| 86 | 3300035170 | Ga0373943_0121324 | Ga0373943_0121324_827_1264 | 140 |
| 87 | 3300035692 | Ga0373935_0124834 | Ga0373935_0124834_620_1057 | 140 |
| 88 | 3300035695 | Ga0373927_0006928 | Ga0373927_0006928_1395_1853 | 140 |
| 89 | 3300035695 | Ga0373927_0110774 | Ga0373927_0110774_701_1138 | 140 |
| 90 | 3300035725 | Ga0373947_0077884 | Ga0373947_0077884_75_512 | 140 |
| 91 | 3300037068 | Ga0373925_0076473 | Ga0373925_0076473_1346_1783 | 140 |
| 92 | 3300041451 | Ga0451791_0562369 | Ga0451791_0562369_994_1440 | 140 |
| 93 | 3300046472 | Ga0495580_0032562 | Ga0495580_0032562_526_963 | 140 |
| 94 | 3300046473 | Ga0495582_0067449 | Ga0495582_0067449_458_895 | 140 |
| 95 | 3300046475 | Ga0495639_0099139 | Ga0495639_0099139_562_999 | 140 |
| 96 | 3300046475 | Ga0495639_0128946 | Ga0495639_0128946_301_759 | 140 |
| 97 | 3300046477 | Ga0495664_0159492 | Ga0495664_0159492_167_604 | 140 |
| 98 | 3300046511 | Ga0495608_0573546 | Ga0495608_0573546_25_462 | 140 |
| 99 | 3300046517 | Ga0495630_0211687 | Ga0495630_0211687_651_1088 | 140 |
| 100 | 3300046523 | Ga0495644_0219979 | Ga0495644_0219979_29_472 | 140 |
| 101 | 3300046526 | Ga0495666_0555330 | Ga0495666_0555330_51_488 | 140 |
| 102 | 3300046535 | Ga0495586_0157218 | Ga0495586_0157218_335_772 | 140 |
| 103 | 3300046642 | Ga0495634_0361001 | Ga0495634_0361001_377_814 | 140 |
| 104 | 3300046663 | Ga0495635_0074085 | Ga0495635_0074085_552_989 | 140 |
| 105 | 3300046680 | Ga0495646_0087710 | Ga0495646_0087710_809_1246 | 140 |
| 106 | 3300046683 | Ga0495658_0327171 | Ga0495658_0327171_325_762 | 140 |
| 107 | 3300046689 | Ga0495613_0100697 | Ga0495613_0100697_274_711 | 140 |
| 108 | 3300046690 | Ga0495624_0044293 | Ga0495624_0044293_1405_1842 | 140 |
| 109 | 3300047315 | Ga0495581_0292926 | Ga0495581_0292926_330_767 | 140 |
| 110 | 3300047319 | Ga0495674_0088724 | Ga0495674_0088724_536_973 | 140 |
| 111 | 3300050489 | nmdc:mga03683_25565_c1 | nmdc:mga03683_25565_c1_1769_2221 | 140 |
| 112 | 3300050491 | nmdc:mga00v17_2278_c1 | nmdc:mga00v17_2278_c1_7801_8253 | 140 |
| 113 | 3300050492 | nmdc:mga0yw44_14035_c1 | nmdc:mga0yw44_14035_c1_2665_3117 | 140 |
| 114 | 3300050495 | nmdc:mga04h51_111053_c1 | nmdc:mga04h51_111053_c1_207_659 | 140 |
| 115 | 3300050511 | nmdc:mga08y16_2070819_c1 | nmdc:mga08y16_2070819_c1_26_478 | 140 |
| 116 | iso_pu_bacteria | 2643221621 | 2644122945 | 140 |
| 117 | iso_pu_bacteria | 2935959822 | 2935965981 | 140 |
| 118 | iso_pu_bacteria | 3005710791 | 3005717311 | 140 |
| 119 | iso_pu_bacteria | 8006926726 | 8006931687 | 140 |
| 120 | 3300003203 | JGI25406J46586_10004272 | JGI25406J46586_100042726 | 142 |
| 121 | 3300005327 | Ga0070658_10005658 | Ga0070658_1000565810 | 142 |
| 122 | 3300005329 | Ga0070683_100089709 | Ga0070683_1000897092 | 142 |
| 123 | 3300005336 | Ga0070680_100016960 | Ga0070680_1000169603 | 142 |
| 124 | 3300005339 | Ga0070660_100029340 | Ga0070660_1000293404 | 142 |
| 125 | 3300005341 | Ga0070691_10011291 | Ga0070691_100112912 | 142 |
| 126 | 3300005344 | Ga0070661_100003193 | Ga0070661_1000031933 | 142 |
| 127 | 3300005366 | Ga0070659_100348585 | Ga0070659_1003485852 | 142 |
| 128 | 3300005458 | Ga0070681_10482526 | Ga0070681_104825262 | 142 |
| 129 | 3300005530 | Ga0070679_100146761 | Ga0070679_1001467614 | 142 |
| 130 | 3300005535 | Ga0070684_100159258 | Ga0070684_1001592581 | 142 |
| 131 | 3300005539 | Ga0068853_100009893 | Ga0068853_1000098937 | 142 |
| 132 | 3300005563 | Ga0068855_100064018 | Ga0068855_1000640182 | 142 |
| 133 | 3300005563 | Ga0068855_101946364 | Ga0068855_1019463641 | 142 |
| 134 | 3300005834 | Ga0068851_10022304 | Ga0068851_100223042 | 142 |
| 135 | 3300005985 | Ga0081539_10001606 | Ga0081539_100016066 | 142 |
| 136 | 3300009093 | Ga0105240_10017853 | Ga0105240_100178532 | 142 |
| 137 | 3300009551 | Ga0105238_10046886 | Ga0105238_100468863 | 142 |
| 138 | 3300010375 | Ga0105239_10233646 | Ga0105239_102336463 | 142 |
| 139 | 3300013105 | Ga0157369_10246117 | Ga0157369_102461173 | 142 |
| 140 | 3300025321 | Ga0207656_10101145 | Ga0207656_101011452 | 142 |
| 141 | 3300025909 | Ga0207705_10114003 | Ga0207705_101140031 | 142 |
| 142 | 3300025912 | Ga0207707_10003157 | Ga0207707_100031574 | 142 |
| 143 | 3300025913 | Ga0207695_10155249 | Ga0207695_101552492 | 142 |
| 144 | 3300025919 | Ga0207657_10004638 | Ga0207657_1000463810 | 142 |
| 145 | 3300025921 | Ga0207652_10060805 | Ga0207652_100608055 | 142 |
| 146 | 3300025924 | Ga0207694_10013152 | Ga0207694_100131523 | 142 |
| 147 | 3300025944 | Ga0207661_10146271 | Ga0207661_101462713 | 142 |
| 148 | 3300025949 | Ga0207667_10177738 | Ga0207667_101777383 | 142 |
| 149 | 3300026041 | Ga0207639_10187226 | Ga0207639_101872262 | 142 |
| 150 | 3300026116 | Ga0207674_10012960 | Ga0207674_100129603 | 142 |
| 151 | 3300026142 | Ga0207698_10071295 | Ga0207698_100712952 | 142 |
| 152 | 3300041441 | Ga0451787_541596 | Ga0451787_541596_17_448 | 142 |
| 153 | 3300046477 | Ga0495664_0063665 | Ga0495664_0063665_405_833 | 142 |
| 154 | 3300046543 | Ga0495645_0001274 | Ga0495645_0001274_12196_12624 | 142 |
| 155 | 3300053077 | Ga0495601_0021234 | Ga0495601_0021234_2822_3250 | 142 |
| 156 | 3300053078 | Ga0495612_0015857 | Ga0495612_0015857_1157_1585 | 142 |
| 157 | iso_pu_bacteria | 2602042107 | 2603860552 | 142 |
| 158 | iso_pu_bacteria | 2857524615 | 2857525507 | 142 |
| 159 | iso_pu_bacteria | 2885374607 | 2885375159 | 142 |
| 160 | iso_pu_bacteria | 2904690495 | 2904691263 | 142 |
| 161 | iso_pu_bacteria | 2904699407 | 2904704931 | 142 |
| 162 | iso_pu_bacteria | 2919073203 | 2919074684 | 142 |
| 163 | iso_pu_bacteria | 8056689827 | 8056693122 | 142 |
| 164 | 3300006178 | Ga0075367_10030079 | Ga0075367_100300793 | 143 |
| 165 | 3300053094 | Ga0500566_0009422 | Ga0500566_0009422_4485_4916 | 143 |
| 166 | 3300053102 | Ga0500554_039363 | Ga0500554_039363_10_441 | 143 |
| 167 | 3300053119 | Ga0500595_000398 | Ga0500595_000398_2865_3296 | 143 |
| 168 | 3300053123 | Ga0500614_017335 | Ga0500614_017335_90_521 | 143 |
| 169 | 3300053162 | Ga0500638_000751 | Ga0500638_000751_5150_5581 | 143 |
| 170 | 3300053178 | Ga0500637_0000118 | Ga0500637_0000118_3353_3784 | 143 |
| 171 | 3300055283 | Ga0500661_000042 | Ga0500661_000042_10523_10954 | 143 |
| 172 | iso_pu_bacteria | 2507262055 | 2507509317 | 143 |
| 173 | iso_pu_bacteria | 2513237098 | 2513672920 | 143 |
| 174 | iso_pu_bacteria | 2513237101 | 2513698853 | 143 |
| 175 | iso_pu_bacteria | 2513237141 | 2513887887 | 143 |
| 176 | iso_pu_bacteria | 2524023210 | 2524470964 | 143 |
| 177 | iso_pu_bacteria | 2643221651 | 2644288985 | 143 |
| 178 | iso_pu_bacteria | 2721755755 | 2723842661 | 143 |
| 179 | iso_pu_bacteria | 2791355197 | 2793066779 | 143 |
| 180 | iso_pu_bacteria | 2791355199 | 2793080468 | 143 |
| 181 | iso_pu_bacteria | 2842038055 | 2842039736 | 143 |
| 182 | iso_pu_bacteria | 2842045827 | 2842047318 | 143 |
| 183 | iso_pu_bacteria | 2874604998 | 2874606664 | 143 |
| 184 | iso_pu_bacteria | 2879110137 | 2879112000 | 143 |
| 185 | iso_pu_bacteria | 2885409591 | 2885411251 | 143 |
| 186 | iso_pu_bacteria | 2889033259 | 2889034043 | 143 |
| 187 | iso_pu_bacteria | 2893066018 | 2893070770 | 143 |
| 188 | iso_pu_bacteria | 2903768456 | 2903770954 | 143 |
| 189 | iso_pu_bacteria | 2906610324 | 2906616585 | 143 |
| 190 | iso_pu_bacteria | 2908756301 | 2908759095 | 143 |
| 191 | iso_pu_bacteria | 2922361189 | 2922367444 | 143 |
| 192 | iso_pu_bacteria | 2922386360 | 2922389859 | 143 |
| 193 | iso_pu_bacteria | 2922425934 | 2922431392 | 143 |
| 194 | iso_pu_bacteria | 2935630451 | 2935633986 | 143 |
| 195 | iso_pu_bacteria | 2941507105 | 2941510711 | 143 |
| 196 | iso_pu_bacteria | 2941515067 | 2941518095 | 143 |
| 197 | iso_pu_bacteria | 2941523033 | 2941527034 | 143 |
| 198 | iso_pu_bacteria | 3005474847 | 3005481185 | 143 |
| 199 | iso_pu_bacteria | 8006964411 | 8006965968 | 143 |
| 200 | iso_pu_bacteria | 8006984368 | 8006989904 | 143 |
| 201 | iso_pu_bacteria | 8006994254 | 8006998260 | 143 |
| 202 | iso_pu_bacteria | 8019555841 | 8019565408 | 143 |
| 203 | iso_pu_bacteria | 8056673599 | 8056677884 | 143 |
| 204 | iso_pu_bacteria | 8056681323 | 8056684486 | 143 |
| 205 | 3300003203 | JGI25406J46586_10000506 | JGI25406J46586_1000050617 | 144 |
| 206 | 3300005328 | Ga0070676_10276015 | Ga0070676_102760152 | 144 |
| 207 | 3300005329 | Ga0070683_100010541 | Ga0070683_1000105416 | 144 |
| 208 | 3300005336 | Ga0070680_100035793 | Ga0070680_1000357933 | 144 |
| 209 | 3300005347 | Ga0070668_100099179 | Ga0070668_1000991793 | 144 |
| 210 | 3300005347 | Ga0070668_101217584 | Ga0070668_1012175842 | 144 |
| 211 | 3300005354 | Ga0070675_100738649 | Ga0070675_1007386492 | 144 |
| 212 | 3300005355 | Ga0070671_100184578 | Ga0070671_1001845781 | 144 |
| 213 | 3300005355 | Ga0070671_101555660 | Ga0070671_1015556601 | 144 |
| 214 | 3300005367 | Ga0070667_101166568 | Ga0070667_1011665681 | 144 |
| 215 | 3300005455 | Ga0070663_101300199 | Ga0070663_1013001991 | 144 |
| 216 | 3300005456 | Ga0070678_100038182 | Ga0070678_1000381823 | 144 |
| 217 | 3300005459 | Ga0068867_100219687 | Ga0068867_1002196872 | 144 |
| 218 | 3300005530 | Ga0070679_101183553 | Ga0070679_1011835532 | 144 |
| 219 | 3300005535 | Ga0070684_100010579 | Ga0070684_1000105795 | 144 |
| 220 | 3300005539 | Ga0068853_101020511 | Ga0068853_1010205112 | 144 |
| 221 | 3300005543 | Ga0070672_100130487 | Ga0070672_1001304872 | 144 |
| 222 | 3300005548 | Ga0070665_100033424 | Ga0070665_1000334243 | 144 |
| 223 | 3300005548 | Ga0070665_100838229 | Ga0070665_1008382292 | 144 |
| 224 | 3300005548 | Ga0070665_101436910 | Ga0070665_1014369102 | 144 |
| 225 | 3300005548 | Ga0070665_101631767 | Ga0070665_1016317672 | 144 |
| 226 | 3300005577 | Ga0068857_100959311 | Ga0068857_1009593111 | 144 |
| 227 | 3300005844 | Ga0068862_100366828 | Ga0068862_1003668282 | 144 |
| 228 | 3300005844 | Ga0068862_100540415 | Ga0068862_1005404152 | 144 |
| 229 | 3300005844 | Ga0068862_101118104 | Ga0068862_1011181042 | 144 |
| 230 | 3300005844 | Ga0068862_101329463 | Ga0068862_1013294632 | 144 |
| 231 | 3300005985 | Ga0081539_10001572 | Ga0081539_1000157237 | 144 |
