F490998

General Info

Members Datasets Scaffolds Average Seq Length
1160 547 1106 146

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0131585|Ga0495680_0131585_111_605
Length 164
Sequence LFGPRLDDPAGIGEGAVTITFENLNTGDSIDGPQFAVSRESIRLFCDASLDYNPLHLDDDYMKGSFGKTNFGGIIMHGMNNFGLISRMITDWAYPAGAIHRRLETRWVKPVRPGDVIQPTGIVKSKQTTANSRWVLIDVMVRNQNDEKVATGEAMVEFPLEAAV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
11 2643221621 Achromobacter sp. Root83 Isolate Unclassified
12 2643221651 Afipia sp. Root123D2 Isolate Unclassified
13 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
14 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
15 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
16 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
17 2791355199
18 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
19 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
20 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
21 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
22 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
23 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
24 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
25 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
26 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
27 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
28 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
29 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
30 2904699407
31 2906610324
32 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
33 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
34 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
35 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
36 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
37 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
38 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
39 2922425934
40 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
41 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
42 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
43 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
44 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
45 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
46 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
47 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
48 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
49 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
90 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
98 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
99 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
100 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
101 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
102 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
119 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
120 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
121 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
122 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
123 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
127 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
128 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
129 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
130 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
131 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
132 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
137 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
138 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
143 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
144 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
145 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
161 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
173 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
174 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
177 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
178 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
179 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
240 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
241 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
242 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
245 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
248 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
249 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
250 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
251 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
252 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
253 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
257 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
258 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
274 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
275 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
276 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
277 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
278 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
280 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
282 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
283 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
284 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
285 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
286 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
287 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
288 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
293 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
294 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
303 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
306 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
307 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
308 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
309 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
310 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
311 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
312 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
313 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
314 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
315 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
316 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
319 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
323 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
324 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
325 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
326 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
327 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
328 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
329 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
330 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
331 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
332 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
342 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
343 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
344 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
348 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
351 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
352 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
353 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
358 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
359 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
360 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
361 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
362 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
363 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
364 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
382 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
383 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
384 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
385 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
390 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
391 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
392 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
395 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
396 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
397 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
398 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
403 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
404 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
408 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
409 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
410 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
411 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
418 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
419 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
420 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
421 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
422 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
423 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
424 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
425 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
426 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
427 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
428 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
429 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
430 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
431 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
432 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
447 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
448 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
449 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
450 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
451 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
452 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
453 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
454 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
458 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
461 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
462 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
463 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
464 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
465 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
466 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
467 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
468 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
471 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
472 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
473 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
477 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
478 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
479 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
480 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
481 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
482 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
483 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
484 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
485 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
486 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
487 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
488 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
489 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
490 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
491 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
492 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
493 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
494 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
495 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
496 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
497 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
498 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
499 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
500 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
501 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
502 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
503 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
504 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
505 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
506 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
507 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
508 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
509 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
510 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
511 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
512 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
513 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
514 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
515 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
516 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
517 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
518 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
519 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
520 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
521 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
522 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
523 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
524 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
525 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
526 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
527 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
528 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
529 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
530 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
531 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
532 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
535 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
536 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
537 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
538 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
539 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
540 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
541 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
542 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
543 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
544 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
545 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
546 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
547 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.67
Metatranscriptomes 0
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.52
Nodule 3.45
Rhizoplane 5.09
Rhizosphere 69.31
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10233007 3300001990 Bacteria 543
2 JGI24744J21845_10007397 3300002077 Bacteria 2268
3 JGI25406J46586_10000506 3300003203 Bacteria 18253
4 JGI25406J46586_10004272 3300003203 Bacteria 6674
5 JGI25165J46597_1008424 3300003214 Bacteria 1618
6 rootH1_10119036 3300003316 Bacteria 1265
7 rootH1_10048045 3300003323 Bacteria 2491
8 JGI25404J52841_10008669 3300003659 Bacteria 2171
9 JGI25404J52841_10022087 3300003659 Bacteria 1376
10 Ga0055526_1021857 3300003771 Bacteria 2204
11 Ga0055526_1043572 3300003771 Bacteria 1091
12 JGI25405J52794_10050771 3300003911 Bacteria 889
13 Ga0070658_10005658 3300005327 Bacteria 10131
14 Ga0070658_10043632 3300005327 Bacteria 3622
15 Ga0070658_10862462 3300005327 Bacteria 787
16 Ga0070676_10276015 3300005328 Bacteria 1130
17 Ga0070683_100010541 3300005329 Bacteria 7946
18 Ga0070683_100089709 3300005329 Bacteria 2885
19 Ga0070670_100667212 3300005331 Bacteria 933
20 Ga0070670_100762094 3300005331 Bacteria 873
21 Ga0070670_101638856 3300005331 Bacteria 592
22 Ga0070677_10337662 3300005333 Bacteria 777
23 Ga0068869_100230778 3300005334 Bacteria 1471
24 Ga0068869_100640373 3300005334 Bacteria 901
25 Ga0068869_100723311 3300005334 Bacteria 850
26 Ga0070680_100016960 3300005336 Bacteria 5734
27 Ga0070680_100035793 3300005336 Bacteria 4009
28 Ga0070680_100106864 3300005336 Bacteria 2327
29 Ga0070680_101061454 3300005336 Bacteria 700
30 Ga0070682_100425063 3300005337 Bacteria 1011
31 Ga0070682_100501566 3300005337 Bacteria 940
32 Ga0070682_100527873 3300005337 Bacteria 919
33 Ga0070660_100029340 3300005339 Bacteria 4122
34 Ga0070660_100313429 3300005339 Bacteria 1288
35 Ga0070660_100571368 3300005339 Bacteria 944
36 Ga0070691_10011291 3300005341 Bacteria 4076
37 Ga0070661_100003193 3300005344 Bacteria 11298
38 Ga0070661_100051572 3300005344 Bacteria 3011
39 Ga0070661_100136029 3300005344 Bacteria 1849
40 Ga0070661_101169224 3300005344 Bacteria 643
41 Ga0070661_101665914 3300005344 Bacteria 540
42 Ga0070668_100099179 3300005347 Bacteria 2306
43 Ga0070668_100127131 3300005347 Bacteria 2042
44 Ga0070668_100944760 3300005347 Bacteria 772
45 Ga0070668_101168006 3300005347 Bacteria 696
46 Ga0070668_101217584 3300005347 Bacteria 683
47 Ga0070669_100273914 3300005353 Bacteria 1350
48 Ga0070669_100445276 3300005353 Bacteria 1067
49 Ga0070675_100256817 3300005354 Bacteria 1530
50 Ga0070675_100738649 3300005354 Bacteria 898
51 Ga0070671_100181765 3300005355 Bacteria 1780
52 Ga0070671_100184578 3300005355 Bacteria 1767
53 Ga0070671_101555660 3300005355 Bacteria 586