| 232 | 3300006051 | Ga0075364_10530689 | Ga0075364_105306892 | 144 |
| 233 | 3300006051 | Ga0075364_10599679 | Ga0075364_105996791 | 144 |
| 234 | 3300006177 | Ga0075362_10217222 | Ga0075362_102172221 | 144 |
| 235 | 3300006178 | Ga0075367_10402752 | Ga0075367_104027522 | 144 |
| 236 | 3300006178 | Ga0075367_10452429 | Ga0075367_104524292 | 144 |
| 237 | 3300006237 | Ga0097621_101524750 | Ga0097621_1015247502 | 144 |
| 238 | 3300006846 | Ga0075430_100699232 | Ga0075430_1006992322 | 144 |
| 239 | 3300009545 | Ga0105237_10910303 | Ga0105237_109103032 | 144 |
| 240 | 3300013105 | Ga0157369_10045792 | Ga0157369_100457924 | 144 |
| 241 | 3300013308 | Ga0157375_10346570 | Ga0157375_103465701 | 144 |
| 242 | 3300013308 | Ga0157375_11248409 | Ga0157375_112484091 | 144 |
| 243 | 3300013308 | Ga0157375_12662694 | Ga0157375_126626941 | 144 |
| 244 | 3300014325 | Ga0163163_10637323 | Ga0163163_106373232 | 144 |
| 245 | 3300014326 | Ga0157380_11366433 | Ga0157380_113664332 | 144 |
| 246 | 3300014968 | Ga0157379_12602923 | Ga0157379_126029231 | 144 |
| 247 | 3300017792 | Ga0163161_10822153 | Ga0163161_108221531 | 144 |
| 248 | 3300025903 | Ga0207680_10781339 | Ga0207680_107813392 | 144 |
| 249 | 3300025912 | Ga0207707_10056424 | Ga0207707_100564244 | 144 |
| 250 | 3300025924 | Ga0207694_10428082 | Ga0207694_104280823 | 144 |
| 251 | 3300025926 | Ga0207659_10278845 | Ga0207659_102788453 | 144 |
| 252 | 3300025931 | Ga0207644_10255998 | Ga0207644_102559982 | 144 |
| 253 | 3300025938 | Ga0207704_11299616 | Ga0207704_112996162 | 144 |
| 254 | 3300025939 | Ga0207665_10149387 | Ga0207665_101493873 | 144 |
| 255 | 3300025944 | Ga0207661_10041449 | Ga0207661_100414492 | 144 |
| 256 | 3300025972 | Ga0207668_10216683 | Ga0207668_102166833 | 144 |
| 257 | 3300025972 | Ga0207668_10712321 | Ga0207668_107123211 | 144 |
| 258 | 3300025986 | Ga0207658_10879491 | Ga0207658_108794912 | 144 |
| 259 | 3300026041 | Ga0207639_10799146 | Ga0207639_107991462 | 144 |
| 260 | 3300026089 | Ga0207648_10445355 | Ga0207648_104453551 | 144 |
| 261 | 3300026116 | Ga0207674_10180724 | Ga0207674_101807243 | 144 |
| 262 | 3300026121 | Ga0207683_10044272 | Ga0207683_100442723 | 144 |
| 263 | 3300026142 | Ga0207698_10275330 | Ga0207698_102753301 | 144 |
| 264 | 3300028379 | Ga0268266_10038384 | Ga0268266_100383846 | 144 |
| 265 | 3300028786 | Ga0307517_10121928 | Ga0307517_101219281 | 144 |
| 266 | 3300028794 | Ga0307515_10011730 | Ga0307515_1001173018 | 144 |
| 267 | 3300028794 | Ga0307515_10416529 | Ga0307515_104165292 | 144 |
| 268 | 3300031241 | Ga0265325_10023051 | Ga0265325_100230514 | 144 |
| 269 | 3300031247 | Ga0265340_10267492 | Ga0265340_102674922 | 144 |
| 270 | 3300031250 | Ga0265331_10055236 | Ga0265331_100552363 | 144 |
| 271 | 3300031344 | Ga0265316_10385129 | Ga0265316_103851291 | 144 |
| 272 | 3300031456 | Ga0307513_10094041 | Ga0307513_100940413 | 144 |
| 273 | 3300031595 | Ga0265313_10076962 | Ga0265313_100769622 | 144 |
| 274 | 3300031712 | Ga0265342_10050961 | Ga0265342_100509612 | 144 |
| 275 | 3300031730 | Ga0307516_10284328 | Ga0307516_102843282 | 144 |
| 276 | 3300031852 | Ga0307410_11275594 | Ga0307410_112755941 | 144 |
| 277 | 3300032002 | Ga0307416_101712059 | Ga0307416_1017120591 | 144 |
| 278 | 3300032005 | Ga0307411_10696156 | Ga0307411_106961562 | 144 |
| 279 | 3300033180 | Ga0307510_10155674 | Ga0307510_101556743 | 144 |
| 280 | 3300033180 | Ga0307510_10365855 | Ga0307510_103658552 | 144 |
| 281 | 3300035113 | Ga0373936_0066768 | Ga0373936_0066768_697_1131 | 144 |
| 282 | 3300035118 | Ga0373954_0375706 | Ga0373954_0375706_45_479 | 144 |
| 283 | 3300035121 | Ga0373960_0333730 | Ga0373960_0333730_53_487 | 144 |
| 284 | 3300035691 | Ga0373931_0914010 | Ga0373931_0914010_48_482 | 144 |
| 285 | 3300035692 | Ga0373935_1388434 | Ga0373935_1388434_55_489 | 144 |
| 286 | 3300035695 | Ga0373927_0461505 | Ga0373927_0461505_134_568 | 144 |
| 287 | 3300037068 | Ga0373925_0228550 | Ga0373925_0228550_552_986 | 144 |
| 288 | 3300037068 | Ga0373925_0814578 | Ga0373925_0814578_162_596 | 144 |
| 289 | 3300037312 | Ga0395899_0083159 | Ga0395899_0083159_487_921 | 144 |
| 290 | 3300037312 | Ga0395899_0690032 | Ga0395899_0690032_52_486 | 144 |
| 291 | 3300037418 | Ga0395900_0001282 | Ga0395900_0001282_16595_17029 | 144 |
| 292 | 3300037418 | Ga0395900_0443041 | Ga0395900_0443041_560_994 | 144 |
| 293 | 3300037466 | Ga0395898_0017060 | Ga0395898_0017060_2657_3091 | 144 |
| 294 | 3300037466 | Ga0395898_0025002 | Ga0395898_0025002_2956_3390 | 144 |
| 295 | 3300037471 | Ga0395905_0109478 | Ga0395905_0109478_1375_1809 | 144 |
| 296 | 3300038443 | Ga0395901_0047469 | Ga0395901_0047469_3712_4146 | 144 |
| 297 | 3300041498 | Ga0451841_0490343 | Ga0451841_0490343_44_478 | 144 |
| 298 | 3300041503 | Ga0451847_0001817 | Ga0451847_0001817_50_484 | 144 |
| 299 | 3300046454 | Ga0495592_0043963 | Ga0495592_0043963_775_1209 | 144 |
| 300 | 3300046459 | Ga0495629_0062946 | Ga0495629_0062946_1378_1812 | 144 |
| 301 | 3300046462 | Ga0495651_0080811 | Ga0495651_0080811_1480_1914 | 144 |
| 302 | 3300046463 | Ga0495653_0107346 | Ga0495653_0107346_1164_1598 | 144 |
| 303 | 3300046477 | Ga0495664_0038387 | Ga0495664_0038387_740_1174 | 144 |
| 304 | 3300046477 | Ga0495664_0081750 | Ga0495664_0081750_361_795 | 144 |
| 305 | 3300046507 | Ga0495606_0312643 | Ga0495606_0312643_128_562 | 144 |
| 306 | 3300046511 | Ga0495608_0048657 | Ga0495608_0048657_692_1126 | 144 |
| 307 | 3300046516 | Ga0495628_0020174 | Ga0495628_0020174_5024_5458 | 144 |
| 308 | 3300046519 | Ga0495632_0048395 | Ga0495632_0048395_1222_1656 | 144 |
| 309 | 3300046519 | Ga0495632_0336421 | Ga0495632_0336421_197_640 | 144 |
| 310 | 3300046529 | Ga0495652_0017676 | Ga0495652_0017676_3082_3516 | 144 |
| 311 | 3300046533 | Ga0495640_0029868 | Ga0495640_0029868_2039_2473 | 144 |
| 312 | 3300046536 | Ga0495587_0037347 | Ga0495587_0037347_773_1207 | 144 |
| 313 | 3300046542 | Ga0495597_0326454 | Ga0495597_0326454_101_535 | 144 |
| 314 | 3300046543 | Ga0495645_0111300 | Ga0495645_0111300_743_1177 | 144 |
| 315 | 3300046559 | Ga0495667_0016196 | Ga0495667_0016196_1397_1831 | 144 |
| 316 | 3300046616 | Ga0495668_0113343 | Ga0495668_0113343_649_1083 | 144 |
| 317 | 3300046642 | Ga0495634_0057272 | Ga0495634_0057272_1188_1622 | 144 |
| 318 | 3300046660 | Ga0495625_0190905 | Ga0495625_0190905_706_1140 | 144 |
| 319 | 3300046663 | Ga0495635_0133449 | Ga0495635_0133449_947_1381 | 144 |
| 320 | 3300046663 | Ga0495635_0804647 | Ga0495635_0804647_151_585 | 144 |
| 321 | 3300046675 | Ga0495657_0003968 | Ga0495657_0003968_8388_8822 | 144 |
| 322 | 3300046678 | Ga0495599_0010495 | Ga0495599_0010495_1464_1898 | 144 |
| 323 | 3300046679 | Ga0495623_0016510 | Ga0495623_0016510_1460_1894 | 144 |
| 324 | 3300046680 | Ga0495646_0060036 | Ga0495646_0060036_1556_1990 | 144 |
| 325 | 3300046684 | Ga0495669_0067122 | Ga0495669_0067122_1018_1452 | 144 |
| 326 | 3300046689 | Ga0495613_0164925 | Ga0495613_0164925_541_975 | 144 |
| 327 | 3300046794 | Ga0495589_0553487 | Ga0495589_0553487_66_500 | 144 |
| 328 | 3300046809 | Ga0495600_0035771 | Ga0495600_0035771_2573_3007 | 144 |
| 329 | 3300047315 | Ga0495581_0231469 | Ga0495581_0231469_411_845 | 144 |
| 330 | 3300047317 | Ga0495604_0068612 | Ga0495604_0068612_1791_2225 | 144 |
| 331 | 3300047319 | Ga0495674_0488460 | Ga0495674_0488460_511_945 | 144 |
| 332 | 3300047322 | Ga0495680_0054979 | Ga0495680_0054979_1088_1522 | 144 |
| 333 | 3300047444 | Ga0495675_0119823 | Ga0495675_0119823_1065_1499 | 144 |
| 334 | 3300047470 | Ga0495681_0147637 | Ga0495681_0147637_350_784 | 144 |
| 335 | 3300047471 | Ga0495684_0128129 | Ga0495684_0128129_837_1271 | 144 |
| 336 | 3300047472 | Ga0495686_0082629 | Ga0495686_0082629_675_1109 | 144 |
| 337 | 3300047472 | Ga0495686_0125388 | Ga0495686_0125388_271_705 | 144 |
| 338 | 3300048088 | Ga0495602_0035721 | Ga0495602_0035721_2887_3321 | 144 |
| 339 | 3300048909 | Ga0496106_0349735 | Ga0496106_0349735_714_1148 | 144 |
| 340 | 3300048910 | Ga0496107_0406553 | Ga0496107_0406553_507_941 | 144 |
| 341 | 3300048911 | Ga0496108_0077649 | Ga0496108_0077649_883_1317 | 144 |
| 342 | 3300048912 | Ga0496109_0242080 | Ga0496109_0242080_259_693 | 144 |
| 343 | 3300048912 | Ga0496109_0656360 | Ga0496109_0656360_145_579 | 144 |
| 344 | 3300048913 | Ga0496110_0248964 | Ga0496110_0248964_597_1031 | 144 |
| 345 | 3300048914 | Ga0496111_0056466 | Ga0496111_0056466_229_663 | 144 |
| 346 | 3300048915 | Ga0496112_0000023 | Ga0496112_0000023_119472_119906 | 144 |
| 347 | 3300048915 | Ga0496112_0399061 | Ga0496112_0399061_230_664 | 144 |
| 348 | 3300048918 | Ga0496115_0123052 | Ga0496115_0123052_287_721 | 144 |
| 349 | 3300048929 | Ga0496126_0123538 | Ga0496126_0123538_1694_2128 | 144 |
| 350 | 3300049572 | Ga0501036_1092299 | Ga0501036_1092299_184_618 | 144 |
| 351 | 3300049581 | Ga0501047_0219789 | Ga0501047_0219789_268_702 | 144 |
| 352 | 3300049590 | Ga0501074_0272240 | Ga0501074_0272240_412_846 | 144 |
| 353 | 3300049823 | Ga0501044_0197185 | Ga0501044_0197185_1270_1704 | 144 |
| 354 | 3300050492 | nmdc:mga0yw44_77641_c1 | nmdc:mga0yw44_77641_c1_1557_1991 | 144 |
| 355 | 3300050493 | nmdc:mga0k408_450689_c1 | nmdc:mga0k408_450689_c1_144_578 | 144 |
| 356 | 3300050494 | nmdc:mga06z11_964168_c1 | nmdc:mga06z11_964168_c1_14_448 | 144 |
| 357 | 3300050512 | nmdc:mga0n895_1646812_c1 | nmdc:mga0n895_1646812_c1_11_445 | 144 |
| 358 | 3300050514 | nmdc:mga08x19_349411_c1 | nmdc:mga08x19_349411_c1_47_481 | 144 |
| 359 | 3300053077 | Ga0495601_0257654 | Ga0495601_0257654_329_763 | 144 |
| 360 | 3300053079 | Ga0500610_0128034 | Ga0500610_0128034_774_1208 | 144 |
| 361 | 3300053080 | Ga0500635_0009036 | Ga0500635_0009036_1227_1661 | 144 |
| 362 | 3300053085 | Ga0495619_0277073 | Ga0495619_0277073_596_1030 | 144 |
| 363 | 3300053085 | Ga0495619_1088320 | Ga0495619_1088320_14_448 | 144 |
| 364 | 3300053093 | Ga0500651_0248473 | Ga0500651_0248473_574_1008 | 144 |
| 365 | 3300053095 | Ga0500640_033975 | Ga0500640_033975_1662_2096 | 144 |
| 366 | 3300053097 | Ga0500648_246944 | Ga0500648_246944_202_636 | 144 |