54 Ga0070674_100042736 3300005356 Bacteria 3080
55 Ga0070674_100307190 3300005356 Bacteria 1267
56 Ga0070674_100786466 3300005356 Bacteria 820
57 Ga0070673_100389150 3300005364 Bacteria 1245
58 Ga0070673_101423418 3300005364 Bacteria 653
59 Ga0070659_100053281 3300005366 Bacteria 3184
60 Ga0070659_100348585 3300005366 Bacteria 1242
61 Ga0070659_100438157 3300005366 Bacteria 1107
62 Ga0070667_100133126 3300005367 Bacteria 2171
63 Ga0070667_100291043 3300005367 Bacteria 1469
64 Ga0070667_101166568 3300005367 Bacteria 721
65 Ga0070709_10148888 3300005434 Bacteria 1616
66 Ga0070714_100291413 3300005435 Bacteria 1519
67 Ga0070714_101018577 3300005435 Bacteria 806
68 Ga0070714_101135693 3300005435 Bacteria 762
69 Ga0070713_100302920 3300005436 Bacteria 1472
70 Ga0070713_101608477 3300005436 Bacteria 631
71 Ga0070710_10089252 3300005437 Bacteria 1815
72 Ga0070711_100682161 3300005439 Bacteria 864
73 Ga0070705_100222254 3300005440 Bacteria 1308
74 Ga0070705_100332163 3300005440 Bacteria 1102
75 Ga0070700_100085097 3300005441 Bacteria 2051
76 Ga0070708_100493791 3300005445 Bacteria 1155
77 Ga0070663_100331498 3300005455 Bacteria 1227
78 Ga0070663_100503118 3300005455 Bacteria 1006
79 Ga0070663_100749797 3300005455 Bacteria 833
80 Ga0070663_100889621 3300005455 Bacteria 768
81 Ga0070663_101300199 3300005455 Bacteria 641
82 Ga0070678_100038182 3300005456 Bacteria 3379
83 Ga0070678_100060737 3300005456 Bacteria 2783
84 Ga0070678_100102017 3300005456 Bacteria 2225
85 Ga0070678_100339844 3300005456 Bacteria 1288
86 Ga0070678_100777996 3300005456 Bacteria 867
87 Ga0070662_100083587 3300005457 Bacteria 2383
88 Ga0070662_100086125 3300005457 Bacteria 2349
89 Ga0070662_100320052 3300005457 Bacteria 1265
90 Ga0070681_10082287 3300005458 Bacteria 3174
91 Ga0070681_10269634 3300005458 Bacteria 1614
92 Ga0070681_10482526 3300005458 Bacteria 1152
93 Ga0070681_10734442 3300005458 Bacteria 903
94 Ga0068867_100069826 3300005459 Bacteria 2624
95 Ga0068867_100219687 3300005459 Bacteria 1531
96 Ga0068867_100451852 3300005459 Bacteria 1095
97 Ga0070706_100691910 3300005467 Bacteria 946
98 Ga0070706_100732196 3300005467 Bacteria 916
99 Ga0070706_102029562 3300005467 Bacteria 521
100 Ga0070707_100272741 3300005468 Bacteria 1645
101 Ga0070698_100120374 3300005471 Bacteria 2585
102 Ga0070698_100379831 3300005471 Bacteria 1345
103 Ga0070699_101068137 3300005518 Bacteria 741
104 Ga0070699_101214952 3300005518 Bacteria 691
105 Ga0070679_100146761 3300005530 Bacteria 2336
106 Ga0070679_100229319 3300005530 Bacteria 1817
107 Ga0070679_100608542 3300005530 Bacteria 1036
108 Ga0070679_100879258 3300005530 Bacteria 839
109 Ga0070679_101183553 3300005530 Bacteria 709
110 Ga0070684_100010579 3300005535 Bacteria 7315
111 Ga0070684_100159258 3300005535 Bacteria 2047
112 Ga0070684_101303597 3300005535 Bacteria 683
113 Ga0070697_100440006 3300005536 Bacteria 1135
114 Ga0068853_100009893 3300005539 Bacteria 7697
115 Ga0068853_100505327 3300005539 Bacteria 1141
116 Ga0068853_100724445 3300005539 Bacteria 950
117 Ga0068853_101020511 3300005539 Bacteria 797
118 Ga0068853_101497639 3300005539 Bacteria 653
119 Ga0070672_100130487 3300005543 Bacteria 2065
120 Ga0070672_100256276 3300005543 Bacteria 1474
121 Ga0070672_100520352 3300005543 Bacteria 1031
122 Ga0070686_100071730 3300005544 Bacteria 2269
123 Ga0070695_100188946 3300005545 Bacteria 1464
124 Ga0070696_100268954 3300005546 Bacteria 1295
125 Ga0070693_100327370 3300005547 Bacteria 1041
126 Ga0070693_100553612 3300005547 Bacteria 824
127 Ga0070693_100742460 3300005547 Bacteria 722
128 Ga0070693_101417298 3300005547 Bacteria 541
129 Ga0070665_100033424 3300005548 Bacteria 5175
130 Ga0070665_100049060 3300005548 Bacteria 4237
131 Ga0070665_100114119 3300005548 Bacteria 2704
132 Ga0070665_100277859 3300005548 Bacteria 1676
133 Ga0070665_100315826 3300005548 Bacteria 1566
134 Ga0070665_100573234 3300005548 Bacteria 1141
135 Ga0070665_100789458 3300005548 Bacteria 962
136 Ga0070665_100838229 3300005548 Bacteria 932
137 Ga0070665_100942965 3300005548 Bacteria 875
138 Ga0070665_101436910 3300005548 Bacteria 699
139 Ga0070665_101631767 3300005548 Bacteria 652
140 Ga0070665_101645743 3300005548 Bacteria 649
141 Ga0070665_101669511 3300005548 Bacteria 645
142 Ga0070704_100521162 3300005549 Bacteria 1034
143 Ga0068855_100064018 3300005563 Bacteria 4289
144 Ga0068855_100090898 3300005563 Bacteria 3522
145 Ga0068855_100306312 3300005563 Bacteria 1758
146 Ga0068855_101150552 3300005563 Bacteria 809
147 Ga0068855_101946364 3300005563 Bacteria 595
148 Ga0068857_100401487 3300005577 Bacteria 1275
149 Ga0068857_100959311 3300005577 Bacteria 822
150 Ga0068857_101010887 3300005577 Bacteria 801
151 Ga0068854_100026148 3300005578 Bacteria 4009
152 Ga0068854_100195888 3300005578 Bacteria 1585
153 Ga0068856_100000046 3300005614 Bacteria 109174
154 Ga0068856_100069409 3300005614 Bacteria 3484
155 Ga0068856_100165022 3300005614 Bacteria 2226
156 Ga0068856_101744280 3300005614 Bacteria 635
157 Ga0068856_101958720 3300005614 Bacteria 596
158 Ga0070702_100900522 3300005615 Bacteria 692
159 Ga0068852_100008117 3300005616 Bacteria 7706
160 Ga0068852_100034471 3300005616 Bacteria 4212
161 Ga0068852_100074065 3300005616 Bacteria 2998
162 Ga0068852_101391280 3300005616 Bacteria 724
163 Ga0068859_101146714 3300005617 Bacteria 856
164 Ga0068864_100094099 3300005618 Bacteria 2647
165 Ga0068866_10236400 3300005718 Bacteria 1110
166 Ga0068866_10477385 3300005718 Bacteria 821
167 Ga0068861_100017186 3300005719 Bacteria 5129
168 Ga0068861_100419799 3300005719 Bacteria 1192
169 Ga0068861_100662571 3300005719 Bacteria 965
170 Ga0068861_101148903 3300005719 Bacteria 748
171 Ga0068851_10022304 3300005834 Bacteria 3082
172 Ga0068851_10861708 3300005834 Bacteria 566
173 Ga0068863_100157574 3300005841 Bacteria 2174
174 Ga0068858_100041366 3300005842 Bacteria 4273
175 Ga0068858_100647765 3300005842 Bacteria 1026
176 Ga0068858_102352186 3300005842 Bacteria 527
177 Ga0068860_100217289 3300005843 Bacteria 1855
178 Ga0068860_100836871 3300005843 Bacteria 935
179 Ga0068862_100063134 3300005844 Bacteria 3187
180 Ga0068862_100212949 3300005844 Bacteria 1746
181 Ga0068862_100366828 3300005844 Bacteria 1339
182 Ga0068862_100520789 3300005844 Bacteria 1131
183 Ga0068862_100540415 3300005844 Bacteria 1111
184 Ga0068862_101118104 3300005844 Bacteria 784
185 Ga0068862_101329463 3300005844 Bacteria 720
186 Ga0081455_10000875 3300005937 Bacteria 38950
187 Ga0081455_10011544 3300005937 Bacteria 8868
188 Ga0081455_10028504 3300005937 Bacteria 5102
189 Ga0081540_1001143 3300005983 Bacteria 23424
190 Ga0081540_1002776 3300005983 Bacteria 14204
191 Ga0081540_1003496 3300005983 Bacteria 12400
192 Ga0081540_1004605 3300005983 Bacteria 10440
193 Ga0081540_1005685 3300005983 Bacteria 9260
194 Ga0081540_1065648 3300005983 Bacteria 1705
195 Ga0081540_1144836 3300005983 Bacteria 948
196 Ga0081539_10001572 3300005985 Bacteria 37755
197 Ga0081539_10001606 3300005985 Bacteria 37203
198 Ga0081539_10040265 3300005985 Bacteria 2744
199 Ga0081539_10042367 3300005985 Bacteria 2653
200 Ga0081539_10077341 3300005985 Bacteria 1760
201 Ga0070717_10435202 3300006028 Bacteria 1181
202 Ga0070717_10968685 3300006028 Bacteria 775
203 Ga0075365_10019900 3300006038 Bacteria 4152
204 Ga0075365_10043535 3300006038 Bacteria 2939
205 Ga0075365_10045372 3300006038 Bacteria 2883
206 Ga0075365_10095901 3300006038 Bacteria 2026
207 Ga0075365_10535332 3300006038 Bacteria 828
208 Ga0075368_10019828 3300006042 Bacteria 2540
209 Ga0075368_10033435 3300006042 Bacteria 2000
210 Ga0075363_100143329 3300006048 Bacteria 1346
211 Ga0075363_100553158 3300006048 Bacteria 687
212 Ga0075363_100563305 3300006048 Bacteria 680
213 Ga0075364_10012790 3300006051 Bacteria 5146
214 Ga0075364_10013014 3300006051 Bacteria 5105
215 Ga0075364_10039069 3300006051 Bacteria 3075
216 Ga0075364_10193964 3300006051 Bacteria 1376
217 Ga0075364_10479953 3300006051 Bacteria 850
218 Ga0075364_10530689 3300006051 Bacteria 805
219 Ga0075364_10599679 3300006051 Bacteria 752
220 Ga0075432_10082761 3300006058 Bacteria 1166
221 Ga0070716_100141123 3300006173 Bacteria 1536
222 Ga0070716_101051224 3300006173 Bacteria 647
223 Ga0070712_100208218 3300006175 Bacteria 1541
224 Ga0070712_100431807 3300006175 Bacteria 1093
225 Ga0075362_10008329 3300006177 Bacteria 3962
226 Ga0075362_10217222 3300006177 Bacteria 934
227 Ga0075367_10019217 3300006178 Bacteria 3786
228 Ga0075367_10030079 3300006178 Bacteria 3110
229 Ga0075367_10039371 3300006178 Bacteria 2756
230 Ga0075367_10162825 3300006178 Bacteria 1387
231 Ga0075367_10186347 3300006178 Bacteria 1294
232 Ga0075367_10198704 3300006178 Bacteria 1253
233 Ga0075367_10358635 3300006178 Bacteria 920
234 Ga0075367_10402752 3300006178 Bacteria 865
235 Ga0075367_10452429 3300006178 Bacteria 814
236 Ga0075369_10165435 3300006186 Bacteria 1014
237 Ga0075366_10086400 3300006195 Bacteria 1876
238 Ga0075366_10680381 3300006195 Bacteria 639
239 Ga0097621_100142279 3300006237 Bacteria 2050
240 Ga0097621_100157271 3300006237 Bacteria 1951
241 Ga0097621_101524750 3300006237 Bacteria 634
242 Ga0075370_10010951 3300006353 Bacteria 4755
243 Ga0075370_10044788 3300006353 Bacteria 2501
244 Ga0075370_10143884 3300006353 Bacteria 1395
245 Ga0075370_10227859 3300006353 Bacteria 1102
246 Ga0075370_10418729 3300006353 Bacteria 805
247 Ga0075370_10535284 3300006353 Bacteria 708
248 Ga0068871_100136505 3300006358 Bacteria 2083
249 Ga0068871_100608175 3300006358 Bacteria 994
250 Ga0075428_100721322 3300006844 Bacteria 1062
251 Ga0075428_101672102 3300006844 Bacteria 665
252 Ga0075430_100699232 3300006846 Bacteria 836
253 Ga0075434_100198912 3300006871 Bacteria 2023
254 Ga0068865_100123706 3300006881 Bacteria 1928
255 Ga0068865_100169452 3300006881 Bacteria 1673
256 Ga0075436_100484045 3300006914 Bacteria 904
257 Ga0097620_101146701 3300006931 Bacteria 856
258 Ga0099824_1011838 3300006942 Bacteria 9725
259 Ga0099822_1001134 3300006943 Bacteria 29705
260 Ga0099794_10386366 3300007265 Bacteria 730
261 Ga0099795_10006976 3300007788 Bacteria 3121
262 Ga0105240_10017853 3300009093 Bacteria 9546
263 Ga0105240_10042035 3300009093 Bacteria 5827
264 Ga0105240_10287474 3300009093 Bacteria 1886
265 Ga0105240_11582313 3300009093 Bacteria 686
266 Ga0111539_10347982 3300009094 Bacteria 1725
267 Ga0105245_10096991 3300009098 Bacteria 2722
268 Ga0105245_10306867 3300009098 Bacteria 1559
269 Ga0105245_11349212 3300009098 Bacteria 763
270 Ga0105247_11190414 3300009101 Bacteria 606
271 Ga0114129_11746886 3300009147 Bacteria 758
272 Ga0105243_10076539 3300009148 Bacteria 2719
273 Ga0105243_10322460 3300009148 Bacteria 1408
274 Ga0105243_10794006 3300009148 Bacteria 932
275 Ga0105241_10440542 3300009174 Bacteria 1151
276 Ga0105241_10751603 3300009174 Bacteria 894
277 Ga0105242_10117957 3300009176 Bacteria 2273
278 Ga0105248_10056731 3300009177 Bacteria 4394
279 Ga0105248_10487616 3300009177 Bacteria 1389
280 Ga0105248_10972242 3300009177 Bacteria 959
281 Ga0105248_11093456 3300009177 Bacteria 901
282 Ga0105237_10602297 3300009545 Bacteria 1106
283 Ga0105237_10910303 3300009545 Bacteria 886
284 Ga0105237_11405722 3300009545 Bacteria 704
285 Ga0105238_10046886 3300009551 Bacteria 4358
286 Ga0105238_10162102 3300009551 Bacteria 2212
287 Ga0105238_10384696 3300009551 Bacteria 1395
288 Ga0105238_10536984 3300009551 Bacteria 1173
289 Ga0099796_10038063 3300010159 Bacteria 1612
290 Ga0099796_10188623 3300010159 Bacteria 831
291 Ga0105239_10162787 3300010375 Bacteria 2493
292 Ga0105239_10233646 3300010375 Bacteria 2063
293 Ga0105239_10298263 3300010375 Bacteria 1815
294 Ga0105246_10015450 3300011119 Bacteria 4825
295 Ga0105246_10114754 3300011119 Bacteria 1985
296 Ga0157320_1019468 3300012481 Bacteria 607
297 Ga0157343_1001969 3300012488 Bacteria 1074
298 Ga0157373_10322265 3300013100 Bacteria 1099
299 Ga0157371_10315200 3300013102 Bacteria 1134
300 Ga0157370_10459580 3300013104 Bacteria 1170
301 Ga0157369_10045792 3300013105 Bacteria 4756
302 Ga0157369_10148152 3300013105 Bacteria 2481
303 Ga0157369_10246117 3300013105 Bacteria 1867
304 Ga0157374_10646477 3300013296 Bacteria 1069
305 Ga0157374_11377052 3300013296 Bacteria 728
306 Ga0157378_10017846 3300013297 Bacteria 6229
307 Ga0157378_10533822 3300013297 Bacteria 1176
308 Ga0163162_10011437 3300013306 Bacteria 8654
309 Ga0163162_10642947 3300013306 Bacteria 1185
310 Ga0157372_10172877 3300013307 Bacteria 2499
311 Ga0157372_10706717 3300013307 Bacteria 1173
312 Ga0157372_10820382 3300013307 Bacteria 1080
313 Ga0157375_10136992 3300013308 Bacteria 2573
314 Ga0157375_10337975 3300013308 Bacteria 1671
315 Ga0157375_10346570 3300013308 Bacteria 1651
316 Ga0157375_11248409 3300013308 Bacteria 872
317 Ga0157375_12662694 3300013308 Bacteria 598
318 Ga0163163_10483232 3300014325 Bacteria 1300
319 Ga0163163_10637323 3300014325 Bacteria 1129
320 Ga0163163_11002986 3300014325 Bacteria 898
321 Ga0163163_11640623 3300014325 Bacteria 704
322 Ga0157380_10561856 3300014326 Bacteria 1121
323 Ga0157380_11152948 3300014326 Bacteria 817
324 Ga0157380_11366433 3300014326 Bacteria 758
325 Ga0182008_10286369 3300014497 Bacteria 859
326 Ga0157377_10095417 3300014745 Bacteria 1763
327 Ga0157377_10408514 3300014745 Bacteria 927
328 Ga0157379_10091450 3300014968 Bacteria 2729
329 Ga0157379_10194278 3300014968 Bacteria 1834
330 Ga0157379_11160540 3300014968 Bacteria 742
331 Ga0157379_11844811 3300014968 Bacteria 595
332 Ga0157379_12602923 3300014968 Bacteria 507
333 Ga0157376_11714591 3300014969 Bacteria 664
334 Ga0163161_10415592 3300017792 Bacteria 1081
335 Ga0163161_10465117 3300017792 Bacteria 1024
336 Ga0163161_10822153 3300017792 Bacteria 782
337 Ga0213874_10071243 3300021377 Bacteria 1109
338 Ga0209233_1010989 3300025261 Bacteria 2683
339 Ga0209233_1014231 3300025261 Bacteria 2248
340 Ga0209130_1047183 3300025284 Bacteria 800
341 Ga0209564_1000503 3300025295 Bacteria 64437
342 Ga0209564_1005251 3300025295 Bacteria 7478
343 Ga0209758_1014122 3300025297 Bacteria 4279
344 Ga0207697_10039080 3300025315 Bacteria 1947
345 Ga0207656_10101145 3300025321 Bacteria 1322
346 Ga0207688_10376705 3300025901 Bacteria 877
347 Ga0207680_10420424 3300025903 Bacteria 946
348 Ga0207680_10781339 3300025903 Bacteria 685
349 Ga0207685_10061554 3300025905 Bacteria 1488
350 Ga0207685_10091468 3300025905 Bacteria 1282
351 Ga0207699_10007971 3300025906 Bacteria 5201
352 Ga0207645_10111250 3300025907 Bacteria 1773
353 Ga0207645_10230001 3300025907 Bacteria 1224
354 Ga0207705_10041505 3300025909 Bacteria 3301
355 Ga0207705_10107411 3300025909 Bacteria 2059
356 Ga0207705_10114003 3300025909 Bacteria 1999
357 Ga0207705_10336965 3300025909 Bacteria 1161
358 Ga0207705_11223407 3300025909 Bacteria 576
359 Ga0207684_11136267 3300025910 Bacteria 649
360 Ga0207654_10003986 3300025911 Bacteria 7435
361 Ga0207707_10003157 3300025912 Bacteria 14629
362 Ga0207707_10004597 3300025912 Bacteria 12121
363 Ga0207707_10056424 3300025912 Bacteria 3417
364 Ga0207707_10508970 3300025912 Bacteria 1026
365 Ga0207707_10801975 3300025912 Bacteria 784
366 Ga0207695_10155249 3300025913 Bacteria 2224
367 Ga0207695_10298911 3300025913 Bacteria 1501
368 Ga0207671_10161433 3300025914 Bacteria 1736
369 Ga0207671_11246706 3300025914 Bacteria 580
370 Ga0207693_10017732 3300025915 Bacteria 5676
371 Ga0207693_10071814 3300025915 Bacteria 2710
372 Ga0207693_10224131 3300025915 Bacteria 1477
373 Ga0207663_10098660 3300025916 Bacteria 1956
374 Ga0207660_10200256 3300025917 Bacteria 1559
375 Ga0207660_10437082 3300025917 Bacteria 1057
376 Ga0207660_10791322 3300025917 Bacteria 774
377 Ga0207662_10053614 3300025918 Bacteria 2403
378 Ga0207657_10004638 3300025919 Bacteria 14521
379 Ga0207657_10108856 3300025919 Bacteria 2291
380 Ga0207657_10144087 3300025919 Bacteria 1944
381 Ga0207652_10012904 3300025921 Bacteria 6758
382 Ga0207652_10060805 3300025921 Bacteria 3260
383 Ga0207652_10190884 3300025921 Bacteria 1843
384 Ga0207646_10654392 3300025922 Bacteria 941
385 Ga0207681_10221169 3300025923 Bacteria 1465
386 Ga0207681_10468987 3300025923 Bacteria 1027
387 Ga0207681_11224201 3300025923 Bacteria 631
388 Ga0207694_10013152 3300025924 Bacteria 6232
389 Ga0207694_10428082 3300025924 Bacteria 1103
390 Ga0207694_10610583 3300025924 Bacteria 917
391 Ga0207650_10224192 3300025925 Bacteria 1514
392 Ga0207659_10278845 3300025926 Bacteria 1366
393 Ga0207687_10072669 3300025927 Bacteria 2461
394 Ga0207687_10156541 3300025927 Bacteria 1744
395 Ga0207687_10681491 3300025927 Bacteria 871
396 Ga0207700_10200263 3300025928 Bacteria 1682
397 Ga0207664_10936273 3300025929 Bacteria 777
398 Ga0207644_10255998 3300025931 Bacteria 1398
399 Ga0207706_10140389 3300025933 Bacteria 2125
400 Ga0207706_10211712 3300025933 Bacteria 1699
401 Ga0207686_10243384 3300025934 Bacteria 1310
402 Ga0207709_10538518 3300025935 Bacteria 917
403 Ga0207669_10461817 3300025937 Bacteria 1008
404 Ga0207704_10235996 3300025938 Bacteria 1363
405 Ga0207704_10590247 3300025938 Bacteria 908
406 Ga0207704_11299616 3300025938 Bacteria 622
407 Ga0207665_10036445 3300025939 Bacteria 3271
408 Ga0207665_10149387 3300025939 Bacteria 1672
409 Ga0207665_10811469 3300025939 Bacteria 740
410 Ga0207691_10112935 3300025940 Bacteria 2415
411 Ga0207691_10382807 3300025940 Bacteria 1201
412 Ga0207711_10132016 3300025941 Bacteria 2240
413 Ga0207711_10141498 3300025941 Bacteria 2165
414 Ga0207689_10188832 3300025942 Bacteria 1700
415 Ga0207661_10041449 3300025944 Bacteria 3624
416 Ga0207661_10146271 3300025944 Bacteria 2039
417 Ga0207679_10830824 3300025945 Bacteria 843
418 Ga0207679_11167435 3300025945 Bacteria 706