| 367 | 3300053102 | Ga0500554_023397 | Ga0500554_023397_730_1164 | 144 |
| 368 | 3300053111 | Ga0500572_040917 | Ga0500572_040917_529_963 | 144 |
| 369 | 3300053121 | Ga0500607_011628 | Ga0500607_011628_830_1264 | 144 |
| 370 | 3300053122 | Ga0500608_060870 | Ga0500608_060870_849_1283 | 144 |
| 371 | 3300053129 | Ga0500628_143850 | Ga0500628_143850_199_651 | 144 |
| 372 | 3300053136 | Ga0500559_0045348 | Ga0500559_0045348_282_716 | 144 |
| 373 | 3300053138 | Ga0500564_039855 | Ga0500564_039855_175_609 | 144 |
| 374 | 3300053150 | Ga0500603_052018 | Ga0500603_052018_144_578 | 144 |
| 375 | 3300053154 | Ga0500619_185859 | Ga0500619_185859_41_475 | 144 |
| 376 | 3300053155 | Ga0500620_001931 | Ga0500620_001931_2212_2646 | 144 |
| 377 | 3300053157 | Ga0500624_072423 | Ga0500624_072423_16_450 | 144 |
| 378 | 3300053162 | Ga0500638_094515 | Ga0500638_094515_246_680 | 144 |
| 379 | 3300053177 | Ga0500636_0002084 | Ga0500636_0002084_9562_9996 | 144 |
| 380 | 3300053178 | Ga0500637_0219892 | Ga0500637_0219892_618_1052 | 144 |
| 381 | 3300053178 | Ga0500637_0226791 | Ga0500637_0226791_103_537 | 144 |
| 382 | 3300053737 | Ga0500601_015500 | Ga0500601_015500_30_464 | 144 |
| 383 | 3300055283 | Ga0500661_003202 | Ga0500661_003202_2625_3059 | 144 |
| 384 | iso_pu_bacteria | 2513237096 | 2513654011 | 144 |
| 385 | iso_pu_bacteria | 2513237137 | 2513856766 | 144 |
| 386 | iso_pu_bacteria | 2513237145 | 2513918351 | 144 |
| 387 | iso_pu_bacteria | 2517572143 | 2517891414 | 144 |
| 388 | iso_pu_bacteria | 2667528175 | 2671118818 | 144 |
| 389 | iso_pu_bacteria | 2728368998 | 2728750112 | 144 |
| 390 | iso_pu_bacteria | 2903748898 | 2903750579 | 144 |
| 391 | iso_pu_bacteria | 2906635258 | 2906635374 | 144 |
| 392 | iso_pu_bacteria | 2906660503 | 2906666919 | 144 |
| 393 | iso_pu_bacteria | 2908739725 | 2908741752 | 144 |
| 394 | 3300005327 | Ga0070658_10862462 | Ga0070658_108624621 | 145 |
| 395 | 3300005334 | Ga0068869_100723311 | Ga0068869_1007233111 | 145 |
| 396 | 3300005336 | Ga0070680_100106864 | Ga0070680_1001068643 | 145 |
| 397 | 3300005336 | Ga0070680_101061454 | Ga0070680_1010614541 | 145 |
| 398 | 3300005339 | Ga0070660_100571368 | Ga0070660_1005713681 | 145 |
| 399 | 3300005366 | Ga0070659_100053281 | Ga0070659_1000532811 | 145 |
| 400 | 3300005435 | Ga0070714_101135693 | Ga0070714_1011356931 | 145 |
| 401 | 3300005436 | Ga0070713_100302920 | Ga0070713_1003029203 | 145 |
| 402 | 3300005458 | Ga0070681_10269634 | Ga0070681_102696342 | 145 |
| 403 | 3300005467 | Ga0070706_100691910 | Ga0070706_1006919102 | 145 |
| 404 | 3300005467 | Ga0070706_102029562 | Ga0070706_1020295621 | 145 |
| 405 | 3300005530 | Ga0070679_100229319 | Ga0070679_1002293192 | 145 |
| 406 | 3300005530 | Ga0070679_100608542 | Ga0070679_1006085422 | 145 |
| 407 | 3300005548 | Ga0070665_101645743 | Ga0070665_1016457431 | 145 |
| 408 | 3300005563 | Ga0068855_100090898 | Ga0068855_1000908981 | 145 |
| 409 | 3300005563 | Ga0068855_100306312 | Ga0068855_1003063122 | 145 |
| 410 | 3300005614 | Ga0068856_100000046 | Ga0068856_10000004650 | 145 |
| 411 | 3300005614 | Ga0068856_100069409 | Ga0068856_1000694097 | 145 |
| 412 | 3300005616 | Ga0068852_100008117 | Ga0068852_10000811710 | 145 |
| 413 | 3300005616 | Ga0068852_101391280 | Ga0068852_1013912802 | 145 |
| 414 | 3300005983 | Ga0081540_1005685 | Ga0081540_10056859 | 145 |
| 415 | 3300006028 | Ga0070717_10435202 | Ga0070717_104352022 | 145 |
| 416 | 3300006028 | Ga0070717_10968685 | Ga0070717_109686852 | 145 |
| 417 | 3300006844 | Ga0075428_100721322 | Ga0075428_1007213222 | 145 |
| 418 | 3300007265 | Ga0099794_10386366 | Ga0099794_103863661 | 145 |
| 419 | 3300007788 | Ga0099795_10006976 | Ga0099795_100069766 | 145 |
| 420 | 3300009093 | Ga0105240_10042035 | Ga0105240_100420356 | 145 |
| 421 | 3300009093 | Ga0105240_11582313 | Ga0105240_115823131 | 145 |
| 422 | 3300009094 | Ga0111539_10347982 | Ga0111539_103479823 | 145 |
| 423 | 3300009174 | Ga0105241_10440542 | Ga0105241_104405423 | 145 |
| 424 | 3300009551 | Ga0105238_10536984 | Ga0105238_105369842 | 145 |
| 425 | 3300010159 | Ga0099796_10188623 | Ga0099796_101886232 | 145 |
| 426 | 3300013104 | Ga0157370_10459580 | Ga0157370_104595802 | 145 |
| 427 | 3300013297 | Ga0157378_10017846 | Ga0157378_100178461 | 145 |
| 428 | 3300013307 | Ga0157372_10820382 | Ga0157372_108203823 | 145 |
| 429 | 3300025909 | Ga0207705_11223407 | Ga0207705_112234072 | 145 |
| 430 | 3300025910 | Ga0207684_11136267 | Ga0207684_111362672 | 145 |
| 431 | 3300025912 | Ga0207707_10801975 | Ga0207707_108019752 | 145 |
| 432 | 3300025914 | Ga0207671_11246706 | Ga0207671_112467061 | 145 |
| 433 | 3300025917 | Ga0207660_10200256 | Ga0207660_102002561 | 145 |
| 434 | 3300025917 | Ga0207660_10437082 | Ga0207660_104370822 | 145 |
| 435 | 3300025917 | Ga0207660_10791322 | Ga0207660_107913221 | 145 |
| 436 | 3300025921 | Ga0207652_10190884 | Ga0207652_101908842 | 145 |
| 437 | 3300025924 | Ga0207694_10610583 | Ga0207694_106105831 | 145 |
| 438 | 3300025928 | Ga0207700_10200263 | Ga0207700_102002633 | 145 |
| 439 | 3300025929 | Ga0207664_10936273 | Ga0207664_109362732 | 145 |
| 440 | 3300025945 | Ga0207679_11167435 | Ga0207679_111674351 | 145 |
| 441 | 3300025949 | Ga0207667_10232071 | Ga0207667_102320712 | 145 |
| 442 | 3300025949 | Ga0207667_10293674 | Ga0207667_102936742 | 145 |
| 443 | 3300025981 | Ga0207640_10014821 | Ga0207640_100148217 | 145 |
| 444 | 3300026067 | Ga0207678_10254536 | Ga0207678_102545362 | 145 |
| 445 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014123 | 145 |
| 446 | 3300026078 | Ga0207702_10294459 | Ga0207702_102944592 | 145 |
| 447 | 3300026078 | Ga0207702_10938663 | Ga0207702_109386632 | 145 |
| 448 | 3300026116 | Ga0207674_11097033 | Ga0207674_110970331 | 145 |
| 449 | 3300027512 | Ga0209179_1089550 | Ga0209179_10895502 | 145 |
| 450 | 3300027671 | Ga0209588_1051632 | Ga0209588_10516321 | 145 |
| 451 | 3300031251 | Ga0265327_10078082 | Ga0265327_100780823 | 145 |
| 452 | 3300031711 | Ga0265314_10109989 | Ga0265314_101099892 | 145 |
| 453 | 3300031712 | Ga0265342_10093523 | Ga0265342_100935233 | 145 |
| 454 | 3300035086 | Ga0373934_0120865 | Ga0373934_0120865_134_571 | 145 |
| 455 | 3300035111 | Ga0373923_0064920 | Ga0373923_0064920_517_954 | 145 |
| 456 | 3300035113 | Ga0373936_0048507 | Ga0373936_0048507_330_767 | 145 |
| 457 | 3300035117 | Ga0373953_0000606 | Ga0373953_0000606_6573_7010 | 145 |
| 458 | 3300035118 | Ga0373954_0001041 | Ga0373954_0001041_3864_4301 | 145 |
| 459 | 3300035119 | Ga0373956_0066495 | Ga0373956_0066495_89_526 | 145 |
| 460 | 3300035120 | Ga0373957_0000527 | Ga0373957_0000527_178_615 | 145 |
| 461 | 3300035170 | Ga0373943_0293303 | Ga0373943_0293303_21_479 | 145 |
| 462 | 3300035172 | Ga0373955_0000535 | Ga0373955_0000535_6662_7099 | 145 |
| 463 | 3300035410 | Ga0373924_0057699 | Ga0373924_0057699_115_552 | 145 |
| 464 | 3300035691 | Ga0373931_0022393 | Ga0373931_0022393_2460_2921 | 145 |
| 465 | 3300035691 | Ga0373931_0208701 | Ga0373931_0208701_180_617 | 145 |
| 466 | 3300035692 | Ga0373935_0061726 | Ga0373935_0061726_463_900 | 145 |
| 467 | 3300035695 | Ga0373927_0067123 | Ga0373927_0067123_251_688 | 145 |
| 468 | 3300035724 | Ga0373933_0000017 | Ga0373933_0000017_9406_9843 | 145 |
| 469 | 3300035724 | Ga0373933_0012317 | Ga0373933_0012317_3992_4429 | 145 |
| 470 | 3300036401 | Ga0373937_0099008 | Ga0373937_0099008_438_875 | 145 |
| 471 | 3300037471 | Ga0395905_0180823 | Ga0395905_0180823_80_565 | 145 |
| 472 | 3300039437 | Ga0436365_1083338 | Ga0436365_1083338_390_833 | 145 |
| 473 | 3300041443 | Ga0451789_0084525 | Ga0451789_0084525_45_482 | 145 |
| 474 | 3300041456 | Ga0451795_0120595 | Ga0451795_0120595_57_494 | 145 |
| 475 | 3300044694 | Ga0466963_0035186 | Ga0466963_0035186_438_875 | 145 |
| 476 | 3300046454 | Ga0495592_0011960 | Ga0495592_0011960_4534_4971 | 145 |
| 477 | 3300046459 | Ga0495629_0001841 | Ga0495629_0001841_14072_14509 | 145 |
| 478 | 3300046463 | Ga0495653_0004149 | Ga0495653_0004149_3840_4277 | 145 |
| 479 | 3300046476 | Ga0495662_0362510 | Ga0495662_0362510_47_484 | 145 |
| 480 | 3300046491 | Ga0495584_0454679 | Ga0495584_0454679_197_634 | 145 |
| 481 | 3300046507 | Ga0495606_0004620 | Ga0495606_0004620_11741_12178 | 145 |
| 482 | 3300046511 | Ga0495608_0052701 | Ga0495608_0052701_1738_2175 | 145 |
| 483 | 3300046529 | Ga0495652_0014821 | Ga0495652_0014821_2099_2536 | 145 |
| 484 | 3300046529 | Ga0495652_0687473 | Ga0495652_0687473_27_464 | 145 |
| 485 | 3300046531 | Ga0495665_0275346 | Ga0495665_0275346_93_530 | 145 |
| 486 | 3300046533 | Ga0495640_0037674 | Ga0495640_0037674_1155_1592 | 145 |
| 487 | 3300046536 | Ga0495587_0075687 | Ga0495587_0075687_1474_1911 | 145 |
| 488 | 3300046543 | Ga0495645_0005613 | Ga0495645_0005613_7366_7803 | 145 |
| 489 | 3300046559 | Ga0495667_0032991 | Ga0495667_0032991_2227_2664 | 145 |
| 490 | 3300046615 | Ga0495656_0132030 | Ga0495656_0132030_485_922 | 145 |
| 491 | 3300046642 | Ga0495634_0068234 | Ga0495634_0068234_1075_1512 | 145 |
| 492 | 3300046660 | Ga0495625_0401718 | Ga0495625_0401718_316_801 | 145 |
| 493 | 3300046663 | Ga0495635_0002477 | Ga0495635_0002477_523_960 | 145 |
| 494 | 3300046678 | Ga0495599_0002497 | Ga0495599_0002497_2881_3318 | 145 |
| 495 | 3300046678 | Ga0495599_0235531 | Ga0495599_0235531_659_1096 | 145 |
| 496 | 3300046679 | Ga0495623_0138573 | Ga0495623_0138573_83_520 | 145 |
| 497 | 3300046680 | Ga0495646_0002092 | Ga0495646_0002092_4134_4571 | 145 |
| 498 | 3300046680 | Ga0495646_0149273 | Ga0495646_0149273_208_645 | 145 |
| 499 | 3300046680 | Ga0495646_0409182 | Ga0495646_0409182_165_602 | 145 |
| 500 | 3300046683 | Ga0495658_0740709 | Ga0495658_0740709_100_537 | 145 |
| 501 | 3300046689 | Ga0495613_0010590 | Ga0495613_0010590_2962_3399 | 145 |
| 502 | 3300046809 | Ga0495600_0001788 | Ga0495600_0001788_7045_7482 | 145 |
| 503 | 3300047317 | Ga0495604_0018510 | Ga0495604_0018510_4344_4781 | 145 |
| 504 | 3300047319 | Ga0495674_0284234 | Ga0495674_0284234_900_1337 | 145 |
| 505 | 3300047321 | Ga0495676_1055676 | Ga0495676_1055676_16_453 | 145 |
| 506 | 3300047322 | Ga0495680_0060977 | Ga0495680_0060977_1474_1911 | 145 |
| 507 | 3300047444 | Ga0495675_0033442 | Ga0495675_0033442_1244_1681 | 145 |
| 508 | 3300047469 | Ga0495673_0175187 | Ga0495673_0175187_185_622 | 145 |
| 509 | 3300047471 | Ga0495684_0001145 | Ga0495684_0001145_7903_8340 | 145 |
| 510 | 3300047673 | Ga0495593_0000526 | Ga0495593_0000526_7485_7922 | 145 |
| 511 | 3300048088 | Ga0495602_0009427 | Ga0495602_0009427_357_794 | 145 |
| 512 | 3300048905 | Ga0496102_0228667 | Ga0496102_0228667_42_482 | 145 |
| 513 | 3300048905 | Ga0496102_0315501 | Ga0496102_0315501_199_636 | 145 |
| 514 | 3300048905 | Ga0496102_1390654 | Ga0496102_1390654_167_604 | 145 |
| 515 | 3300048907 | Ga0496104_0049104 | Ga0496104_0049104_2132_2593 | 145 |
| 516 | 3300048910 | Ga0496107_0286458 | Ga0496107_0286458_658_1095 | 145 |
| 517 | 3300048910 | Ga0496107_1166956 | Ga0496107_1166956_14_454 | 145 |
| 518 | 3300048911 | Ga0496108_0163680 | Ga0496108_0163680_458_919 | 145 |
| 519 | 3300048913 | Ga0496110_0074390 | Ga0496110_0074390_306_743 | 145 |
| 520 | 3300048913 | Ga0496110_0620058 | Ga0496110_0620058_176_637 | 145 |
| 521 | 3300048914 | Ga0496111_0160257 | Ga0496111_0160257_414_875 | 145 |
| 522 | 3300048914 | Ga0496111_1353757 | Ga0496111_1353757_53_490 | 145 |
| 523 | 3300048915 | Ga0496112_1497246 | Ga0496112_1497246_61_498 | 145 |
| 524 | 3300048925 | Ga0496122_0033823 | Ga0496122_0033823_488_925 | 145 |
| 525 | 3300048928 | Ga0496125_0000099 | Ga0496125_0000099_16260_16697 | 145 |
| 526 | 3300049570 | Ga0501033_0479227 | Ga0501033_0479227_227_664 | 145 |
| 527 | 3300049574 | Ga0501038_0587592 | Ga0501038_0587592_102_539 | 145 |
| 528 | 3300049578 | Ga0501042_0479340 | Ga0501042_0479340_310_747 | 145 |
| 529 | 3300049582 | Ga0501048_0046128 | Ga0501048_0046128_2524_2961 | 145 |
| 530 | 3300050511 | nmdc:mga08y16_54346_c1 | nmdc:mga08y16_54346_c1_3090_3527 | 145 |
| 531 | 3300053077 | Ga0495601_0018722 | Ga0495601_0018722_356_793 | 145 |
| 532 | 3300053084 | Ga0495595_0001351 | Ga0495595_0001351_9015_9452 | 145 |
| 533 | 3300053177 | Ga0500636_0354281 | Ga0500636_0354281_151_588 | 145 |
| 534 | 3300003771 | Ga0055526_1021857 | Ga0055526_10218574 | 146 |
| 535 | 3300003771 | Ga0055526_1043572 | Ga0055526_10435722 | 146 |
| 536 | 3300005455 | Ga0070663_100749797 | Ga0070663_1007497971 | 146 |
| 537 | 3300005459 | Ga0068867_100451852 | Ga0068867_1004518521 | 146 |
| 538 | 3300005577 | Ga0068857_101010887 | Ga0068857_1010108872 | 146 |
| 539 | 3300006038 | Ga0075365_10535332 | Ga0075365_105353322 | 146 |
| 540 | 3300006051 | Ga0075364_10012790 | Ga0075364_100127905 | 146 |
| 541 | 3300006051 | Ga0075364_10193964 | Ga0075364_101939642 | 146 |
| 542 | 3300006051 | Ga0075364_10479953 | Ga0075364_104799532 | 146 |
| 543 | 3300006178 | Ga0075367_10162825 | Ga0075367_101628252 | 146 |
| 544 | 3300006353 | Ga0075370_10418729 | Ga0075370_104187292 | 146 |
| 545 | 3300009098 | Ga0105245_11349212 | Ga0105245_113492121 | 146 |
| 546 | 3300009101 | Ga0105247_11190414 | Ga0105247_111904141 | 146 |
| 547 | 3300009148 | Ga0105243_10076539 | Ga0105243_100765394 | 146 |
| 548 | 3300009545 | Ga0105237_10602297 | Ga0105237_106022972 | 146 |
| 549 | 3300013102 | Ga0157371_10315200 | Ga0157371_103152001 | 146 |
| 550 | 3300013307 | Ga0157372_10172877 | Ga0157372_101728773 | 146 |
| 551 | 3300014326 | Ga0157380_10561856 | Ga0157380_105618562 | 146 |
| 552 | 3300025261 | Ga0209233_1014231 | Ga0209233_10142312 | 146 |
| 553 | 3300025284 | Ga0209130_1047183 | Ga0209130_10471832 | 146 |
| 554 | 3300025295 | Ga0209564_1000503 | Ga0209564_100050359 | 146 |
| 555 | 3300025295 | Ga0209564_1005251 | Ga0209564_10052518 | 146 |
| 556 | 3300025923 | Ga0207681_11224201 | Ga0207681_112242012 | 146 |
| 557 | 3300025927 | Ga0207687_10681491 | Ga0207687_106814911 | 146 |
| 558 | 3300026067 | Ga0207678_10008062 | Ga0207678_100080625 | 146 |
| 559 | 3300028794 | Ga0307515_10150467 | Ga0307515_101504672 | 146 |
| 560 | 3300031995 | Ga0307409_100994274 | Ga0307409_1009942742 | 146 |
| 561 | 3300035118 | Ga0373954_0425102 | Ga0373954_0425102_197_637 | 146 |
| 562 | 3300039437 | Ga0436365_0847422 | Ga0436365_0847422_786_1226 | 146 |
| 563 | 3300041452 | Ga0451793_0353251 | Ga0451793_0353251_282_722 | 146 |
| 564 | 3300041498 | Ga0451841_1340806 | Ga0451841_1340806_34_474 | 146 |
| 565 | 3300042012 | Ga0439455_0101697 | Ga0439455_0101697_251_691 | 146 |
| 566 | 3300046460 | Ga0495638_0016732 | Ga0495638_0016732_60_500 | 146 |
| 567 | 3300046462 | Ga0495651_0240063 | Ga0495651_0240063_666_1106 | 146 |
| 568 | 3300046506 | Ga0495583_0047153 | Ga0495583_0047153_391_831 | 146 |
| 569 | 3300046507 | Ga0495606_0106351 | Ga0495606_0106351_286_726 | 146 |
| 570 | 3300046515 | Ga0495620_0018112 | Ga0495620_0018112_1375_1815 | 146 |
| 571 | 3300046518 | Ga0495631_0037364 | Ga0495631_0037364_788_1228 | 146 |
| 572 | 3300046542 | Ga0495597_0057985 | Ga0495597_0057985_210_650 | 146 |
| 573 | 3300046615 | Ga0495656_0528793 | Ga0495656_0528793_53_493 | 146 |
| 574 | 3300046616 | Ga0495668_0465529 | Ga0495668_0465529_48_488 | 146 |
| 575 | 3300046660 | Ga0495625_0092445 | Ga0495625_0092445_517_957 | 146 |
| 576 | 3300046674 | Ga0495588_0021630 | Ga0495588_0021630_1107_1547 | 146 |
| 577 | 3300046691 | Ga0495670_0013233 | Ga0495670_0013233_1944_2384 | 146 |
| 578 | 3300046692 | Ga0495671_0135727 | Ga0495671_0135727_729_1169 | 146 |
| 579 | 3300046809 | Ga0495600_0046953 | Ga0495600_0046953_1396_1836 | 146 |
| 580 | 3300047320 | Ga0495672_0000894 | Ga0495672_0000894_4605_5045 | 146 |
| 581 | 3300047445 | Ga0495677_0144654 | Ga0495677_0144654_342_782 | 146 |
| 582 | 3300047470 | Ga0495681_0160804 | Ga0495681_0160804_41_481 | 146 |
| 583 | 3300047472 | Ga0495686_0004867 | Ga0495686_0004867_8339_8779 | 146 |
| 584 | 3300048905 | Ga0496102_0603491 | Ga0496102_0603491_44_487 | 146 |
| 585 | 3300048919 | Ga0496116_0007011 | Ga0496116_0007011_8847_9287 | 146 |
| 586 | 3300048920 | Ga0496117_0233888 | Ga0496117_0233888_103_543 | 146 |
| 587 | 3300048920 | Ga0496117_0525460 | Ga0496117_0525460_71_511 | 146 |
| 588 | 3300048921 | Ga0496118_0067018 | Ga0496118_0067018_63_503 | 146 |
| 589 | 3300048921 | Ga0496118_0129349 | Ga0496118_0129349_510_950 | 146 |
| 590 | 3300048922 | Ga0496119_0363954 | Ga0496119_0363954_102_542 | 146 |
| 591 | 3300048923 | Ga0496120_0190582 | Ga0496120_0190582_524_964 | 146 |
| 592 | 3300048924 | Ga0496121_0013014 | Ga0496121_0013014_562_1011 | 146 |
| 593 | 3300048924 | Ga0496121_0014373 | Ga0496121_0014373_4042_4482 | 146 |
| 594 | 3300048925 | Ga0496122_0084789 | Ga0496122_0084789_1207_1647 | 146 |
| 595 | 3300048925 | Ga0496122_0196896 | Ga0496122_0196896_577_1017 | 146 |
| 596 | 3300048926 | Ga0496123_0103219 | Ga0496123_0103219_661_1101 | 146 |
| 597 | 3300048928 | Ga0496125_0004699 | Ga0496125_0004699_12567_13007 | 146 |
| 598 | 3300048929 | Ga0496126_0373350 | Ga0496126_0373350_39_479 | 146 |
| 599 | 3300049568 | Ga0501031_0017619 | Ga0501031_0017619_1627_2067 | 146 |
| 600 | 3300049569 | Ga0501032_0000030 | Ga0501032_0000030_66749_67189 | 146 |
| 601 | 3300049570 | Ga0501033_0001069 | Ga0501033_0001069_12992_13432 | 146 |
| 602 | 3300049571 | Ga0501034_0000117 | Ga0501034_0000117_22897_23337 | 146 |
| 603 | 3300049572 | Ga0501036_0000033 | Ga0501036_0000033_82083_82523 | 146 |
| 604 | 3300049573 | Ga0501037_0000090 | Ga0501037_0000090_44674_45114 | 146 |
| 605 | 3300049574 | Ga0501038_0001923 | Ga0501038_0001923_17206_17646 | 146 |
| 606 | 3300049575 | Ga0501039_0000343 | Ga0501039_0000343_19570_20010 | 146 |
| 607 | 3300049578 | Ga0501042_0318617 | Ga0501042_0318617_99_539 | 146 |
| 608 | 3300049579 | Ga0501043_0001280 | Ga0501043_0001280_11916_12356 | 146 |
| 609 | 3300049580 | Ga0501046_0000078 | Ga0501046_0000078_26638_27078 | 146 |
| 610 | 3300049581 | Ga0501047_0001617 | Ga0501047_0001617_3427_3867 | 146 |
| 611 | 3300049582 | Ga0501048_0000235 | Ga0501048_0000235_916_1356 | 146 |
| 612 | 3300049583 | Ga0501067_0000299 | Ga0501067_0000299_21067_21507 | 146 |
| 613 | 3300049584 | Ga0501068_0001611 | Ga0501068_0001611_1792_2232 | 146 |
| 614 | 3300049585 | Ga0501069_0070531 | Ga0501069_0070531_122_562 | 146 |
| 615 | 3300049586 | Ga0501070_0016001 | Ga0501070_0016001_5151_5591 | 146 |
| 616 | 3300049586 | Ga0501070_0765201 | Ga0501070_0765201_198_638 | 146 |
| 617 | 3300049587 | Ga0501071_0070512 | Ga0501071_0070512_1325_1765 | 146 |
| 618 | 3300049588 | Ga0501072_0000414 | Ga0501072_0000414_16231_16671 | 146 |
| 619 | 3300049589 | Ga0501073_0000209 | Ga0501073_0000209_15309_15749 | 146 |
| 620 | 3300049590 | Ga0501074_0000441 | Ga0501074_0000441_12244_12684 | 146 |
| 621 | 3300049741 | Ga0501079_0025908 | Ga0501079_0025908_1050_1490 | 146 |
| 622 | 3300049742 | Ga0501080_0000567 | Ga0501080_0000567_5909_6349 | 146 |
| 623 | 3300049744 | Ga0501083_0002984 | Ga0501083_0002984_1429_1869 | 146 |
| 624 | 3300049822 | Ga0501035_0008484 | Ga0501035_0008484_7919_8359 | 146 |
| 625 | 3300049823 | Ga0501044_0000304 | Ga0501044_0000304_38541_38981 | 146 |
| 626 | 3300049824 | Ga0501045_0040887 | Ga0501045_0040887_1454_1894 | 146 |
| 627 | 3300050491 | nmdc:mga00v17_21925_c1 | nmdc:mga00v17_21925_c1_1053_1493 | 146 |
| 628 | 3300050494 | nmdc:mga06z11_77693_c1 | nmdc:mga06z11_77693_c1_718_1158 | 146 |
| 629 | 3300050496 | nmdc:mga07m45_306879_c1 | nmdc:mga07m45_306879_c1_240_680 | 146 |
| 630 | 3300050516 | nmdc:mga0sz30_54642_c1 | nmdc:mga0sz30_54642_c1_56_496 | 146 |
| 631 | 3300053088 | Ga0500644_0163297 | Ga0500644_0163297_49_489 | 146 |
| 632 | 3300053089 | Ga0500581_177134 | Ga0500581_177134_391_831 | 146 |
| 633 | 3300053093 | Ga0500651_0031822 | Ga0500651_0031822_576_1016 | 146 |
| 634 | 3300053094 | Ga0500566_0000128 | Ga0500566_0000128_1263_1703 | 146 |
| 635 | 3300053095 | Ga0500640_000168 | Ga0500640_000168_2885_3325 | 146 |
| 636 | 3300053096 | Ga0500641_0003698 | Ga0500641_0003698_29_469 | 146 |
| 637 | 3300053098 | Ga0500650_0009359 | Ga0500650_0009359_61_501 | 146 |
| 638 | 3300053104 | Ga0500556_0000045 | Ga0500556_0000045_115892_116332 | 146 |
| 639 | 3300053109 | Ga0500569_162679 | Ga0500569_162679_270_710 | 146 |