419 Ga0207667_10177738 3300025949 Bacteria 2186
420 Ga0207667_10232071 3300025949 Bacteria 1889
421 Ga0207667_10293674 3300025949 Bacteria 1660
422 Ga0207667_10398955 3300025949 Bacteria 1400
423 Ga0207651_10437235 3300025960 Bacteria 1120
424 Ga0207651_11462327 3300025960 Bacteria 615
425 Ga0207668_10093773 3300025972 Bacteria 2212
426 Ga0207668_10100667 3300025972 Bacteria 2146
427 Ga0207668_10216683 3300025972 Bacteria 1534
428 Ga0207668_10712321 3300025972 Bacteria 883
429 Ga0207668_11587980 3300025972 Bacteria 590
430 Ga0207640_10014821 3300025981 Bacteria 4497
431 Ga0207640_10123664 3300025981 Bacteria 1858
432 Ga0207658_10068710 3300025986 Bacteria 2674
433 Ga0207658_10417121 3300025986 Bacteria 1183
434 Ga0207658_10708564 3300025986 Bacteria 910
435 Ga0207658_10879491 3300025986 Bacteria 815
436 Ga0207677_10009584 3300026023 Bacteria 5450
437 Ga0207677_10502184 3300026023 Bacteria 1049
438 Ga0207703_10198335 3300026035 Bacteria 1782
439 Ga0207639_10187226 3300026041 Bacteria 1765
440 Ga0207639_10187856 3300026041 Bacteria 1763
441 Ga0207639_10799146 3300026041 Bacteria 879
442 Ga0207639_10910572 3300026041 Bacteria 822
443 Ga0207678_10008062 3300026067 Bacteria 9289
444 Ga0207678_10091019 3300026067 Bacteria 2607
445 Ga0207678_10145389 3300026067 Bacteria 2024
446 Ga0207678_10254536 3300026067 Bacteria 1504
447 Ga0207678_10311791 3300026067 Bacteria 1353
448 Ga0207708_10070207 3300026075 Bacteria 2682
449 Ga0207708_10172260 3300026075 Bacteria 1715
450 Ga0207702_10000014 3300026078 Bacteria 253304
451 Ga0207702_10268410 3300026078 Bacteria 1609
452 Ga0207702_10294459 3300026078 Bacteria 1538
453 Ga0207702_10888642 3300026078 Bacteria 883
454 Ga0207702_10938663 3300026078 Bacteria 858
455 Ga0207641_10196970 3300026088 Bacteria 1855
456 Ga0207641_10370945 3300026088 Bacteria 1368
457 Ga0207648_10445355 3300026089 Bacteria 1179
458 Ga0207648_10515576 3300026089 Bacteria 1095
459 Ga0207674_10012960 3300026116 Bacteria 9298
460 Ga0207674_10180724 3300026116 Bacteria 2061
461 Ga0207674_11097033 3300026116 Bacteria 765
462 Ga0207674_11349153 3300026116 Bacteria 683
463 Ga0207675_100023943 3300026118 Bacteria 5678
464 Ga0207675_100301927 3300026118 Bacteria 1559
465 Ga0207683_10044272 3300026121 Bacteria 3891
466 Ga0207683_10129878 3300026121 Bacteria 2265
467 Ga0207683_10142278 3300026121 Bacteria 2162
468 Ga0207683_10836774 3300026121 Bacteria 854
469 Ga0207698_10022118 3300026142 Bacteria 4411
470 Ga0207698_10071295 3300026142 Bacteria 2757
471 Ga0207698_10275330 3300026142 Bacteria 1554
472 Ga0207698_10319619 3300026142 Bacteria 1453
473 Ga0207698_10673861 3300026142 Bacteria 1027
474 Ga0209589_1000014 3300027357 Bacteria 227996
475 Ga0209489_100014 3300027361 Bacteria 227996
476 Ga0209700_100024 3300027363 Bacteria 227996
477 Ga0209179_1089550 3300027512 Bacteria 682
478 Ga0209588_1051632 3300027671 Bacteria 1330
479 Ga0209813_10093866 3300027866 Bacteria 1011
480 Ga0209813_10100369 3300027866 Bacteria 984
481 Ga0209813_10228056 3300027866 Bacteria 700
482 Ga0268266_10002572 3300028379 Bacteria 19242
483 Ga0268266_10016539 3300028379 Bacteria 6306
484 Ga0268266_10038384 3300028379 Bacteria 4077
485 Ga0268266_10524305 3300028379 Bacteria 1133
486 Ga0268266_10939677 3300028379 Bacteria 836
487 Ga0268264_10381065 3300028381 Bacteria 1350
488 Ga0265334_10033792 3300028573 Bacteria 2033
489 Ga0307517_10000542 3300028786 Bacteria 64617
490 Ga0307517_10121928 3300028786 Bacteria 1923
491 Ga0307517_10328433 3300028786 Bacteria 842
492 Ga0307515_10011730 3300028794 Bacteria 16583
493 Ga0307515_10150467 3300028794 Bacteria 2436
494 Ga0307515_10416529 3300028794 Bacteria 965
495 Ga0307515_10514596 3300028794 Bacteria 807
496 Ga0265332_10038362 3300031238 Bacteria 2076
497 Ga0265325_10001890 3300031241 Bacteria 14468
498 Ga0265325_10023051 3300031241 Bacteria 3404
499 Ga0265329_10202263 3300031242 Bacteria 654
500 Ga0265340_10267492 3300031247 Bacteria 761
501 Ga0265331_10055236 3300031250 Bacteria 1889
502 Ga0265327_10078082 3300031251 Bacteria 1641
503 Ga0265316_10385129 3300031344 Bacteria 1011
504 Ga0307513_10094041 3300031456 Bacteria 3044
505 Ga0307513_10312420 3300031456 Bacteria 1333
506 Ga0307509_10022374 3300031507 Bacteria 7127
507 Ga0307408_100688655 3300031548 Bacteria 918
508 Ga0307408_100798699 3300031548 Bacteria 856
509 Ga0265313_10052638 3300031595 Bacteria 1942
510 Ga0265313_10076962 3300031595 Bacteria 1524
511 Ga0307508_10054533 3300031616 Bacteria 3544
512 Ga0265314_10109989 3300031711 Bacteria 1753
513 Ga0265342_10050961 3300031712 Bacteria 2471
514 Ga0265342_10093523 3300031712 Bacteria 1721
515 Ga0307516_10284328 3300031730 Bacteria 1335
516 Ga0307516_10338700 3300031730 Bacteria 1172
517 Ga0307516_10558769 3300031730 Bacteria 798
518 Ga0307410_11275594 3300031852 Bacteria 642
519 Ga0307412_10154604 3300031911 Bacteria 1697
520 Ga0307409_100353766 3300031995 Bacteria 1387
521 Ga0307409_100534399 3300031995 Bacteria 1148
522 Ga0307409_100994274 3300031995 Bacteria 857
523 Ga0307416_101712059 3300032002 Bacteria 733
524 Ga0307414_10177646 3300032004 Bacteria 1709
525 Ga0307411_10696156 3300032005 Bacteria 885
526 Ga0307411_11338587 3300032005 Bacteria 653
527 Ga0307411_11484487 3300032005 Bacteria 623
528 Ga0307507_10284262 3300033179 Bacteria 1031
529 Ga0307510_10020603 3300033180 Bacteria 7701
530 Ga0307510_10155674 3300033180 Bacteria 1892
531 Ga0307510_10365855 3300033180 Bacteria 889
532 Ga0315911_1000002 3300033442 Bacteria 926833
533 Ga0373959_0012270 3300034820 Bacteria 1527
534 Ga0373929_0008655 3300035085 Bacteria 1877
535 Ga0373934_0120865 3300035086 Bacteria 1065
536 Ga0373944_0114222 3300035089 Bacteria 925
537 Ga0373923_0037675 3300035111 Bacteria 1979
538 Ga0373923_0064920 3300035111 Bacteria 1557
539 Ga0373932_0115129 3300035112 Bacteria 891
540 Ga0373936_0027174 3300035113 Bacteria 2244
541 Ga0373936_0048507 3300035113 Bacteria 1714
542 Ga0373936_0066768 3300035113 Bacteria 1477
543 Ga0373936_0139431 3300035113 Bacteria 1046
544 Ga0373936_0489572 3300035113 Bacteria 571
545 Ga0373945_0008608 3300035116 Bacteria 3327
546 Ga0373945_0074838 3300035116 Bacteria 1288
547 Ga0373953_0000606 3300035117 Bacteria 9923
548 Ga0373953_0126273 3300035117 Bacteria 1089
549 Ga0373954_0001041 3300035118 Bacteria 11023
550 Ga0373954_0375706 3300035118 Bacteria 702
551 Ga0373954_0425102 3300035118 Bacteria 657
552 Ga0373956_0066495 3300035119 Bacteria 1639
553 Ga0373957_0000527 3300035120 Bacteria 9628
554 Ga0373960_0333730 3300035121 Bacteria 571
555 Ga0373943_0008018 3300035170 Bacteria 4741
556 Ga0373943_0121324 3300035170 Bacteria 1389
557 Ga0373943_0293303 3300035170 Bacteria 922
558 Ga0373955_0000535 3300035172 Bacteria 16084
559 Ga0373955_0146440 3300035172 Bacteria 1388
560 Ga0373924_0009724 3300035410 Bacteria 3533
561 Ga0373924_0057699 3300035410 Bacteria 1619
562 Ga0373931_0001627 3300035691 Bacteria 9720
563 Ga0373931_0022393 3300035691 Bacteria 3180
564 Ga0373931_0208701 3300035691 Bacteria 1170
565 Ga0373931_0914010 3300035691 Bacteria 590
566 Ga0373935_0002921 3300035692 Bacteria 9842
567 Ga0373935_0061726 3300035692 Bacteria 2400
568 Ga0373935_0124834 3300035692 Bacteria 1723
569 Ga0373935_0256586 3300035692 Bacteria 1225
570 Ga0373935_1388434 3300035692 Bacteria 525
571 Ga0373927_0006216 3300035695 Bacteria 8153
572 Ga0373927_0006928 3300035695 Bacteria 7697
573 Ga0373927_0008327 3300035695 Bacteria 6982
574 Ga0373927_0067123 3300035695 Bacteria 2321
575 Ga0373927_0110774 3300035695 Bacteria 1788
576 Ga0373927_0401527 3300035695 Bacteria 904
577 Ga0373927_0461505 3300035695 Bacteria 839
578 Ga0373933_0000017 3300035724 Bacteria 100816
579 Ga0373933_0012317 3300035724 Bacteria 4723
580 Ga0373947_0009619 3300035725 Bacteria 5548
581 Ga0373947_0039668 3300035725 Bacteria 2802
582 Ga0373947_0077884 3300035725 Bacteria 2045
583 Ga0373937_0099008 3300036401 Bacteria 2704
584 Ga0373925_0014356 3300037068 Bacteria 5729
585 Ga0373925_0076473 3300037068 Bacteria 2538
586 Ga0373925_0228550 3300037068 Bacteria 1487
587 Ga0373925_0548489 3300037068 Bacteria 951
588 Ga0373925_0677298 3300037068 Bacteria 850
589 Ga0373925_0814578 3300037068 Bacteria 770
590 Ga0395899_0083159 3300037312 Bacteria 2328
591 Ga0395899_0690032 3300037312 Bacteria 641
592 Ga0395900_0001282 3300037418 Bacteria 30694
593 Ga0395900_0185512 3300037418 Bacteria 2112
594 Ga0395900_0443041 3300037418 Bacteria 1256
595 Ga0395898_0017060 3300037466 Bacteria 7416
596 Ga0395898_0017739 3300037466 Bacteria 7264
597 Ga0395898_0025002 3300037466 Bacteria 6021
598 Ga0395905_0109478 3300037471 Bacteria 2594
599 Ga0395905_0180823 3300037471 Bacteria 1980
600 Ga0395905_0281840 3300037471 Bacteria 1548
601 Ga0395905_0327977 3300037471 Bacteria 1421
602 Ga0395905_1560150 3300037471 Bacteria 565
603 Ga0395901_0047469 3300038443 Bacteria 4459
604 Ga0436365_0847422 3300039437 Bacteria 1441
605 Ga0436365_1083338 3300039437 Bacteria 982
606 Ga0436365_1875539 3300039437 Bacteria 649
607 Ga0436363_0502738 3300039450 Bacteria 943
608 Ga0439465_0122313 3300041413 Bacteria 913
609 Ga0451787_541596 3300041441 Bacteria 509
610 Ga0451789_0084525 3300041443 Bacteria 552
611 Ga0451789_0740288 3300041443 Bacteria 1353
612 Ga0451791_0562369 3300041451 Bacteria 1486
613 Ga0451793_0353251 3300041452 Bacteria 828
614 Ga0451793_0743023 3300041452 Bacteria 647
615 Ga0451795_0120595 3300041456 Bacteria 563
616 Ga0451800_0174695 3300041459 Bacteria 629
617 Ga0451837_0207973 3300041494 Bacteria 676
618 Ga0451841_0490343 3300041498 Bacteria 538
619 Ga0451841_1340806 3300041498 Bacteria 583
620 Ga0451847_0001817 3300041503 Bacteria 689
621 Ga0451849_1079513 3300041505 Bacteria 693
622 Ga0439431_0037586 3300041997 Bacteria 1223
623 Ga0439455_0101697 3300042012 Bacteria 795
624 Ga0466963_0035186 3300044694 Bacteria 3262
625 Ga0466963_0067977 3300044694 Bacteria 2392
626 Ga0451576_0746588 3300045051 Bacteria 1028
627 Ga0495617_083401 3300046452 Bacteria 1046
628 Ga0495592_0011960 3300046454 Bacteria 6578
629 Ga0495592_0043963 3300046454 Bacteria 3340
630 Ga0495603_0000923 3300046455 Bacteria 16862
631 Ga0495603_0008897 3300046455 Bacteria 6071
632 Ga0495603_0029126 3300046455 Bacteria 3330
633 Ga0495590_0203895 3300046457 Bacteria 727
634 Ga0495591_061776 3300046458 Bacteria 994
635 Ga0495629_0001841 3300046459 Bacteria 16607
636 Ga0495629_0002400 3300046459 Bacteria 14408
637 Ga0495629_0062946 3300046459 Bacteria 2591
638 Ga0495638_0016732 3300046460 Bacteria 4902
639 Ga0495638_0137440 3300046460 Bacteria 1429
640 Ga0495641_0005021 3300046461 Bacteria 9123
641 Ga0495651_0080811 3300046462 Bacteria 2454
642 Ga0495651_0240063 3300046462 Bacteria 1243
643 Ga0495653_0004149 3300046463 Bacteria 11724
644 Ga0495653_0107346 3300046463 Bacteria 2012
645 Ga0495650_0070150 3300046471 Bacteria 1377
646 Ga0495580_0008695 3300046472 Bacteria 8051
647 Ga0495580_0032562 3300046472 Bacteria 3761
648 Ga0495582_0000283 3300046473 Bacteria 28312
649 Ga0495582_0067449 3300046473 Bacteria 1977
650 Ga0495582_0345117 3300046473 Bacteria 857
651 Ga0495605_0126586 3300046474 Bacteria 1155
652 Ga0495639_0000947 3300046475 Bacteria 13079
653 Ga0495639_0044326 3300046475 Bacteria 2011
654 Ga0495639_0099139 3300046475 Bacteria 1374
655 Ga0495639_0128946 3300046475 Bacteria 1210
656 Ga0495639_0183009 3300046475 Bacteria 1021
657 Ga0495662_0001975 3300046476 Bacteria 10288
658 Ga0495662_0236757 3300046476 Bacteria 900
659 Ga0495662_0362510 3300046476 Bacteria 712
660 Ga0495664_0014799 3300046477 Bacteria 4428
661 Ga0495664_0038387 3300046477 Bacteria 2827
662 Ga0495664_0063665 3300046477 Bacteria 2198
663 Ga0495664_0081750 3300046477 Bacteria 1937
664 Ga0495664_0159492 3300046477 Bacteria 1368
665 Ga0495584_0454679 3300046491 Bacteria 651
666 Ga0495585_0156841 3300046492 Bacteria 1183
667 Ga0495594_0000509 3300046499 Bacteria 19796
668 Ga0495594_0038494 3300046499 Bacteria 2612
669 Ga0495594_0413967 3300046499 Bacteria 767
670 Ga0495596_0152786 3300046500 Bacteria 896
671 Ga0495596_0394139 3300046500 Bacteria 539
672 Ga0495607_0529310 3300046501 Bacteria 520
673 Ga0495583_0047153 3300046506 Bacteria 1984
674 Ga0495606_0004620 3300046507 Bacteria 13639
675 Ga0495606_0106351 3300046507 Bacteria 1699
676 Ga0495606_0312643 3300046507 Bacteria 847
677 Ga0495606_0377530 3300046507 Bacteria 744
678 Ga0495606_0397170 3300046507 Bacteria 719
679 Ga0495608_0048657 3300046511 Bacteria 2816
680 Ga0495608_0052701 3300046511 Bacteria 2692
681 Ga0495608_0573546 3300046511 Bacteria 679
682 Ga0495620_0018112 3300046515 Bacteria 3493
683 Ga0495628_0008185 3300046516 Bacteria 8992
684 Ga0495628_0020174 3300046516 Bacteria 5501
685 Ga0495630_0007704 3300046517 Bacteria 7702
686 Ga0495630_0211687 3300046517 Bacteria 1479
687 Ga0495631_0037364 3300046518 Bacteria 2164
688 Ga0495631_0080510 3300046518 Bacteria 1405
689 Ga0495631_0275632 3300046518 Bacteria 716
690 Ga0495632_0048395 3300046519 Bacteria 2105
691 Ga0495632_0102600 3300046519 Bacteria 1347
692 Ga0495632_0336421 3300046519 Bacteria 665
693 Ga0495632_0347077 3300046519 Bacteria 653
694 Ga0495644_0061172 3300046523 Bacteria 1415
695 Ga0495644_0161790 3300046523 Bacteria 858
696 Ga0495644_0219979 3300046523 Bacteria 734
697 Ga0495648_0003557 3300046524 Bacteria 13636
698 Ga0495648_0127691 3300046524 Bacteria 1356
699 Ga0495666_0165013 3300046526 Bacteria 1026
700 Ga0495666_0555330 3300046526 Bacteria 512
701 Ga0495652_0014821 3300046529 Bacteria 6988
702 Ga0495652_0017676 3300046529 Bacteria 6363
703 Ga0495652_0149151 3300046529 Bacteria 1829
704 Ga0495652_0687473 3300046529 Bacteria 689
705 Ga0495665_0000145 3300046531 Bacteria 34959
706 Ga0495665_0275346 3300046531 Bacteria 864
707 Ga0495640_0018916 3300046533 Bacteria 5095
708 Ga0495640_0029868 3300046533 Bacteria 3907
709 Ga0495640_0037674 3300046533 Bacteria 3409
710 Ga0495586_0157218 3300046535 Bacteria 1281
711 Ga0495587_0037347 3300046536 Bacteria 2917
712 Ga0495587_0075687 3300046536 Bacteria 1954
713 Ga0495598_0025225 3300046537 Bacteria 1619
714 Ga0495621_0074838 3300046539 Bacteria 1253
715 Ga0495597_0057985 3300046542 Bacteria 1693
716 Ga0495597_0326454 3300046542 Bacteria 592
717 Ga0495645_0001274 3300046543 Bacteria 17169
718 Ga0495645_0005613 3300046543 Bacteria 8630
719 Ga0495645_0111300 3300046543 Bacteria 1937
720 Ga0495622_0035544 3300046557 Bacteria 2323
721 Ga0495622_0111847 3300046557 Bacteria 1250
722 Ga0495633_0140540 3300046558 Bacteria 1116
723 Ga0495633_0178699 3300046558 Bacteria 977
724 Ga0495667_0016196 3300046559 Bacteria 5036
725 Ga0495667_0032991 3300046559 Bacteria 3465
726 Ga0495656_0029999 3300046615 Bacteria 2194
727 Ga0495656_0132030 3300046615 Bacteria 1189
728 Ga0495656_0528793 3300046615 Bacteria 627
729 Ga0495668_0029125 3300046616 Bacteria 3121
730 Ga0495668_0097747 3300046616 Bacteria 1607
731 Ga0495668_0113343 3300046616 Bacteria 1483
732 Ga0495668_0465529 3300046616 Bacteria 696
733 Ga0495634_0001108 3300046642 Bacteria 24957
734 Ga0495634_0057272 3300046642 Bacteria 2602
735 Ga0495634_0068234 3300046642 Bacteria 2350
736 Ga0495634_0361001 3300046642 Bacteria 868
737 Ga0495625_0092445 3300046660 Bacteria 2090
738 Ga0495625_0190905 3300046660 Bacteria 1357
739 Ga0495625_0401718 3300046660 Bacteria 856
740 Ga0495625_0420253 3300046660 Bacteria 831
741 Ga0495635_0002477 3300046663 Bacteria 12604
742 Ga0495635_0043801 3300046663 Bacteria 3087
743 Ga0495635_0074085 3300046663 Bacteria 2332
744 Ga0495635_0133449 3300046663 Bacteria 1692
745 Ga0495635_0804647 3300046663 Bacteria 605
746 Ga0495659_0063340 3300046664 Bacteria 1370
747 Ga0495588_0021630 3300046674 Bacteria 3172
748 Ga0495588_0029555 3300046674 Bacteria 2750
749 Ga0495588_0224003 3300046674 Bacteria 992
750 Ga0495657_0003968 3300046675 Bacteria 11874
751 Ga0495599_0002497 3300046678 Bacteria 10714
752 Ga0495599_0010495 3300046678 Bacteria 5667
753 Ga0495599_0235531 3300046678 Bacteria 1117
754 Ga0495623_0016510 3300046679 Bacteria 4770
755 Ga0495623_0138573 3300046679 Bacteria 1449
756 Ga0495646_0002092 3300046680 Bacteria 12100
757 Ga0495646_0060036 3300046680 Bacteria 2269
758 Ga0495646_0087710 3300046680 Bacteria 1803
759 Ga0495646_0093632 3300046680 Bacteria 1731
760 Ga0495646_0149273 3300046680 Bacteria 1301
761 Ga0495646_0409182 3300046680 Bacteria 704
762 Ga0495647_0001082 3300046681 Bacteria 8305
763 Ga0495658_0000547 3300046683 Bacteria 20542
764 Ga0495658_0327171 3300046683 Bacteria 972
765 Ga0495658_0740709 3300046683 Bacteria 630
766 Ga0495658_0948278 3300046683 Bacteria 550
767 Ga0495669_0067122 3300046684 Bacteria 1630
768 Ga0495669_0204882 3300046684 Bacteria 943
769 Ga0495613_0002250 3300046689 Bacteria 14591
770 Ga0495613_0010590 3300046689 Bacteria 6839
771 Ga0495613_0100697 3300046689 Bacteria 2087
772 Ga0495613_0164925 3300046689 Bacteria 1574
773 Ga0495624_0005060 3300046690 Bacteria 9536
774 Ga0495624_0044293 3300046690 Bacteria 2837
775 Ga0495670_0013233 3300046691 Bacteria 4057
776 Ga0495671_0135727 3300046692 Bacteria 1199
777 Ga0495671_0175425 3300046692 Bacteria 1041
778 Ga0495649_0324637 3300046694 Bacteria 781
779 Ga0495589_0073693 3300046794 Bacteria 1666
780 Ga0495589_0553487 3300046794 Bacteria 524
781 Ga0495600_0001788 3300046809 Bacteria 12015
782 Ga0495600_0035771 3300046809 Bacteria 3227
783 Ga0495600_0046953 3300046809 Bacteria 2817
784 Ga0495581_0000529 3300047315 Bacteria 19610
785 Ga0495581_0231469 3300047315 Bacteria 1081
786 Ga0495581_0292926 3300047315 Bacteria 951
787 Ga0495581_0338982 3300047315 Bacteria 878
788 Ga0495581_0487189 3300047315 Bacteria 717
789 Ga0495581_0821646 3300047315 Bacteria 533
790 Ga0495604_0018510 3300047317 Bacteria 5578
791 Ga0495604_0068612 3300047317 Bacteria 2690
792 Ga0495604_0508708 3300047317 Bacteria 780
793 Ga0495604_0535105 3300047317 Bacteria 757
794 Ga0495636_0082983 3300047318 Bacteria 1382
795 Ga0495674_0016431 3300047319 Bacteria 6903
796 Ga0495674_0088724 3300047319 Bacteria 2644
797 Ga0495674_0284234 3300047319 Bacteria 1354
798 Ga0495674_0488460 3300047319 Bacteria 986
799 Ga0495672_0000894 3300047320 Bacteria 31271
800 Ga0495672_0054549 3300047320 Bacteria 2335
801 Ga0495676_0017967 3300047321 Bacteria 6240
802 Ga0495676_1055676 3300047321 Bacteria 517
803 Ga0495680_0054979 3300047322 Bacteria 3088
804 Ga0495680_0060977 3300047322 Bacteria 2903
805 Ga0495680_0131585 3300047322 Bacteria 1838
806 Ga0495683_0163836 3300047323 Bacteria 1026
807 Ga0495683_0289851 3300047323 Bacteria 706
808 Ga0495683_0339548 3300047323 Bacteria 636
809 Ga0495675_0033442 3300047444 Bacteria 3282
810 Ga0495675_0119823 3300047444 Bacteria 1639
811 Ga0495677_0027527 3300047445 Bacteria 2063
812 Ga0495677_0144654 3300047445 Bacteria 914
813 Ga0495685_085656 3300047447 Bacteria 1047
814 Ga0495673_0104083 3300047469 Bacteria 1143
815 Ga0495673_0175187 3300047469 Bacteria 815
816 Ga0495681_0147637 3300047470 Bacteria 989
817 Ga0495681_0160804 3300047470 Bacteria 935
818 Ga0495684_0001145 3300047471 Bacteria 21346
819 Ga0495684_0128129 3300047471 Bacteria 1908
820 Ga0495684_0343619 3300047471 Bacteria 1061
821 Ga0495686_0004867 3300047472 Bacteria 10831
822 Ga0495686_0082629 3300047472 Bacteria 1960
823 Ga0495686_0125388 3300047472 Bacteria 1527
824 Ga0495686_0420027 3300047472 Bacteria 715
825 Ga0495593_0000526 3300047673 Bacteria 21677
826 Ga0495593_0000877 3300047673 Bacteria 17432
827 Ga0495602_0009427 3300048088 Bacteria 10154
828 Ga0495602_0035721 3300048088 Bacteria 4632
829 Ga0495615_0047371 3300048090 Bacteria 1095
830 Ga0495615_0125972 3300048090 Bacteria 745
831 Ga0495626_0045400 3300048091 Bacteria 2051
832 Ga0496100_0190172 3300048903 Bacteria 1490
833 Ga0496100_0406092 3300048903 Bacteria 1038
834 Ga0496101_0245391 3300048904 Bacteria 1394
835 Ga0496101_1305519 3300048904 Bacteria 567
836 Ga0496102_0228667 3300048905 Bacteria 1754
837 Ga0496102_0274253 3300048905 Bacteria 1590
838 Ga0496102_0315501 3300048905 Bacteria 1473
839 Ga0496102_0603491 3300048905 Bacteria 1021
840 Ga0496102_0716835 3300048905 Bacteria 923
841 Ga0496102_1390654 3300048905 Bacteria 621
842 Ga0496103_0036877 3300048906 Bacteria 2995
843 Ga0496103_0283353 3300048906 Bacteria 1066
844 Ga0496104_0049104 3300048907 Bacteria 3979
845 Ga0496104_0237039 3300048907 Bacteria 1736
846 Ga0496105_0166142 3300048908 Bacteria 1810
847 Ga0496105_0321703 3300048908 Bacteria 1240
848 Ga0496106_0277923 3300048909 Bacteria 1341
849 Ga0496106_0349735 3300048909 Bacteria 1187
850 Ga0496106_0499129 3300048909 Bacteria 978
851 Ga0496107_0135503 3300048910 Bacteria 1819
852 Ga0496107_0286458 3300048910 Bacteria 1226
853 Ga0496107_0406553 3300048910 Bacteria 1012
854 Ga0496107_1166956 3300048910 Bacteria 554
855 Ga0496108_0005832 3300048911 Bacteria 9985
856 Ga0496108_0077649 3300048911 Bacteria 2809
857 Ga0496108_0163680 3300048911 Bacteria 1923
858 Ga0496109_0232105 3300048912 Bacteria 1736
859 Ga0496109_0242080 3300048912 Bacteria 1698
860 Ga0496109_0656360 3300048912 Bacteria 986
861 Ga0496110_0074390 3300048913 Bacteria 3017
862 Ga0496110_0248964 3300048913 Bacteria 1617
863 Ga0496110_0334689 3300048913 Bacteria 1379
864 Ga0496110_0383326 3300048913 Bacteria 1281
865 Ga0496110_0620058 3300048913 Bacteria 980
866 Ga0496110_1206726 3300048913 Bacteria 665
867 Ga0496111_0056466 3300048914 Bacteria 2841
868 Ga0496111_0090509 3300048914 Bacteria 2241
869 Ga0496111_0160257 3300048914 Bacteria 1670
870 Ga0496111_1353757 3300048914 Bacteria 500
871 Ga0496112_0000023 3300048915 Bacteria 156144
872 Ga0496112_0128266 3300048915 Bacteria 2507
873 Ga0496112_0360407 3300048915 Bacteria 1396
874 Ga0496112_0399061 3300048915 Bacteria 1315
875 Ga0496112_1497246 3300048915 Bacteria 589
876 Ga0496113_0063748 3300048916 Bacteria 2785
877 Ga0496113_1359157 3300048916 Bacteria 551
878 Ga0496115_0108177 3300048918 Bacteria 2283
879 Ga0496115_0123052 3300048918 Bacteria 2135
880 Ga0496115_0286332 3300048918 Bacteria 1352
881 Ga0496116_0007011 3300048919 Bacteria 10089
882 Ga0496116_0250958 3300048919 Bacteria 881
883 Ga0496117_0233888 3300048920 Bacteria 1013
884 Ga0496117_0413288 3300048920 Bacteria 677
885 Ga0496117_0525460 3300048920 Bacteria 568
886 Ga0496118_0067018 3300048921 Bacteria 2617
887 Ga0496118_0129349 3300048921 Bacteria 1625
888 Ga0496119_0363954 3300048922 Bacteria 697
889 Ga0496120_0190582 3300048923 Bacteria 1000
890 Ga0496121_0013014 3300048924 Bacteria 8989
891 Ga0496121_0014373 3300048924 Bacteria 8405
892 Ga0496121_0091052 3300048924 Bacteria 2382
893 Ga0496121_0182304 3300048924 Bacteria 1514
894 Ga0496121_0339226 3300048924 Bacteria 1005
895 Ga0496121_0388225 3300048924 Bacteria 918
896 Ga0496122_0033823 3300048925 Bacteria 4197
897 Ga0496122_0084789 3300048925 Bacteria 2189
898 Ga0496122_0196896 3300048925 Bacteria 1182
899 Ga0496123_0103219 3300048926 Bacteria 1652
900 Ga0496124_0201315 3300048927 Bacteria 1514
901 Ga0496124_0218488 3300048927 Bacteria 1435
902 Ga0496125_0000099 3300048928 Bacteria 203333
903 Ga0496125_0004699 3300048928 Bacteria 15565
904 Ga0496126_0020218 3300048929 Bacteria 6533
905 Ga0496126_0036489 3300048929 Bacteria 4596
906 Ga0496126_0075786 3300048929 Bacteria 2985
907 Ga0496126_0123538 3300048929 Bacteria 2242
908 Ga0496126_0373350 3300048929 Bacteria 1162
909 Ga0496126_0464960 3300048929 Bacteria 1016
910 Ga0495678_135871 3300049459 Bacteria 810
911 Ga0495682_0039370 3300049460 Bacteria 1735
912 Ga0501031_0017619 3300049568 Bacteria 4643
913 Ga0501032_0000030 3300049569 Bacteria 130405
914 Ga0501033_0001069 3300049570 Bacteria 24919
915 Ga0501033_0479227 3300049570 Bacteria 862
916 Ga0501034_0000117 3300049571 Bacteria 144865
917 Ga0501036_0000033 3300049572 Bacteria 88546
918 Ga0501036_1092299 3300049572 Bacteria 652
919 Ga0501037_0000090 3300049573 Bacteria 85021
920 Ga0501038_0001923 3300049574 Bacteria 19177
921 Ga0501038_0587592 3300049574 Bacteria 844
922 Ga0501039_0000343 3300049575 Bacteria 33369
923 Ga0501040_1343336 3300049576 Bacteria 519
924 Ga0501042_0318617 3300049578 Bacteria 1123
925 Ga0501042_0479340 3300049578 Bacteria 903
926 Ga0501043_0001280 3300049579 Bacteria 22065
927 Ga0501046_0000078 3300049580 Bacteria 102826
928 Ga0501046_0589643 3300049580 Bacteria 789
929 Ga0501047_0001617 3300049581 Bacteria 21972
930 Ga0501047_0219789 3300049581 Bacteria 1756
931 Ga0501048_0000235 3300049582 Bacteria 36704
932 Ga0501048_0046128 3300049582 Bacteria 3112
933 Ga0501067_0000299 3300049583 Bacteria 27211
934 Ga0501067_0015314 3300049583 Bacteria 4244
935 Ga0501068_0001611 3300049584 Bacteria 12020
936 Ga0501069_0070531 3300049585 Bacteria 1957
937 Ga0501069_0198636 3300049585 Bacteria 1162
938 Ga0501070_0016001 3300049586 Bacteria 6303
939 Ga0501070_0042040 3300049586 Bacteria 3806
940 Ga0501070_0765201 3300049586 Bacteria 760
941 Ga0501071_0070512 3300049587 Bacteria 2546
942 Ga0501072_0000414 3300049588 Bacteria 30504
943 Ga0501073_0000209 3300049589 Bacteria 38645
944 Ga0501074_0000441 3300049590 Bacteria 24796
945 Ga0501074_0272240 3300049590 Bacteria 1204
946 Ga0501076_0531103 3300049592 Bacteria 970
947 Ga0501079_0025908 3300049741 Bacteria 4498
948 Ga0501080_0000567 3300049742 Bacteria 29245
949 Ga0501083_0002984 3300049744 Bacteria 11751
950 Ga0501035_0008484 3300049822 Bacteria 9568
951 Ga0501035_0302631 3300049822 Bacteria 1347
952 Ga0501044_0000304 3300049823 Bacteria 61877
953 Ga0501044_0197185 3300049823 Bacteria 1973
954 Ga0501045_0040887 3300049824 Bacteria 3372
955 nmdc:mga03683_25565_c1 3300050489 Bacteria 2321
956 nmdc:mga03683_37660_c1 3300050489 Bacteria 1972
957 nmdc:mga03n38_23610_c1 3300050490 Bacteria 2505
958 nmdc:mga03n38_2731_c1 3300050490 Bacteria 5524
959 nmdc:mga03n38_345885_c1 3300050490 Bacteria 808
960 nmdc:mga03n38_492990_c1 3300050490 Bacteria 687
961 nmdc:mga00v17_21925_c1 3300050491 Bacteria 3679
962 nmdc:mga00v17_2278_c1 3300050491 Bacteria 9845
963 nmdc:mga00v17_355299_c1 3300050491 Bacteria 953
964 nmdc:mga0yw44_1075814_c1 3300050492 Bacteria 544
965 nmdc:mga0yw44_14035_c1 3300050492 Bacteria 4239
966 nmdc:mga0yw44_591053_c1 3300050492 Bacteria 754
967 nmdc:mga0yw44_610427_c1 3300050492 Bacteria 741
968 nmdc:mga0yw44_77641_c1 3300050492 Bacteria 2075
969 nmdc:mga0k408_131452_c1 3300050493 Bacteria 1486
970 nmdc:mga0k408_157311_c1 3300050493 Bacteria 1013
971 nmdc:mga0k408_290290_c1 3300050493 Bacteria 976
972 nmdc:mga0k408_450689_c1 3300050493 Bacteria 764
973 nmdc:mga06z11_123811_c1 3300050494 Bacteria 1445
974 nmdc:mga06z11_210473_c1 3300050494 Bacteria 1133
975 nmdc:mga06z11_755090_c1 3300050494 Bacteria 593
976 nmdc:mga06z11_77693_c1 3300050494 Bacteria 1773
977 nmdc:mga06z11_7845_c1 3300050494 Bacteria 4416
978 nmdc:mga06z11_964168_c1 3300050494 Bacteria 520
979 nmdc:mga04h51_111053_c1 3300050495 Bacteria 1011
980 nmdc:mga04h51_14733_c1 3300050495 Bacteria 1844
981 nmdc:mga07m45_10213_c1 3300050496 Bacteria 4896
982 nmdc:mga07m45_260018_c1 3300050496 Bacteria 1010
983 nmdc:mga07m45_306879_c1 3300050496 Bacteria 923
984 nmdc:mga07m45_466221_c1 3300050496 Bacteria 732
985 nmdc:mga08y16_2070819_c1 3300050511 Bacteria 517
986 nmdc:mga08y16_54346_c1 3300050511 Bacteria 4184
987 nmdc:mga0n895_1646812_c1 3300050512 Bacteria 605
988 nmdc:mga0n895_218891_c1 3300050512 Bacteria 1933
989 nmdc:mga0rr50_472846_c1 3300050513 Bacteria 1064
990 nmdc:mga08x19_349411_c1 3300050514 Bacteria 1032
991 nmdc:mga0sz30_40347_c1 3300050516 Bacteria 1962
992 nmdc:mga0sz30_420904_c1 3300050516 Bacteria 599
993 nmdc:mga0sz30_54642_c1 3300050516 Bacteria 1699
994 Ga0495601_0018722 3300053077 Bacteria 4215
995 Ga0495601_0021234 3300053077 Bacteria 3974
996 Ga0495601_0170570 3300053077 Bacteria 1422
997 Ga0495601_0257654 3300053077 Bacteria 1139
998 Ga0495612_0015857 3300053078 Bacteria 3020
999 Ga0495612_0070130 3300053078 Bacteria 1460
1000 Ga0500610_0128034 3300053079 Bacteria 1294
1001 Ga0500610_0277187 3300053079 Bacteria 755
1002 Ga0500635_0009036 3300053080 Bacteria 2752
1003 Ga0495655_0019706 3300053083 Bacteria 1502
1004 Ga0495655_0066392 3300053083 Bacteria 998
1005 Ga0495595_0001351 3300053084 Bacteria 9525
1006 Ga0495595_0005676 3300053084 Bacteria 5052
1007 Ga0495619_0204408 3300053085 Bacteria 1367
1008 Ga0495619_0277073 3300053085 Bacteria 1162
1009 Ga0495619_1088320 3300053085 Bacteria 532
1010 Ga0500578_0237796 3300053086 Bacteria 1101
1011 Ga0500644_0163297 3300053088 Bacteria 901
1012 Ga0500644_0316851 3300053088 Bacteria 670
1013 Ga0500581_177134 3300053089 Bacteria 972
1014 Ga0500651_0012461 3300053093 Bacteria 5156
1015 Ga0500651_0031822 3300053093 Bacteria 3323
1016 Ga0500651_0161567 3300053093 Bacteria 1339
1017 Ga0500651_0248473 3300053093 Bacteria 1035
1018 Ga0500566_0000128 3300053094 Bacteria 38564
1019 Ga0500566_0003981 3300053094 Bacteria 8821
1020 Ga0500566_0009422 3300053094 Bacteria 5771
1021 Ga0500640_000168 3300053095 Bacteria 13302
1022 Ga0500640_033975 3300053095 Bacteria 2239
1023 Ga0500641_0003698 3300053096 Bacteria 5399
1024 Ga0500641_0013736 3300053096 Bacteria 2978
1025 Ga0500648_246944 3300053097 Bacteria 844
1026 Ga0500650_0009359 3300053098 Bacteria 3928
1027 Ga0500554_023397 3300053102 Bacteria 1737
1028 Ga0500554_039363 3300053102 Bacteria 1443
1029 Ga0500554_315860 3300053102 Bacteria 503
1030 Ga0500555_039621 3300053103 Bacteria 1315
1031 Ga0500556_0000045 3300053104 Bacteria 130653
1032 Ga0500556_0250891 3300053104 Bacteria 697
1033 Ga0500569_162679 3300053109 Bacteria 755
1034 Ga0500572_000620 3300053111 Bacteria 11912
1035 Ga0500572_040917 3300053111 Bacteria 1343
1036 Ga0500591_120068 3300053115 Bacteria 1082
1037 Ga0500592_000231 3300053116 Bacteria 10183
1038 Ga0500593_021146 3300053117 Bacteria 2864
1039 Ga0500594_0129753 3300053118 Bacteria 797
1040 Ga0500595_000398 3300053119 Bacteria 27905
1041 Ga0500595_021448 3300053119 Bacteria 2304
1042 Ga0500607_011628 3300053121 Bacteria 5198
1043 Ga0500607_099110 3300053121 Bacteria 1450
1044 Ga0500608_041088 3300053122 Bacteria 2218
1045 Ga0500608_060870 3300053122 Bacteria 1805
1046 Ga0500614_001536 3300053123 Bacteria 5475
1047 Ga0500614_017335 3300053123 Bacteria 1627
1048 Ga0500617_138974 3300053124 Bacteria 977
1049 Ga0500618_002192 3300053125 Bacteria 7647
1050 Ga0500618_118601 3300053125 Bacteria 599
1051 Ga0500623_258140 3300053127 Bacteria 574
1052 Ga0500628_143850 3300053129 Bacteria 663
1053 Ga0500642_0000024 3300053130 Bacteria 134373
1054 Ga0500652_000963 3300053131 Bacteria 9516
1055 Ga0500658_0045660 3300053134 Bacteria 1771
1056 Ga0500658_0214615 3300053134 Bacteria 881
1057 Ga0500559_0000051 3300053136 Bacteria 91468
1058 Ga0500559_0013716 3300053136 Bacteria 3427
1059 Ga0500559_0045348 3300053136 Bacteria 1924
1060 Ga0500564_039855 3300053138 Bacteria 2163
1061 Ga0500568_0004072 3300053139 Bacteria 7914
1062 Ga0500577_0081679 3300053142 Bacteria 1290
1063 Ga0500579_127333 3300053143 Bacteria 1207
1064 Ga0500586_000623 3300053145 Bacteria 7202
1065 Ga0500586_040909 3300053145 Bacteria 1572
1066 Ga0500590_025192 3300053148 Bacteria 3088
1067 Ga0500590_133908 3300053148 Bacteria 1143
1068 Ga0500590_138224 3300053148 Bacteria 1117
1069 Ga0500603_000356 3300053150 Bacteria 11934
1070 Ga0500603_052018 3300053150 Bacteria 1123
1071 Ga0500604_0194807 3300053151 Bacteria 696
1072 Ga0500616_0000054 3300053153 Bacteria 290186
1073 Ga0500616_0159686 3300053153 Bacteria 1035
1074 Ga0500619_185859 3300053154 Bacteria 700
1075 Ga0500620_001931 3300053155 Bacteria 4012
1076 Ga0500622_0002139 3300053156 Bacteria 14682
1077 Ga0500624_011437 3300053157 Bacteria 1296
1078 Ga0500624_072423 3300053157 Bacteria 676
1079 Ga0500627_0177519 3300053158 Bacteria 958
1080 Ga0500630_025238 3300053159 Bacteria 2933
1081 Ga0500633_0013325 3300053160 Bacteria 2301
1082 Ga0500634_0041699 3300053161 Bacteria 2492
1083 Ga0500634_0184765 3300053161 Bacteria 933
1084 Ga0500638_000751 3300053162 Bacteria 8810
1085 Ga0500638_039001 3300053162 Bacteria 2306
1086 Ga0500638_063626 3300053162 Bacteria 1770
1087 Ga0500638_094515 3300053162 Bacteria 1402
1088 Ga0500639_000125 3300053163 Bacteria 36885
1089 Ga0500636_0000249 3300053177 Bacteria 29583
1090 Ga0500636_0002084 3300053177 Bacteria 11042
1091 Ga0500636_0354281 3300053177 Bacteria 699
1092 Ga0500637_0000118 3300053178 Bacteria 28882
1093 Ga0500637_0219892 3300053178 Bacteria 1074
1094 Ga0500637_0226791 3300053178 Bacteria 1053
1095 Ga0500637_0414618 3300053178 Bacteria 695
1096 Ga0500567_098423 3300053723 Bacteria 1221
1097 Ga0500645_090029 3300053730 Bacteria 870
1098 Ga0500609_016844 3300053731 Bacteria 992
1099 Ga0500596_000129 3300053735 Bacteria 11049
1100 Ga0500596_011038 3300053735 Bacteria 1386
1101 Ga0500601_005462 3300053737 Bacteria 1391
1102 Ga0500601_015500 3300053737 Bacteria 866
1103 Ga0501084_0102518 3300054114 Bacteria 2403
1104 Ga0500661_000042 3300055283 Bacteria 19485
1105 Ga0500661_003202 3300055283 Bacteria 3080
1106 Ga0501082_0103155 3300060353 Bacteria 2467

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_102352186 Ga0068858_1023521862 112
2 3300005719 Ga0068861_101148903 Ga0068861_1011489032 129
3 3300005539 Ga0068853_101497639 Ga0068853_1014976392 130
4 3300005563 Ga0068855_101150552 Ga0068855_1011505521 130
5 3300037466 Ga0395898_0017739 Ga0395898_0017739_2854_3285 132
6 3300005327 Ga0070658_10043632 Ga0070658_100436323 134
7 3300005344 Ga0070661_101665914 Ga0070661_1016659141 134
8 3300025909 Ga0207705_10041505 Ga0207705_100415053 134
9 3300031911 Ga0307412_10154604 Ga0307412_101546043 134
10 3300046524 Ga0495648_0003557 Ga0495648_0003557_692_1147 134
11 3300048929 Ga0496126_0464960 Ga0496126_0464960_58_498 134
12 3300005436 Ga0070713_101608477 Ga0070713_1016084771 135
13 3300048929 Ga0496126_0036489 Ga0496126_0036489_3119_3568 135
14 3300053161 Ga0500634_0041699 Ga0500634_0041699_705_1145 135
15 3300005458 Ga0070681_10734442 Ga0070681_107344422 136
16 3300013308 Ga0157375_10337975 Ga0157375_103379751 136
17 3300025912 Ga0207707_10508970 Ga0207707_105089701 136
18 3300037418 Ga0395900_0185512 Ga0395900_0185512_331_780 136
19 3300005331 Ga0070670_100762094 Ga0070670_1007620941 137
20 3300005337 Ga0070682_100501566 Ga0070682_1005015662 137
21 3300005842 Ga0068858_100041366 Ga0068858_1000413662 137
22 3300006173 Ga0070716_100141123 Ga0070716_1001411232 137
23 3300006173 Ga0070716_101051224 Ga0070716_1010512242 137
24 3300006195 Ga0075366_10680381 Ga0075366_106803812 137
25 3300006237 Ga0097621_100157271 Ga0097621_1001572711 137
26 3300006358 Ga0068871_100608175 Ga0068871_1006081752 137
27 3300009177 Ga0105248_10972242 Ga0105248_109722421 137
28 3300014968 Ga0157379_11844811 Ga0157379_118448112 137
29 3300025939 Ga0207665_10036445 Ga0207665_100364452 137
30 3300026088 Ga0207641_10196970 Ga0207641_101969702 137
31 3300027866 Ga0209813_10228056 Ga0209813_102280561 137
32 3300028786 Ga0307517_10000542 Ga0307517_1000054264 137
33 3300031456 Ga0307513_10312420 Ga0307513_103124201 137
34 3300031616 Ga0307508_10054533 Ga0307508_100545332 137
35 3300034820 Ga0373959_0012270 Ga0373959_0012270_331_765 137
36 3300035085 Ga0373929_0008655 Ga0373929_0008655_433_867 137
37 3300035112 Ga0373932_0115129 Ga0373932_0115129_290_724 137
38 3300035691 Ga0373931_0001627 Ga0373931_0001627_1399_1833 137
39 3300047323 Ga0495683_0289851 Ga0495683_0289851_115_549 137