| 640 | 3300053111 | Ga0500572_000620 | Ga0500572_000620_10001_10441 | 146 |
| 641 | 3300053115 | Ga0500591_120068 | Ga0500591_120068_305_745 | 146 |
| 642 | 3300053116 | Ga0500592_000231 | Ga0500592_000231_8160_8600 | 146 |
| 643 | 3300053117 | Ga0500593_021146 | Ga0500593_021146_560_1000 | 146 |
| 644 | 3300053118 | Ga0500594_0129753 | Ga0500594_0129753_37_477 | 146 |
| 645 | 3300053121 | Ga0500607_099110 | Ga0500607_099110_687_1127 | 146 |
| 646 | 3300053122 | Ga0500608_041088 | Ga0500608_041088_1284_1724 | 146 |
| 647 | 3300053123 | Ga0500614_001536 | Ga0500614_001536_3796_4236 | 146 |
| 648 | 3300053125 | Ga0500618_118601 | Ga0500618_118601_72_512 | 146 |
| 649 | 3300053130 | Ga0500642_0000024 | Ga0500642_0000024_119800_120240 | 146 |
| 650 | 3300053131 | Ga0500652_000963 | Ga0500652_000963_1067_1507 | 146 |
| 651 | 3300053134 | Ga0500658_0045660 | Ga0500658_0045660_59_499 | 146 |
| 652 | 3300053136 | Ga0500559_0013716 | Ga0500559_0013716_2932_3372 | 146 |
| 653 | 3300053139 | Ga0500568_0004072 | Ga0500568_0004072_5924_6364 | 146 |
| 654 | 3300053142 | Ga0500577_0081679 | Ga0500577_0081679_28_468 | 146 |
| 655 | 3300053145 | Ga0500586_000623 | Ga0500586_000623_6464_6904 | 146 |
| 656 | 3300053145 | Ga0500586_040909 | Ga0500586_040909_622_1062 | 146 |
| 657 | 3300053148 | Ga0500590_138224 | Ga0500590_138224_117_557 | 146 |
| 658 | 3300053150 | Ga0500603_000356 | Ga0500603_000356_1222_1662 | 146 |
| 659 | 3300053151 | Ga0500604_0194807 | Ga0500604_0194807_29_469 | 146 |
| 660 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_127033_127473 | 146 |
| 661 | 3300053153 | Ga0500616_0159686 | Ga0500616_0159686_514_954 | 146 |
| 662 | 3300053156 | Ga0500622_0002139 | Ga0500622_0002139_681_1121 | 146 |
| 663 | 3300053158 | Ga0500627_0177519 | Ga0500627_0177519_351_791 | 146 |
| 664 | 3300053159 | Ga0500630_025238 | Ga0500630_025238_1675_2115 | 146 |
| 665 | 3300053160 | Ga0500633_0013325 | Ga0500633_0013325_1182_1622 | 146 |
| 666 | 3300053162 | Ga0500638_039001 | Ga0500638_039001_1635_2075 | 146 |
| 667 | 3300053163 | Ga0500639_000125 | Ga0500639_000125_8720_9160 | 146 |
| 668 | 3300053723 | Ga0500567_098423 | Ga0500567_098423_64_504 | 146 |
| 669 | 3300053735 | Ga0500596_000129 | Ga0500596_000129_1073_1513 | 146 |
| 670 | 3300053737 | Ga0500601_005462 | Ga0500601_005462_564_1004 | 146 |
| 671 | 3300054114 | Ga0501084_0102518 | Ga0501084_0102518_1603_2043 | 146 |
| 672 | 3300060353 | Ga0501082_0103155 | Ga0501082_0103155_1409_1849 | 146 |
| 673 | 3300001990 | JGI24737J22298_10233007 | JGI24737J22298_102330071 | 147 |
| 674 | 3300002077 | JGI24744J21845_10007397 | JGI24744J21845_100073972 | 147 |
| 675 | 3300003214 | JGI25165J46597_1008424 | JGI25165J46597_10084242 | 147 |
| 676 | 3300003316 | rootH1_10119036 | rootH1_101190363 | 147 |
| 677 | 3300003323 | rootH1_10048045 | rootH1_100480452 | 147 |
| 678 | 3300003659 | JGI25404J52841_10008669 | JGI25404J52841_100086693 | 147 |
| 679 | 3300003659 | JGI25404J52841_10022087 | JGI25404J52841_100220873 | 147 |
| 680 | 3300003911 | JGI25405J52794_10050771 | JGI25405J52794_100507711 | 147 |
| 681 | 3300005331 | Ga0070670_100667212 | Ga0070670_1006672122 | 147 |
| 682 | 3300005331 | Ga0070670_101638856 | Ga0070670_1016388561 | 147 |
| 683 | 3300005333 | Ga0070677_10337662 | Ga0070677_103376621 | 147 |
| 684 | 3300005334 | Ga0068869_100230778 | Ga0068869_1002307782 | 147 |
| 685 | 3300005334 | Ga0068869_100640373 | Ga0068869_1006403731 | 147 |
| 686 | 3300005337 | Ga0070682_100527873 | Ga0070682_1005278731 | 147 |
| 687 | 3300005339 | Ga0070660_100313429 | Ga0070660_1003134291 | 147 |
| 688 | 3300005344 | Ga0070661_100051572 | Ga0070661_1000515724 | 147 |
| 689 | 3300005344 | Ga0070661_100136029 | Ga0070661_1001360293 | 147 |
| 690 | 3300005344 | Ga0070661_101169224 | Ga0070661_1011692242 | 147 |
| 691 | 3300005347 | Ga0070668_100127131 | Ga0070668_1001271312 | 147 |
| 692 | 3300005347 | Ga0070668_100944760 | Ga0070668_1009447601 | 147 |
| 693 | 3300005347 | Ga0070668_101168006 | Ga0070668_1011680061 | 147 |
| 694 | 3300005353 | Ga0070669_100273914 | Ga0070669_1002739143 | 147 |
| 695 | 3300005353 | Ga0070669_100445276 | Ga0070669_1004452762 | 147 |
| 696 | 3300005354 | Ga0070675_100256817 | Ga0070675_1002568171 | 147 |
| 697 | 3300005355 | Ga0070671_100181765 | Ga0070671_1001817652 | 147 |
| 698 | 3300005356 | Ga0070674_100042736 | Ga0070674_1000427363 | 147 |
| 699 | 3300005356 | Ga0070674_100307190 | Ga0070674_1003071901 | 147 |
| 700 | 3300005356 | Ga0070674_100786466 | Ga0070674_1007864661 | 147 |
| 701 | 3300005364 | Ga0070673_100389150 | Ga0070673_1003891502 | 147 |
| 702 | 3300005364 | Ga0070673_101423418 | Ga0070673_1014234181 | 147 |
| 703 | 3300005366 | Ga0070659_100438157 | Ga0070659_1004381572 | 147 |
| 704 | 3300005367 | Ga0070667_100133126 | Ga0070667_1001331262 | 147 |
| 705 | 3300005367 | Ga0070667_100291043 | Ga0070667_1002910432 | 147 |
| 706 | 3300005434 | Ga0070709_10148888 | Ga0070709_101488881 | 147 |
| 707 | 3300005435 | Ga0070714_100291413 | Ga0070714_1002914132 | 147 |
| 708 | 3300005435 | Ga0070714_101018577 | Ga0070714_1010185772 | 147 |
| 709 | 3300005437 | Ga0070710_10089252 | Ga0070710_100892523 | 147 |
| 710 | 3300005439 | Ga0070711_100682161 | Ga0070711_1006821611 | 147 |
| 711 | 3300005440 | Ga0070705_100222254 | Ga0070705_1002222543 | 147 |
| 712 | 3300005440 | Ga0070705_100332163 | Ga0070705_1003321632 | 147 |
| 713 | 3300005441 | Ga0070700_100085097 | Ga0070700_1000850973 | 147 |
| 714 | 3300005445 | Ga0070708_100493791 | Ga0070708_1004937912 | 147 |
| 715 | 3300005455 | Ga0070663_100331498 | Ga0070663_1003314983 | 147 |
| 716 | 3300005455 | Ga0070663_100503118 | Ga0070663_1005031181 | 147 |
| 717 | 3300005455 | Ga0070663_100889621 | Ga0070663_1008896212 | 147 |
| 718 | 3300005456 | Ga0070678_100060737 | Ga0070678_1000607372 | 147 |
| 719 | 3300005456 | Ga0070678_100102017 | Ga0070678_1001020172 | 147 |
| 720 | 3300005456 | Ga0070678_100339844 | Ga0070678_1003398442 | 147 |
| 721 | 3300005456 | Ga0070678_100777996 | Ga0070678_1007779961 | 147 |
| 722 | 3300005457 | Ga0070662_100083587 | Ga0070662_1000835873 | 147 |
| 723 | 3300005457 | Ga0070662_100086125 | Ga0070662_1000861252 | 147 |
| 724 | 3300005457 | Ga0070662_100320052 | Ga0070662_1003200521 | 147 |
| 725 | 3300005459 | Ga0068867_100069826 | Ga0068867_1000698263 | 147 |
| 726 | 3300005467 | Ga0070706_100732196 | Ga0070706_1007321961 | 147 |
| 727 | 3300005468 | Ga0070707_100272741 | Ga0070707_1002727412 | 147 |
| 728 | 3300005471 | Ga0070698_100120374 | Ga0070698_1001203744 | 147 |
| 729 | 3300005471 | Ga0070698_100379831 | Ga0070698_1003798312 | 147 |
| 730 | 3300005518 | Ga0070699_101068137 | Ga0070699_1010681372 | 147 |
| 731 | 3300005518 | Ga0070699_101214952 | Ga0070699_1012149521 | 147 |
| 732 | 3300005535 | Ga0070684_101303597 | Ga0070684_1013035972 | 147 |
| 733 | 3300005536 | Ga0070697_100440006 | Ga0070697_1004400062 | 147 |
| 734 | 3300005539 | Ga0068853_100505327 | Ga0068853_1005053272 | 147 |
| 735 | 3300005543 | Ga0070672_100256276 | Ga0070672_1002562762 | 147 |
| 736 | 3300005543 | Ga0070672_100520352 | Ga0070672_1005203521 | 147 |
| 737 | 3300005544 | Ga0070686_100071730 | Ga0070686_1000717303 | 147 |
| 738 | 3300005545 | Ga0070695_100188946 | Ga0070695_1001889461 | 147 |
| 739 | 3300005546 | Ga0070696_100268954 | Ga0070696_1002689541 | 147 |
| 740 | 3300005547 | Ga0070693_100327370 | Ga0070693_1003273702 | 147 |
| 741 | 3300005547 | Ga0070693_100553612 | Ga0070693_1005536121 | 147 |
| 742 | 3300005547 | Ga0070693_101417298 | Ga0070693_1014172981 | 147 |
| 743 | 3300005548 | Ga0070665_100049060 | Ga0070665_1000490605 | 147 |
| 744 | 3300005548 | Ga0070665_100114119 | Ga0070665_1001141192 | 147 |
| 745 | 3300005548 | Ga0070665_100277859 | Ga0070665_1002778593 | 147 |
| 746 | 3300005548 | Ga0070665_100315826 | Ga0070665_1003158262 | 147 |
| 747 | 3300005548 | Ga0070665_100573234 | Ga0070665_1005732342 | 147 |
| 748 | 3300005548 | Ga0070665_100789458 | Ga0070665_1007894582 | 147 |
| 749 | 3300005548 | Ga0070665_100942965 | Ga0070665_1009429652 | 147 |
| 750 | 3300005548 | Ga0070665_101669511 | Ga0070665_1016695112 | 147 |
| 751 | 3300005549 | Ga0070704_100521162 | Ga0070704_1005211621 | 147 |
| 752 | 3300005577 | Ga0068857_100401487 | Ga0068857_1004014871 | 147 |
| 753 | 3300005578 | Ga0068854_100026148 | Ga0068854_1000261483 | 147 |
| 754 | 3300005578 | Ga0068854_100195888 | Ga0068854_1001958883 | 147 |
| 755 | 3300005614 | Ga0068856_100165022 | Ga0068856_1001650221 | 147 |
| 756 | 3300005614 | Ga0068856_101958720 | Ga0068856_1019587201 | 147 |
| 757 | 3300005615 | Ga0070702_100900522 | Ga0070702_1009005221 | 147 |
| 758 | 3300005616 | Ga0068852_100034471 | Ga0068852_1000344714 | 147 |
| 759 | 3300005616 | Ga0068852_100074065 | Ga0068852_1000740652 | 147 |
| 760 | 3300005617 | Ga0068859_101146714 | Ga0068859_1011467142 | 147 |
| 761 | 3300005618 | Ga0068864_100094099 | Ga0068864_1000940995 | 147 |
| 762 | 3300005718 | Ga0068866_10236400 | Ga0068866_102364002 | 147 |
| 763 | 3300005718 | Ga0068866_10477385 | Ga0068866_104773852 | 147 |
| 764 | 3300005719 | Ga0068861_100017186 | Ga0068861_1000171863 | 147 |
| 765 | 3300005719 | Ga0068861_100419799 | Ga0068861_1004197992 | 147 |
| 766 | 3300005719 | Ga0068861_100662571 | Ga0068861_1006625711 | 147 |
| 767 | 3300005834 | Ga0068851_10861708 | Ga0068851_108617081 | 147 |
| 768 | 3300005841 | Ga0068863_100157574 | Ga0068863_1001575744 | 147 |
| 769 | 3300005842 | Ga0068858_100647765 | Ga0068858_1006477652 | 147 |
| 770 | 3300005843 | Ga0068860_100217289 | Ga0068860_1002172892 | 147 |
| 771 | 3300005843 | Ga0068860_100836871 | Ga0068860_1008368712 | 147 |
| 772 | 3300005844 | Ga0068862_100063134 | Ga0068862_1000631344 | 147 |
| 773 | 3300005844 | Ga0068862_100212949 | Ga0068862_1002129492 | 147 |
| 774 | 3300005844 | Ga0068862_100520789 | Ga0068862_1005207891 | 147 |
| 775 | 3300005937 | Ga0081455_10000875 | Ga0081455_1000087527 | 147 |
| 776 | 3300005937 | Ga0081455_10011544 | Ga0081455_100115443 | 147 |
| 777 | 3300005937 | Ga0081455_10028504 | Ga0081455_100285047 | 147 |