40 3300048904 Ga0496101_0245391 Ga0496101_0245391_155_589 137
41 3300048906 Ga0496103_0036877 Ga0496103_0036877_62_496 137
42 3300048908 Ga0496105_0166142 Ga0496105_0166142_32_466 137
43 3300048909 Ga0496106_0277923 Ga0496106_0277923_659_1093 137
44 3300048911 Ga0496108_0005832 Ga0496108_0005832_151_585 137
45 3300048914 Ga0496111_0090509 Ga0496111_0090509_748_1182 137
46 3300048915 Ga0496112_0128266 Ga0496112_0128266_560_994 137
47 3300048916 Ga0496113_0063748 Ga0496113_0063748_169_603 137
48 3300048916 Ga0496113_1359157 Ga0496113_1359157_68_520 137
49 3300048918 Ga0496115_0286332 Ga0496115_0286332_845_1318 137
50 3300050494 nmdc:mga06z11_123811_c1 nmdc:mga06z11_123811_c1_578_1012 137
51 3300053077 Ga0495601_0170570 Ga0495601_0170570_675_1109 137
52 3300053084 Ga0495595_0005676 Ga0495595_0005676_3960_4394 137
53 3300053085 Ga0495619_0204408 Ga0495619_0204408_276_710 137
54 3300025939 Ga0207665_10811469 Ga0207665_108114692 138
55 3300031241 Ga0265325_10001890 Ga0265325_100018902 138
56 3300031595 Ga0265313_10052638 Ga0265313_100526383 138
57 3300041505 Ga0451849_1079513 Ga0451849_1079513_87_536 138
58 3300047317 Ga0495604_0535105 Ga0495604_0535105_37_474 138
59 3300005337 Ga0070682_100425063 Ga0070682_1004250631 139
60 3300005458 Ga0070681_10082287 Ga0070681_100822872 139
61 3300005530 Ga0070679_100879258 Ga0070679_1008792581 139
62 3300005539 Ga0068853_100724445 Ga0068853_1007244452 139
63 3300005547 Ga0070693_100742460 Ga0070693_1007424601 139
64 3300005614 Ga0068856_101744280 Ga0068856_1017442802 139
65 3300006237 Ga0097621_100142279 Ga0097621_1001422793 139
66 3300009093 Ga0105240_10287474 Ga0105240_102874742 139
67 3300009551 Ga0105238_10162102 Ga0105238_101621023 139
68 3300010159 Ga0099796_10038063 Ga0099796_100380632 139
69 3300013307 Ga0157372_10706717 Ga0157372_107067172 139
70 3300025912 Ga0207707_10004597 Ga0207707_1000459711 139
71 3300025913 Ga0207695_10298911 Ga0207695_102989113 139
72 3300025921 Ga0207652_10012904 Ga0207652_100129048 139
73 3300026041 Ga0207639_10910572 Ga0207639_109105722 139
74 3300026078 Ga0207702_10268410 Ga0207702_102684103 139
75 3300037068 Ga0373925_0677298 Ga0373925_0677298_153_587 139
76 3300048906 Ga0496103_0283353 Ga0496103_0283353_397_831 139
77 3300006038 Ga0075365_10019900 Ga0075365_100199004 140
78 3300006042 Ga0075368_10033435 Ga0075368_100334352 140
79 3300006051 Ga0075364_10013014 Ga0075364_100130148 140
80 3300006177 Ga0075362_10008329 Ga0075362_100083296 140
81 3300025315 Ga0207697_10039080 Ga0207697_100390802 140
82 3300027866 Ga0209813_10093866 Ga0209813_100938662 140
83 3300035111 Ga0373923_0037675 Ga0373923_0037675_759_1196 140
84 3300035113 Ga0373936_0139431 Ga0373936_0139431_559_996 140
85 3300035117 Ga0373953_0126273 Ga0373953_0126273_522_959 140
86 3300035170 Ga0373943_0121324 Ga0373943_0121324_827_1264 140
87 3300035692 Ga0373935_0124834 Ga0373935_0124834_620_1057 140
88 3300035695 Ga0373927_0006928 Ga0373927_0006928_1395_1853 140
89 3300035695 Ga0373927_0110774 Ga0373927_0110774_701_1138 140
90 3300035725 Ga0373947_0077884 Ga0373947_0077884_75_512 140
91 3300037068 Ga0373925_0076473 Ga0373925_0076473_1346_1783 140
92 3300041451 Ga0451791_0562369 Ga0451791_0562369_994_1440 140
93 3300046472 Ga0495580_0032562 Ga0495580_0032562_526_963 140
94 3300046473 Ga0495582_0067449 Ga0495582_0067449_458_895 140
95 3300046475 Ga0495639_0099139 Ga0495639_0099139_562_999 140
96 3300046475 Ga0495639_0128946 Ga0495639_0128946_301_759 140
97 3300046477 Ga0495664_0159492 Ga0495664_0159492_167_604 140
98 3300046511 Ga0495608_0573546 Ga0495608_0573546_25_462 140
99 3300046517 Ga0495630_0211687 Ga0495630_0211687_651_1088 140
100 3300046523 Ga0495644_0219979 Ga0495644_0219979_29_472 140
101 3300046526 Ga0495666_0555330 Ga0495666_0555330_51_488 140
102 3300046535 Ga0495586_0157218 Ga0495586_0157218_335_772 140
103 3300046642 Ga0495634_0361001 Ga0495634_0361001_377_814 140
104 3300046663 Ga0495635_0074085 Ga0495635_0074085_552_989 140
105 3300046680 Ga0495646_0087710 Ga0495646_0087710_809_1246 140
106 3300046683 Ga0495658_0327171 Ga0495658_0327171_325_762 140
107 3300046689 Ga0495613_0100697 Ga0495613_0100697_274_711 140
108 3300046690 Ga0495624_0044293 Ga0495624_0044293_1405_1842 140
109 3300047315 Ga0495581_0292926 Ga0495581_0292926_330_767 140
110 3300047319 Ga0495674_0088724 Ga0495674_0088724_536_973 140
111 3300050489 nmdc:mga03683_25565_c1 nmdc:mga03683_25565_c1_1769_2221 140
112 3300050491 nmdc:mga00v17_2278_c1 nmdc:mga00v17_2278_c1_7801_8253 140
113 3300050492 nmdc:mga0yw44_14035_c1 nmdc:mga0yw44_14035_c1_2665_3117 140
114 3300050495 nmdc:mga04h51_111053_c1 nmdc:mga04h51_111053_c1_207_659 140
115 3300050511 nmdc:mga08y16_2070819_c1 nmdc:mga08y16_2070819_c1_26_478 140
116 iso_pu_bacteria 2643221621 2644122945 140
117 iso_pu_bacteria 2935959822 2935965981 140
118 iso_pu_bacteria 3005710791 3005717311 140
119 iso_pu_bacteria 8006926726 8006931687 140
120 3300003203 JGI25406J46586_10004272 JGI25406J46586_100042726 142
121 3300005327 Ga0070658_10005658 Ga0070658_1000565810 142
122 3300005329 Ga0070683_100089709 Ga0070683_1000897092 142
123 3300005336 Ga0070680_100016960 Ga0070680_1000169603 142
124 3300005339 Ga0070660_100029340 Ga0070660_1000293404 142
125 3300005341 Ga0070691_10011291 Ga0070691_100112912 142
126 3300005344 Ga0070661_100003193 Ga0070661_1000031933 142
127 3300005366 Ga0070659_100348585 Ga0070659_1003485852 142
128 3300005458 Ga0070681_10482526 Ga0070681_104825262 142
129 3300005530 Ga0070679_100146761 Ga0070679_1001467614 142
130 3300005535 Ga0070684_100159258 Ga0070684_1001592581 142
131 3300005539 Ga0068853_100009893 Ga0068853_1000098937 142
132 3300005563 Ga0068855_100064018 Ga0068855_1000640182 142
133 3300005563 Ga0068855_101946364 Ga0068855_1019463641 142
134 3300005834 Ga0068851_10022304 Ga0068851_100223042 142
135 3300005985 Ga0081539_10001606 Ga0081539_100016066 142
136 3300009093 Ga0105240_10017853 Ga0105240_100178532 142
137 3300009551 Ga0105238_10046886 Ga0105238_100468863 142
138 3300010375 Ga0105239_10233646 Ga0105239_102336463 142
139 3300013105 Ga0157369_10246117 Ga0157369_102461173 142
140 3300025321 Ga0207656_10101145 Ga0207656_101011452 142
141 3300025909 Ga0207705_10114003 Ga0207705_101140031 142
142 3300025912 Ga0207707_10003157 Ga0207707_100031574 142
143 3300025913 Ga0207695_10155249 Ga0207695_101552492 142
144 3300025919 Ga0207657_10004638 Ga0207657_1000463810 142
145 3300025921 Ga0207652_10060805 Ga0207652_100608055 142
146 3300025924 Ga0207694_10013152 Ga0207694_100131523 142
147 3300025944 Ga0207661_10146271 Ga0207661_101462713 142
148 3300025949 Ga0207667_10177738 Ga0207667_101777383 142
149 3300026041 Ga0207639_10187226 Ga0207639_101872262 142
150 3300026116 Ga0207674_10012960 Ga0207674_100129603 142
151 3300026142 Ga0207698_10071295 Ga0207698_100712952 142
152 3300041441 Ga0451787_541596 Ga0451787_541596_17_448 142
153 3300046477 Ga0495664_0063665 Ga0495664_0063665_405_833 142
154 3300046543 Ga0495645_0001274 Ga0495645_0001274_12196_12624 142
155 3300053077 Ga0495601_0021234 Ga0495601_0021234_2822_3250 142
156 3300053078 Ga0495612_0015857 Ga0495612_0015857_1157_1585 142
157 iso_pu_bacteria 2602042107 2603860552 142
158 iso_pu_bacteria 2857524615 2857525507 142
159 iso_pu_bacteria 2885374607 2885375159 142
160 iso_pu_bacteria 2904690495 2904691263 142
161 iso_pu_bacteria 2904699407 2904704931 142
162 iso_pu_bacteria 2919073203 2919074684 142
163 iso_pu_bacteria 8056689827 8056693122 142
164 3300006178 Ga0075367_10030079 Ga0075367_100300793 143
165 3300053094 Ga0500566_0009422 Ga0500566_0009422_4485_4916 143
166 3300053102 Ga0500554_039363 Ga0500554_039363_10_441 143
167 3300053119 Ga0500595_000398 Ga0500595_000398_2865_3296 143
168 3300053123 Ga0500614_017335 Ga0500614_017335_90_521 143
169 3300053162 Ga0500638_000751 Ga0500638_000751_5150_5581 143
170 3300053178 Ga0500637_0000118 Ga0500637_0000118_3353_3784 143
171 3300055283 Ga0500661_000042 Ga0500661_000042_10523_10954 143
172 iso_pu_bacteria 2507262055 2507509317 143
173 iso_pu_bacteria 2513237098 2513672920 143
174 iso_pu_bacteria 2513237101 2513698853 143
175 iso_pu_bacteria 2513237141 2513887887 143
176 iso_pu_bacteria 2524023210 2524470964 143
177 iso_pu_bacteria 2643221651 2644288985 143
178 iso_pu_bacteria 2721755755 2723842661 143
179 iso_pu_bacteria 2791355197 2793066779 143
180 iso_pu_bacteria 2791355199 2793080468 143
181 iso_pu_bacteria 2842038055 2842039736 143
182 iso_pu_bacteria 2842045827 2842047318 143
183 iso_pu_bacteria 2874604998 2874606664 143
184 iso_pu_bacteria 2879110137 2879112000 143
185 iso_pu_bacteria 2885409591 2885411251 143
186 iso_pu_bacteria 2889033259 2889034043 143
187 iso_pu_bacteria 2893066018 2893070770 143
188 iso_pu_bacteria 2903768456 2903770954 143
189 iso_pu_bacteria 2906610324 2906616585 143
190 iso_pu_bacteria 2908756301 2908759095 143
191 iso_pu_bacteria 2922361189 2922367444 143
192 iso_pu_bacteria 2922386360 2922389859 143
193 iso_pu_bacteria 2922425934 2922431392 143
194 iso_pu_bacteria 2935630451 2935633986 143
195 iso_pu_bacteria 2941507105 2941510711 143
196 iso_pu_bacteria 2941515067 2941518095 143
197 iso_pu_bacteria 2941523033 2941527034 143
198 iso_pu_bacteria 3005474847 3005481185 143
199 iso_pu_bacteria 8006964411 8006965968 143
200 iso_pu_bacteria 8006984368 8006989904 143
201 iso_pu_bacteria 8006994254 8006998260 143
202 iso_pu_bacteria 8019555841 8019565408 143
203 iso_pu_bacteria 8056673599 8056677884 143
204 iso_pu_bacteria 8056681323 8056684486 143
205 3300003203 JGI25406J46586_10000506 JGI25406J46586_1000050617 144
206 3300005328 Ga0070676_10276015 Ga0070676_102760152 144
207 3300005329 Ga0070683_100010541 Ga0070683_1000105416 144
208 3300005336 Ga0070680_100035793 Ga0070680_1000357933 144
209 3300005347 Ga0070668_100099179 Ga0070668_1000991793 144
210 3300005347 Ga0070668_101217584 Ga0070668_1012175842 144
211 3300005354 Ga0070675_100738649 Ga0070675_1007386492 144
212 3300005355 Ga0070671_100184578 Ga0070671_1001845781 144
213 3300005355 Ga0070671_101555660 Ga0070671_1015556601 144
214 3300005367 Ga0070667_101166568 Ga0070667_1011665681 144
215 3300005455 Ga0070663_101300199 Ga0070663_1013001991 144
216 3300005456 Ga0070678_100038182 Ga0070678_1000381823 144
217 3300005459 Ga0068867_100219687 Ga0068867_1002196872 144
218 3300005530 Ga0070679_101183553 Ga0070679_1011835532 144
219 3300005535 Ga0070684_100010579 Ga0070684_1000105795 144
220 3300005539 Ga0068853_101020511 Ga0068853_1010205112 144
221 3300005543 Ga0070672_100130487 Ga0070672_1001304872 144
222 3300005548 Ga0070665_100033424 Ga0070665_1000334243 144
223 3300005548 Ga0070665_100838229 Ga0070665_1008382292 144
224 3300005548 Ga0070665_101436910 Ga0070665_1014369102 144
225 3300005548 Ga0070665_101631767 Ga0070665_1016317672 144
226 3300005577 Ga0068857_100959311 Ga0068857_1009593111 144
227 3300005844 Ga0068862_100366828 Ga0068862_1003668282 144
228 3300005844 Ga0068862_100540415 Ga0068862_1005404152 144
229 3300005844 Ga0068862_101118104 Ga0068862_1011181042 144
230 3300005844 Ga0068862_101329463 Ga0068862_1013294632 144
231 3300005985 Ga0081539_10001572 Ga0081539_1000157237 144
232 3300006051 Ga0075364_10530689 Ga0075364_105306892 144
233 3300006051 Ga0075364_10599679 Ga0075364_105996791 144
234 3300006177 Ga0075362_10217222 Ga0075362_102172221 144
235 3300006178 Ga0075367_10402752 Ga0075367_104027522 144
236 3300006178 Ga0075367_10452429 Ga0075367_104524292 144
237 3300006237 Ga0097621_101524750 Ga0097621_1015247502 144
238 3300006846 Ga0075430_100699232 Ga0075430_1006992322 144
239 3300009545 Ga0105237_10910303 Ga0105237_109103032 144
240 3300013105 Ga0157369_10045792 Ga0157369_100457924 144
241 3300013308 Ga0157375_10346570 Ga0157375_103465701 144
242 3300013308 Ga0157375_11248409 Ga0157375_112484091 144
243 3300013308 Ga0157375_12662694 Ga0157375_126626941 144
244 3300014325 Ga0163163_10637323 Ga0163163_106373232 144
245 3300014326 Ga0157380_11366433 Ga0157380_113664332 144
246 3300014968 Ga0157379_12602923 Ga0157379_126029231 144
247 3300017792 Ga0163161_10822153 Ga0163161_108221531 144
248 3300025903 Ga0207680_10781339 Ga0207680_107813392 144
249 3300025912 Ga0207707_10056424 Ga0207707_100564244 144
250 3300025924 Ga0207694_10428082 Ga0207694_104280823 144
251 3300025926 Ga0207659_10278845 Ga0207659_102788453 144
252 3300025931 Ga0207644_10255998 Ga0207644_102559982 144
253 3300025938 Ga0207704_11299616 Ga0207704_112996162 144
254 3300025939 Ga0207665_10149387 Ga0207665_101493873 144
255 3300025944 Ga0207661_10041449 Ga0207661_100414492 144
256 3300025972 Ga0207668_10216683 Ga0207668_102166833 144
257 3300025972 Ga0207668_10712321 Ga0207668_107123211 144
258 3300025986 Ga0207658_10879491 Ga0207658_108794912 144
259 3300026041 Ga0207639_10799146 Ga0207639_107991462 144
260 3300026089 Ga0207648_10445355 Ga0207648_104453551 144
261 3300026116 Ga0207674_10180724 Ga0207674_101807243 144
262 3300026121 Ga0207683_10044272 Ga0207683_100442723 144
263 3300026142 Ga0207698_10275330 Ga0207698_102753301 144
264 3300028379 Ga0268266_10038384 Ga0268266_100383846 144
265 3300028786 Ga0307517_10121928 Ga0307517_101219281 144
266 3300028794 Ga0307515_10011730 Ga0307515_1001173018 144
267 3300028794 Ga0307515_10416529 Ga0307515_104165292 144
268 3300031241 Ga0265325_10023051 Ga0265325_100230514 144
269 3300031247 Ga0265340_10267492 Ga0265340_102674922 144
270 3300031250 Ga0265331_10055236 Ga0265331_100552363 144
271 3300031344 Ga0265316_10385129 Ga0265316_103851291 144
272 3300031456 Ga0307513_10094041 Ga0307513_100940413 144
273 3300031595 Ga0265313_10076962 Ga0265313_100769622 144
274 3300031712 Ga0265342_10050961 Ga0265342_100509612 144
275 3300031730 Ga0307516_10284328 Ga0307516_102843282 144
276 3300031852 Ga0307410_11275594 Ga0307410_112755941 144
277 3300032002 Ga0307416_101712059 Ga0307416_1017120591 144
278 3300032005 Ga0307411_10696156 Ga0307411_106961562 144
279 3300033180 Ga0307510_10155674 Ga0307510_101556743 144
280 3300033180 Ga0307510_10365855 Ga0307510_103658552 144
281 3300035113 Ga0373936_0066768 Ga0373936_0066768_697_1131 144
282 3300035118 Ga0373954_0375706 Ga0373954_0375706_45_479 144
283 3300035121 Ga0373960_0333730 Ga0373960_0333730_53_487 144
284 3300035691 Ga0373931_0914010 Ga0373931_0914010_48_482 144
285 3300035692 Ga0373935_1388434 Ga0373935_1388434_55_489 144
286 3300035695 Ga0373927_0461505 Ga0373927_0461505_134_568 144
287 3300037068 Ga0373925_0228550 Ga0373925_0228550_552_986 144
288 3300037068 Ga0373925_0814578 Ga0373925_0814578_162_596 144
289 3300037312 Ga0395899_0083159 Ga0395899_0083159_487_921 144
290 3300037312 Ga0395899_0690032 Ga0395899_0690032_52_486 144
291 3300037418 Ga0395900_0001282 Ga0395900_0001282_16595_17029 144
292 3300037418 Ga0395900_0443041 Ga0395900_0443041_560_994 144
293 3300037466 Ga0395898_0017060 Ga0395898_0017060_2657_3091 144
294 3300037466 Ga0395898_0025002 Ga0395898_0025002_2956_3390 144
295 3300037471 Ga0395905_0109478 Ga0395905_0109478_1375_1809 144
296 3300038443 Ga0395901_0047469 Ga0395901_0047469_3712_4146 144
297 3300041498 Ga0451841_0490343 Ga0451841_0490343_44_478 144
298 3300041503 Ga0451847_0001817 Ga0451847_0001817_50_484 144
299 3300046454 Ga0495592_0043963 Ga0495592_0043963_775_1209 144
300 3300046459 Ga0495629_0062946 Ga0495629_0062946_1378_1812 144
301 3300046462 Ga0495651_0080811 Ga0495651_0080811_1480_1914 144
302 3300046463 Ga0495653_0107346 Ga0495653_0107346_1164_1598 144
303 3300046477 Ga0495664_0038387 Ga0495664_0038387_740_1174 144
304 3300046477 Ga0495664_0081750 Ga0495664_0081750_361_795 144
305 3300046507 Ga0495606_0312643 Ga0495606_0312643_128_562 144
306 3300046511 Ga0495608_0048657 Ga0495608_0048657_692_1126 144
307 3300046516 Ga0495628_0020174 Ga0495628_0020174_5024_5458 144
308 3300046519 Ga0495632_0048395 Ga0495632_0048395_1222_1656 144
309 3300046519 Ga0495632_0336421 Ga0495632_0336421_197_640 144
310 3300046529 Ga0495652_0017676 Ga0495652_0017676_3082_3516 144
311 3300046533 Ga0495640_0029868 Ga0495640_0029868_2039_2473 144
312 3300046536 Ga0495587_0037347 Ga0495587_0037347_773_1207 144
313 3300046542 Ga0495597_0326454 Ga0495597_0326454_101_535 144
314 3300046543 Ga0495645_0111300 Ga0495645_0111300_743_1177 144
315 3300046559 Ga0495667_0016196 Ga0495667_0016196_1397_1831 144
316 3300046616 Ga0495668_0113343 Ga0495668_0113343_649_1083 144
317 3300046642 Ga0495634_0057272 Ga0495634_0057272_1188_1622 144
318 3300046660 Ga0495625_0190905 Ga0495625_0190905_706_1140 144
319 3300046663 Ga0495635_0133449 Ga0495635_0133449_947_1381 144
320 3300046663 Ga0495635_0804647 Ga0495635_0804647_151_585 144
321 3300046675 Ga0495657_0003968 Ga0495657_0003968_8388_8822 144
322 3300046678 Ga0495599_0010495 Ga0495599_0010495_1464_1898 144
323 3300046679 Ga0495623_0016510 Ga0495623_0016510_1460_1894 144
324 3300046680 Ga0495646_0060036 Ga0495646_0060036_1556_1990 144
325 3300046684 Ga0495669_0067122 Ga0495669_0067122_1018_1452 144
326 3300046689 Ga0495613_0164925 Ga0495613_0164925_541_975 144
327 3300046794 Ga0495589_0553487 Ga0495589_0553487_66_500 144
328 3300046809 Ga0495600_0035771 Ga0495600_0035771_2573_3007 144
329 3300047315 Ga0495581_0231469 Ga0495581_0231469_411_845 144
330 3300047317 Ga0495604_0068612 Ga0495604_0068612_1791_2225 144
331 3300047319 Ga0495674_0488460 Ga0495674_0488460_511_945 144
332 3300047322 Ga0495680_0054979 Ga0495680_0054979_1088_1522 144
333 3300047444 Ga0495675_0119823 Ga0495675_0119823_1065_1499 144
334 3300047470 Ga0495681_0147637 Ga0495681_0147637_350_784 144
335 3300047471 Ga0495684_0128129 Ga0495684_0128129_837_1271 144
336 3300047472 Ga0495686_0082629 Ga0495686_0082629_675_1109 144
337 3300047472 Ga0495686_0125388 Ga0495686_0125388_271_705 144
338 3300048088 Ga0495602_0035721 Ga0495602_0035721_2887_3321 144
339 3300048909 Ga0496106_0349735 Ga0496106_0349735_714_1148 144
340 3300048910 Ga0496107_0406553 Ga0496107_0406553_507_941 144
341 3300048911 Ga0496108_0077649 Ga0496108_0077649_883_1317 144
342 3300048912 Ga0496109_0242080 Ga0496109_0242080_259_693 144
343 3300048912 Ga0496109_0656360 Ga0496109_0656360_145_579 144
344 3300048913 Ga0496110_0248964 Ga0496110_0248964_597_1031 144
345 3300048914 Ga0496111_0056466 Ga0496111_0056466_229_663 144
346 3300048915 Ga0496112_0000023 Ga0496112_0000023_119472_119906 144
347 3300048915 Ga0496112_0399061 Ga0496112_0399061_230_664 144
348 3300048918 Ga0496115_0123052 Ga0496115_0123052_287_721 144
349 3300048929 Ga0496126_0123538 Ga0496126_0123538_1694_2128 144
350 3300049572 Ga0501036_1092299 Ga0501036_1092299_184_618 144
351 3300049581 Ga0501047_0219789 Ga0501047_0219789_268_702 144
352 3300049590 Ga0501074_0272240 Ga0501074_0272240_412_846 144
353 3300049823 Ga0501044_0197185 Ga0501044_0197185_1270_1704 144
354 3300050492 nmdc:mga0yw44_77641_c1 nmdc:mga0yw44_77641_c1_1557_1991 144
355 3300050493 nmdc:mga0k408_450689_c1 nmdc:mga0k408_450689_c1_144_578 144
356 3300050494 nmdc:mga06z11_964168_c1 nmdc:mga06z11_964168_c1_14_448 144
357 3300050512 nmdc:mga0n895_1646812_c1 nmdc:mga0n895_1646812_c1_11_445 144
358 3300050514 nmdc:mga08x19_349411_c1 nmdc:mga08x19_349411_c1_47_481 144
359 3300053077 Ga0495601_0257654 Ga0495601_0257654_329_763 144
360 3300053079 Ga0500610_0128034 Ga0500610_0128034_774_1208 144
361 3300053080 Ga0500635_0009036 Ga0500635_0009036_1227_1661 144
362 3300053085 Ga0495619_0277073 Ga0495619_0277073_596_1030 144
363 3300053085 Ga0495619_1088320 Ga0495619_1088320_14_448 144
364 3300053093 Ga0500651_0248473 Ga0500651_0248473_574_1008 144
365 3300053095 Ga0500640_033975 Ga0500640_033975_1662_2096 144
366 3300053097 Ga0500648_246944 Ga0500648_246944_202_636 144
367 3300053102 Ga0500554_023397 Ga0500554_023397_730_1164 144
368 3300053111 Ga0500572_040917 Ga0500572_040917_529_963 144
369 3300053121 Ga0500607_011628 Ga0500607_011628_830_1264 144
370 3300053122 Ga0500608_060870 Ga0500608_060870_849_1283 144
371 3300053129 Ga0500628_143850 Ga0500628_143850_199_651 144
372 3300053136 Ga0500559_0045348 Ga0500559_0045348_282_716 144
373 3300053138 Ga0500564_039855 Ga0500564_039855_175_609 144
374 3300053150 Ga0500603_052018 Ga0500603_052018_144_578 144
375 3300053154 Ga0500619_185859 Ga0500619_185859_41_475 144
376 3300053155 Ga0500620_001931 Ga0500620_001931_2212_2646 144
377 3300053157 Ga0500624_072423 Ga0500624_072423_16_450 144
378 3300053162 Ga0500638_094515 Ga0500638_094515_246_680 144
379 3300053177 Ga0500636_0002084 Ga0500636_0002084_9562_9996 144
380 3300053178 Ga0500637_0219892 Ga0500637_0219892_618_1052 144
381 3300053178 Ga0500637_0226791 Ga0500637_0226791_103_537 144
382 3300053737 Ga0500601_015500 Ga0500601_015500_30_464 144
383 3300055283 Ga0500661_003202 Ga0500661_003202_2625_3059 144
384 iso_pu_bacteria 2513237096 2513654011 144
385 iso_pu_bacteria 2513237137 2513856766 144
386 iso_pu_bacteria 2513237145 2513918351 144
387 iso_pu_bacteria 2517572143 2517891414 144
388 iso_pu_bacteria 2667528175 2671118818 144
389 iso_pu_bacteria 2728368998 2728750112 144
390 iso_pu_bacteria 2903748898 2903750579 144
391 iso_pu_bacteria 2906635258 2906635374 144
392 iso_pu_bacteria 2906660503 2906666919 144
393 iso_pu_bacteria 2908739725 2908741752 144
394 3300005327 Ga0070658_10862462 Ga0070658_108624621 145
395 3300005334 Ga0068869_100723311 Ga0068869_1007233111 145
396 3300005336 Ga0070680_100106864 Ga0070680_1001068643 145
397 3300005336 Ga0070680_101061454 Ga0070680_1010614541 145
398 3300005339 Ga0070660_100571368 Ga0070660_1005713681 145
399 3300005366 Ga0070659_100053281 Ga0070659_1000532811 145
400 3300005435 Ga0070714_101135693 Ga0070714_1011356931 145
401 3300005436 Ga0070713_100302920 Ga0070713_1003029203 145
402 3300005458 Ga0070681_10269634 Ga0070681_102696342 145
403 3300005467 Ga0070706_100691910 Ga0070706_1006919102 145
404 3300005467 Ga0070706_102029562 Ga0070706_1020295621 145
405 3300005530 Ga0070679_100229319 Ga0070679_1002293192 145
406 3300005530 Ga0070679_100608542 Ga0070679_1006085422 145
407 3300005548 Ga0070665_101645743 Ga0070665_1016457431 145
408 3300005563 Ga0068855_100090898 Ga0068855_1000908981 145
409 3300005563 Ga0068855_100306312 Ga0068855_1003063122 145
410 3300005614 Ga0068856_100000046 Ga0068856_10000004650 145
411 3300005614 Ga0068856_100069409 Ga0068856_1000694097 145
412 3300005616 Ga0068852_100008117 Ga0068852_10000811710 145
413 3300005616 Ga0068852_101391280 Ga0068852_1013912802 145
414 3300005983 Ga0081540_1005685 Ga0081540_10056859 145
415 3300006028 Ga0070717_10435202 Ga0070717_104352022 145
416 3300006028 Ga0070717_10968685 Ga0070717_109686852 145
417 3300006844 Ga0075428_100721322 Ga0075428_1007213222 145
418 3300007265 Ga0099794_10386366 Ga0099794_103863661 145
419 3300007788 Ga0099795_10006976 Ga0099795_100069766 145
420 3300009093 Ga0105240_10042035 Ga0105240_100420356 145
421 3300009093 Ga0105240_11582313 Ga0105240_115823131 145
422 3300009094 Ga0111539_10347982 Ga0111539_103479823 145
423 3300009174 Ga0105241_10440542 Ga0105241_104405423 145
424 3300009551 Ga0105238_10536984 Ga0105238_105369842 145
425 3300010159 Ga0099796_10188623 Ga0099796_101886232 145
426 3300013104 Ga0157370_10459580 Ga0157370_104595802 145
427 3300013297 Ga0157378_10017846 Ga0157378_100178461 145
428 3300013307 Ga0157372_10820382 Ga0157372_108203823 145
429 3300025909 Ga0207705_11223407 Ga0207705_112234072 145
430 3300025910 Ga0207684_11136267 Ga0207684_111362672 145
431 3300025912 Ga0207707_10801975 Ga0207707_108019752 145
432 3300025914 Ga0207671_11246706 Ga0207671_112467061 145
433 3300025917 Ga0207660_10200256 Ga0207660_102002561 145
434 3300025917 Ga0207660_10437082 Ga0207660_104370822 145
435 3300025917 Ga0207660_10791322 Ga0207660_107913221 145
436 3300025921 Ga0207652_10190884 Ga0207652_101908842 145
437 3300025924 Ga0207694_10610583 Ga0207694_106105831 145
438 3300025928 Ga0207700_10200263 Ga0207700_102002633 145
439 3300025929 Ga0207664_10936273 Ga0207664_109362732 145
440 3300025945 Ga0207679_11167435 Ga0207679_111674351 145
441 3300025949 Ga0207667_10232071 Ga0207667_102320712 145
442 3300025949 Ga0207667_10293674 Ga0207667_102936742 145
443 3300025981 Ga0207640_10014821 Ga0207640_100148217 145
444 3300026067 Ga0207678_10254536 Ga0207678_102545362 145
445 3300026078 Ga0207702_10000014 Ga0207702_10000014123 145
446 3300026078 Ga0207702_10294459 Ga0207702_102944592 145
447 3300026078 Ga0207702_10938663 Ga0207702_109386632 145
448 3300026116 Ga0207674_11097033 Ga0207674_110970331 145
449 3300027512 Ga0209179_1089550 Ga0209179_10895502 145
450 3300027671 Ga0209588_1051632 Ga0209588_10516321 145
451 3300031251 Ga0265327_10078082 Ga0265327_100780823 145
452 3300031711 Ga0265314_10109989 Ga0265314_101099892 145
453 3300031712 Ga0265342_10093523 Ga0265342_100935233 145
454 3300035086 Ga0373934_0120865 Ga0373934_0120865_134_571 145
455 3300035111 Ga0373923_0064920 Ga0373923_0064920_517_954 145
456 3300035113 Ga0373936_0048507 Ga0373936_0048507_330_767 145
457 3300035117 Ga0373953_0000606 Ga0373953_0000606_6573_7010 145
458 3300035118 Ga0373954_0001041 Ga0373954_0001041_3864_4301 145
459 3300035119 Ga0373956_0066495 Ga0373956_0066495_89_526 145
460 3300035120 Ga0373957_0000527 Ga0373957_0000527_178_615 145
461 3300035170 Ga0373943_0293303 Ga0373943_0293303_21_479 145
462 3300035172 Ga0373955_0000535 Ga0373955_0000535_6662_7099 145
463 3300035410 Ga0373924_0057699 Ga0373924_0057699_115_552 145
464 3300035691 Ga0373931_0022393 Ga0373931_0022393_2460_2921 145
465 3300035691 Ga0373931_0208701 Ga0373931_0208701_180_617 145
466 3300035692 Ga0373935_0061726 Ga0373935_0061726_463_900 145
467 3300035695 Ga0373927_0067123 Ga0373927_0067123_251_688 145
468 3300035724 Ga0373933_0000017 Ga0373933_0000017_9406_9843 145
469 3300035724 Ga0373933_0012317 Ga0373933_0012317_3992_4429 145
470 3300036401 Ga0373937_0099008 Ga0373937_0099008_438_875 145
471 3300037471 Ga0395905_0180823 Ga0395905_0180823_80_565 145
472 3300039437 Ga0436365_1083338 Ga0436365_1083338_390_833 145
473 3300041443 Ga0451789_0084525 Ga0451789_0084525_45_482 145
474 3300041456 Ga0451795_0120595 Ga0451795_0120595_57_494 145
475 3300044694 Ga0466963_0035186 Ga0466963_0035186_438_875 145
476 3300046454 Ga0495592_0011960 Ga0495592_0011960_4534_4971 145
477 3300046459 Ga0495629_0001841 Ga0495629_0001841_14072_14509 145
478 3300046463 Ga0495653_0004149 Ga0495653_0004149_3840_4277 145
479 3300046476 Ga0495662_0362510 Ga0495662_0362510_47_484 145
480 3300046491 Ga0495584_0454679 Ga0495584_0454679_197_634 145
481 3300046507 Ga0495606_0004620 Ga0495606_0004620_11741_12178 145
482 3300046511 Ga0495608_0052701 Ga0495608_0052701_1738_2175 145
483 3300046529 Ga0495652_0014821 Ga0495652_0014821_2099_2536 145
484 3300046529 Ga0495652_0687473 Ga0495652_0687473_27_464 145
485 3300046531 Ga0495665_0275346 Ga0495665_0275346_93_530 145
486 3300046533 Ga0495640_0037674 Ga0495640_0037674_1155_1592 145
487 3300046536 Ga0495587_0075687 Ga0495587_0075687_1474_1911 145
488 3300046543 Ga0495645_0005613 Ga0495645_0005613_7366_7803 145
489 3300046559 Ga0495667_0032991 Ga0495667_0032991_2227_2664 145
490 3300046615 Ga0495656_0132030 Ga0495656_0132030_485_922 145
491 3300046642 Ga0495634_0068234 Ga0495634_0068234_1075_1512 145
492 3300046660 Ga0495625_0401718 Ga0495625_0401718_316_801 145
493 3300046663 Ga0495635_0002477 Ga0495635_0002477_523_960 145
494 3300046678 Ga0495599_0002497 Ga0495599_0002497_2881_3318 145
495 3300046678 Ga0495599_0235531 Ga0495599_0235531_659_1096 145
496 3300046679 Ga0495623_0138573 Ga0495623_0138573_83_520 145
497 3300046680 Ga0495646_0002092 Ga0495646_0002092_4134_4571 145
498 3300046680 Ga0495646_0149273 Ga0495646_0149273_208_645 145
499 3300046680 Ga0495646_0409182 Ga0495646_0409182_165_602 145
500 3300046683 Ga0495658_0740709 Ga0495658_0740709_100_537 145
501 3300046689 Ga0495613_0010590 Ga0495613_0010590_2962_3399 145
502 3300046809 Ga0495600_0001788 Ga0495600_0001788_7045_7482 145
503 3300047317 Ga0495604_0018510 Ga0495604_0018510_4344_4781 145
504 3300047319 Ga0495674_0284234 Ga0495674_0284234_900_1337 145
505 3300047321 Ga0495676_1055676 Ga0495676_1055676_16_453 145
506 3300047322 Ga0495680_0060977 Ga0495680_0060977_1474_1911 145
507 3300047444 Ga0495675_0033442 Ga0495675_0033442_1244_1681 145
508 3300047469 Ga0495673_0175187 Ga0495673_0175187_185_622 145
509 3300047471 Ga0495684_0001145 Ga0495684_0001145_7903_8340 145
510 3300047673 Ga0495593_0000526 Ga0495593_0000526_7485_7922 145
511 3300048088 Ga0495602_0009427 Ga0495602_0009427_357_794 145
512 3300048905 Ga0496102_0228667 Ga0496102_0228667_42_482 145
513 3300048905 Ga0496102_0315501 Ga0496102_0315501_199_636 145
514 3300048905 Ga0496102_1390654 Ga0496102_1390654_167_604 145
515 3300048907 Ga0496104_0049104 Ga0496104_0049104_2132_2593 145
516 3300048910 Ga0496107_0286458 Ga0496107_0286458_658_1095 145
517 3300048910 Ga0496107_1166956 Ga0496107_1166956_14_454 145
518 3300048911 Ga0496108_0163680 Ga0496108_0163680_458_919 145
519 3300048913 Ga0496110_0074390 Ga0496110_0074390_306_743 145
520 3300048913 Ga0496110_0620058 Ga0496110_0620058_176_637 145
521 3300048914 Ga0496111_0160257 Ga0496111_0160257_414_875 145
522 3300048914 Ga0496111_1353757 Ga0496111_1353757_53_490 145
523 3300048915 Ga0496112_1497246 Ga0496112_1497246_61_498 145
524 3300048925 Ga0496122_0033823 Ga0496122_0033823_488_925 145
525 3300048928 Ga0496125_0000099 Ga0496125_0000099_16260_16697 145
526 3300049570 Ga0501033_0479227 Ga0501033_0479227_227_664 145
527 3300049574 Ga0501038_0587592 Ga0501038_0587592_102_539 145
528 3300049578 Ga0501042_0479340 Ga0501042_0479340_310_747 145
529 3300049582 Ga0501048_0046128 Ga0501048_0046128_2524_2961 145
530 3300050511 nmdc:mga08y16_54346_c1 nmdc:mga08y16_54346_c1_3090_3527 145
531 3300053077 Ga0495601_0018722 Ga0495601_0018722_356_793 145
532 3300053084 Ga0495595_0001351 Ga0495595_0001351_9015_9452 145
533 3300053177 Ga0500636_0354281 Ga0500636_0354281_151_588 145
534 3300003771 Ga0055526_1021857 Ga0055526_10218574 146
535 3300003771 Ga0055526_1043572 Ga0055526_10435722 146
536 3300005455 Ga0070663_100749797 Ga0070663_1007497971 146
537 3300005459 Ga0068867_100451852 Ga0068867_1004518521 146
538 3300005577 Ga0068857_101010887 Ga0068857_1010108872 146
539 3300006038 Ga0075365_10535332 Ga0075365_105353322 146
540 3300006051 Ga0075364_10012790 Ga0075364_100127905 146
541 3300006051 Ga0075364_10193964 Ga0075364_101939642 146
542 3300006051 Ga0075364_10479953 Ga0075364_104799532 146
543 3300006178 Ga0075367_10162825 Ga0075367_101628252 146
544 3300006353 Ga0075370_10418729 Ga0075370_104187292 146
545 3300009098 Ga0105245_11349212 Ga0105245_113492121 146
546 3300009101 Ga0105247_11190414 Ga0105247_111904141 146
547 3300009148 Ga0105243_10076539 Ga0105243_100765394 146
548 3300009545 Ga0105237_10602297 Ga0105237_106022972 146
549 3300013102 Ga0157371_10315200 Ga0157371_103152001 146
550 3300013307 Ga0157372_10172877 Ga0157372_101728773 146
551 3300014326 Ga0157380_10561856 Ga0157380_105618562 146
552 3300025261 Ga0209233_1014231 Ga0209233_10142312 146
553 3300025284 Ga0209130_1047183 Ga0209130_10471832 146
554 3300025295 Ga0209564_1000503 Ga0209564_100050359 146
555 3300025295 Ga0209564_1005251 Ga0209564_10052518 146
556 3300025923 Ga0207681_11224201 Ga0207681_112242012 146
557 3300025927 Ga0207687_10681491 Ga0207687_106814911 146
558 3300026067 Ga0207678_10008062 Ga0207678_100080625 146
559 3300028794 Ga0307515_10150467 Ga0307515_101504672 146
560 3300031995 Ga0307409_100994274 Ga0307409_1009942742 146
561 3300035118 Ga0373954_0425102 Ga0373954_0425102_197_637 146
562 3300039437 Ga0436365_0847422 Ga0436365_0847422_786_1226 146
563 3300041452 Ga0451793_0353251 Ga0451793_0353251_282_722 146
564 3300041498 Ga0451841_1340806 Ga0451841_1340806_34_474 146
565 3300042012 Ga0439455_0101697 Ga0439455_0101697_251_691 146
566 3300046460 Ga0495638_0016732 Ga0495638_0016732_60_500 146
567 3300046462 Ga0495651_0240063 Ga0495651_0240063_666_1106 146
568 3300046506 Ga0495583_0047153 Ga0495583_0047153_391_831 146
569 3300046507 Ga0495606_0106351 Ga0495606_0106351_286_726 146
570 3300046515 Ga0495620_0018112 Ga0495620_0018112_1375_1815 146
571 3300046518 Ga0495631_0037364 Ga0495631_0037364_788_1228 146
572 3300046542 Ga0495597_0057985 Ga0495597_0057985_210_650 146
573 3300046615 Ga0495656_0528793 Ga0495656_0528793_53_493 146
574 3300046616 Ga0495668_0465529 Ga0495668_0465529_48_488 146
575 3300046660 Ga0495625_0092445 Ga0495625_0092445_517_957 146
576 3300046674 Ga0495588_0021630 Ga0495588_0021630_1107_1547 146
577 3300046691 Ga0495670_0013233 Ga0495670_0013233_1944_2384 146
578 3300046692 Ga0495671_0135727 Ga0495671_0135727_729_1169 146
579 3300046809 Ga0495600_0046953 Ga0495600_0046953_1396_1836 146
580 3300047320 Ga0495672_0000894 Ga0495672_0000894_4605_5045 146
581 3300047445 Ga0495677_0144654 Ga0495677_0144654_342_782 146
582 3300047470 Ga0495681_0160804 Ga0495681_0160804_41_481 146
583 3300047472 Ga0495686_0004867 Ga0495686_0004867_8339_8779 146
584 3300048905 Ga0496102_0603491 Ga0496102_0603491_44_487 146
585 3300048919 Ga0496116_0007011 Ga0496116_0007011_8847_9287 146
586 3300048920 Ga0496117_0233888 Ga0496117_0233888_103_543 146
587 3300048920 Ga0496117_0525460 Ga0496117_0525460_71_511 146
588 3300048921 Ga0496118_0067018 Ga0496118_0067018_63_503 146
589 3300048921 Ga0496118_0129349 Ga0496118_0129349_510_950 146
590 3300048922 Ga0496119_0363954 Ga0496119_0363954_102_542 146
591 3300048923 Ga0496120_0190582 Ga0496120_0190582_524_964 146
592 3300048924 Ga0496121_0013014 Ga0496121_0013014_562_1011 146
593 3300048924 Ga0496121_0014373 Ga0496121_0014373_4042_4482 146
594 3300048925 Ga0496122_0084789 Ga0496122_0084789_1207_1647 146
595 3300048925 Ga0496122_0196896 Ga0496122_0196896_577_1017 146
596 3300048926 Ga0496123_0103219 Ga0496123_0103219_661_1101 146
597 3300048928 Ga0496125_0004699 Ga0496125_0004699_12567_13007 146
598 3300048929 Ga0496126_0373350 Ga0496126_0373350_39_479 146
599 3300049568 Ga0501031_0017619 Ga0501031_0017619_1627_2067 146
600 3300049569 Ga0501032_0000030 Ga0501032_0000030_66749_67189 146
601 3300049570 Ga0501033_0001069 Ga0501033_0001069_12992_13432 146
602 3300049571 Ga0501034_0000117 Ga0501034_0000117_22897_23337 146
603 3300049572 Ga0501036_0000033 Ga0501036_0000033_82083_82523 146
604 3300049573 Ga0501037_0000090 Ga0501037_0000090_44674_45114 146
605 3300049574 Ga0501038_0001923 Ga0501038_0001923_17206_17646 146
606 3300049575 Ga0501039_0000343 Ga0501039_0000343_19570_20010 146
607 3300049578 Ga0501042_0318617 Ga0501042_0318617_99_539 146
608 3300049579 Ga0501043_0001280 Ga0501043_0001280_11916_12356 146
609 3300049580 Ga0501046_0000078 Ga0501046_0000078_26638_27078 146
610 3300049581 Ga0501047_0001617 Ga0501047_0001617_3427_3867 146
611 3300049582 Ga0501048_0000235 Ga0501048_0000235_916_1356 146
612 3300049583 Ga0501067_0000299 Ga0501067_0000299_21067_21507 146
613 3300049584 Ga0501068_0001611 Ga0501068_0001611_1792_2232 146
614 3300049585 Ga0501069_0070531 Ga0501069_0070531_122_562 146
615 3300049586 Ga0501070_0016001 Ga0501070_0016001_5151_5591 146
616 3300049586 Ga0501070_0765201 Ga0501070_0765201_198_638 146
617 3300049587 Ga0501071_0070512 Ga0501071_0070512_1325_1765 146
618 3300049588 Ga0501072_0000414 Ga0501072_0000414_16231_16671 146
619 3300049589 Ga0501073_0000209 Ga0501073_0000209_15309_15749 146
620 3300049590 Ga0501074_0000441 Ga0501074_0000441_12244_12684 146
621 3300049741 Ga0501079_0025908 Ga0501079_0025908_1050_1490 146
622 3300049742 Ga0501080_0000567 Ga0501080_0000567_5909_6349 146
623 3300049744 Ga0501083_0002984 Ga0501083_0002984_1429_1869 146
624 3300049822 Ga0501035_0008484 Ga0501035_0008484_7919_8359 146
625 3300049823 Ga0501044_0000304 Ga0501044_0000304_38541_38981 146
626 3300049824 Ga0501045_0040887 Ga0501045_0040887_1454_1894 146
627 3300050491 nmdc:mga00v17_21925_c1 nmdc:mga00v17_21925_c1_1053_1493 146
628 3300050494 nmdc:mga06z11_77693_c1 nmdc:mga06z11_77693_c1_718_1158 146
629 3300050496 nmdc:mga07m45_306879_c1 nmdc:mga07m45_306879_c1_240_680 146
630 3300050516 nmdc:mga0sz30_54642_c1 nmdc:mga0sz30_54642_c1_56_496 146
631 3300053088 Ga0500644_0163297 Ga0500644_0163297_49_489 146
632 3300053089 Ga0500581_177134 Ga0500581_177134_391_831 146
633 3300053093 Ga0500651_0031822 Ga0500651_0031822_576_1016 146
634 3300053094 Ga0500566_0000128 Ga0500566_0000128_1263_1703 146
635 3300053095 Ga0500640_000168 Ga0500640_000168_2885_3325 146
636 3300053096 Ga0500641_0003698 Ga0500641_0003698_29_469 146
637 3300053098 Ga0500650_0009359 Ga0500650_0009359_61_501 146
638 3300053104 Ga0500556_0000045 Ga0500556_0000045_115892_116332 146
639 3300053109 Ga0500569_162679 Ga0500569_162679_270_710 146
640 3300053111 Ga0500572_000620 Ga0500572_000620_10001_10441 146
641 3300053115 Ga0500591_120068 Ga0500591_120068_305_745 146
642 3300053116 Ga0500592_000231 Ga0500592_000231_8160_8600 146
643 3300053117 Ga0500593_021146 Ga0500593_021146_560_1000 146
644 3300053118 Ga0500594_0129753 Ga0500594_0129753_37_477 146
645 3300053121 Ga0500607_099110 Ga0500607_099110_687_1127 146
646 3300053122 Ga0500608_041088 Ga0500608_041088_1284_1724 146
647 3300053123 Ga0500614_001536 Ga0500614_001536_3796_4236 146
648 3300053125 Ga0500618_118601 Ga0500618_118601_72_512 146
649 3300053130 Ga0500642_0000024 Ga0500642_0000024_119800_120240 146
650 3300053131 Ga0500652_000963 Ga0500652_000963_1067_1507 146
651 3300053134 Ga0500658_0045660 Ga0500658_0045660_59_499 146
652 3300053136 Ga0500559_0013716 Ga0500559_0013716_2932_3372 146
653 3300053139 Ga0500568_0004072 Ga0500568_0004072_5924_6364 146
654 3300053142 Ga0500577_0081679 Ga0500577_0081679_28_468 146
655 3300053145 Ga0500586_000623 Ga0500586_000623_6464_6904 146
656 3300053145 Ga0500586_040909 Ga0500586_040909_622_1062 146
657 3300053148 Ga0500590_138224 Ga0500590_138224_117_557 146
658 3300053150 Ga0500603_000356 Ga0500603_000356_1222_1662 146
659 3300053151 Ga0500604_0194807 Ga0500604_0194807_29_469 146
660 3300053153 Ga0500616_0000054 Ga0500616_0000054_127033_127473 146
661 3300053153 Ga0500616_0159686 Ga0500616_0159686_514_954 146
662 3300053156 Ga0500622_0002139 Ga0500622_0002139_681_1121 146
663 3300053158 Ga0500627_0177519 Ga0500627_0177519_351_791 146
664 3300053159 Ga0500630_025238 Ga0500630_025238_1675_2115 146
665 3300053160 Ga0500633_0013325 Ga0500633_0013325_1182_1622 146
666 3300053162 Ga0500638_039001 Ga0500638_039001_1635_2075 146
667 3300053163 Ga0500639_000125 Ga0500639_000125_8720_9160 146
668 3300053723 Ga0500567_098423 Ga0500567_098423_64_504 146
669 3300053735 Ga0500596_000129 Ga0500596_000129_1073_1513 146
670 3300053737 Ga0500601_005462 Ga0500601_005462_564_1004 146
671 3300054114 Ga0501084_0102518 Ga0501084_0102518_1603_2043 146
672 3300060353 Ga0501082_0103155 Ga0501082_0103155_1409_1849 146
673 3300001990 JGI24737J22298_10233007 JGI24737J22298_102330071 147
674 3300002077 JGI24744J21845_10007397 JGI24744J21845_100073972 147
675 3300003214 JGI25165J46597_1008424 JGI25165J46597_10084242 147
676 3300003316 rootH1_10119036 rootH1_101190363 147
677 3300003323 rootH1_10048045 rootH1_100480452 147
678 3300003659 JGI25404J52841_10008669 JGI25404J52841_100086693 147
679 3300003659 JGI25404J52841_10022087 JGI25404J52841_100220873 147
680 3300003911 JGI25405J52794_10050771 JGI25405J52794_100507711 147
681 3300005331 Ga0070670_100667212 Ga0070670_1006672122 147
682 3300005331 Ga0070670_101638856 Ga0070670_1016388561 147
683 3300005333 Ga0070677_10337662 Ga0070677_103376621 147
684 3300005334 Ga0068869_100230778 Ga0068869_1002307782 147
685 3300005334 Ga0068869_100640373 Ga0068869_1006403731 147
686 3300005337 Ga0070682_100527873 Ga0070682_1005278731 147
687 3300005339 Ga0070660_100313429 Ga0070660_1003134291 147
688 3300005344 Ga0070661_100051572 Ga0070661_1000515724 147
689 3300005344 Ga0070661_100136029 Ga0070661_1001360293 147
690 3300005344 Ga0070661_101169224 Ga0070661_1011692242 147
691 3300005347 Ga0070668_100127131 Ga0070668_1001271312 147
692 3300005347 Ga0070668_100944760 Ga0070668_1009447601 147
693 3300005347 Ga0070668_101168006 Ga0070668_1011680061 147
694 3300005353 Ga0070669_100273914 Ga0070669_1002739143 147
695 3300005353 Ga0070669_100445276 Ga0070669_1004452762 147
696 3300005354 Ga0070675_100256817 Ga0070675_1002568171 147
697 3300005355 Ga0070671_100181765 Ga0070671_1001817652 147
698 3300005356 Ga0070674_100042736 Ga0070674_1000427363 147
699 3300005356 Ga0070674_100307190 Ga0070674_1003071901 147
700 3300005356 Ga0070674_100786466 Ga0070674_1007864661 147
701 3300005364 Ga0070673_100389150 Ga0070673_1003891502 147
702 3300005364 Ga0070673_101423418 Ga0070673_1014234181 147
703 3300005366 Ga0070659_100438157 Ga0070659_1004381572 147
704 3300005367 Ga0070667_100133126 Ga0070667_1001331262 147
705 3300005367 Ga0070667_100291043 Ga0070667_1002910432 147
706 3300005434 Ga0070709_10148888 Ga0070709_101488881 147
707 3300005435 Ga0070714_100291413 Ga0070714_1002914132 147
708 3300005435 Ga0070714_101018577 Ga0070714_1010185772 147
709 3300005437 Ga0070710_10089252 Ga0070710_100892523 147
710 3300005439 Ga0070711_100682161 Ga0070711_1006821611 147
711 3300005440 Ga0070705_100222254 Ga0070705_1002222543 147
712 3300005440 Ga0070705_100332163 Ga0070705_1003321632 147
713 3300005441 Ga0070700_100085097 Ga0070700_1000850973 147
714 3300005445 Ga0070708_100493791 Ga0070708_1004937912 147
715 3300005455 Ga0070663_100331498 Ga0070663_1003314983 147
716 3300005455 Ga0070663_100503118 Ga0070663_1005031181 147
717 3300005455 Ga0070663_100889621 Ga0070663_1008896212 147
718 3300005456 Ga0070678_100060737 Ga0070678_1000607372 147
719 3300005456 Ga0070678_100102017 Ga0070678_1001020172 147
720 3300005456 Ga0070678_100339844 Ga0070678_1003398442 147
721 3300005456 Ga0070678_100777996 Ga0070678_1007779961 147
722 3300005457 Ga0070662_100083587 Ga0070662_1000835873 147
723 3300005457 Ga0070662_100086125 Ga0070662_1000861252 147
724 3300005457 Ga0070662_100320052 Ga0070662_1003200521 147
725 3300005459 Ga0068867_100069826 Ga0068867_1000698263 147
726 3300005467 Ga0070706_100732196 Ga0070706_1007321961 147
727 3300005468 Ga0070707_100272741 Ga0070707_1002727412 147
728 3300005471 Ga0070698_100120374 Ga0070698_1001203744 147
729 3300005471 Ga0070698_100379831 Ga0070698_1003798312 147
730 3300005518 Ga0070699_101068137 Ga0070699_1010681372 147
731 3300005518 Ga0070699_101214952 Ga0070699_1012149521 147
732 3300005535 Ga0070684_101303597 Ga0070684_1013035972 147
733 3300005536 Ga0070697_100440006 Ga0070697_1004400062 147
734 3300005539 Ga0068853_100505327 Ga0068853_1005053272 147
735 3300005543 Ga0070672_100256276 Ga0070672_1002562762 147
736 3300005543 Ga0070672_100520352 Ga0070672_1005203521 147
737 3300005544 Ga0070686_100071730 Ga0070686_1000717303 147
738 3300005545 Ga0070695_100188946 Ga0070695_1001889461 147
739 3300005546 Ga0070696_100268954 Ga0070696_1002689541 147
740 3300005547 Ga0070693_100327370 Ga0070693_1003273702 147
741 3300005547 Ga0070693_100553612 Ga0070693_1005536121 147
742 3300005547 Ga0070693_101417298 Ga0070693_1014172981 147
743 3300005548 Ga0070665_100049060 Ga0070665_1000490605 147
744 3300005548 Ga0070665_100114119 Ga0070665_1001141192 147
745 3300005548 Ga0070665_100277859 Ga0070665_1002778593 147
746 3300005548 Ga0070665_100315826 Ga0070665_1003158262 147
747 3300005548 Ga0070665_100573234 Ga0070665_1005732342 147
748 3300005548 Ga0070665_100789458 Ga0070665_1007894582 147
749 3300005548 Ga0070665_100942965 Ga0070665_1009429652 147
750 3300005548 Ga0070665_101669511 Ga0070665_1016695112 147
751 3300005549 Ga0070704_100521162 Ga0070704_1005211621 147
752 3300005577 Ga0068857_100401487 Ga0068857_1004014871 147
753 3300005578 Ga0068854_100026148 Ga0068854_1000261483 147
754 3300005578 Ga0068854_100195888 Ga0068854_1001958883 147
755 3300005614 Ga0068856_100165022 Ga0068856_1001650221 147
756 3300005614 Ga0068856_101958720 Ga0068856_1019587201 147
757 3300005615 Ga0070702_100900522 Ga0070702_1009005221 147
758 3300005616 Ga0068852_100034471 Ga0068852_1000344714 147
759 3300005616 Ga0068852_100074065 Ga0068852_1000740652 147
760 3300005617 Ga0068859_101146714 Ga0068859_1011467142 147
761 3300005618 Ga0068864_100094099 Ga0068864_1000940995 147
762 3300005718 Ga0068866_10236400 Ga0068866_102364002 147
763 3300005718 Ga0068866_10477385 Ga0068866_104773852 147
764 3300005719 Ga0068861_100017186 Ga0068861_1000171863 147
765 3300005719 Ga0068861_100419799 Ga0068861_1004197992 147
766 3300005719 Ga0068861_100662571 Ga0068861_1006625711 147
767 3300005834 Ga0068851_10861708 Ga0068851_108617081 147
768 3300005841 Ga0068863_100157574 Ga0068863_1001575744 147
769 3300005842 Ga0068858_100647765 Ga0068858_1006477652 147
770 3300005843 Ga0068860_100217289 Ga0068860_1002172892 147
771 3300005843 Ga0068860_100836871 Ga0068860_1008368712 147
772 3300005844 Ga0068862_100063134 Ga0068862_1000631344 147
773 3300005844 Ga0068862_100212949 Ga0068862_1002129492 147
774 3300005844 Ga0068862_100520789 Ga0068862_1005207891 147
775 3300005937 Ga0081455_10000875 Ga0081455_1000087527 147
776 3300005937 Ga0081455_10011544 Ga0081455_100115443 147
777 3300005937 Ga0081455_10028504 Ga0081455_100285047 147
778 3300005983 Ga0081540_1001143 Ga0081540_100114318 147
779 3300005983 Ga0081540_1002776 Ga0081540_100277620 147
780 3300005983 Ga0081540_1003496 Ga0081540_100349614 147
781 3300005983 Ga0081540_1004605 Ga0081540_10046058 147
782 3300005983 Ga0081540_1065648 Ga0081540_10656481 147
783 3300005983 Ga0081540_1144836 Ga0081540_11448363 147
784 3300005985 Ga0081539_10040265 Ga0081539_100402653 147
785 3300005985 Ga0081539_10042367 Ga0081539_100423674 147
786 3300005985 Ga0081539_10077341 Ga0081539_100773413 147
787 3300006038 Ga0075365_10043535 Ga0075365_100435353 147
788 3300006038 Ga0075365_10045372 Ga0075365_100453722 147
789 3300006038 Ga0075365_10095901 Ga0075365_100959012 147
790 3300006042 Ga0075368_10019828 Ga0075368_100198283 147
791 3300006048 Ga0075363_100143329 Ga0075363_1001433291 147
792 3300006048 Ga0075363_100553158 Ga0075363_1005531581 147
793 3300006048 Ga0075363_100563305 Ga0075363_1005633052 147
794 3300006051 Ga0075364_10039069 Ga0075364_100390694 147
795 3300006058 Ga0075432_10082761 Ga0075432_100827612 147
796 3300006175 Ga0070712_100208218 Ga0070712_1002082181 147
797 3300006175 Ga0070712_100431807 Ga0070712_1004318072 147
798 3300006178 Ga0075367_10019217 Ga0075367_100192174 147
799 3300006178 Ga0075367_10039371 Ga0075367_100393712 147
800 3300006178 Ga0075367_10186347 Ga0075367_101863472 147
801 3300006178 Ga0075367_10198704 Ga0075367_101987042 147
802 3300006178 Ga0075367_10358635 Ga0075367_103586352 147
803 3300006186 Ga0075369_10165435 Ga0075369_101654351 147
804 3300006195 Ga0075366_10086400 Ga0075366_100864002 147
805 3300006353 Ga0075370_10010951 Ga0075370_100109512 147
806 3300006353 Ga0075370_10044788 Ga0075370_100447883 147
807 3300006353 Ga0075370_10143884 Ga0075370_101438842 147
808 3300006353 Ga0075370_10227859 Ga0075370_102278592 147
809 3300006353 Ga0075370_10535284 Ga0075370_105352842 147
810 3300006358 Ga0068871_100136505 Ga0068871_1001365052 147
811 3300006844 Ga0075428_101672102 Ga0075428_1016721022 147
812 3300006871 Ga0075434_100198912 Ga0075434_1001989121 147
813 3300006881 Ga0068865_100123706 Ga0068865_1001237063 147
814 3300006881 Ga0068865_100169452 Ga0068865_1001694523 147
815 3300006914 Ga0075436_100484045 Ga0075436_1004840452 147
816 3300006931 Ga0097620_101146701 Ga0097620_1011467011 147
817 3300006942 Ga0099824_1011838 Ga0099824_101183810 147
818 3300006943 Ga0099822_1001134 Ga0099822_10011345 147
819 3300009098 Ga0105245_10096991 Ga0105245_100969913 147
820 3300009098 Ga0105245_10306867 Ga0105245_103068672 147
821 3300009147 Ga0114129_11746886 Ga0114129_117468862 147
822 3300009148 Ga0105243_10322460 Ga0105243_103224603 147
823 3300009148 Ga0105243_10794006 Ga0105243_107940061 147
824 3300009174 Ga0105241_10751603 Ga0105241_107516031 147
825 3300009176 Ga0105242_10117957 Ga0105242_101179572 147
826 3300009177 Ga0105248_10056731 Ga0105248_100567312 147
827 3300009177 Ga0105248_10487616 Ga0105248_104876162 147
828 3300009177 Ga0105248_11093456 Ga0105248_110934562 147
829 3300009545 Ga0105237_11405722 Ga0105237_114057222 147
830 3300009551 Ga0105238_10384696 Ga0105238_103846962 147
831 3300010375 Ga0105239_10162787 Ga0105239_101627872 147
832 3300010375 Ga0105239_10298263 Ga0105239_102982633 147
833 3300011119 Ga0105246_10015450 Ga0105246_100154506 147
834 3300011119 Ga0105246_10114754 Ga0105246_101147542 147
835 3300012481 Ga0157320_1019468 Ga0157320_10194681 147
836 3300012488 Ga0157343_1001969 Ga0157343_10019692 147
837 3300013100 Ga0157373_10322265 Ga0157373_103222652 147
838 3300013105 Ga0157369_10148152 Ga0157369_101481521 147
839 3300013296 Ga0157374_10646477 Ga0157374_106464771 147
840 3300013296 Ga0157374_11377052 Ga0157374_113770521 147
841 3300013297 Ga0157378_10533822 Ga0157378_105338222 147
842 3300013306 Ga0163162_10011437 Ga0163162_1001143711 147
843 3300013306 Ga0163162_10642947 Ga0163162_106429472 147
844 3300013308 Ga0157375_10136992 Ga0157375_101369922 147
845 3300014325 Ga0163163_10483232 Ga0163163_104832322 147
846 3300014325 Ga0163163_11002986 Ga0163163_110029862 147
847 3300014325 Ga0163163_11640623 Ga0163163_116406232 147
848 3300014326 Ga0157380_11152948 Ga0157380_111529482 147
849 3300014497 Ga0182008_10286369 Ga0182008_102863692 147
850 3300014745 Ga0157377_10095417 Ga0157377_100954173 147
851 3300014745 Ga0157377_10408514 Ga0157377_104085142 147
852 3300014968 Ga0157379_10091450 Ga0157379_100914503 147
853 3300014968 Ga0157379_10194278 Ga0157379_101942782 147
854 3300014968 Ga0157379_11160540 Ga0157379_111605401 147
855 3300014969 Ga0157376_11714591 Ga0157376_117145911 147
856 3300017792 Ga0163161_10415592 Ga0163161_104155922 147
857 3300017792 Ga0163161_10465117 Ga0163161_104651172 147
858 3300021377 Ga0213874_10071243 Ga0213874_100712431 147
859 3300025261 Ga0209233_1010989 Ga0209233_10109892 147
860 3300025297 Ga0209758_1014122 Ga0209758_10141223 147
861 3300025901 Ga0207688_10376705 Ga0207688_103767052 147
862 3300025903 Ga0207680_10420424 Ga0207680_104204242 147
863 3300025905 Ga0207685_10061554 Ga0207685_100615541 147
864 3300025905 Ga0207685_10091468 Ga0207685_100914683 147
865 3300025906 Ga0207699_10007971 Ga0207699_100079713 147
866 3300025907 Ga0207645_10111250 Ga0207645_101112503 147
867 3300025907 Ga0207645_10230001 Ga0207645_102300013 147
868 3300025909 Ga0207705_10107411 Ga0207705_101074112 147
869 3300025909 Ga0207705_10336965 Ga0207705_103369652 147
870 3300025911 Ga0207654_10003986 Ga0207654_100039869 147
871 3300025914 Ga0207671_10161433 Ga0207671_101614332 147
872 3300025915 Ga0207693_10017732 Ga0207693_100177327 147
873 3300025915 Ga0207693_10071814 Ga0207693_100718145 147
874 3300025915 Ga0207693_10224131 Ga0207693_102241313 147
875 3300025916 Ga0207663_10098660 Ga0207663_100986602 147
876 3300025918 Ga0207662_10053614 Ga0207662_100536144 147
877 3300025919 Ga0207657_10108856 Ga0207657_101088562 147
878 3300025919 Ga0207657_10144087 Ga0207657_101440873 147
879 3300025922 Ga0207646_10654392 Ga0207646_106543921 147
880 3300025923 Ga0207681_10221169 Ga0207681_102211692 147
881 3300025923 Ga0207681_10468987 Ga0207681_104689872 147
882 3300025925 Ga0207650_10224192 Ga0207650_102241922 147
883 3300025927 Ga0207687_10072669 Ga0207687_100726692 147
884 3300025927 Ga0207687_10156541 Ga0207687_101565412 147
885 3300025933 Ga0207706_10140389 Ga0207706_101403893 147
886 3300025933 Ga0207706_10211712 Ga0207706_102117123 147
887 3300025934 Ga0207686_10243384 Ga0207686_102433842 147
888 3300025935 Ga0207709_10538518 Ga0207709_105385182 147
889 3300025937 Ga0207669_10461817 Ga0207669_104618171 147
890 3300025938 Ga0207704_10235996 Ga0207704_102359962 147
891 3300025938 Ga0207704_10590247 Ga0207704_105902472 147
892 3300025940 Ga0207691_10112935 Ga0207691_101129352 147
893 3300025940 Ga0207691_10382807 Ga0207691_103828071 147
894 3300025941 Ga0207711_10132016 Ga0207711_101320163 147
895 3300025941 Ga0207711_10141498 Ga0207711_101414982 147
896 3300025942 Ga0207689_10188832 Ga0207689_101888322 147
897 3300025945 Ga0207679_10830824 Ga0207679_108308241 147
898 3300025949 Ga0207667_10398955 Ga0207667_103989552 147
899 3300025960 Ga0207651_10437235 Ga0207651_104372352 147
900 3300025960 Ga0207651_11462327 Ga0207651_114623271 147
901 3300025972 Ga0207668_10093773 Ga0207668_100937732 147
902 3300025972 Ga0207668_10100667 Ga0207668_101006672 147
903 3300025972 Ga0207668_11587980 Ga0207668_115879801 147
904 3300025981 Ga0207640_10123664 Ga0207640_101236642 147
905 3300025986 Ga0207658_10068710 Ga0207658_100687102 147
906 3300025986 Ga0207658_10417121 Ga0207658_104171212 147
907 3300025986 Ga0207658_10708564 Ga0207658_107085642 147
908 3300026023 Ga0207677_10009584 Ga0207677_100095849 147
909 3300026023 Ga0207677_10502184 Ga0207677_105021842 147
910 3300026035 Ga0207703_10198335 Ga0207703_101983353 147
911 3300026041 Ga0207639_10187856 Ga0207639_101878563 147
912 3300026067 Ga0207678_10091019 Ga0207678_100910193 147
913 3300026067 Ga0207678_10145389 Ga0207678_101453892 147
914 3300026067 Ga0207678_10311791 Ga0207678_103117912 147
915 3300026075 Ga0207708_10070207 Ga0207708_100702072 147
916 3300026075 Ga0207708_10172260 Ga0207708_101722602 147
917 3300026078 Ga0207702_10888642 Ga0207702_108886421 147
918 3300026088 Ga0207641_10370945 Ga0207641_103709452 147
919 3300026089 Ga0207648_10515576 Ga0207648_105155763 147
920 3300026116 Ga0207674_11349153 Ga0207674_113491532 147
921 3300026118 Ga0207675_100023943 Ga0207675_1000239432 147
922 3300026118 Ga0207675_100301927 Ga0207675_1003019272 147
923 3300026121 Ga0207683_10129878 Ga0207683_101298783 147
924 3300026121 Ga0207683_10142278 Ga0207683_101422782 147
925 3300026121 Ga0207683_10836774 Ga0207683_108367741 147
926 3300026142 Ga0207698_10022118 Ga0207698_100221182 147
927 3300026142 Ga0207698_10319619 Ga0207698_103196192 147
928 3300026142 Ga0207698_10673861 Ga0207698_106738612 147
929 3300027357 Ga0209589_1000014 Ga0209589_1000014128 147
930 3300027361 Ga0209489_100014 Ga0209489_100014128 147
931 3300027363 Ga0209700_100024 Ga0209700_100024128 147
932 3300027866 Ga0209813_10100369 Ga0209813_101003692 147
933 3300028379 Ga0268266_10002572 Ga0268266_1000257217 147
934 3300028379 Ga0268266_10016539 Ga0268266_100165393 147
935 3300028379 Ga0268266_10524305 Ga0268266_105243052 147
936 3300028379 Ga0268266_10939677 Ga0268266_109396772 147
937 3300028381 Ga0268264_10381065 Ga0268264_103810652 147
938 3300028573 Ga0265334_10033792 Ga0265334_100337922 147
939 3300028786 Ga0307517_10328433 Ga0307517_103284331 147
940 3300028794 Ga0307515_10514596 Ga0307515_105145962 147
941 3300031238 Ga0265332_10038362 Ga0265332_100383623 147
942 3300031242 Ga0265329_10202263 Ga0265329_102022631 147
943 3300031507 Ga0307509_10022374 Ga0307509_1002237410 147
944 3300031548 Ga0307408_100688655 Ga0307408_1006886552 147
945 3300031548 Ga0307408_100798699 Ga0307408_1007986992 147
946 3300031730 Ga0307516_10338700 Ga0307516_103387001 147
947 3300031730 Ga0307516_10558769 Ga0307516_105587692 147
948 3300031995 Ga0307409_100353766 Ga0307409_1003537664 147
949 3300031995 Ga0307409_100534399 Ga0307409_1005343992 147
950 3300032004 Ga0307414_10177646 Ga0307414_101776462 147
951 3300032005 Ga0307411_11338587 Ga0307411_113385871 147
952 3300032005 Ga0307411_11484487 Ga0307411_114844872 147
953 3300033179 Ga0307507_10284262 Ga0307507_102842622 147
954 3300033180 Ga0307510_10020603 Ga0307510_100206035 147
955 3300033442 Ga0315911_1000002 Ga0315911_1000002210 147
956 3300035089 Ga0373944_0114222 Ga0373944_0114222_82_528 147
957 3300035113 Ga0373936_0027174 Ga0373936_0027174_609_1055 147
958 3300035113 Ga0373936_0489572 Ga0373936_0489572_14_457 147
959 3300035116 Ga0373945_0008608 Ga0373945_0008608_188_634 147
960 3300035116 Ga0373945_0074838 Ga0373945_0074838_177_650 147
961 3300035170 Ga0373943_0008018 Ga0373943_0008018_2087_2533 147
962 3300035172 Ga0373955_0146440 Ga0373955_0146440_510_956 147
963 3300035410 Ga0373924_0009724 Ga0373924_0009724_2049_2495 147
964 3300035692 Ga0373935_0002921 Ga0373935_0002921_1364_1810 147
965 3300035692 Ga0373935_0256586 Ga0373935_0256586_457_930 147
966 3300035695 Ga0373927_0006216 Ga0373927_0006216_4891_5337 147
967 3300035695 Ga0373927_0008327 Ga0373927_0008327_3679_4152 147
968 3300035695 Ga0373927_0401527 Ga0373927_0401527_137_586 147
969 3300035725 Ga0373947_0009619 Ga0373947_0009619_5020_5466 147
970 3300035725 Ga0373947_0039668 Ga0373947_0039668_662_1135 147
971 3300037068 Ga0373925_0014356 Ga0373925_0014356_5202_5648 147
972 3300037068 Ga0373925_0548489 Ga0373925_0548489_280_732 147
973 3300037471 Ga0395905_0281840 Ga0395905_0281840_396_845 147
974 3300037471 Ga0395905_0327977 Ga0395905_0327977_461_910 147
975 3300037471 Ga0395905_1560150 Ga0395905_1560150_47_496 147
976 3300039437 Ga0436365_1875539 Ga0436365_1875539_171_617 147
977 3300039450 Ga0436363_0502738 Ga0436363_0502738_69_512 147
978 3300041413 Ga0439465_0122313 Ga0439465_0122313_423_872 147
979 3300041443 Ga0451789_0740288 Ga0451789_0740288_712_1161 147
980 3300041452 Ga0451793_0743023 Ga0451793_0743023_55_504 147
981 3300041459 Ga0451800_0174695 Ga0451800_0174695_112_558 147
982 3300041494 Ga0451837_0207973 Ga0451837_0207973_170_619 147
983 3300041997 Ga0439431_0037586 Ga0439431_0037586_695_1141 147
984 3300044694 Ga0466963_0067977 Ga0466963_0067977_1755_2201 147
985 3300045051 Ga0451576_0746588 Ga0451576_0746588_274_723 147
986 3300046452 Ga0495617_083401 Ga0495617_083401_418_867 147
987 3300046455 Ga0495603_0000923 Ga0495603_0000923_136_582 147
988 3300046455 Ga0495603_0008897 Ga0495603_0008897_3085_3558 147
989 3300046455 Ga0495603_0029126 Ga0495603_0029126_1162_1611 147
990 3300046457 Ga0495590_0203895 Ga0495590_0203895_47_496 147
991 3300046458 Ga0495591_061776 Ga0495591_061776_198_647 147
992 3300046459 Ga0495629_0002400 Ga0495629_0002400_10156_10602 147
993 3300046460 Ga0495638_0137440 Ga0495638_0137440_596_1045 147
994 3300046461 Ga0495641_0005021 Ga0495641_0005021_7985_8431 147
995 3300046471 Ga0495650_0070150 Ga0495650_0070150_722_1171 147
996 3300046472 Ga0495580_0008695 Ga0495580_0008695_4156_4602 147
997 3300046473 Ga0495582_0000283 Ga0495582_0000283_10882_11328 147
998 3300046473 Ga0495582_0345117 Ga0495582_0345117_398_847 147
999 3300046474 Ga0495605_0126586 Ga0495605_0126586_415_864 147
1000 3300046475 Ga0495639_0000947 Ga0495639_0000947_11662_12108 147
1001 3300046475 Ga0495639_0044326 Ga0495639_0044326_827_1300 147
1002 3300046475 Ga0495639_0183009 Ga0495639_0183009_229_678 147
1003 3300046476 Ga0495662_0001975 Ga0495662_0001975_3683_4129 147
1004 3300046476 Ga0495662_0236757 Ga0495662_0236757_136_588 147
1005 3300046477 Ga0495664_0014799 Ga0495664_0014799_2121_2567 147
1006 3300046492 Ga0495585_0156841 Ga0495585_0156841_681_1130 147
1007 3300046499 Ga0495594_0000509 Ga0495594_0000509_5843_6289 147
1008 3300046499 Ga0495594_0038494 Ga0495594_0038494_155_604 147
1009 3300046499 Ga0495594_0413967 Ga0495594_0413967_145_594 147
1010 3300046500 Ga0495596_0152786 Ga0495596_0152786_412_861 147
1011 3300046500 Ga0495596_0394139 Ga0495596_0394139_51_500 147
1012 3300046501 Ga0495607_0529310 Ga0495607_0529310_17_466 147
1013 3300046507 Ga0495606_0377530 Ga0495606_0377530_56_505 147
1014 3300046507 Ga0495606_0397170 Ga0495606_0397170_245_697 147
1015 3300046516 Ga0495628_0008185 Ga0495628_0008185_7160_7606 147
1016 3300046517 Ga0495630_0007704 Ga0495630_0007704_7129_7575 147
1017 3300046518 Ga0495631_0080510 Ga0495631_0080510_11_460 147
1018 3300046518 Ga0495631_0275632 Ga0495631_0275632_238_687 147
1019 3300046519 Ga0495632_0102600 Ga0495632_0102600_135_584 147
1020 3300046519 Ga0495632_0347077 Ga0495632_0347077_186_635 147
1021 3300046523 Ga0495644_0061172 Ga0495644_0061172_592_1041 147
1022 3300046523 Ga0495644_0161790 Ga0495644_0161790_317_766 147
1023 3300046524 Ga0495648_0127691 Ga0495648_0127691_222_671 147
1024 3300046526 Ga0495666_0165013 Ga0495666_0165013_227_700 147
1025 3300046529 Ga0495652_0149151 Ga0495652_0149151_1236_1682 147
1026 3300046531 Ga0495665_0000145 Ga0495665_0000145_13850_14296 147
1027 3300046533 Ga0495640_0018916 Ga0495640_0018916_2417_2863 147
1028 3300046537 Ga0495598_0025225 Ga0495598_0025225_526_975 147
1029 3300046539 Ga0495621_0074838 Ga0495621_0074838_659_1108 147
1030 3300046557 Ga0495622_0035544 Ga0495622_0035544_1215_1664 147
1031 3300046557 Ga0495622_0111847 Ga0495622_0111847_434_880 147
1032 3300046558 Ga0495633_0140540 Ga0495633_0140540_262_711 147
1033 3300046558 Ga0495633_0178699 Ga0495633_0178699_287_736 147
1034 3300046615 Ga0495656_0029999 Ga0495656_0029999_785_1234 147
1035 3300046616 Ga0495668_0029125 Ga0495668_0029125_928_1377 147
1036 3300046616 Ga0495668_0097747 Ga0495668_0097747_482_931 147
1037 3300046642 Ga0495634_0001108 Ga0495634_0001108_135_581 147
1038 3300046660 Ga0495625_0420253 Ga0495625_0420253_199_648 147
1039 3300046663 Ga0495635_0043801 Ga0495635_0043801_188_634 147
1040 3300046664 Ga0495659_0063340 Ga0495659_0063340_356_805 147
1041 3300046674 Ga0495588_0029555 Ga0495588_0029555_2170_2616 147
1042 3300046674 Ga0495588_0224003 Ga0495588_0224003_395_844 147
1043 3300046680 Ga0495646_0093632 Ga0495646_0093632_158_604 147
1044 3300046681 Ga0495647_0001082 Ga0495647_0001082_2645_3091 147
1045 3300046683 Ga0495658_0000547 Ga0495658_0000547_6255_6701 147
1046 3300046683 Ga0495658_0948278 Ga0495658_0948278_22_471 147
1047 3300046684 Ga0495669_0204882 Ga0495669_0204882_225_674 147
1048 3300046689 Ga0495613_0002250 Ga0495613_0002250_10449_10895 147
1049 3300046690 Ga0495624_0005060 Ga0495624_0005060_1050_1496 147
1050 3300046692 Ga0495671_0175425 Ga0495671_0175425_210_659 147
1051 3300046694 Ga0495649_0324637 Ga0495649_0324637_128_574 147
1052 3300046794 Ga0495589_0073693 Ga0495589_0073693_807_1250 147
1053 3300047315 Ga0495581_0000529 Ga0495581_0000529_2715_3161 147
1054 3300047315 Ga0495581_0338982 Ga0495581_0338982_91_540 147
1055 3300047315 Ga0495581_0487189 Ga0495581_0487189_170_619 147
1056 3300047315 Ga0495581_0821646 Ga0495581_0821646_74_523 147
1057 3300047317 Ga0495604_0508708 Ga0495604_0508708_280_726 147
1058 3300047318 Ga0495636_0082983 Ga0495636_0082983_266_715 147
1059 3300047319 Ga0495674_0016431 Ga0495674_0016431_5980_6426 147
1060 3300047320 Ga0495672_0054549 Ga0495672_0054549_786_1238 147
1061 3300047321 Ga0495676_0017967 Ga0495676_0017967_3103_3549 147
1062 3300047322 Ga0495680_0131585 Ga0495680_0131585_111_605 147
1063 3300047323 Ga0495683_0163836 Ga0495683_0163836_406_855 147
1064 3300047323 Ga0495683_0339548 Ga0495683_0339548_31_480 147
1065 3300047445 Ga0495677_0027527 Ga0495677_0027527_356_799 147
1066 3300047447 Ga0495685_085656 Ga0495685_085656_226_675 147
1067 3300047469 Ga0495673_0104083 Ga0495673_0104083_379_828 147
1068 3300047471 Ga0495684_0343619 Ga0495684_0343619_461_907 147
1069 3300047472 Ga0495686_0420027 Ga0495686_0420027_28_477 147
1070 3300047673 Ga0495593_0000877 Ga0495593_0000877_10755_11201 147
1071 3300048090 Ga0495615_0047371 Ga0495615_0047371_617_1066 147
1072 3300048090 Ga0495615_0125972 Ga0495615_0125972_41_484 147
1073 3300048091 Ga0495626_0045400 Ga0495626_0045400_1487_1933 147
1074 3300048903 Ga0496100_0190172 Ga0496100_0190172_709_1167 147
1075 3300048903 Ga0496100_0406092 Ga0496100_0406092_571_1014 147
1076 3300048904 Ga0496101_1305519 Ga0496101_1305519_28_471 147
1077 3300048905 Ga0496102_0274253 Ga0496102_0274253_850_1299 147
1078 3300048905 Ga0496102_0716835 Ga0496102_0716835_295_744 147
1079 3300048907 Ga0496104_0237039 Ga0496104_0237039_1055_1498 147
1080 3300048908 Ga0496105_0321703 Ga0496105_0321703_637_1080 147
1081 3300048909 Ga0496106_0499129 Ga0496106_0499129_449_892 147
1082 3300048910 Ga0496107_0135503 Ga0496107_0135503_859_1308 147
1083 3300048912 Ga0496109_0232105 Ga0496109_0232105_525_974 147
1084 3300048913 Ga0496110_0334689 Ga0496110_0334689_835_1287 147
1085 3300048913 Ga0496110_0383326 Ga0496110_0383326_62_511 147
1086 3300048913 Ga0496110_1206726 Ga0496110_1206726_55_513 147
1087 3300048915 Ga0496112_0360407 Ga0496112_0360407_465_914 147
1088 3300048918 Ga0496115_0108177 Ga0496115_0108177_1447_1890 147
1089 3300048919 Ga0496116_0250958 Ga0496116_0250958_378_827 147
1090 3300048920 Ga0496117_0413288 Ga0496117_0413288_162_611 147
1091 3300048924 Ga0496121_0091052 Ga0496121_0091052_799_1245 147
1092 3300048924 Ga0496121_0182304 Ga0496121_0182304_506_958 147
1093 3300048924 Ga0496121_0339226 Ga0496121_0339226_152_604 147
1094 3300048924 Ga0496121_0388225 Ga0496121_0388225_95_541 147
1095 3300048927 Ga0496124_0201315 Ga0496124_0201315_944_1390 147
1096 3300048927 Ga0496124_0218488 Ga0496124_0218488_863_1312 147
1097 3300048929 Ga0496126_0020218 Ga0496126_0020218_3020_3478 147
1098 3300048929 Ga0496126_0075786 Ga0496126_0075786_1476_1925 147
1099 3300049459 Ga0495678_135871 Ga0495678_135871_79_528 147
1100 3300049460 Ga0495682_0039370 Ga0495682_0039370_496_945 147
1101 3300049576 Ga0501040_1343336 Ga0501040_1343336_50_499 147
1102 3300049580 Ga0501046_0589643 Ga0501046_0589643_139_588 147
1103 3300049583 Ga0501067_0015314 Ga0501067_0015314_1165_1614 147
1104 3300049585 Ga0501069_0198636 Ga0501069_0198636_415_864 147
1105 3300049586 Ga0501070_0042040 Ga0501070_0042040_732_1181 147
1106 3300049592 Ga0501076_0531103 Ga0501076_0531103_317_766 147
1107 3300049822 Ga0501035_0302631 Ga0501035_0302631_308_757 147
1108 3300050489 nmdc:mga03683_37660_c1 nmdc:mga03683_37660_c1_865_1314 147
1109 3300050490 nmdc:mga03n38_23610_c1 nmdc:mga03n38_23610_c1_784_1227 147
1110 3300050490 nmdc:mga03n38_2731_c1 nmdc:mga03n38_2731_c1_2793_3239 147
1111 3300050490 nmdc:mga03n38_345885_c1 nmdc:mga03n38_345885_c1_260_706 147
1112 3300050490 nmdc:mga03n38_492990_c1 nmdc:mga03n38_492990_c1_178_627 147
1113 3300050491 nmdc:mga00v17_355299_c1 nmdc:mga00v17_355299_c1_250_699 147
1114 3300050492 nmdc:mga0yw44_1075814_c1 nmdc:mga0yw44_1075814_c1_19_468 147
1115 3300050492 nmdc:mga0yw44_591053_c1 nmdc:mga0yw44_591053_c1_21_470 147
1116 3300050492 nmdc:mga0yw44_610427_c1 nmdc:mga0yw44_610427_c1_191_640 147
1117 3300050493 nmdc:mga0k408_131452_c1 nmdc:mga0k408_131452_c1_989_1432 147
1118 3300050493 nmdc:mga0k408_157311_c1 nmdc:mga0k408_157311_c1_186_635 147
1119 3300050493 nmdc:mga0k408_290290_c1 nmdc:mga0k408_290290_c1_29_475 147
1120 3300050494 nmdc:mga06z11_210473_c1 nmdc:mga06z11_210473_c1_645_1094 147
1121 3300050494 nmdc:mga06z11_755090_c1 nmdc:mga06z11_755090_c1_40_483 147
1122 3300050494 nmdc:mga06z11_7845_c1 nmdc:mga06z11_7845_c1_283_729 147
1123 3300050495 nmdc:mga04h51_14733_c1 nmdc:mga04h51_14733_c1_293_739 147
1124 3300050496 nmdc:mga07m45_10213_c1 nmdc:mga07m45_10213_c1_3350_3793 147
1125 3300050496 nmdc:mga07m45_260018_c1 nmdc:mga07m45_260018_c1_359_805 147
1126 3300050496 nmdc:mga07m45_466221_c1 nmdc:mga07m45_466221_c1_138_587 147
1127 3300050512 nmdc:mga0n895_218891_c1 nmdc:mga0n895_218891_c1_1270_1719 147
1128 3300050513 nmdc:mga0rr50_472846_c1 nmdc:mga0rr50_472846_c1_188_637 147
1129 3300050516 nmdc:mga0sz30_40347_c1 nmdc:mga0sz30_40347_c1_944_1387 147
1130 3300050516 nmdc:mga0sz30_420904_c1 nmdc:mga0sz30_420904_c1_86_535 147
1131 3300053078 Ga0495612_0070130 Ga0495612_0070130_147_596 147
1132 3300053079 Ga0500610_0277187 Ga0500610_0277187_117_566 147
1133 3300053083 Ga0495655_0019706 Ga0495655_0019706_751_1197 147
1134 3300053083 Ga0495655_0066392 Ga0495655_0066392_319_768 147
1135 3300053086 Ga0500578_0237796 Ga0500578_0237796_369_818 147
1136 3300053088 Ga0500644_0316851 Ga0500644_0316851_96_545 147
1137 3300053093 Ga0500651_0012461 Ga0500651_0012461_1883_2329 147
1138 3300053093 Ga0500651_0161567 Ga0500651_0161567_420_869 147
1139 3300053094 Ga0500566_0003981 Ga0500566_0003981_4669_5115 147
1140 3300053096 Ga0500641_0013736 Ga0500641_0013736_2206_2649 147
1141 3300053102 Ga0500554_315860 Ga0500554_315860_22_468 147
1142 3300053103 Ga0500555_039621 Ga0500555_039621_529_978 147
1143 3300053104 Ga0500556_0250891 Ga0500556_0250891_35_484 147
1144 3300053119 Ga0500595_021448 Ga0500595_021448_812_1261 147
1145 3300053124 Ga0500617_138974 Ga0500617_138974_487_936 147
1146 3300053125 Ga0500618_002192 Ga0500618_002192_7152_7598 147
1147 3300053127 Ga0500623_258140 Ga0500623_258140_34_483 147
1148 3300053134 Ga0500658_0214615 Ga0500658_0214615_224_673 147
1149 3300053136 Ga0500559_0000051 Ga0500559_0000051_63340_63786 147
1150 3300053143 Ga0500579_127333 Ga0500579_127333_210_659 147
1151 3300053148 Ga0500590_025192 Ga0500590_025192_603_1049 147
1152 3300053148 Ga0500590_133908 Ga0500590_133908_671_1120 147
1153 3300053157 Ga0500624_011437 Ga0500624_011437_834_1280 147
1154 3300053161 Ga0500634_0184765 Ga0500634_0184765_196_645 147
1155 3300053162 Ga0500638_063626 Ga0500638_063626_1117_1566 147
1156 3300053177 Ga0500636_0000249 Ga0500636_0000249_28271_28717 147
1157 3300053178 Ga0500637_0414618 Ga0500637_0414618_60_506 147
1158 3300053730 Ga0500645_090029 Ga0500645_090029_118_567 147
1159 3300053731 Ga0500609_016844 Ga0500609_016844_301_750 147
1160 3300053735 Ga0500596_011038 Ga0500596_011038_113_559 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

21

145

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qda-assembly4.cif.gz_F crystal structure of mutant thioesterase pa1618 (e64a) from pseudomonas aeruginosa 0.8559 81 142
3fzx-assembly1.cif.gz_A-2 crystal structure of a putative exported protein with ymcc-like fold (bf2203) from bacteroides fragilis nctc 9343 at 2.22 a resolution 0.8541 100 141
1vh9-assembly1.cif.gz_A crystal structure of a putative thioesterase 0.8343 81 140
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.8266 7 142
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8263 5 144
ID Description Score Start End Superfamily
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8796 81 142 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8266 7 142 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8263 5 144 3.10.129.10
af_Q86HX3_15_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8215 82 138 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8191 6 142 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4Q5V589-F1-model_v4 deleted 0.9088 54 143
AF-A0A327KDA8-F1-model_v4 Phosphate acetyltransferase 0.8976 4 143 GO:0006633
GO:0016740
GO:0019171
AF-A0A3S4FCD8-F1-model_v4 (R)-specific enoyl-CoA hydratase 0.8935 3 143 GO:0006633
GO:0019171
AF-A0A6N6T4G8-F1-model_v4 MaoC family dehydratase 0.889 1 146
AF-H0JVR2-F1-model_v4 Beta-hydroxyacyl-[acyl-carrier-protein] dehydratase subunit 0.8859 81 146

Feature Viewer

pLDDT pTM Quality
86.45 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map