| 778 | 3300005983 | Ga0081540_1001143 | Ga0081540_100114318 | 147 |
| 779 | 3300005983 | Ga0081540_1002776 | Ga0081540_100277620 | 147 |
| 780 | 3300005983 | Ga0081540_1003496 | Ga0081540_100349614 | 147 |
| 781 | 3300005983 | Ga0081540_1004605 | Ga0081540_10046058 | 147 |
| 782 | 3300005983 | Ga0081540_1065648 | Ga0081540_10656481 | 147 |
| 783 | 3300005983 | Ga0081540_1144836 | Ga0081540_11448363 | 147 |
| 784 | 3300005985 | Ga0081539_10040265 | Ga0081539_100402653 | 147 |
| 785 | 3300005985 | Ga0081539_10042367 | Ga0081539_100423674 | 147 |
| 786 | 3300005985 | Ga0081539_10077341 | Ga0081539_100773413 | 147 |
| 787 | 3300006038 | Ga0075365_10043535 | Ga0075365_100435353 | 147 |
| 788 | 3300006038 | Ga0075365_10045372 | Ga0075365_100453722 | 147 |
| 789 | 3300006038 | Ga0075365_10095901 | Ga0075365_100959012 | 147 |
| 790 | 3300006042 | Ga0075368_10019828 | Ga0075368_100198283 | 147 |
| 791 | 3300006048 | Ga0075363_100143329 | Ga0075363_1001433291 | 147 |
| 792 | 3300006048 | Ga0075363_100553158 | Ga0075363_1005531581 | 147 |
| 793 | 3300006048 | Ga0075363_100563305 | Ga0075363_1005633052 | 147 |
| 794 | 3300006051 | Ga0075364_10039069 | Ga0075364_100390694 | 147 |
| 795 | 3300006058 | Ga0075432_10082761 | Ga0075432_100827612 | 147 |
| 796 | 3300006175 | Ga0070712_100208218 | Ga0070712_1002082181 | 147 |
| 797 | 3300006175 | Ga0070712_100431807 | Ga0070712_1004318072 | 147 |
| 798 | 3300006178 | Ga0075367_10019217 | Ga0075367_100192174 | 147 |
| 799 | 3300006178 | Ga0075367_10039371 | Ga0075367_100393712 | 147 |
| 800 | 3300006178 | Ga0075367_10186347 | Ga0075367_101863472 | 147 |
| 801 | 3300006178 | Ga0075367_10198704 | Ga0075367_101987042 | 147 |
| 802 | 3300006178 | Ga0075367_10358635 | Ga0075367_103586352 | 147 |
| 803 | 3300006186 | Ga0075369_10165435 | Ga0075369_101654351 | 147 |
| 804 | 3300006195 | Ga0075366_10086400 | Ga0075366_100864002 | 147 |
| 805 | 3300006353 | Ga0075370_10010951 | Ga0075370_100109512 | 147 |
| 806 | 3300006353 | Ga0075370_10044788 | Ga0075370_100447883 | 147 |
| 807 | 3300006353 | Ga0075370_10143884 | Ga0075370_101438842 | 147 |
| 808 | 3300006353 | Ga0075370_10227859 | Ga0075370_102278592 | 147 |
| 809 | 3300006353 | Ga0075370_10535284 | Ga0075370_105352842 | 147 |
| 810 | 3300006358 | Ga0068871_100136505 | Ga0068871_1001365052 | 147 |
| 811 | 3300006844 | Ga0075428_101672102 | Ga0075428_1016721022 | 147 |
| 812 | 3300006871 | Ga0075434_100198912 | Ga0075434_1001989121 | 147 |
| 813 | 3300006881 | Ga0068865_100123706 | Ga0068865_1001237063 | 147 |
| 814 | 3300006881 | Ga0068865_100169452 | Ga0068865_1001694523 | 147 |
| 815 | 3300006914 | Ga0075436_100484045 | Ga0075436_1004840452 | 147 |
| 816 | 3300006931 | Ga0097620_101146701 | Ga0097620_1011467011 | 147 |
| 817 | 3300006942 | Ga0099824_1011838 | Ga0099824_101183810 | 147 |
| 818 | 3300006943 | Ga0099822_1001134 | Ga0099822_10011345 | 147 |
| 819 | 3300009098 | Ga0105245_10096991 | Ga0105245_100969913 | 147 |
| 820 | 3300009098 | Ga0105245_10306867 | Ga0105245_103068672 | 147 |
| 821 | 3300009147 | Ga0114129_11746886 | Ga0114129_117468862 | 147 |
| 822 | 3300009148 | Ga0105243_10322460 | Ga0105243_103224603 | 147 |
| 823 | 3300009148 | Ga0105243_10794006 | Ga0105243_107940061 | 147 |
| 824 | 3300009174 | Ga0105241_10751603 | Ga0105241_107516031 | 147 |
| 825 | 3300009176 | Ga0105242_10117957 | Ga0105242_101179572 | 147 |
| 826 | 3300009177 | Ga0105248_10056731 | Ga0105248_100567312 | 147 |
| 827 | 3300009177 | Ga0105248_10487616 | Ga0105248_104876162 | 147 |
| 828 | 3300009177 | Ga0105248_11093456 | Ga0105248_110934562 | 147 |
| 829 | 3300009545 | Ga0105237_11405722 | Ga0105237_114057222 | 147 |
| 830 | 3300009551 | Ga0105238_10384696 | Ga0105238_103846962 | 147 |
| 831 | 3300010375 | Ga0105239_10162787 | Ga0105239_101627872 | 147 |
| 832 | 3300010375 | Ga0105239_10298263 | Ga0105239_102982633 | 147 |
| 833 | 3300011119 | Ga0105246_10015450 | Ga0105246_100154506 | 147 |
| 834 | 3300011119 | Ga0105246_10114754 | Ga0105246_101147542 | 147 |
| 835 | 3300012481 | Ga0157320_1019468 | Ga0157320_10194681 | 147 |
| 836 | 3300012488 | Ga0157343_1001969 | Ga0157343_10019692 | 147 |
| 837 | 3300013100 | Ga0157373_10322265 | Ga0157373_103222652 | 147 |
| 838 | 3300013105 | Ga0157369_10148152 | Ga0157369_101481521 | 147 |
| 839 | 3300013296 | Ga0157374_10646477 | Ga0157374_106464771 | 147 |
| 840 | 3300013296 | Ga0157374_11377052 | Ga0157374_113770521 | 147 |
| 841 | 3300013297 | Ga0157378_10533822 | Ga0157378_105338222 | 147 |
| 842 | 3300013306 | Ga0163162_10011437 | Ga0163162_1001143711 | 147 |
| 843 | 3300013306 | Ga0163162_10642947 | Ga0163162_106429472 | 147 |
| 844 | 3300013308 | Ga0157375_10136992 | Ga0157375_101369922 | 147 |
| 845 | 3300014325 | Ga0163163_10483232 | Ga0163163_104832322 | 147 |
| 846 | 3300014325 | Ga0163163_11002986 | Ga0163163_110029862 | 147 |
| 847 | 3300014325 | Ga0163163_11640623 | Ga0163163_116406232 | 147 |
| 848 | 3300014326 | Ga0157380_11152948 | Ga0157380_111529482 | 147 |
| 849 | 3300014497 | Ga0182008_10286369 | Ga0182008_102863692 | 147 |
| 850 | 3300014745 | Ga0157377_10095417 | Ga0157377_100954173 | 147 |
| 851 | 3300014745 | Ga0157377_10408514 | Ga0157377_104085142 | 147 |
| 852 | 3300014968 | Ga0157379_10091450 | Ga0157379_100914503 | 147 |
| 853 | 3300014968 | Ga0157379_10194278 | Ga0157379_101942782 | 147 |
| 854 | 3300014968 | Ga0157379_11160540 | Ga0157379_111605401 | 147 |
| 855 | 3300014969 | Ga0157376_11714591 | Ga0157376_117145911 | 147 |
| 856 | 3300017792 | Ga0163161_10415592 | Ga0163161_104155922 | 147 |
| 857 | 3300017792 | Ga0163161_10465117 | Ga0163161_104651172 | 147 |
| 858 | 3300021377 | Ga0213874_10071243 | Ga0213874_100712431 | 147 |
| 859 | 3300025261 | Ga0209233_1010989 | Ga0209233_10109892 | 147 |
| 860 | 3300025297 | Ga0209758_1014122 | Ga0209758_10141223 | 147 |
| 861 | 3300025901 | Ga0207688_10376705 | Ga0207688_103767052 | 147 |
| 862 | 3300025903 | Ga0207680_10420424 | Ga0207680_104204242 | 147 |
| 863 | 3300025905 | Ga0207685_10061554 | Ga0207685_100615541 | 147 |
| 864 | 3300025905 | Ga0207685_10091468 | Ga0207685_100914683 | 147 |
| 865 | 3300025906 | Ga0207699_10007971 | Ga0207699_100079713 | 147 |
| 866 | 3300025907 | Ga0207645_10111250 | Ga0207645_101112503 | 147 |
| 867 | 3300025907 | Ga0207645_10230001 | Ga0207645_102300013 | 147 |
| 868 | 3300025909 | Ga0207705_10107411 | Ga0207705_101074112 | 147 |
| 869 | 3300025909 | Ga0207705_10336965 | Ga0207705_103369652 | 147 |
| 870 | 3300025911 | Ga0207654_10003986 | Ga0207654_100039869 | 147 |
| 871 | 3300025914 | Ga0207671_10161433 | Ga0207671_101614332 | 147 |
| 872 | 3300025915 | Ga0207693_10017732 | Ga0207693_100177327 | 147 |
| 873 | 3300025915 | Ga0207693_10071814 | Ga0207693_100718145 | 147 |
| 874 | 3300025915 | Ga0207693_10224131 | Ga0207693_102241313 | 147 |
| 875 | 3300025916 | Ga0207663_10098660 | Ga0207663_100986602 | 147 |
| 876 | 3300025918 | Ga0207662_10053614 | Ga0207662_100536144 | 147 |
| 877 | 3300025919 | Ga0207657_10108856 | Ga0207657_101088562 | 147 |
| 878 | 3300025919 | Ga0207657_10144087 | Ga0207657_101440873 | 147 |
| 879 | 3300025922 | Ga0207646_10654392 | Ga0207646_106543921 | 147 |
| 880 | 3300025923 | Ga0207681_10221169 | Ga0207681_102211692 | 147 |
| 881 | 3300025923 | Ga0207681_10468987 | Ga0207681_104689872 | 147 |
| 882 | 3300025925 | Ga0207650_10224192 | Ga0207650_102241922 | 147 |
| 883 | 3300025927 | Ga0207687_10072669 | Ga0207687_100726692 | 147 |
| 884 | 3300025927 | Ga0207687_10156541 | Ga0207687_101565412 | 147 |
| 885 | 3300025933 | Ga0207706_10140389 | Ga0207706_101403893 | 147 |
| 886 | 3300025933 | Ga0207706_10211712 | Ga0207706_102117123 | 147 |
| 887 | 3300025934 | Ga0207686_10243384 | Ga0207686_102433842 | 147 |
| 888 | 3300025935 | Ga0207709_10538518 | Ga0207709_105385182 | 147 |
| 889 | 3300025937 | Ga0207669_10461817 | Ga0207669_104618171 | 147 |
| 890 | 3300025938 | Ga0207704_10235996 | Ga0207704_102359962 | 147 |
| 891 | 3300025938 | Ga0207704_10590247 | Ga0207704_105902472 | 147 |
| 892 | 3300025940 | Ga0207691_10112935 | Ga0207691_101129352 | 147 |
| 893 | 3300025940 | Ga0207691_10382807 | Ga0207691_103828071 | 147 |
| 894 | 3300025941 | Ga0207711_10132016 | Ga0207711_101320163 | 147 |
| 895 | 3300025941 | Ga0207711_10141498 | Ga0207711_101414982 | 147 |
| 896 | 3300025942 | Ga0207689_10188832 | Ga0207689_101888322 | 147 |
| 897 | 3300025945 | Ga0207679_10830824 | Ga0207679_108308241 | 147 |
| 898 | 3300025949 | Ga0207667_10398955 | Ga0207667_103989552 | 147 |
| 899 | 3300025960 | Ga0207651_10437235 | Ga0207651_104372352 | 147 |
| 900 | 3300025960 | Ga0207651_11462327 | Ga0207651_114623271 | 147 |
| 901 | 3300025972 | Ga0207668_10093773 | Ga0207668_100937732 | 147 |
| 902 | 3300025972 | Ga0207668_10100667 | Ga0207668_101006672 | 147 |
| 903 | 3300025972 | Ga0207668_11587980 | Ga0207668_115879801 | 147 |
| 904 | 3300025981 | Ga0207640_10123664 | Ga0207640_101236642 | 147 |
| 905 | 3300025986 | Ga0207658_10068710 | Ga0207658_100687102 | 147 |
| 906 | 3300025986 | Ga0207658_10417121 | Ga0207658_104171212 | 147 |
| 907 | 3300025986 | Ga0207658_10708564 | Ga0207658_107085642 | 147 |
| 908 | 3300026023 | Ga0207677_10009584 | Ga0207677_100095849 | 147 |
| 909 | 3300026023 | Ga0207677_10502184 | Ga0207677_105021842 | 147 |
| 910 | 3300026035 | Ga0207703_10198335 | Ga0207703_101983353 | 147 |
| 911 | 3300026041 | Ga0207639_10187856 | Ga0207639_101878563 | 147 |
| 912 | 3300026067 | Ga0207678_10091019 | Ga0207678_100910193 | 147 |
| 913 | 3300026067 | Ga0207678_10145389 | Ga0207678_101453892 | 147 |
| 914 | 3300026067 | Ga0207678_10311791 | Ga0207678_103117912 | 147 |
| 915 | 3300026075 | Ga0207708_10070207 | Ga0207708_100702072 | 147 |
| 916 | 3300026075 | Ga0207708_10172260 | Ga0207708_101722602 | 147 |
| 917 | 3300026078 | Ga0207702_10888642 | Ga0207702_108886421 | 147 |
| 918 | 3300026088 | Ga0207641_10370945 | Ga0207641_103709452 | 147 |
| 919 | 3300026089 | Ga0207648_10515576 | Ga0207648_105155763 | 147 |
| 920 | 3300026116 | Ga0207674_11349153 | Ga0207674_113491532 | 147 |
| 921 | 3300026118 | Ga0207675_100023943 | Ga0207675_1000239432 | 147 |
| 922 | 3300026118 | Ga0207675_100301927 | Ga0207675_1003019272 | 147 |
| 923 | 3300026121 | Ga0207683_10129878 | Ga0207683_101298783 | 147 |
| 924 | 3300026121 | Ga0207683_10142278 | Ga0207683_101422782 | 147 |
| 925 | 3300026121 | Ga0207683_10836774 | Ga0207683_108367741 | 147 |
| 926 | 3300026142 | Ga0207698_10022118 | Ga0207698_100221182 | 147 |
| 927 | 3300026142 | Ga0207698_10319619 | Ga0207698_103196192 | 147 |
| 928 | 3300026142 | Ga0207698_10673861 | Ga0207698_106738612 | 147 |
| 929 | 3300027357 | Ga0209589_1000014 | Ga0209589_1000014128 | 147 |
| 930 | 3300027361 | Ga0209489_100014 | Ga0209489_100014128 | 147 |
| 931 | 3300027363 | Ga0209700_100024 | Ga0209700_100024128 | 147 |
| 932 | 3300027866 | Ga0209813_10100369 | Ga0209813_101003692 | 147 |
| 933 | 3300028379 | Ga0268266_10002572 | Ga0268266_1000257217 | 147 |
| 934 | 3300028379 | Ga0268266_10016539 | Ga0268266_100165393 | 147 |
| 935 | 3300028379 | Ga0268266_10524305 | Ga0268266_105243052 | 147 |
| 936 | 3300028379 | Ga0268266_10939677 | Ga0268266_109396772 | 147 |
| 937 | 3300028381 | Ga0268264_10381065 | Ga0268264_103810652 | 147 |
| 938 | 3300028573 | Ga0265334_10033792 | Ga0265334_100337922 | 147 |
| 939 | 3300028786 | Ga0307517_10328433 | Ga0307517_103284331 | 147 |
| 940 | 3300028794 | Ga0307515_10514596 | Ga0307515_105145962 | 147 |
| 941 | 3300031238 | Ga0265332_10038362 | Ga0265332_100383623 | 147 |
| 942 | 3300031242 | Ga0265329_10202263 | Ga0265329_102022631 | 147 |
| 943 | 3300031507 | Ga0307509_10022374 | Ga0307509_1002237410 | 147 |
| 944 | 3300031548 | Ga0307408_100688655 | Ga0307408_1006886552 | 147 |
| 945 | 3300031548 | Ga0307408_100798699 | Ga0307408_1007986992 | 147 |
| 946 | 3300031730 | Ga0307516_10338700 | Ga0307516_103387001 | 147 |
| 947 | 3300031730 | Ga0307516_10558769 | Ga0307516_105587692 | 147 |
| 948 | 3300031995 | Ga0307409_100353766 | Ga0307409_1003537664 | 147 |
| 949 | 3300031995 | Ga0307409_100534399 | Ga0307409_1005343992 | 147 |
| 950 | 3300032004 | Ga0307414_10177646 | Ga0307414_101776462 | 147 |
| 951 | 3300032005 | Ga0307411_11338587 | Ga0307411_113385871 | 147 |
| 952 | 3300032005 | Ga0307411_11484487 | Ga0307411_114844872 | 147 |
| 953 | 3300033179 | Ga0307507_10284262 | Ga0307507_102842622 | 147 |
| 954 | 3300033180 | Ga0307510_10020603 | Ga0307510_100206035 | 147 |
| 955 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002210 | 147 |
| 956 | 3300035089 | Ga0373944_0114222 | Ga0373944_0114222_82_528 | 147 |
| 957 | 3300035113 | Ga0373936_0027174 | Ga0373936_0027174_609_1055 | 147 |
| 958 | 3300035113 | Ga0373936_0489572 | Ga0373936_0489572_14_457 | 147 |
| 959 | 3300035116 | Ga0373945_0008608 | Ga0373945_0008608_188_634 | 147 |
| 960 | 3300035116 | Ga0373945_0074838 | Ga0373945_0074838_177_650 | 147 |
| 961 | 3300035170 | Ga0373943_0008018 | Ga0373943_0008018_2087_2533 | 147 |
| 962 | 3300035172 | Ga0373955_0146440 | Ga0373955_0146440_510_956 | 147 |
| 963 | 3300035410 | Ga0373924_0009724 | Ga0373924_0009724_2049_2495 | 147 |
| 964 | 3300035692 | Ga0373935_0002921 | Ga0373935_0002921_1364_1810 | 147 |
| 965 | 3300035692 | Ga0373935_0256586 | Ga0373935_0256586_457_930 | 147 |
| 966 | 3300035695 | Ga0373927_0006216 | Ga0373927_0006216_4891_5337 | 147 |
| 967 | 3300035695 | Ga0373927_0008327 | Ga0373927_0008327_3679_4152 | 147 |
| 968 | 3300035695 | Ga0373927_0401527 | Ga0373927_0401527_137_586 | 147 |
| 969 | 3300035725 | Ga0373947_0009619 | Ga0373947_0009619_5020_5466 | 147 |
| 970 | 3300035725 | Ga0373947_0039668 | Ga0373947_0039668_662_1135 | 147 |
| 971 | 3300037068 | Ga0373925_0014356 | Ga0373925_0014356_5202_5648 | 147 |
| 972 | 3300037068 | Ga0373925_0548489 | Ga0373925_0548489_280_732 | 147 |
| 973 | 3300037471 | Ga0395905_0281840 | Ga0395905_0281840_396_845 | 147 |
| 974 | 3300037471 | Ga0395905_0327977 | Ga0395905_0327977_461_910 | 147 |
| 975 | 3300037471 | Ga0395905_1560150 | Ga0395905_1560150_47_496 | 147 |
| 976 | 3300039437 | Ga0436365_1875539 | Ga0436365_1875539_171_617 | 147 |
| 977 | 3300039450 | Ga0436363_0502738 | Ga0436363_0502738_69_512 | 147 |
| 978 | 3300041413 | Ga0439465_0122313 | Ga0439465_0122313_423_872 | 147 |
| 979 | 3300041443 | Ga0451789_0740288 | Ga0451789_0740288_712_1161 | 147 |
| 980 | 3300041452 | Ga0451793_0743023 | Ga0451793_0743023_55_504 | 147 |
| 981 | 3300041459 | Ga0451800_0174695 | Ga0451800_0174695_112_558 | 147 |
| 982 | 3300041494 | Ga0451837_0207973 | Ga0451837_0207973_170_619 | 147 |
| 983 | 3300041997 | Ga0439431_0037586 | Ga0439431_0037586_695_1141 | 147 |
| 984 | 3300044694 | Ga0466963_0067977 | Ga0466963_0067977_1755_2201 | 147 |
| 985 | 3300045051 | Ga0451576_0746588 | Ga0451576_0746588_274_723 | 147 |
| 986 | 3300046452 | Ga0495617_083401 | Ga0495617_083401_418_867 | 147 |
| 987 | 3300046455 | Ga0495603_0000923 | Ga0495603_0000923_136_582 | 147 |
| 988 | 3300046455 | Ga0495603_0008897 | Ga0495603_0008897_3085_3558 | 147 |
| 989 | 3300046455 | Ga0495603_0029126 | Ga0495603_0029126_1162_1611 | 147 |
| 990 | 3300046457 | Ga0495590_0203895 | Ga0495590_0203895_47_496 | 147 |
| 991 | 3300046458 | Ga0495591_061776 | Ga0495591_061776_198_647 | 147 |
| 992 | 3300046459 | Ga0495629_0002400 | Ga0495629_0002400_10156_10602 | 147 |
| 993 | 3300046460 | Ga0495638_0137440 | Ga0495638_0137440_596_1045 | 147 |
| 994 | 3300046461 | Ga0495641_0005021 | Ga0495641_0005021_7985_8431 | 147 |
| 995 | 3300046471 | Ga0495650_0070150 | Ga0495650_0070150_722_1171 | 147 |
| 996 | 3300046472 | Ga0495580_0008695 | Ga0495580_0008695_4156_4602 | 147 |
| 997 | 3300046473 | Ga0495582_0000283 | Ga0495582_0000283_10882_11328 | 147 |
| 998 | 3300046473 | Ga0495582_0345117 | Ga0495582_0345117_398_847 | 147 |
| 999 | 3300046474 | Ga0495605_0126586 | Ga0495605_0126586_415_864 | 147 |
| 1000 | 3300046475 | Ga0495639_0000947 | Ga0495639_0000947_11662_12108 | 147 |
| 1001 | 3300046475 | Ga0495639_0044326 | Ga0495639_0044326_827_1300 | 147 |
| 1002 | 3300046475 | Ga0495639_0183009 | Ga0495639_0183009_229_678 | 147 |
| 1003 | 3300046476 | Ga0495662_0001975 | Ga0495662_0001975_3683_4129 | 147 |
| 1004 | 3300046476 | Ga0495662_0236757 | Ga0495662_0236757_136_588 | 147 |
| 1005 | 3300046477 | Ga0495664_0014799 | Ga0495664_0014799_2121_2567 | 147 |
| 1006 | 3300046492 | Ga0495585_0156841 | Ga0495585_0156841_681_1130 | 147 |
| 1007 | 3300046499 | Ga0495594_0000509 | Ga0495594_0000509_5843_6289 | 147 |
| 1008 | 3300046499 | Ga0495594_0038494 | Ga0495594_0038494_155_604 | 147 |
| 1009 | 3300046499 | Ga0495594_0413967 | Ga0495594_0413967_145_594 | 147 |
| 1010 | 3300046500 | Ga0495596_0152786 | Ga0495596_0152786_412_861 | 147 |
| 1011 | 3300046500 | Ga0495596_0394139 | Ga0495596_0394139_51_500 | 147 |
| 1012 | 3300046501 | Ga0495607_0529310 | Ga0495607_0529310_17_466 | 147 |
| 1013 | 3300046507 | Ga0495606_0377530 | Ga0495606_0377530_56_505 | 147 |
| 1014 | 3300046507 | Ga0495606_0397170 | Ga0495606_0397170_245_697 | 147 |
| 1015 | 3300046516 | Ga0495628_0008185 | Ga0495628_0008185_7160_7606 | 147 |
| 1016 | 3300046517 | Ga0495630_0007704 | Ga0495630_0007704_7129_7575 | 147 |
| 1017 | 3300046518 | Ga0495631_0080510 | Ga0495631_0080510_11_460 | 147 |
| 1018 | 3300046518 | Ga0495631_0275632 | Ga0495631_0275632_238_687 | 147 |
| 1019 | 3300046519 | Ga0495632_0102600 | Ga0495632_0102600_135_584 | 147 |
| 1020 | 3300046519 | Ga0495632_0347077 | Ga0495632_0347077_186_635 | 147 |
| 1021 | 3300046523 | Ga0495644_0061172 | Ga0495644_0061172_592_1041 | 147 |
| 1022 | 3300046523 | Ga0495644_0161790 | Ga0495644_0161790_317_766 | 147 |
| 1023 | 3300046524 | Ga0495648_0127691 | Ga0495648_0127691_222_671 | 147 |
| 1024 | 3300046526 | Ga0495666_0165013 | Ga0495666_0165013_227_700 | 147 |
| 1025 | 3300046529 | Ga0495652_0149151 | Ga0495652_0149151_1236_1682 | 147 |
| 1026 | 3300046531 | Ga0495665_0000145 | Ga0495665_0000145_13850_14296 | 147 |
| 1027 | 3300046533 | Ga0495640_0018916 | Ga0495640_0018916_2417_2863 | 147 |
| 1028 | 3300046537 | Ga0495598_0025225 | Ga0495598_0025225_526_975 | 147 |
| 1029 | 3300046539 | Ga0495621_0074838 | Ga0495621_0074838_659_1108 | 147 |
| 1030 | 3300046557 | Ga0495622_0035544 | Ga0495622_0035544_1215_1664 | 147 |
| 1031 | 3300046557 | Ga0495622_0111847 | Ga0495622_0111847_434_880 | 147 |
| 1032 | 3300046558 | Ga0495633_0140540 | Ga0495633_0140540_262_711 | 147 |
| 1033 | 3300046558 | Ga0495633_0178699 | Ga0495633_0178699_287_736 | 147 |
| 1034 | 3300046615 | Ga0495656_0029999 | Ga0495656_0029999_785_1234 | 147 |
| 1035 | 3300046616 | Ga0495668_0029125 | Ga0495668_0029125_928_1377 | 147 |
| 1036 | 3300046616 | Ga0495668_0097747 | Ga0495668_0097747_482_931 | 147 |
| 1037 | 3300046642 | Ga0495634_0001108 | Ga0495634_0001108_135_581 | 147 |
| 1038 | 3300046660 | Ga0495625_0420253 | Ga0495625_0420253_199_648 | 147 |
| 1039 | 3300046663 | Ga0495635_0043801 | Ga0495635_0043801_188_634 | 147 |
| 1040 | 3300046664 | Ga0495659_0063340 | Ga0495659_0063340_356_805 | 147 |
| 1041 | 3300046674 | Ga0495588_0029555 | Ga0495588_0029555_2170_2616 | 147 |
| 1042 | 3300046674 | Ga0495588_0224003 | Ga0495588_0224003_395_844 | 147 |
| 1043 | 3300046680 | Ga0495646_0093632 | Ga0495646_0093632_158_604 | 147 |
| 1044 | 3300046681 | Ga0495647_0001082 | Ga0495647_0001082_2645_3091 | 147 |
| 1045 | 3300046683 | Ga0495658_0000547 | Ga0495658_0000547_6255_6701 | 147 |
| 1046 | 3300046683 | Ga0495658_0948278 | Ga0495658_0948278_22_471 | 147 |
| 1047 | 3300046684 | Ga0495669_0204882 | Ga0495669_0204882_225_674 | 147 |
| 1048 | 3300046689 | Ga0495613_0002250 | Ga0495613_0002250_10449_10895 | 147 |
| 1049 | 3300046690 | Ga0495624_0005060 | Ga0495624_0005060_1050_1496 | 147 |
| 1050 | 3300046692 | Ga0495671_0175425 | Ga0495671_0175425_210_659 | 147 |
| 1051 | 3300046694 | Ga0495649_0324637 | Ga0495649_0324637_128_574 | 147 |
| 1052 | 3300046794 | Ga0495589_0073693 | Ga0495589_0073693_807_1250 | 147 |
| 1053 | 3300047315 | Ga0495581_0000529 | Ga0495581_0000529_2715_3161 | 147 |
| 1054 | 3300047315 | Ga0495581_0338982 | Ga0495581_0338982_91_540 | 147 |
| 1055 | 3300047315 | Ga0495581_0487189 | Ga0495581_0487189_170_619 | 147 |
| 1056 | 3300047315 | Ga0495581_0821646 | Ga0495581_0821646_74_523 | 147 |
| 1057 | 3300047317 | Ga0495604_0508708 | Ga0495604_0508708_280_726 | 147 |
| 1058 | 3300047318 | Ga0495636_0082983 | Ga0495636_0082983_266_715 | 147 |
| 1059 | 3300047319 | Ga0495674_0016431 | Ga0495674_0016431_5980_6426 | 147 |
| 1060 | 3300047320 | Ga0495672_0054549 | Ga0495672_0054549_786_1238 | 147 |
| 1061 | 3300047321 | Ga0495676_0017967 | Ga0495676_0017967_3103_3549 | 147 |
| 1062 | 3300047322 | Ga0495680_0131585 | Ga0495680_0131585_111_605 | 147 |
| 1063 | 3300047323 | Ga0495683_0163836 | Ga0495683_0163836_406_855 | 147 |
| 1064 | 3300047323 | Ga0495683_0339548 | Ga0495683_0339548_31_480 | 147 |
| 1065 | 3300047445 | Ga0495677_0027527 | Ga0495677_0027527_356_799 | 147 |
| 1066 | 3300047447 | Ga0495685_085656 | Ga0495685_085656_226_675 | 147 |
| 1067 | 3300047469 | Ga0495673_0104083 | Ga0495673_0104083_379_828 | 147 |
| 1068 | 3300047471 | Ga0495684_0343619 | Ga0495684_0343619_461_907 | 147 |
| 1069 | 3300047472 | Ga0495686_0420027 | Ga0495686_0420027_28_477 | 147 |
| 1070 | 3300047673 | Ga0495593_0000877 | Ga0495593_0000877_10755_11201 | 147 |
| 1071 | 3300048090 | Ga0495615_0047371 | Ga0495615_0047371_617_1066 | 147 |
| 1072 | 3300048090 | Ga0495615_0125972 | Ga0495615_0125972_41_484 | 147 |
| 1073 | 3300048091 | Ga0495626_0045400 | Ga0495626_0045400_1487_1933 | 147 |
| 1074 | 3300048903 | Ga0496100_0190172 | Ga0496100_0190172_709_1167 | 147 |
| 1075 | 3300048903 | Ga0496100_0406092 | Ga0496100_0406092_571_1014 | 147 |
| 1076 | 3300048904 | Ga0496101_1305519 | Ga0496101_1305519_28_471 | 147 |
| 1077 | 3300048905 | Ga0496102_0274253 | Ga0496102_0274253_850_1299 | 147 |
| 1078 | 3300048905 | Ga0496102_0716835 | Ga0496102_0716835_295_744 | 147 |
| 1079 | 3300048907 | Ga0496104_0237039 | Ga0496104_0237039_1055_1498 | 147 |
| 1080 | 3300048908 | Ga0496105_0321703 | Ga0496105_0321703_637_1080 | 147 |
| 1081 | 3300048909 | Ga0496106_0499129 | Ga0496106_0499129_449_892 | 147 |
| 1082 | 3300048910 | Ga0496107_0135503 | Ga0496107_0135503_859_1308 | 147 |
| 1083 | 3300048912 | Ga0496109_0232105 | Ga0496109_0232105_525_974 | 147 |
| 1084 | 3300048913 | Ga0496110_0334689 | Ga0496110_0334689_835_1287 | 147 |
| 1085 | 3300048913 | Ga0496110_0383326 | Ga0496110_0383326_62_511 | 147 |
| 1086 | 3300048913 | Ga0496110_1206726 | Ga0496110_1206726_55_513 | 147 |
| 1087 | 3300048915 | Ga0496112_0360407 | Ga0496112_0360407_465_914 | 147 |
| 1088 | 3300048918 | Ga0496115_0108177 | Ga0496115_0108177_1447_1890 | 147 |
| 1089 | 3300048919 | Ga0496116_0250958 | Ga0496116_0250958_378_827 | 147 |
| 1090 | 3300048920 | Ga0496117_0413288 | Ga0496117_0413288_162_611 | 147 |
| 1091 | 3300048924 | Ga0496121_0091052 | Ga0496121_0091052_799_1245 | 147 |
| 1092 | 3300048924 | Ga0496121_0182304 | Ga0496121_0182304_506_958 | 147 |
| 1093 | 3300048924 | Ga0496121_0339226 | Ga0496121_0339226_152_604 | 147 |
| 1094 | 3300048924 | Ga0496121_0388225 | Ga0496121_0388225_95_541 | 147 |
| 1095 | 3300048927 | Ga0496124_0201315 | Ga0496124_0201315_944_1390 | 147 |
| 1096 | 3300048927 | Ga0496124_0218488 | Ga0496124_0218488_863_1312 | 147 |
| 1097 | 3300048929 | Ga0496126_0020218 | Ga0496126_0020218_3020_3478 | 147 |
| 1098 | 3300048929 | Ga0496126_0075786 | Ga0496126_0075786_1476_1925 | 147 |
| 1099 | 3300049459 | Ga0495678_135871 | Ga0495678_135871_79_528 | 147 |
| 1100 | 3300049460 | Ga0495682_0039370 | Ga0495682_0039370_496_945 | 147 |
| 1101 | 3300049576 | Ga0501040_1343336 | Ga0501040_1343336_50_499 | 147 |
| 1102 | 3300049580 | Ga0501046_0589643 | Ga0501046_0589643_139_588 | 147 |
| 1103 | 3300049583 | Ga0501067_0015314 | Ga0501067_0015314_1165_1614 | 147 |
| 1104 | 3300049585 | Ga0501069_0198636 | Ga0501069_0198636_415_864 | 147 |
| 1105 | 3300049586 | Ga0501070_0042040 | Ga0501070_0042040_732_1181 | 147 |
| 1106 | 3300049592 | Ga0501076_0531103 | Ga0501076_0531103_317_766 | 147 |
| 1107 | 3300049822 | Ga0501035_0302631 | Ga0501035_0302631_308_757 | 147 |
| 1108 | 3300050489 | nmdc:mga03683_37660_c1 | nmdc:mga03683_37660_c1_865_1314 | 147 |
| 1109 | 3300050490 | nmdc:mga03n38_23610_c1 | nmdc:mga03n38_23610_c1_784_1227 | 147 |
| 1110 | 3300050490 | nmdc:mga03n38_2731_c1 | nmdc:mga03n38_2731_c1_2793_3239 | 147 |
| 1111 | 3300050490 | nmdc:mga03n38_345885_c1 | nmdc:mga03n38_345885_c1_260_706 | 147 |
| 1112 | 3300050490 | nmdc:mga03n38_492990_c1 | nmdc:mga03n38_492990_c1_178_627 | 147 |
| 1113 | 3300050491 | nmdc:mga00v17_355299_c1 | nmdc:mga00v17_355299_c1_250_699 | 147 |
| 1114 | 3300050492 | nmdc:mga0yw44_1075814_c1 | nmdc:mga0yw44_1075814_c1_19_468 | 147 |
| 1115 | 3300050492 | nmdc:mga0yw44_591053_c1 | nmdc:mga0yw44_591053_c1_21_470 | 147 |
| 1116 | 3300050492 | nmdc:mga0yw44_610427_c1 | nmdc:mga0yw44_610427_c1_191_640 | 147 |
| 1117 | 3300050493 | nmdc:mga0k408_131452_c1 | nmdc:mga0k408_131452_c1_989_1432 | 147 |
| 1118 | 3300050493 | nmdc:mga0k408_157311_c1 | nmdc:mga0k408_157311_c1_186_635 | 147 |
| 1119 | 3300050493 | nmdc:mga0k408_290290_c1 | nmdc:mga0k408_290290_c1_29_475 | 147 |
| 1120 | 3300050494 | nmdc:mga06z11_210473_c1 | nmdc:mga06z11_210473_c1_645_1094 | 147 |
| 1121 | 3300050494 | nmdc:mga06z11_755090_c1 | nmdc:mga06z11_755090_c1_40_483 | 147 |
| 1122 | 3300050494 | nmdc:mga06z11_7845_c1 | nmdc:mga06z11_7845_c1_283_729 | 147 |
| 1123 | 3300050495 | nmdc:mga04h51_14733_c1 | nmdc:mga04h51_14733_c1_293_739 | 147 |
| 1124 | 3300050496 | nmdc:mga07m45_10213_c1 | nmdc:mga07m45_10213_c1_3350_3793 | 147 |
| 1125 | 3300050496 | nmdc:mga07m45_260018_c1 | nmdc:mga07m45_260018_c1_359_805 | 147 |
| 1126 | 3300050496 | nmdc:mga07m45_466221_c1 | nmdc:mga07m45_466221_c1_138_587 | 147 |
| 1127 | 3300050512 | nmdc:mga0n895_218891_c1 | nmdc:mga0n895_218891_c1_1270_1719 | 147 |
| 1128 | 3300050513 | nmdc:mga0rr50_472846_c1 | nmdc:mga0rr50_472846_c1_188_637 | 147 |
| 1129 | 3300050516 | nmdc:mga0sz30_40347_c1 | nmdc:mga0sz30_40347_c1_944_1387 | 147 |
| 1130 | 3300050516 | nmdc:mga0sz30_420904_c1 | nmdc:mga0sz30_420904_c1_86_535 | 147 |
| 1131 | 3300053078 | Ga0495612_0070130 | Ga0495612_0070130_147_596 | 147 |
| 1132 | 3300053079 | Ga0500610_0277187 | Ga0500610_0277187_117_566 | 147 |
| 1133 | 3300053083 | Ga0495655_0019706 | Ga0495655_0019706_751_1197 | 147 |
| 1134 | 3300053083 | Ga0495655_0066392 | Ga0495655_0066392_319_768 | 147 |
| 1135 | 3300053086 | Ga0500578_0237796 | Ga0500578_0237796_369_818 | 147 |
| 1136 | 3300053088 | Ga0500644_0316851 | Ga0500644_0316851_96_545 | 147 |
| 1137 | 3300053093 | Ga0500651_0012461 | Ga0500651_0012461_1883_2329 | 147 |
| 1138 | 3300053093 | Ga0500651_0161567 | Ga0500651_0161567_420_869 | 147 |
| 1139 | 3300053094 | Ga0500566_0003981 | Ga0500566_0003981_4669_5115 | 147 |
| 1140 | 3300053096 | Ga0500641_0013736 | Ga0500641_0013736_2206_2649 | 147 |
| 1141 | 3300053102 | Ga0500554_315860 | Ga0500554_315860_22_468 | 147 |
| 1142 | 3300053103 | Ga0500555_039621 | Ga0500555_039621_529_978 | 147 |
| 1143 | 3300053104 | Ga0500556_0250891 | Ga0500556_0250891_35_484 | 147 |
| 1144 | 3300053119 | Ga0500595_021448 | Ga0500595_021448_812_1261 | 147 |
| 1145 | 3300053124 | Ga0500617_138974 | Ga0500617_138974_487_936 | 147 |
| 1146 | 3300053125 | Ga0500618_002192 | Ga0500618_002192_7152_7598 | 147 |
| 1147 | 3300053127 | Ga0500623_258140 | Ga0500623_258140_34_483 | 147 |
| 1148 | 3300053134 | Ga0500658_0214615 | Ga0500658_0214615_224_673 | 147 |
| 1149 | 3300053136 | Ga0500559_0000051 | Ga0500559_0000051_63340_63786 | 147 |
| 1150 | 3300053143 | Ga0500579_127333 | Ga0500579_127333_210_659 | 147 |
| 1151 | 3300053148 | Ga0500590_025192 | Ga0500590_025192_603_1049 | 147 |
| 1152 | 3300053148 | Ga0500590_133908 | Ga0500590_133908_671_1120 | 147 |
| 1153 | 3300053157 | Ga0500624_011437 | Ga0500624_011437_834_1280 | 147 |
| 1154 | 3300053161 | Ga0500634_0184765 | Ga0500634_0184765_196_645 | 147 |
| 1155 | 3300053162 | Ga0500638_063626 | Ga0500638_063626_1117_1566 | 147 |
| 1156 | 3300053177 | Ga0500636_0000249 | Ga0500636_0000249_28271_28717 | 147 |
| 1157 | 3300053178 | Ga0500637_0414618 | Ga0500637_0414618_60_506 | 147 |
| 1158 | 3300053730 | Ga0500645_090029 | Ga0500645_090029_118_567 | 147 |
| 1159 | 3300053731 | Ga0500609_016844 | Ga0500609_016844_301_750 | 147 |
| 1160 | 3300053735 | Ga0500596_011038 | Ga0500596_011038_113_559 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qda-assembly4.cif.gz_F | crystal structure of mutant thioesterase pa1618 (e64a) from pseudomonas aeruginosa | 0.8559 | 81 | 142 |
| 3fzx-assembly1.cif.gz_A-2 | crystal structure of a putative exported protein with ymcc-like fold (bf2203) from bacteroides fragilis nctc 9343 at 2.22 a resolution | 0.8541 | 100 | 141 |
| 1vh9-assembly1.cif.gz_A | crystal structure of a putative thioesterase | 0.8343 | 81 | 140 |
| 3k67-assembly1.cif.gz_A | crystal structure of protein af1124 from archaeoglobus fulgidus | 0.8266 | 7 | 142 |
| 5cpg-assembly1.cif.gz_B | r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form | 0.8263 | 5 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A0N4_66_202_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8796 | 81 | 142 | 3.10.129.10 |
| 3k67A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8266 | 7 | 142 | 3.10.129.10 |
| 5cpgB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8263 | 5 | 144 | 3.10.129.10 |
| af_Q86HX3_15_154_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8215 | 82 | 138 | 3.10.129.10 |
| 1iq6A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8191 | 6 | 142 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5V589-F1-model_v4 | deleted | 0.9088 | 54 | 143 |
|
| AF-A0A327KDA8-F1-model_v4 | Phosphate acetyltransferase | 0.8976 | 4 | 143 |
GO:0006633
GO:0016740 GO:0019171 |
| AF-A0A3S4FCD8-F1-model_v4 | (R)-specific enoyl-CoA hydratase | 0.8935 | 3 | 143 |
GO:0006633
GO:0019171 |
| AF-A0A6N6T4G8-F1-model_v4 | MaoC family dehydratase | 0.889 | 1 | 146 |
|
| AF-H0JVR2-F1-model_v4 | Beta-hydroxyacyl-[acyl-carrier-protein] dehydratase subunit | 0.8859 | 81 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar