F491012

General Info

Members Datasets Scaffolds Average Seq Length
1161 559 2323 280

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0084748|Ga0373937_0084748_397_1428
Length 335
Sequence MTTRLPIPVSFEFFPPNTPVGSEKLKTVVSELATVEPEFFSVTYGAGGSTRDKTLATVSDIAALGQEAAPHLSCVGSTKDGISEILATYRAQKIRRLVALRGDLPSGTATAGEFRYASELISFIRETQGKDWFIEVAAYPEYHPQERYAKRDLQHFAAKVKAGADSAITQFFFNPDAYFHFVDEVRALGVEVPIVPGIMPFHNYAKIAQFAARDGIDIPRWVALKMEGFMDDAGSIRAFGLDVVTRLARRLIEGGAPGLHFYTLNQSPLTLELFKRLAGGFGGGLPPASGRCHITPSSVRSASSRNGRKPWVKLTPTVTGRGVSARSVRSKKPPP

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
104 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
136 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
139 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
143 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
158 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
233 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
234 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
238 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
247 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
258 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
259 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
268 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
269 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
274 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
287 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
288 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
289 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
290 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
291 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
292 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
293 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
294 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
295 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
296 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
297 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
298 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
299 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
300 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
301 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
302 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
303 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
304 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
305 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
306 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
307 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
308 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
309 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
310 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
311 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
314 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
320 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
321 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
322 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
332 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
333 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
334 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
335 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
336 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
339 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
342 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
343 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
344 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
345 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
346 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
347 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
348 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
353 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
354 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
355 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
358 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
359 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
360 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
361 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
362 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
363 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
364 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
365 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
366 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
367 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
368 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
369 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
370 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
371 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
372 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
373 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
374 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
375 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
376 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
388 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
392 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
393 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
394 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
395 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
399 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
400 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
401 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
402 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
405 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
406 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
407 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
408 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
409 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
410 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
411 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
412 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
413 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
420 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
421 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
422 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
423 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
424 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
425 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
426 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
427 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
428 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
429 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
430 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
431 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
432 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
433 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
436 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
443 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
446 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
447 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
448 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
449 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
450 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
451 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
452 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
453 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
454 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
455 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
456 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
457 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
458 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
459 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
460 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
461 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
462 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
463 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
464 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
468 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
469 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
470 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
471 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
472 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
473 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
474 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
475 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
476 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
477 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
478 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
479 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
480 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
481 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
482 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
483 2519103095 Burkholderia sp. KJ006 Isolate Nodule
484 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
485 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
486 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
487 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
488 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
489 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
490 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
491 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
492 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
493 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
494 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
495 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
496 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
497 2643221585 Pelomonas sp. Root662 Isolate Unclassified
498 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
499 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
500 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
501 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
502 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
503 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
504 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
505 2643221656 Pelomonas sp. Root405 Isolate Unclassified
506 2643221660 Methylibium sp. Root1272 Isolate Unclassified
507 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
508 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
509 2738541337 Pelomonas sp. BT06 Isolate Unclassified
510 2738543013 Variovorax sp. BT01 Isolate Unclassified
511 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
512 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
513 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
514 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
515 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
516 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
517 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
518 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
519 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
520 2818991436 Collimonas arenae 515 Isolate Unclassified
521 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
522 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
523 2831864461 Roseateles noduli HZ7 Isolate Nodule
524 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
525 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
526 2842711865 Duganella sp. R-73148 Isolate Unclassified
527 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
528 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
529 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
530 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
531 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
532 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
533 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
534 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
535 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
536 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
537 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
538 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
539 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
540 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
541 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
542 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
543 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
544 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
545 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
546 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
547 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
548 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
549 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
550 2928058823 Ralstonia sp. 1138 Isolate Unclassified
551 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
552 2928163908 Burkholderia sp. 567 Isolate Unclassified
553 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
554 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
555 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
556 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
557 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
558 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
559 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.04
Metatranscriptomes 0.78
Isolates 8.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.28
Nodule 1.72
Rhizoplane 2.5
Rhizosphere 68.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0084748 3300036401 Bacteria 2932
2 JGI24741J21665_1000659 3300001915 Bacteria 10436
3 JGI24740J21852_10003369 3300001979 Bacteria 7046
4 JGI25155J39150_1000249 3300002704 Bacteria 20726
5 JGI25155J39150_1000328 3300002704 Bacteria 15729
6 JGI25155J39150_1000403 3300002704 Bacteria 12058
7 JGI25156J39149_1000117 3300002705 Bacteria 57700
8 JGI25156J39149_1001439 3300002705 Bacteria 10102
9 JGI25162J39368_1000148 3300002737 Bacteria 76611
10 JGI25162J39368_1004924 3300002737 Bacteria 2850
11 JGI25154J39366_1000107 3300002738 Bacteria 73482
12 JGI25154J39366_1000440 3300002738 Bacteria 22091
13 JGI25154J39366_1000661 3300002738 Bacteria 16103
14 JGI25157J39369_1000884 3300002741 Bacteria 14427
15 JGI25151J46595_10001412 3300003187 Bacteria 16428
16 JGI25151J46595_10012502 3300003187 Bacteria 3858
17 JGI25165J46597_1000030 3300003214 Bacteria 305254
18 rootH1_10009708 3300003316 Bacteria 16787
19 rootH1_10046862 3300003316 Bacteria 1922
20 rootH1_10046862 3300003323 Bacteria 4327
21 rootH1_10091210 3300003316 Bacteria 2975
22 rootH2_10003807 3300003320 Bacteria 2237
23 rootL2_10001066 3300003322 Bacteria 89444
24 rootL2_10044783 3300003322 Bacteria 5369
25 rootL2_10093618 3300003322 Bacteria 6140
26 rootL2_10123098 3300003322 Bacteria 1657
27 JGI26128J50194_1001242 3300003347 Bacteria 1595
28 JGI25160J50197_1000367 3300003354 Bacteria 29519
29 Ga0006556J51387_1023961 3300003479 Bacteria 3016
30 Ga0006560J51390_1017447 3300003565 Bacteria 3203
31 Ga0055538_1000017 3300003751 Bacteria 305254
32 Ga0055538_1000085 3300003751 Bacteria 81616
33 Ga0055538_1003429 3300003751 Bacteria 2020
34 Ga0055539_1000022 3300003752 Bacteria 305254
35 Ga0055539_1000126 3300003752 Bacteria 81616
36 Ga0055539_1000214 3300003752 Bacteria 42035
37 Ga0055533_1000030 3300003756 Bacteria 305254
38 Ga0055533_1000133 3300003756 Bacteria 81616
39 Ga0055533_1000605 3300003756 Bacteria 12145
40 Ga0055533_1001088 3300003756 Bacteria 7785
41 Ga0055532_1000040 3300003758 Bacteria 198031
42 Ga0055532_1000044 3300003758 Bacteria 191110
43 Ga0055525_1000034 3300003759 Bacteria 305254
44 Ga0055525_1000054 3300003759 Bacteria 216523
45 Ga0055525_1000174 3300003759 Bacteria 81616
46 Ga0055525_1000420 3300003759 Bacteria 25543
47 Ga0055535_1000029 3300003761 Bacteria 198031
48 Ga0055542_1006798 3300003762 Bacteria 2399
49 Ga0055529_1000055 3300003763 Bacteria 197545
50 Ga0055529_1000945 3300003763 Bacteria 15337
51 Ga0055526_1002077 3300003771 Bacteria 13757
52 Ga0055526_1003730 3300003771 Bacteria 9514
53 Ga0055526_1007791 3300003771 Bacteria 5487
54 Ga0055537_1000114 3300003773 Bacteria 60836
55 Ga0055524_1000550 3300003775 Bacteria 28332
56 Ga0055524_1001670 3300003775 Bacteria 12366
57 Ga0055524_1013761 3300003775 Bacteria 3035
58 Ga0055524_1015430 3300003775 Bacteria 2785
59 Ga0055536_1000031 3300003781 Bacteria 151112
60 Ga0055534_1000259 3300003784 Bacteria 36742
61 Ga0055534_1001330 3300003784 Bacteria 9921
62 Ga0055534_1002212 3300003784 Bacteria 6901
63 Ga0055534_1004644 3300003784 Bacteria 3905
64 Ga0055528_1000059 3300003790 Bacteria 87695
65 Ga0055531_10000042 3300003794 Bacteria 134368
66 Ga0055541_1000015 3300003841 Bacteria 305254
67 Ga0055541_1000085 3300003841 Bacteria 81616
68 Ga0055541_1000760 3300003841 Bacteria 8177
69 Ga0065165_1000474 3300005262 Bacteria 62687
70 Ga0065165_1000621 3300005262 Bacteria 51523
71 Ga0065165_1001219 3300005262 Bacteria 29587
72 Ga0065165_1001544 3300005262 Bacteria 24046
73 Ga0070658_10027022 3300005327 Bacteria 4608
74 Ga0070658_10561836 3300005327 Bacteria 988
75 Ga0070676_10000434 3300005328 Bacteria 19840
76 Ga0070690_100001931 3300005330 Bacteria 11018
77 Ga0070670_100011920 3300005331 Bacteria 7434
78 Ga0070670_100023566 3300005331 Bacteria 5298
79 Ga0070670_100024473 3300005331 Bacteria 5192
80 Ga0070670_100030033 3300005331 Bacteria 4680
81 Ga0070670_100057768 3300005331 Bacteria 3330
82 Ga0070670_100139592 3300005331 Bacteria 2095
83 Ga0070670_100309540 3300005331 Bacteria 1382
84 Ga0070670_100420808 3300005331 Bacteria 1181
85 Ga0070677_10002998 3300005333 Bacteria 5427
86 Ga0070677_10088019 3300005333 Bacteria 1344
87 Ga0070677_10134184 3300005333 Bacteria 1134
88 Ga0068869_100035950 3300005334 Bacteria 3515
89 Ga0068869_100052968 3300005334 Bacteria 2948
90 Ga0068869_100073084 3300005334 Bacteria 2542
91 Ga0068869_100150690 3300005334 Bacteria 1803
92 Ga0070666_10002319 3300005335 Bacteria 11506
93 Ga0070666_10143697 3300005335 Bacteria 1662
94 Ga0070666_10255356 3300005335 Bacteria 1242
95 Ga0070680_100001090 3300005336 Bacteria 19474
96 Ga0070682_100064094 3300005337 Bacteria 2332
97 Ga0068868_100002885 3300005338 Bacteria 11932
98 Ga0068868_100022383 3300005338 Bacteria 4769
99 Ga0068868_100045059 3300005338 Bacteria 3450
100 Ga0068868_100211881 3300005338 Bacteria 1619
101 Ga0068868_100235499 3300005338 Bacteria 1537
102 Ga0070660_100062262 3300005339 Bacteria 2898
103 Ga0070660_100181019 3300005339 Bacteria 1705
104 Ga0070689_100140805 3300005340 Bacteria 1940
105 Ga0070689_100189617 3300005340 Bacteria 1674
106 Ga0070689_100262479 3300005340 Bacteria 1428
107 Ga0070687_100001074 3300005343 Bacteria 9366
108 Ga0070661_100000037 3300005344 Bacteria 107325
109 Ga0070668_100000210 3300005347 Bacteria 38311
110 Ga0070668_100047815 3300005347 Bacteria 3290
111 Ga0070668_100169199 3300005347 Bacteria 1778
112 Ga0070669_100000370 3300005353 Bacteria 34811
113 Ga0070669_100030221 3300005353 Bacteria 3908
114 Ga0070669_100152920 3300005353 Bacteria 1787
115 Ga0070669_100277617 3300005353 Bacteria 1342
116 Ga0070675_100000692 3300005354 Bacteria 23415
117 Ga0070675_100014685 3300005354 Bacteria 6177
118 Ga0070675_100024652 3300005354 Bacteria 4817
119 Ga0070675_100171157 3300005354 Bacteria 1873
120 Ga0070675_100441032 3300005354 Bacteria 1166
121 Ga0070671_100001030 3300005355 Bacteria 20495
122 Ga0070671_100025332 3300005355 Bacteria 4866
123 Ga0070671_100048387 3300005355 Bacteria 3535
124 Ga0070671_100052291 3300005355 Bacteria 3397
125 Ga0070671_100103137 3300005355 Bacteria 2393
126 Ga0070671_100148744 3300005355 Bacteria 1977
127 Ga0070671_100189936 3300005355 Bacteria 1741
128 Ga0070674_100001560 3300005356 Bacteria 12278
129 Ga0070674_100017826 3300005356 Bacteria 4474
130 Ga0070674_100031238 3300005356 Bacteria 3527
131 Ga0070674_100353523 3300005356 Bacteria 1187
132 Ga0070673_100005042 3300005364 Bacteria 8423
133 Ga0070673_100017993 3300005364 Bacteria 5038
134 Ga0070673_100044461 3300005364 Bacteria 3439
135 Ga0070688_100072165 3300005365 Bacteria 2211
136 Ga0070659_100000268 3300005366 Bacteria 40889
137 Ga0070667_100000294 3300005367 Bacteria 56218
138 Ga0070667_100003264 3300005367 Bacteria 13863
139 Ga0070667_100022091 3300005367 Bacteria 5277
140 Ga0070667_100137649 3300005367 Bacteria 2135
141 Ga0070667_100144573 3300005367 Bacteria 2085
142 Ga0070667_100369742 3300005367 Bacteria 1301
143 Ga0070667_100398929 3300005367 Bacteria 1252
144 Ga0070713_100095071 3300005436 Bacteria 2570
145 Ga0070701_10065313 3300005438 Bacteria 1931
146 Ga0070708_100639403 3300005445 Bacteria 1003
147 Ga0070663_100000001 3300005455 Bacteria 318372
148 Ga0070678_100002211 3300005456 Bacteria 10580
149 Ga0070678_100004854 3300005456 Bacteria 7679
150 Ga0070678_100064650 3300005456 Bacteria 2712
151 Ga0070678_100091383 3300005456 Bacteria 2336
152 Ga0070678_100208545 3300005456 Bacteria 1617
153 Ga0070662_100014012 3300005457 Bacteria 5344
154 Ga0070662_100046171 3300005457 Bacteria 3129
155 Ga0070662_100076345 3300005457 Bacteria 2483
156 Ga0070662_100195539 3300005457 Bacteria 1602
157 Ga0068867_100001702 3300005459 Bacteria 15330
158 Ga0068867_100002661 3300005459 Bacteria 12602
159 Ga0068867_100008359 3300005459 Bacteria 7304
160 Ga0068867_100025546 3300005459 Bacteria 4239
161 Ga0068867_100034937 3300005459 Bacteria 3645
162 Ga0068867_100127994 3300005459 Bacteria 1970
163 Ga0068867_100184109 3300005459 Bacteria 1662
164 Ga0068867_100203951 3300005459 Bacteria 1584
165 Ga0068867_100240701 3300005459 Bacteria 1467
166 Ga0070706_100003301 3300005467 Bacteria 15955
167 Ga0070707_100035771 3300005468 Bacteria 4739
168 Ga0068853_100009360 3300005539 Bacteria 7898
169 Ga0068853_100478194 3300005539 Bacteria 1174
170 Ga0070672_100000286 3300005543 Bacteria 28584
171 Ga0070672_100000712 3300005543 Bacteria 19713
172 Ga0070672_100006372 3300005543 Bacteria 7925
173 Ga0070672_100018646 3300005543 Bacteria 5022
174 Ga0070672_100027706 3300005543 Bacteria 4229
175 Ga0070672_100109913 3300005543 Bacteria 2246
176 Ga0070686_100247415 3300005544 Bacteria 1301
177 Ga0070693_100032105 3300005547 Bacteria 2884
178 Ga0070665_100330310 3300005548 Bacteria 1529
179 Ga0070665_100639660 3300005548 Bacteria 1077
180 Ga0068855_100005276 3300005563 Bacteria 15776
181 Ga0068855_100147077 3300005563 Bacteria 2681
182 Ga0068855_100170676 3300005563 Bacteria 2464
183 Ga0068855_100175969 3300005563 Bacteria 2421
184 Ga0068855_100354541 3300005563 Bacteria 1616
185 Ga0070664_100000006 3300005564 Bacteria 189856
186 Ga0070664_100262573 3300005564 Bacteria 1554
187 Ga0068857_100048044 3300005577 Bacteria 3789
188 Ga0068857_100097295 3300005577 Bacteria 2638
189 Ga0068857_100122293 3300005577 Bacteria 2344
190 Ga0068857_100299431 3300005577 Bacteria 1482
191 Ga0068854_100002991 3300005578 Bacteria 10487
192 Ga0068854_100061897 3300005578 Bacteria 2711
193 Ga0068854_100173028 3300005578 Bacteria 1681
194 Ga0068856_100000032 3300005614 Bacteria 124895
195 Ga0070702_100172958 3300005615 Bacteria 1407
196 Ga0070702_100254733 3300005615 Bacteria 1192
197 Ga0068852_100006988 3300005616 Bacteria 8214
198 Ga0068852_100024872 3300005616 Bacteria 4845
199 Ga0068852_100054367 3300005616 Bacteria 3451
200 Ga0068852_100071258 3300005616 Bacteria 3051
201 Ga0068852_100170213 3300005616 Bacteria 2041
202 Ga0068852_100477932 3300005616 Bacteria 1238
203 Ga0068859_100120053 3300005617 Bacteria 2695
204 Ga0068859_100176440 3300005617 Bacteria 2219
205 Ga0068859_100378623 3300005617 Bacteria 1511
206 Ga0068864_100000417 3300005618 Bacteria 36778
207 Ga0068864_100018136 3300005618 Bacteria 5873
208 Ga0068864_100071218 3300005618 Bacteria 3027
209 Ga0068864_100110450 3300005618 Bacteria 2448
210 Ga0068864_100569551 3300005618 Bacteria 1097
211 Ga0068866_10005226 3300005718 Bacteria 5348
212 Ga0068861_100000398 3300005719 Bacteria 25148
213 Ga0068861_100010875 3300005719 Bacteria 6323
214 Ga0068861_100027316 3300005719 Bacteria 4155
215 Ga0068861_100173269 3300005719 Bacteria 1790
216 Ga0068851_10008763 3300005834 Bacteria 4685
217 Ga0068870_10055112 3300005840 Bacteria 2117
218 Ga0068870_10221762 3300005840 Bacteria 1158
219 Ga0068863_100000638 3300005841 Bacteria 35489
220 Ga0068863_100021605 3300005841 Bacteria 6138
221 Ga0068863_100095002 3300005841 Bacteria 2830
222 Ga0068863_100116242 3300005841 Bacteria 2549
223 Ga0068863_100116455 3300005841 Bacteria 2546
224 Ga0068858_100000623 3300005842 Bacteria 36873
225 Ga0068858_100004551 3300005842 Bacteria 13580
226 Ga0068858_100042716 3300005842 Bacteria 4203
227 Ga0068858_100353339 3300005842 Bacteria 1408
228 Ga0068860_100001020 3300005843 Bacteria 30989
229 Ga0068860_100002539 3300005843 Bacteria 19101
230 Ga0068860_100047148 3300005843 Bacteria 4107
231 Ga0068862_100003087 3300005844 Bacteria 14521
232 Ga0068862_100039734 3300005844 Bacteria 3997
233 Ga0068862_100053450 3300005844 Bacteria 3458
234 Ga0068862_100098908 3300005844 Bacteria 2549
235 Ga0075368_10010902 3300006042 Bacteria 3296
236 Ga0075368_10015811 3300006042 Bacteria 2804
237 Ga0075363_100086454 3300006048 Bacteria 1721
238 Ga0075364_10067075 3300006051 Bacteria 2358
239 Ga0075362_10018818 3300006177 Bacteria 2863
240 Ga0075367_10027649 3300006178 Bacteria 3229
241 Ga0075367_10048135 3300006178 Bacteria 2510
242 Ga0075366_10003944 3300006195 Bacteria 7916
243 Ga0075366_10004375 3300006195 Bacteria 7579
244 Ga0075366_10004423 3300006195 Bacteria 7543
245 Ga0075366_10016373 3300006195 Bacteria 4261
246 Ga0075366_10027032 3300006195 Bacteria 3365
247 Ga0075366_10065018 3300006195 Bacteria 2169
248 Ga0075366_10085433 3300006195 Bacteria 1887
249 Ga0075366_10209799 3300006195 Bacteria 1186
250 Ga0097621_100010671 3300006237 Bacteria 6732
251 Ga0097621_100031314 3300006237 Bacteria 4220
252 Ga0097621_100138552 3300006237 Bacteria 2078
253 Ga0097621_100253122 3300006237 Bacteria 1543
254 Ga0097621_100260001 3300006237 Bacteria 1522
255 Ga0075370_10000291 3300006353 Bacteria 17999
256 Ga0075370_10000595 3300006353 Bacteria 13965
257 Ga0075370_10006650 3300006353 Bacteria 5831
258 Ga0075370_10027042 3300006353 Bacteria 3181
259 Ga0075370_10041151 3300006353 Bacteria 2608
260 Ga0068871_100094720 3300006358 Bacteria 2492
261 Ga0068871_100257770 3300006358 Bacteria 1520
262 Ga0075430_100211114 3300006846 Bacteria 1611
263 Ga0075434_100685126 3300006871 Bacteria 1043
264 Ga0075429_100000224 3300006880 Bacteria 38311
265 Ga0068865_100000504 3300006881 Bacteria 21850
266 Ga0068865_100006531 3300006881 Bacteria 7125
267 Ga0068865_100051687 3300006881 Bacteria 2846
268 Ga0068865_100104594 3300006881 Bacteria 2078
269 Ga0097620_100120048 3300006931 Bacteria 2695
270 Ga0097620_100176445 3300006931 Bacteria 2219
271 Ga0097620_100378658 3300006931 Bacteria 1511
272 Ga0099823_1000559 3300006944 Bacteria 25703
273 Ga0079104_1010957 3300006946 Bacteria 2948
274 Ga0105251_10072277 3300009011 Bacteria 1604
275 Ga0105251_10149572 3300009011 Bacteria 1055
276 Ga0105240_10015068 3300009093 Bacteria 10523
277 Ga0105240_10022053 3300009093 Bacteria 8454
278 Ga0105240_10077623 3300009093 Bacteria 4091
279 Ga0105240_10174543 3300009093 Bacteria 2542
280 Ga0105240_10196467 3300009093 Bacteria 2368
281 Ga0105240_10295608 3300009093 Bacteria 1855
282 Ga0105240_10413203 3300009093 Bacteria 1517
283 Ga0105240_10413204 3300009093 Bacteria 1517
284 Ga0105245_10012144 3300009098 Bacteria 7490
285 Ga0105245_10046369 3300009098 Bacteria 3884
286 Ga0105245_10197412 3300009098 Bacteria 1931
287 Ga0114129_10975478 3300009147 Bacteria 1069
288 Ga0105243_10006497 3300009148 Bacteria 9041
289 Ga0105243_10039272 3300009148 Bacteria 3688
290 Ga0105243_10107642 3300009148 Bacteria 2325
291 Ga0105243_10119821 3300009148 Bacteria 2216
292 Ga0105241_10348034 3300009174 Bacteria 1286
293 Ga0105242_10018196 3300009176 Bacteria 5490
294 Ga0105248_10027320 3300009177 Bacteria 6351
295 Ga0105248_10116277 3300009177 Bacteria 3016
296 Ga0105248_10150457 3300009177 Bacteria 2626
297 Ga0105237_10033144 3300009545 Bacteria 5233
298 Ga0105237_10080569 3300009545 Bacteria 3246
299 Ga0105237_10097519 3300009545 Bacteria 2930
300 Ga0105238_10000038 3300009551 Bacteria 162920
301 Ga0105238_10007405 3300009551 Bacteria 10994
302 Ga0105249_10002938 3300009553 Bacteria 14709
303 Ga0105249_10052983 3300009553 Bacteria 3707
304 Ga0105249_10166150 3300009553 Bacteria 2136
305 Ga0105239_10004364 3300010375 Bacteria 16946
306 Ga0105239_10138089 3300010375 Bacteria 2714
307 Ga0157319_1000005 3300012497 Bacteria 372810
308 Ga0157373_10079106 3300013100 Bacteria 2319
309 Ga0157373_10080356 3300013100 Bacteria 2299
310 Ga0157373_10364764 3300013100 Bacteria 1031
311 Ga0157371_10000106 3300013102 Bacteria 126567
312 Ga0157370_10000062 3300013104 Bacteria 115487
313 Ga0157369_10019944 3300013105 Bacteria 7498
314 Ga0157374_10024366 3300013296 Bacteria 5425
315 Ga0157374_10130406 3300013296 Bacteria 2433
316 Ga0157374_10253714 3300013296 Bacteria 1731
317 Ga0157378_10053754 3300013297 Bacteria 3585
318 Ga0157378_10382849 3300013297 Bacteria 1382
319 Ga0157378_10736485 3300013297 Bacteria 1008
320 Ga0163162_10000701 3300013306 Bacteria 30951
321 Ga0163162_10051946 3300013306 Bacteria 4115
322 Ga0163162_10274052 3300013306 Bacteria 1819
323 Ga0163162_10525009 3300013306 Bacteria 1313
324 Ga0163162_10563620 3300013306 Bacteria 1267
325 Ga0157372_10000108 3300013307 Bacteria 86863
326 Ga0157372_10107117 3300013307 Bacteria 3198
327 Ga0157375_10006514 3300013308 Bacteria 10163
328 Ga0157375_10009924 3300013308 Bacteria 8376
329 Ga0157375_10153266 3300013308 Bacteria 2442
330 Ga0163163_10195108 3300014325 Bacteria 2073
331 Ga0163163_10205725 3300014325 Bacteria 2016
332 Ga0163163_10231195 3300014325 Bacteria 1898
333 Ga0157380_10000472 3300014326 Bacteria 24494
334 Ga0157380_10033017 3300014326 Bacteria 3983
335 Ga0157380_10145419 3300014326 Bacteria 2042
336 Ga0182008_10042885 3300014497 Bacteria 2253
337 Ga0182008_10112057 3300014497 Bacteria 1352
338 Ga0157377_10000034 3300014745 Bacteria 117744
339 Ga0157377_10039116 3300014745 Bacteria 2622
340 Ga0157379_10001128 3300014968 Bacteria 21831
341 Ga0157379_10002106 3300014968 Bacteria 16495
342 Ga0157379_10005918 3300014968 Bacteria 10530
343 Ga0157379_10050097 3300014968 Bacteria 3727
344 Ga0157379_10072142 3300014968 Bacteria 3089
345 Ga0157379_10422105 3300014968 Bacteria 1228
346 Ga0157376_10021689 3300014969 Bacteria 4992
347 Ga0157376_10039629 3300014969 Bacteria 3844
348 Ga0157376_10185936 3300014969 Bacteria 1902
349 Ga0157376_10236372 3300014969 Bacteria 1700
350 Ga0157376_10360986 3300014969 Bacteria 1393
351 Ga0157376_10552731 3300014969 Bacteria 1139
352 Ga0182006_1001438 3300015261 Bacteria 14409
353 Ga0182006_1012816 3300015261 Bacteria 3658
354 Ga0182006_1020296 3300015261 Bacteria 2785
355 Ga0182006_1028442 3300015261 Bacteria 2273
356 Ga0182006_1076641 3300015261 Bacteria 1228
357 Ga0182007_10013248 3300015262 Bacteria 3150
358 Ga0182007_10020262 3300015262 Bacteria 2380
359 Ga0182005_1000142 3300015265 Bacteria 50650
360 Ga0183361_10001 3300016635 Bacteria 908583
361 Ga0163161_10001102 3300017792 Bacteria 20382
362 Ga0163161_10012016 3300017792 Bacteria 6007
363 Ga0163161_10076474 3300017792 Bacteria 2457
364 Ga0206355_1625393 3300020076 Bacteria 2024
365 Ga0206351_10698205 3300020077 Bacteria 5141
366 Ga0154015_1545624 3300020610 Bacteria 8382
367 Ga0213872_10000861 3300021361 Bacteria 21979
368 Ga0213872_10000883 3300021361 Bacteria 21687
369 Ga0213872_10000982 3300021361 Bacteria 19943
370 Ga0213872_10004235 3300021361 Bacteria 7693
371 Ga0213872_10006327 3300021361 Bacteria 5958
372 Ga0213872_10007165 3300021361 Bacteria 5512
373 Ga0209435_100004 3300025206 Bacteria 633417
374 Ga0209435_100891 3300025206 Bacteria 4560
375 Ga0209760_101145 3300025207 Bacteria 3003
376 Ga0209784_100006 3300025224 Bacteria 930704
377 Ga0209784_100021 3300025224 Bacteria 408534
378 Ga0209784_100034 3300025224 Bacteria 305504
379 Ga0209784_100559 3300025224 Bacteria 13132
380 Ga0209566_100002 3300025225 Bacteria 2614868
381 Ga0209566_100038 3300025225 Bacteria 305504
382 Ga0209566_100039 3300025225 Bacteria 303368
383 Ga0209566_100678 3300025225 Bacteria 20133
384 Ga0209566_102039 3300025225 Bacteria 4240
385 Ga0209566_102609 3300025225 Bacteria 3201
386 Ga0209674_100010 3300025226 Bacteria 1038638
387 Ga0209674_100036 3300025226 Bacteria 408534
388 Ga0209674_100056 3300025226 Bacteria 305504
389 Ga0209674_100060 3300025226 Bacteria 282102
390 Ga0209674_100076 3300025226 Bacteria 210323
391 Ga0209674_106794 3300025226 Bacteria 1511
392 Ga0209672_101956 3300025228 Bacteria 5797
393 Ga0209672_108353 3300025228 Bacteria 1538
394 Ga0209147_100011 3300025229 Bacteria 702140
395 Ga0209147_100018 3300025229 Bacteria 515719
396 Ga0209563_100040 3300025230 Bacteria 408534
397 Ga0209563_100041 3300025230 Bacteria 407467
398 Ga0209563_100057 3300025230 Bacteria 305604
399 Ga0209563_100075 3300025230 Bacteria 216575
400 Ga0209563_106287 3300025230 Bacteria 2053
401 Ga0207427_103609 3300025231 Bacteria 3136
402 Ga0209437_100071 3300025233 Bacteria 305604
403 Ga0209437_100393 3300025233 Bacteria 42190
404 Ga0209258_100028 3300025242 Bacteria 515719
405 Ga0209258_106057 3300025242 Bacteria 1948
406 Ga0209646_1000043 3300025246 Bacteria 343652
407 Ga0209646_1000149 3300025246 Bacteria 100004
408 Ga0209646_1000191 3300025246 Bacteria 75546
409 Ga0209646_1000233 3300025246 Bacteria 57776
410 Ga0209026_1000066 3300025250 Bacteria 207691
411 Ga0209026_1002225 3300025250 Bacteria 7491
412 Ga0209026_1009862 3300025250 Bacteria 1832
413 Ga0209677_100007 3300025253 Bacteria 1021332
414 Ga0209677_100023 3300025253 Bacteria 408534
415 Ga0209677_100035 3300025253 Bacteria 305504
416 Ga0209677_102676 3300025253 Bacteria 6432
417 Ga0209148_1000162 3300025254 Bacteria 138642
418 Ga0209759_1000072 3300025256 Bacteria 178206
419 Ga0209759_1000182 3300025256 Bacteria 102836
420 Ga0209759_1001347 3300025256 Bacteria 14286
421 Ga0209759_1003723 3300025256 Bacteria 5970
422 Ga0209129_1004031 3300025258 Bacteria 6006
423 Ga0209233_1000094 3300025261 Bacteria 305604
424 Ga0209565_1000032 3300025263 Bacteria 316777
425 Ga0209565_1000611 3300025263 Bacteria 23691
426 Ga0207666_1013333 3300025271 Bacteria 1153
427 Ga0209455_1000065 3300025272 Bacteria 321272
428 Ga0209455_1001116 3300025272 Bacteria 13109
429 Ga0209455_1010351 3300025272 Bacteria 2376
430 Ga0209673_1000029 3300025273 Bacteria 351978
431 Ga0209673_1004669 3300025273 Bacteria 7231
432 Ga0209673_1009458 3300025273 Bacteria 4218
433 Ga0209675_1000019 3300025291 Bacteria 351950
434 Ga0209675_1000231 3300025291 Bacteria 56755
435 Ga0209675_1001472 3300025291 Bacteria 13522
436 Ga0209675_1009719 3300025291 Bacteria 3368
437 Ga0209676_1000036 3300025292 Bacteria 457623
438 Ga0209025_1000345 3300025294 Bacteria 100876
439 Ga0209025_1000860 3300025294 Bacteria 47953
440 Ga0209025_1000885 3300025294 Bacteria 46908
441 Ga0209025_1002236 3300025294 Bacteria 21305
442 Ga0209025_1003617 3300025294 Bacteria 14389
443 Ga0209025_1020816 3300025294 Bacteria 3564
444 Ga0209564_1000021 3300025295 Bacteria 571316
445 Ga0209564_1000291 3300025295 Bacteria 101831
446 Ga0209564_1001814 3300025295 Bacteria 19671
447 Ga0209564_1002897 3300025295 Bacteria 12521
448 Ga0209564_1003347 3300025295 Bacteria 11112
449 Ga0209758_1014888 3300025297 Bacteria 4084
450 Ga0209050_1001572 3300025298 Bacteria 23718
451 Ga0209256_1000244 3300025299 Bacteria 96646
452 Ga0209256_1000309 3300025299 Bacteria 85294
453 Ga0209256_1001175 3300025299 Bacteria 29496
454 Ga0209256_1003136 3300025299 Bacteria 12042
455 Ga0209256_1012735 3300025299 Bacteria 3185
456 Ga0207426_1000007 3300025302 Bacteria 971011
457 Ga0209051_1002025 3300025303 Bacteria 15428
458 Ga0209051_1003442 3300025303 Bacteria 10373
459 Ga0209257_1000016 3300025304 Bacteria 908015
460 Ga0209257_1000981 3300025304 Bacteria 38736
461 Ga0209257_1003659 3300025304 Bacteria 12890
462 Ga0209257_1021536 3300025304 Bacteria 2337
463 Ga0207697_10005788 3300025315 Bacteria 5698
464 Ga0207656_10007965 3300025321 Bacteria 3885
465 Ga0207656_10049107 3300025321 Bacteria 1819
466 Ga0207713_1077262 3300025735 Bacteria 1209
467 Ga0207682_10001283 3300025893 Bacteria 11529
468 Ga0207682_10066783 3300025893 Bacteria 1516
469 Ga0207682_10067497 3300025893 Bacteria 1509
470 Ga0207682_10128893 3300025893 Bacteria 1128
471 Ga0207642_10005579 3300025899 Bacteria 4118
472 Ga0207642_10014175 3300025899 Bacteria 2933
473 Ga0207642_10041206 3300025899 Bacteria 2020
474 Ga0207688_10055694 3300025901 Bacteria 2220
475 Ga0207680_10002133 3300025903 Bacteria 9262
476 Ga0207680_10048731 3300025903 Bacteria 2518
477 Ga0207680_10283664 3300025903 Bacteria 1151
478 Ga0207647_10053550 3300025904 Bacteria 2486
479 Ga0207645_10001321 3300025907 Bacteria 20363
480 Ga0207645_10002041 3300025907 Bacteria 16211
481 Ga0207645_10004182 3300025907 Bacteria 10717
482 Ga0207645_10034575 3300025907 Bacteria 3247
483 Ga0207645_10163414 3300025907 Bacteria 1457
484 Ga0207643_10159082 3300025908 Bacteria 1358
485 Ga0207643_10263413 3300025908 Bacteria 1065
486 Ga0207705_10053592 3300025909 Bacteria 2906
487 Ga0207684_10012702 3300025910 Bacteria 7312
488 Ga0207654_10065427 3300025911 Bacteria 2140
489 Ga0207695_10000979 3300025913 Bacteria 50790
490 Ga0207695_10001817 3300025913 Bacteria 33592
491 Ga0207695_10002079 3300025913 Bacteria 30518
492 Ga0207695_10082442 3300025913 Bacteria 3251
493 Ga0207695_10108766 3300025913 Bacteria 2756
494 Ga0207695_10550327 3300025913 Bacteria 1035
495 Ga0207671_10001710 3300025914 Bacteria 24779
496 Ga0207671_10182234 3300025914 Bacteria 1635
497 Ga0207660_10006825 3300025917 Bacteria 7390
498 Ga0207662_10163295 3300025918 Bacteria 1424
499 Ga0207657_10127064 3300025919 Bacteria 2093
500 Ga0207649_10000477 3300025920 Bacteria 28564
501 Ga0207649_10095109 3300025920 Bacteria 1959
502 Ga0207681_10001157 3300025923 Bacteria 17033
503 Ga0207681_10012075 3300025923 Bacteria 5322
504 Ga0207694_10000069 3300025924 Bacteria 124500
505 Ga0207694_10011272 3300025924 Bacteria 6752
506 Ga0207694_10025608 3300025924 Bacteria 4484
507 Ga0207694_10145325 3300025924 Bacteria 1909
508 Ga0207650_10000603 3300025925 Bacteria 28763
509 Ga0207650_10001006 3300025925 Bacteria 21205
510 Ga0207650_10032175 3300025925 Bacteria 3794
511 Ga0207650_10048101 3300025925 Bacteria 3144
512 Ga0207650_10320901 3300025925 Bacteria 1268
513 Ga0207659_10000488 3300025926 Bacteria 23860
514 Ga0207659_10003135 3300025926 Bacteria 9880
515 Ga0207659_10033524 3300025926 Bacteria 3535
516 Ga0207659_10038095 3300025926 Bacteria 3342
517 Ga0207659_10162824 3300025926 Bacteria 1753
518 Ga0207687_10019791 3300025927 Bacteria 4463
519 Ga0207687_10022125 3300025927 Bacteria 4230
520 Ga0207700_10059448 3300025928 Bacteria 2891
521 Ga0207644_10019134 3300025931 Bacteria 4642
522 Ga0207644_10021105 3300025931 Bacteria 4434
523 Ga0207644_10043820 3300025931 Bacteria 3176
524 Ga0207644_10183703 3300025931 Bacteria 1640
525 Ga0207644_10386487 3300025931 Bacteria 1142
526 Ga0207690_10001542 3300025932 Bacteria 14419
527 Ga0207690_10061546 3300025932 Bacteria 2552
528 Ga0207706_10005604 3300025933 Bacteria 11696
529 Ga0207706_10023257 3300025933 Bacteria 5566
530 Ga0207706_10067960 3300025933 Bacteria 3136
531 Ga0207686_10161890 3300025934 Bacteria 1569
532 Ga0207709_10022617 3300025935 Bacteria 3567
533 Ga0207709_10077907 3300025935 Bacteria 2126
534 Ga0207709_10166238 3300025935 Bacteria 1544
535 Ga0207670_10137243 3300025936 Bacteria 1799
536 Ga0207670_10137759 3300025936 Bacteria 1796
537 Ga0207669_10002675 3300025937 Bacteria 7630
538 Ga0207669_10010185 3300025937 Bacteria 4516
539 Ga0207704_10002511 3300025938 Bacteria 8267
540 Ga0207704_10003713 3300025938 Bacteria 6943
541 Ga0207704_10164572 3300025938 Bacteria 1583
542 Ga0207665_10275322 3300025939 Bacteria 1251
543 Ga0207691_10001925 3300025940 Bacteria 20256
544 Ga0207691_10002589 3300025940 Bacteria 17678
545 Ga0207691_10026069 3300025940 Bacteria 5486
546 Ga0207691_10029199 3300025940 Bacteria 5159
547 Ga0207691_10044567 3300025940 Bacteria 4081
548 Ga0207691_10066955 3300025940 Bacteria 3248
549 Ga0207691_10076817 3300025940 Bacteria 3009
550 Ga0207691_10105579 3300025940 Bacteria 2509
551 Ga0207711_10009121 3300025941 Bacteria 8282
552 Ga0207711_10057113 3300025941 Bacteria 3355
553 Ga0207711_10469707 3300025941 Bacteria 1171
554 Ga0207711_10604105 3300025941 Bacteria 1024
555 Ga0207689_10000415 3300025942 Bacteria 39864
556 Ga0207689_10032225 3300025942 Bacteria 4360
557 Ga0207689_10205596 3300025942 Bacteria 1626
558 Ga0207689_10217162 3300025942 Bacteria 1580
559 Ga0207661_10146534 3300025944 Bacteria 2037
560 Ga0207679_10000012 3300025945 Bacteria 339773
561 Ga0207679_10021183 3300025945 Bacteria 4401
562 Ga0207679_10072028 3300025945 Bacteria 2609
563 Ga0207679_10368181 3300025945 Bacteria 1257
564 Ga0207667_10000043 3300025949 Bacteria 261426
565 Ga0207667_10025668 3300025949 Bacteria 6448
566 Ga0207667_10066892 3300025949 Bacteria 3745
567 Ga0207667_10268643 3300025949 Bacteria 1744
568 Ga0207651_10031644 3300025960 Bacteria 3385
569 Ga0207651_10062810 3300025960 Bacteria 2590
570 Ga0207712_10002826 3300025961 Bacteria 11123
571 Ga0207712_10046807 3300025961 Bacteria 3000
572 Ga0207712_10188467 3300025961 Bacteria 1626
573 Ga0207712_10328714 3300025961 Bacteria 1264
574 Ga0207668_10257076 3300025972 Bacteria 1421
575 Ga0207668_10272165 3300025972 Bacteria 1385
576 Ga0207640_10000012 3300025981 Bacteria 242060
577 Ga0207640_10007512 3300025981 Bacteria 6019
578 Ga0207640_10567072 3300025981 Bacteria 956
579 Ga0207658_10000212 3300025986 Bacteria 60851
580 Ga0207658_10006064 3300025986 Bacteria 8255
581 Ga0207658_10030972 3300025986 Bacteria 3794
582 Ga0207658_10136734 3300025986 Bacteria 1977
583 Ga0207658_10534647 3300025986 Bacteria 1047
584 Ga0207677_10007613 3300026023 Bacteria 6007
585 Ga0207677_10086434 3300026023 Bacteria 2267
586 Ga0207677_10107251 3300026023 Bacteria 2071
587 Ga0207677_10195898 3300026023 Bacteria 1602
588 Ga0207677_10267004 3300026023 Bacteria 1398
589 Ga0207703_10002429 3300026035 Bacteria 16148
590 Ga0207703_10003032 3300026035 Bacteria 14219
591 Ga0207703_10009710 3300026035 Bacteria 7551
592 Ga0207703_10413025 3300026035 Bacteria 1254
593 Ga0207639_10054234 3300026041 Bacteria 3063
594 Ga0207639_10151752 3300026041 Bacteria 1941
595 Ga0207639_10166052 3300026041 Bacteria 1865
596 Ga0207678_10000009 3300026067 Bacteria 156690
597 Ga0207678_10006113 3300026067 Bacteria 10709
598 Ga0207678_10063109 3300026067 Bacteria 3184
599 Ga0207678_10584938 3300026067 Bacteria 978
600 Ga0207708_10043164 3300026075 Bacteria 3437
601 Ga0207702_10000028 3300026078 Bacteria 183005
602 Ga0207641_10009276 3300026088 Bacteria 8114
603 Ga0207641_10097769 3300026088 Bacteria 2581
604 Ga0207641_10153136 3300026088 Bacteria 2089
605 Ga0207641_10205166 3300026088 Bacteria 1820
606 Ga0207641_10396913 3300026088 Bacteria 1323
607 Ga0207648_10000054 3300026089 Bacteria 106684
608 Ga0207648_10005336 3300026089 Bacteria 12956
609 Ga0207648_10008160 3300026089 Bacteria 10182
610 Ga0207648_10037529 3300026089 Bacteria 4268
611 Ga0207648_10120747 3300026089 Bacteria 2304
612 Ga0207648_10142370 3300026089 Bacteria 2114
613 Ga0207648_10251892 3300026089 Bacteria 1574
614 Ga0207676_10039147 3300026095 Bacteria 3624
615 Ga0207676_10044261 3300026095 Bacteria 3433
616 Ga0207676_10057970 3300026095 Bacteria 3052
617 Ga0207676_10075167 3300026095 Bacteria 2724
618 Ga0207676_10078899 3300026095 Bacteria 2668
619 Ga0207676_10083234 3300026095 Bacteria 2605
620 Ga0207676_10296744 3300026095 Bacteria 1474
621 Ga0207674_10010925 3300026116 Bacteria 10218
622 Ga0207674_10068252 3300026116 Bacteria 3578
623 Ga0207674_10093730 3300026116 Bacteria 2991
624 Ga0207674_10336626 3300026116 Bacteria 1459
625 Ga0207674_10573987 3300026116 Bacteria 1089
626 Ga0207675_100000177 3300026118 Bacteria 57433
627 Ga0207675_100002649 3300026118 Bacteria 17661
628 Ga0207675_100006060 3300026118 Bacteria 11505
629 Ga0207683_10011037 3300026121 Bacteria 7699
630 Ga0207683_10056721 3300026121 Bacteria 3437
631 Ga0207683_10105509 3300026121 Bacteria 2519
632 Ga0207683_10125588 3300026121 Bacteria 2305
633 Ga0207698_10005873 3300026142 Bacteria 7627
634 Ga0207698_10006654 3300026142 Bacteria 7222
635 Ga0207698_10016463 3300026142 Bacteria 4985
636 Ga0207698_10040883 3300026142 Bacteria 3450
637 Ga0207698_10104678 3300026142 Bacteria 2355
638 Ga0209281_1007147 3300027111 Bacteria 2821
639 Ga0209389_1006254 3300027296 Bacteria 10313
640 Ga0209996_1007401 3300027395 Bacteria 1427
641 Ga0209968_1000442 3300027526 Bacteria 6685
642 Ga0209282_1000021 3300027666 Bacteria 177705
643 Ga0209813_10097025 3300027866 Bacteria 998
644 Ga0209974_10090038 3300027876 Bacteria 1063
645 Ga0207428_10174560 3300027907 Bacteria 1626
646 Ga0268266_10254014 3300028379 Bacteria 1627
647 Ga0268266_10280483 3300028379 Bacteria 1549
648 Ga0268266_10421137 3300028379 Bacteria 1265
649 Ga0268265_10038444 3300028380 Bacteria 3520
650 Ga0268265_10042591 3300028380 Bacteria 3370
651 Ga0268265_10089362 3300028380 Bacteria 2457
652 Ga0268265_10103325 3300028380 Bacteria 2307
653 Ga0268264_10004393 3300028381 Bacteria 12027
654 Ga0268264_10020354 3300028381 Bacteria 5422
655 Ga0307517_10012331 3300028786 Bacteria 11744
656 Ga0307517_10142360 3300028786 Bacteria 1678
657 Ga0307515_10000089 3300028794 Bacteria 215736
658 Ga0307515_10000096 3300028794 Bacteria 206366
659 Ga0307515_10007484 3300028794 Bacteria 21573
660 Ga0307515_10041885 3300028794 Bacteria 7185
661 Ga0307515_10080610 3300028794 Bacteria 4242
662 Ga0307515_10089153 3300028794 Bacteria 3888
663 Ga0307515_10297510 3300028794 Bacteria 1302
664 Ga0265338_10000258 3300028800 Bacteria 96517
665 Ga0265338_10001135 3300028800 Bacteria 44081
666 Ga0265324_10002038 3300029957 Bacteria 10739
667 Ga0265324_10035527 3300029957 Bacteria 1735
668 Ga0307512_10051922 3300030522 Bacteria 3275
669 Ga0307512_10052334 3300030522 Bacteria 3257
670 Ga0265332_10049707 3300031238 Bacteria 1803
671 Ga0265328_10006255 3300031239 Bacteria 5058
672 Ga0265325_10010371 3300031241 Bacteria 5400
673 Ga0265331_10006099 3300031250 Bacteria 7172
674 Ga0265327_10000080 3300031251 Bacteria 206086
675 Ga0265327_10017033 3300031251 Bacteria 4581
676 Ga0265316_10309929 3300031344 Bacteria 1148
677 Ga0265316_10326724 3300031344 Bacteria 1113
678 Ga0307513_10005057 3300031456 Bacteria 17459
679 Ga0307513_10016545 3300031456 Bacteria 8890
680 Ga0307513_10035292 3300031456 Bacteria 5596
681 Ga0307509_10000032 3300031507 Bacteria 202919
682 Ga0307509_10001647 3300031507 Bacteria 37422
683 Ga0307509_10006706 3300031507 Bacteria 15360
684 Ga0307509_10013664 3300031507 Bacteria 9594
685 Ga0307408_100000006 3300031548 Bacteria 472824
686 Ga0307408_100037196 3300031548 Bacteria 3427
687 Ga0307408_100051736 3300031548 Bacteria 2960
688 Ga0307508_10000028 3300031616 Bacteria 168639
689 Ga0307508_10001377 3300031616 Bacteria 27383
690 Ga0307508_10065069 3300031616 Bacteria 3213
691 Ga0316575_10000063 3300031665 Bacteria 26008
692 Ga0265314_10003091 3300031711 Bacteria 16392
693 Ga0265314_10032720 3300031711 Bacteria 3821
694 Ga0265314_10043851 3300031711 Bacteria 3175
695 Ga0265314_10166143 3300031711 Bacteria 1337
696 Ga0307516_10001972 3300031730 Bacteria 28094
697 Ga0307516_10177718 3300031730 Bacteria 1864
698 Ga0307405_10028317 3300031731 Bacteria 3261
699 Ga0307405_10089539 3300031731 Bacteria 2033
700 Ga0307405_10413528 3300031731 Bacteria 1059
701 Ga0307413_10052421 3300031824 Bacteria 2464
702 Ga0307407_10442262 3300031903 Bacteria 942
703 Ga0307412_10034330 3300031911 Bacteria 3233
704 Ga0307412_10117010 3300031911 Bacteria 1913
705 Ga0307409_100019603 3300031995 Bacteria 4585
706 Ga0307409_100084584 3300031995 Bacteria 2576
707 Ga0307409_100336573 3300031995 Bacteria 1418
708 Ga0307416_100017160 3300032002 Bacteria 5055
709 Ga0307416_100032323 3300032002 Bacteria 3952
710 Ga0307416_100243962 3300032002 Bacteria 1743
711 Ga0307414_10042417 3300032004 Bacteria 3091
712 Ga0307414_10333943 3300032004 Bacteria 1295
713 Ga0307414_10608346 3300032004 Bacteria 981
714 Ga0307411_10000288 3300032005 Bacteria 16790
715 Ga0307411_10006128 3300032005 Bacteria 5982
716 Ga0307411_10008111 3300032005 Bacteria 5415
717 Ga0307411_10329331 3300032005 Bacteria 1237
718 Ga0307415_100109353 3300032126 Bacteria 2047
719 Ga0307510_10038927 3300033180 Bacteria 5248
720 Ga0307510_10060241 3300033180 Bacteria 3909
721 Ga0307510_10094301 3300033180 Bacteria 2819
722 Ga0307510_10249400 3300033180 Bacteria 1264
723 Ga0307510_10251756 3300033180 Bacteria 1254
724 Ga0373934_0074756 3300035086 Bacteria 1358
725 Ga0373940_0013736 3300035088 Bacteria 1966
726 Ga0373932_0065646 3300035112 Bacteria 1113
727 Ga0373939_0000019 3300035114 Bacteria 59562
728 Ga0373954_0012937 3300035118 Bacteria 3715
729 Ga0373960_0000625 3300035121 Bacteria 7251
730 Ga0373943_0211349 3300035170 Bacteria 1077
731 Ga0373946_0062880 3300035171 Bacteria 1584
732 Ga0373931_0000679 3300035691 Bacteria 14119
733 Ga0373931_0048610 3300035691 Bacteria 2249
734 Ga0373947_0043758 3300035725 Bacteria 2675
735 Ga0373937_0073412 3300036401 Bacteria 3156
736 Ga0373937_0094160 3300036401 Bacteria 2777
737 Ga0373925_0003513 3300037068 Bacteria 12109
738 Ga0395899_0004383 3300037312 Bacteria 11004
739 Ga0395899_0175410 3300037312 Bacteria 1508
740 Ga0395900_0013773 3300037418 Bacteria 8255
741 Ga0395900_0124976 3300037418 Bacteria 2638
742 Ga0395900_0195119 3300037418 Bacteria 2052
743 Ga0395900_0228891 3300037418 Bacteria 1870
744 Ga0395900_0452826 3300037418 Bacteria 1239
745 Ga0395898_0012659 3300037466 Bacteria 8720
746 Ga0395898_0021873 3300037466 Bacteria 6479
747 Ga0395898_0227363 3300037466 Bacteria 1780
748 Ga0395905_0000176 3300037471 Bacteria 102060
749 Ga0395905_0001424 3300037471 Bacteria 28863
750 Ga0395905_0001639 3300037471 Bacteria 26517
751 Ga0395905_0003250 3300037471 Bacteria 17474
752 Ga0395905_0056444 3300037471 Bacteria 3674
753 Ga0395905_0099973 3300037471 Bacteria 2723
754 Ga0395905_0182943 3300037471 Bacteria 1967
755 Ga0395905_0342059 3300037471 Bacteria 1387
756 Ga0436364_1473161 3300037853 Bacteria 2163
757 Ga0395901_0007843 3300038443 Bacteria 10769
758 Ga0395901_0081520 3300038443 Bacteria 3379
759 Ga0395901_0125401 3300038443 Bacteria 2698
760 Ga0395901_0258231 3300038443 Bacteria 1814
761 Ga0400491_02286 3300038727 Bacteria 1850
762 Ga0436361_0004926 3300039447 Bacteria 16512
763 Ga0436361_0027317 3300039447 Bacteria 79578
764 Ga0436361_0046388 3300039447 Bacteria 28554
765 Ga0436361_0799645 3300039447 Bacteria 27063
766 Ga0436361_0968600 3300039447 Bacteria 8144
767 Ga0436361_1048468 3300039447 Bacteria 939
768 Ga0436362_0709755 3300039453 Bacteria 1463
769 Ga0439436_0079053 3300041404 Bacteria 916
770 Ga0439453_0018184 3300041408 Bacteria 1241
771 Ga0439461_0007811 3300041410 Bacteria 1906
772 Ga0439461_0019390 3300041410 Bacteria 1339
773 Ga0451847_0330048 3300041503 Bacteria 1222
774 Ga0451853_3142898 3300041512 Bacteria 3143
775 Ga0451853_3427827 3300041512 Bacteria 957
776 Ga0450917_000993 3300042120 Bacteria 2095
777 Ga0450888_000191 3300042126 Bacteria 5385
778 Ga0450890_009711 3300042127 Bacteria 1236
779 Ga0450897_005099 3300042128 Bacteria 1125
780 Ga0450891_000071 3300042129 Bacteria 8281
781 Ga0450903_020238 3300042138 Bacteria 1029
782 Ga0450904_008647 3300042139 Bacteria 1005
783 Ga0450905_004917 3300042142 Bacteria 1787
784 Ga0450889_000069 3300042144 Bacteria 9191
785 Ga0439446_0014075 3300042156 Bacteria 2203
786 Ga0450909_009486 3300042185 Bacteria 1421
787 Ga0439459_0001762 3300042438 Bacteria 3239
788 Ga0439460_0012999 3300042461 Bacteria 2171
789 Ga0450893_0001280 3300042532 Bacteria 3804
790 Ga0451577_0000002 3300042876 Bacteria 1731375
791 Ga0451577_0001738 3300042876 Bacteria 28073
792 Ga0451577_0002438 3300042876 Bacteria 22187
793 Ga0451577_0022885 3300042876 Bacteria 5703
794 Ga0451577_0033629 3300042876 Bacteria 4622
795 Ga0451577_0174819 3300042876 Bacteria 1935
796 Ga0451577_0235067 3300042876 Bacteria 1657
797 Ga0451577_0273374 3300042876 Bacteria 1530
798 Ga0451577_0273461 3300042876 Bacteria 1530
799 Ga0451577_0312740 3300042876 Bacteria 1424
800 Ga0451577_0344687 3300042876 Bacteria 1351
801 Ga0451577_0395006 3300042876 Bacteria 1255
802 Ga0451577_0583350 3300042876 Bacteria 1015
803 Ga0466986_0063558 3300044650 Bacteria 2556
804 Ga0466969_0000929 3300044656 Bacteria 15821
805 Ga0466969_0044748 3300044656 Bacteria 2200
806 Ga0466977_0000690 3300044666 Bacteria 11950
807 Ga0453683_0000013 3300044673 Bacteria 371932
808 Ga0466965_0000237 3300044683 Bacteria 17680
809 Ga0466966_0002735 3300044684 Bacteria 11583
810 Ga0466966_0120370 3300044684 Bacteria 1613
811 Ga0466961_0012022 3300044693 Bacteria 5531
812 Ga0466961_0142232 3300044693 Bacteria 1501
813 Ga0466963_0016316 3300044694 Bacteria 4617
814 Ga0466963_0031985 3300044694 Bacteria 3403
815 Ga0453684_0000002 3300044712 Bacteria 1731375
816 Ga0453684_0005486 3300044712 Bacteria 25079
817 Ga0453684_0008430 3300044712 Bacteria 18462
818 Ga0453684_0034698 3300044712 Bacteria 6993
819 Ga0453684_0042904 3300044712 Bacteria 6088
820 Ga0453684_0093099 3300044712 Bacteria 3713
821 Ga0453684_0117420 3300044712 Bacteria 3220
822 Ga0453684_0159885 3300044712 Bacteria 2666
823 Ga0453684_0316764 3300044712 Bacteria 1768
824 Ga0453684_0454880 3300044712 Bacteria 1424
825 Ga0466971_0002984 3300044719 Bacteria 7188
826 Ga0466968_0004214 3300044735 Bacteria 5360
827 Ga0466970_0027008 3300044765 Bacteria 3010
828 Ga0466957_0000447 3300044842 Bacteria 20382
829 Ga0466957_0125266 3300044842 Bacteria 1641
830 Ga0466959_0027748 3300045049 Bacteria 4198
831 Ga0466959_0073287 3300045049 Bacteria 2477
832 Ga0451576_0000037 3300045051 Bacteria 372173
833 Ga0451576_0001760 3300045051 Bacteria 35546
834 Ga0451576_0002464 3300045051 Bacteria 27543
835 Ga0451576_0009103 3300045051 Bacteria 11553
836 Ga0451576_0015201 3300045051 Bacteria 8539
837 Ga0451576_0021486 3300045051 Bacteria 7014
838 Ga0451576_0111564 3300045051 Bacteria 2846
839 Ga0451576_0118778 3300045051 Bacteria 2752
840 Ga0451576_0168250 3300045051 Bacteria 2287
841 Ga0451576_0202520 3300045051 Bacteria 2073
842 Ga0451576_0261405 3300045051 Bacteria 1809
843 Ga0466958_0090299 3300045836 Bacteria 1895
844 Ga0466958_0151304 3300045836 Bacteria 1464
845 Ga0466967_0546697 3300045976 Bacteria 1140
846 Ga0495592_0019120 3300046454 Bacteria 5212
847 Ga0495592_0034924 3300046454 Bacteria 3789
848 Ga0495592_0188472 3300046454 Bacteria 1399
849 Ga0495590_0003935 3300046457 Bacteria 6041
850 Ga0495590_0036912 3300046457 Bacteria 1704
851 Ga0495590_0062264 3300046457 Bacteria 1306
852 Ga0495629_0047432 3300046459 Bacteria 3013
853 Ga0495638_0062244 3300046460 Bacteria 2304
854 Ga0495651_0005769 3300046462 Bacteria 9446
855 Ga0495651_0072318 3300046462 Bacteria 2619
856 Ga0495651_0221611 3300046462 Bacteria 1308
857 Ga0495653_0034300 3300046463 Bacteria 4015
858 Ga0495650_0024295 3300046471 Bacteria 2864
859 Ga0495650_0061097 3300046471 Bacteria 1511
860 Ga0495582_0042043 3300046473 Bacteria 2518
861 Ga0495605_0006736 3300046474 Bacteria 6569
862 Ga0495605_0061328 3300046474 Bacteria 1800
863 Ga0495664_0325460 3300046477 Bacteria 927
864 Ga0495584_0010102 3300046491 Bacteria 4847
865 Ga0495596_0000385 3300046500 Bacteria 28186
866 Ga0495596_0134958 3300046500 Bacteria 958
867 Ga0495607_0077829 3300046501 Bacteria 1831
868 Ga0495583_0040632 3300046506 Bacteria 2183
869 Ga0495606_0012870 3300046507 Bacteria 6663
870 Ga0495608_0265627 3300046511 Bacteria 1067
871 Ga0495610_0009756 3300046512 Bacteria 6036
872 Ga0495616_0003889 3300046513 Bacteria 9515
873 Ga0495620_0031763 3300046515 Bacteria 2415
874 Ga0495628_0001234 3300046516 Bacteria 23412
875 Ga0495628_0048653 3300046516 Bacteria 3360
876 Ga0495628_0064766 3300046516 Bacteria 2861
877 Ga0495630_0041291 3300046517 Bacteria 3444
878 Ga0495632_0009387 3300046519 Bacteria 5903
879 Ga0495642_0022222 3300046528 Bacteria 2499
880 Ga0495642_0033764 3300046528 Bacteria 2058
881 Ga0495652_0123393 3300046529 Bacteria 2062
882 Ga0495652_0223499 3300046529 Bacteria 1413
883 Ga0495609_0000136 3300046538 Bacteria 77986
884 Ga0495609_0001940 3300046538 Bacteria 13168
885 Ga0495609_0068091 3300046538 Bacteria 1567
886 Ga0495621_0006088 3300046539 Bacteria 3504
887 Ga0495597_0012048 3300046542 Bacteria 4179
888 Ga0495645_0026599 3300046543 Bacteria 4201
889 Ga0495633_0040028 3300046558 Bacteria 2235
890 Ga0495667_0129864 3300046559 Bacteria 1626
891 Ga0495668_0000029 3300046616 Bacteria 279128
892 Ga0495668_0033309 3300046616 Bacteria 2895
893 Ga0495668_0085564 3300046616 Bacteria 1729
894 Ga0495625_0002966 3300046660 Bacteria 17641
895 Ga0495625_0022770 3300046660 Bacteria 4795
896 Ga0495625_0033839 3300046660 Bacteria 3775
897 Ga0495635_0061843 3300046663 Bacteria 2571
898 Ga0495646_0004580 3300046680 Bacteria 8715
899 Ga0495646_0070868 3300046680 Bacteria 2052
900 Ga0495647_0068643 3300046681 Bacteria 1414
901 Ga0495669_0001803 3300046684 Bacteria 8750
902 Ga0495670_0026463 3300046691 Bacteria 2871
903 Ga0495671_0125627 3300046692 Bacteria 1251
904 Ga0495649_0000541 3300046694 Bacteria 32077
905 Ga0495649_0059878 3300046694 Bacteria 2049
906 Ga0495589_0071998 3300046794 Bacteria 1689
907 Ga0495600_0065179 3300046809 Bacteria 2381
908 Ga0495600_0110953 3300046809 Bacteria 1786
909 Ga0495660_0063546 3300046810 Bacteria 1976
910 Ga0495660_0108014 3300046810 Bacteria 1423
911 Ga0495604_0149320 3300047317 Bacteria 1662
912 Ga0495636_0008030 3300047318 Bacteria 4160
913 Ga0495636_0022950 3300047318 Bacteria 2524
914 Ga0495674_0013839 3300047319 Bacteria 7573
915 Ga0495683_0196721 3300047323 Bacteria 911
916 Ga0495687_001991 3300047443 Bacteria 17372
917 Ga0495687_006560 3300047443 Bacteria 7098
918 Ga0495687_014896 3300047443 Bacteria 3974
919 Ga0495687_062118 3300047443 Bacteria 1534
920 Ga0495679_006268 3300047446 Bacteria 5148
921 Ga0495685_008022 3300047447 Bacteria 3497
922 Ga0495673_0146820 3300047469 Bacteria 915
923 Ga0495681_0014798 3300047470 Bacteria 4451
924 Ga0495684_0062323 3300047471 Bacteria 2837
925 Ga0495686_0007111 3300047472 Bacteria 8434
926 Ga0495593_0056385 3300047673 Bacteria 2066
927 Ga0495602_0144374 3300048088 Bacteria 1880
928 Ga0495602_0170371 3300048088 Bacteria 1690
929 Ga0495626_0089455 3300048091 Bacteria 1356
930 Ga0496100_0023701 3300048903 Bacteria 3733
931 Ga0496100_0503784 3300048903 Bacteria 933
932 Ga0496101_0013511 3300048904 Bacteria 5473
933 Ga0496101_0195147 3300048904 Bacteria 1564
934 Ga0496102_0027430 3300048905 Bacteria 5085
935 Ga0496102_0033963 3300048905 Bacteria 4587
936 Ga0496103_0055059 3300048906 Bacteria 2466
937 Ga0496104_0044408 3300048907 Bacteria 4175
938 Ga0496104_0215855 3300048907 Bacteria 1830
939 Ga0496104_0279502 3300048907 Bacteria 1582
940 Ga0496104_0314276 3300048907 Bacteria 1479
941 Ga0496104_0481158 3300048907 Bacteria 1153
942 Ga0496105_0110051 3300048908 Bacteria 2274
943 Ga0496106_0000011 3300048909 Bacteria 222845
944 Ga0496106_0006072 3300048909 Bacteria 8940
945 Ga0496106_0459919 3300048909 Bacteria 1022
946 Ga0496107_0141916 3300048910 Bacteria 1775
947 Ga0496107_0208243 3300048910 Bacteria 1454
948 Ga0496108_0017021 3300048911 Bacteria 5942
949 Ga0496109_0129150 3300048912 Bacteria 2358
950 Ga0496110_0007472 3300048913 Bacteria 8735
951 Ga0496111_0205344 3300048914 Bacteria 1464
952 Ga0496111_0345940 3300048914 Bacteria 1101
953 Ga0496113_0043484 3300048916 Bacteria 3325
954 Ga0496114_0007646 3300048917 Bacteria 8547
955 Ga0496114_0164755 3300048917 Bacteria 1929
956 Ga0496114_0255612 3300048917 Bacteria 1542
957 Ga0496115_0007917 3300048918 Bacteria 7839
958 Ga0496116_0021901 3300048919 Bacteria 4806
959 Ga0496117_0028852 3300048920 Bacteria 4289
960 Ga0496118_0041792 3300048921 Bacteria 3625
961 Ga0496118_0101239 3300048921 Bacteria 1946
962 Ga0496118_0156283 3300048921 Bacteria 1418
963 Ga0496119_0110012 3300048922 Bacteria 1531
964 Ga0496121_0010887 3300048924 Bacteria 10167
965 Ga0496121_0023777 3300048924 Bacteria 5885
966 Ga0496121_0042796 3300048924 Bacteria 3933
967 Ga0496121_0137378 3300048924 Bacteria 1819
968 Ga0496121_0265552 3300048924 Bacteria 1182
969 Ga0496122_0003149 3300048925 Bacteria 22078
970 Ga0496122_0021327 3300048925 Bacteria 5804
971 Ga0496123_0000916 3300048926 Bacteria 46316
972 Ga0496123_0027948 3300048926 Bacteria 4187
973 Ga0496124_0066161 3300048927 Bacteria 3011
974 Ga0496125_0004292 3300048928 Bacteria 16553
975 Ga0496126_0002068 3300048929 Bacteria 28159
976 Ga0496126_0026637 3300048929 Bacteria 5540
977 Ga0496126_0194871 3300048929 Bacteria 1714
978 Ga0495682_0084323 3300049460 Bacteria 1142
979 Ga0501292_005344 3300049515 Bacteria 1789
980 Ga0501297_000437 3300049520 Bacteria 3798
981 Ga0501297_001705 3300049520 Bacteria 2052
982 Ga0501300_005125 3300049523 Bacteria 1939
983 Ga0501318_005591 3300049534 Bacteria 1253
984 Ga0501034_0000092 3300049571 Bacteria 164224
985 Ga0501043_0000058 3300049579 Bacteria 102030
986 Ga0501043_0104737 3300049579 Bacteria 2223
987 Ga0501043_0257990 3300049579 Bacteria 1341
988 Ga0501046_0000051 3300049580 Bacteria 133545
989 Ga0501046_0037420 3300049580 Bacteria 3899
990 Ga0501047_0000003 3300049581 Bacteria 508375
991 Ga0501047_0027508 3300049581 Bacteria 5479
992 Ga0501048_0000321 3300049582 Bacteria 32907
993 Ga0501198_000007 3300049649 Bacteria 129700
994 Ga0501211_001859 3300049658 Bacteria 2253
995 Ga0501222_000005 3300049662 Bacteria 129724
996 Ga0501222_000600 3300049662 Bacteria 5290
997 Ga0501223_008762 3300049663 Bacteria 2060
998 Ga0501235_006815 3300049669 Bacteria 2486
999 Ga0501221_000150 3300049704 Bacteria 9308
1000 Ga0501225_0018533 3300049705 Bacteria 1929
1001 Ga0501232_001083 3300049757 Bacteria 2058
1002 Ga0501262_001378 3300049759 Bacteria 2726
1003 Ga0501265_001507 3300049762 Bacteria 2618
1004 Ga0501267_001311 3300049764 Bacteria 2112
1005 Ga0501272_004940 3300049769 Bacteria 1395
1006 Ga0501282_006018 3300049778 Bacteria 1298
1007 Ga0501283_005329 3300049779 Bacteria 1766
1008 Ga0501035_0007072 3300049822 Bacteria 10489
1009 Ga0501035_0208416 3300049822 Bacteria 1673
1010 Ga0501044_0013104 3300049823 Bacteria 8975
1011 Ga0501044_0273189 3300049823 Bacteria 1625
1012 Ga0501045_0075630 3300049824 Bacteria 2480
1013 Ga0501045_0312017 3300049824 Bacteria 1170
1014 nmdc:mga03683_113732_c1 3300050489 Bacteria 1199
1015 nmdc:mga03683_41512_c1 3300050489 Bacteria 1890
1016 nmdc:mga0yw44_64903_c1 3300050492 Bacteria 2248
1017 nmdc:mga0k408_121887_c1 3300050493 Bacteria 1544
1018 nmdc:mga0k408_19056_c1 3300050493 Bacteria 3832
1019 nmdc:mga0k408_20391_c1 3300050493 Bacteria 2752
1020 nmdc:mga0k408_23723_c1 3300050493 Bacteria 3464
1021 nmdc:mga0k408_30466_c1 3300050493 Bacteria 3076
1022 nmdc:mga0k408_370_c1 3300050493 Bacteria 24649
1023 nmdc:mga0k408_4315_c1 3300050493 Bacteria 7552
1024 nmdc:mga06z11_181621_c1 3300050494 Bacteria 1213
1025 nmdc:mga06z11_34181_c1 3300050494 Bacteria 2494
1026 nmdc:mga06z11_80032_c1 3300050494 Bacteria 1751
1027 nmdc:mga04h51_9044_c1 3300050495 Bacteria 2685
1028 nmdc:mga07m45_110530_c1 3300050496 Bacteria 1583
1029 nmdc:mga07m45_14825_c1 3300050496 Bacteria 2056
1030 nmdc:mga07m45_1517_c1 3300050496 Bacteria 10644
1031 nmdc:mga07m45_18156_c1 3300050496 Bacteria 3791
1032 nmdc:mga07m45_25005_c1 3300050496 Bacteria 1239
1033 nmdc:mga07m45_32728_c1 3300050496 Bacteria 2884
1034 nmdc:mga07m45_43356_c1 3300050496 Bacteria 2522
1035 nmdc:mga07m45_54331_c1 3300050496 Bacteria 2264
1036 nmdc:mga07m45_61286_c1 3300050496 Bacteria 2131
1037 nmdc:mga07m45_7007_c1 3300050496 Bacteria 5734
1038 nmdc:mga09592_176549_c1 3300050508 Bacteria 1847
1039 nmdc:mga09592_819_c1 3300050508 Bacteria 24059
1040 nmdc:mga0qj67_191552_c1 3300050509 Bacteria 1662
1041 nmdc:mga0sz30_26990_c2 3300050516 Bacteria 1999
1042 Ga0495601_0055940 3300053077 Bacteria 2498
1043 Ga0495612_0039580 3300053078 Bacteria 1918
1044 Ga0495595_0057445 3300053084 Bacteria 1815
1045 Ga0500647_0117247 3300053091 Bacteria 1262
1046 Ga0500583_0104323 3300053092 Bacteria 1391
1047 Ga0500651_0080149 3300053093 Bacteria 2022
1048 Ga0500650_0073375 3300053098 Bacteria 1600
1049 Ga0500593_001896 3300053117 Bacteria 7524
1050 Ga0500593_007810 3300053117 Bacteria 4373
1051 Ga0500594_0001004 3300053118 Bacteria 6050
1052 Ga0500595_003933 3300053119 Bacteria 6805
1053 Ga0500618_000765 3300053125 Bacteria 18166
1054 Ga0500618_001461 3300053125 Bacteria 10499
1055 Ga0500658_0008109 3300053134 Bacteria 3883
1056 Ga0500559_0000694 3300053136 Bacteria 22155
1057 Ga0500564_019933 3300053138 Bacteria 3069
1058 Ga0500568_0033439 3300053139 Bacteria 2109
1059 Ga0500590_023706 3300053148 Bacteria 3185
1060 Ga0500619_003712 3300053154 Bacteria 3171
1061 Ga0500622_0002460 3300053156 Bacteria 13355
1062 Ga0500622_0005187 3300053156 Bacteria 7891
1063 Ga0500587_003270 3300053739 Bacteria 2274
1064 Ga0587098_001158 3300059604 Bacteria 1938
1065 Ga0587067_000132 3300059640 Bacteria 5020
1066 Ga0587072_000426 3300059643 Bacteria 4190
1067 Ga0530510_0350864 3300061734 Bacteria 1108
1068 2501073722 2501025501 Bacteria 7768574
1069 2501078483 2501025502 Bacteria 9641094
1070 2501410241 2501025504 Bacteria 8008976
1071 2511090177 2510917013 Bacteria 9951648
1072 2511095559 2510917014 Bacteria 8296963
1073 2511102196 2510917015 Bacteria 7950052
1074 2511249570 2511231003 Bacteria 5606035
1075 2511384104 2511231026 Bacteria 5225445
1076 2513554616 2513237082 Bacteria 8640282
1077 2513563567 2513237083 Bacteria 8410967
1078 2513957329 2513237150 Bacteria 6553639
1079 2514044772 2513237165 Bacteria 6771773
1080 2514050637 2513237166 Bacteria 10373764
1081 2515688179 2515154123 Bacteria 6387382
1082 2516018595 2515154189 Bacteria 9629850
1083 2519457415 2519103095 Bacteria 6629912
1084 2521560228 2521172590 Bacteria 5047645
1085 2547376340 2547132103 Bacteria 5115736
1086 2550695367 2548876994 Bacteria 4904866
1087 2553005030 2551306416 Bacteria 6152985
1088 2563055625 2562617112 Bacteria 10918404
1089 2585292034 2582581311 Bacteria 6763856
1090 2587725981 2585428057 Bacteria 6737412
1091 2587735643 2585428058 Bacteria 6853932
1092 2588292810 2588253510 Bacteria 6901809
1093 2597029377 2596583598 Bacteria 5251611
1094 2599447397 2599185178 Bacteria 5365746
1095 2600813160 2600255067 Bacteria 6795583
1096 2643744130 2643221544 Bacteria 5886209
1097 2643932397 2643221585 Bacteria 5812563
1098 2643967918 2643221592 Bacteria 6608788
1099 2644028182 2643221603 Bacteria 6147767
1100 2644143182 2643221625 Bacteria 6512927
1101 2644219799 2643221639 Bacteria 6649903
1102 2644256270 2643221646 Bacteria 6433402
1103 2644271730 2643221648 Bacteria 6521465
1104 2644301121 2643221654 Bacteria 5273570
1105 2644313648 2643221656 Bacteria 5809961
1106 2644338510 2643221660 Bacteria 4208257
1107 2713478727 2711768613 Bacteria 11048459
1108 2723875888 2721755763 Bacteria 4464185
1109 2739054699 2738541337 Bacteria 6183410
1110 2739249710 2738543013 Bacteria 5618633
1111 2753568769 2751185846 Bacteria 7242164
1112 2765571400 2765235838 Bacteria 5445269
1113 2792836902 2791355137 Bacteria 9654227
1114 2808982437 2808606386 Bacteria 4471946
1115 2809129736 2808606415 Bacteria 4576710
1116 2809149209 2808606419 Bacteria 4576925
1117 2817259609 2816332253 Bacteria 6764532
1118 2817277276 2816332256 Bacteria 6891714
1119 2817452248 2816332286 Bacteria 6853759
1120 2819542336 2818991436 Bacteria 5376622
1121 2819592953 2818991445 Bacteria 4955017
1122 2819616585 2818991449 Bacteria 5518009
1123 2831867658 2831864461 Bacteria 6502356
1124 2834644221 2834641062 Bacteria 5559922
1125 2839098688 2839094727 Bacteria 5534556
1126 2842717422 2842711865 Bacteria 7155354
1127 2843694597 2843690924 Bacteria 5169057
1128 2846035025 2846033681 Bacteria 4377894
1129 2852619350 2852618963 Bacteria 4577824
1130 2856292321 2856287931 Bacteria 7223934
1131 2857365466 2857357740 Bacteria 9937880
1132 2858698061 2858688981 Bacteria 8184122
1133 2883096222 2883087390 Bacteria 9532701
1134 2884812065 2884811622 Bacteria 5552861
1135 2884838535 2884836552 Bacteria 5219991
1136 2884854826 2884852848 Bacteria 5221161
1137 2886849101 2886848708 Bacteria 5632523
1138 2886850283 2886848708 Bacteria 5632523
1139 2886850446 2886848708 Bacteria 5632523
1140 2886853446 2886848708 Bacteria 5632523
1141 2894024001 2894023352 Bacteria 5167372
1142 2896156505 2896154374 Bacteria 5221518
1143 2901304086 2901300506 Bacteria 8463898
1144 2904440731 2904439833 Bacteria 5931679
1145 2904535330 2904530477 Bacteria 5876334
1146 2904589191 2904584206 Bacteria 6028872
1147 2904594591 2904589729 Bacteria 6113573
1148 2904605818 2904601388 Bacteria 5884906
1149 2919048896 2919046199 Bacteria 5567169
1150 2919084099 2919079590 Bacteria 5946433
1151 2921653674 2921643360 Bacteria 11448031
1152 2923513981 2923510766 Bacteria 5926163
1153 2928060769 2928058823 Bacteria 5520022
1154 2928134745 2928130867 Bacteria 5467269
1155 2928170282 2928163908 Bacteria 7561269
1156 644746524 644736347 Bacteria 6476522
1157 8003401927 8003400568 Bacteria 5535898
1158 8003960314 8003955200 Bacteria 8601927
1159 8020812577 8020807995 Bacteria 6801506
1160 8040172493 8040167225 Bacteria 6542727
1161 8040177097 8040173305 Bacteria 6827067
1162 8048747194 8048746797 Bacteria 3557226
1163 Ga0373937_0084748
1164 JGI24741J21665_1000659
1165 JGI24740J21852_10003369
1166 JGI25155J39150_1000249
1167 JGI25155J39150_1000328
1168 JGI25155J39150_1000403
1169 JGI25156J39149_1000117
1170 JGI25156J39149_1001439
1171 JGI25162J39368_1000148
1172 JGI25162J39368_1004924
1173 JGI25154J39366_1000107
1174 JGI25154J39366_1000440
1175 JGI25154J39366_1000661
1176 JGI25157J39369_1000884
1177 JGI25151J46595_10001412
1178 JGI25151J46595_10012502
1179 JGI25165J46597_1000030
1180 rootH1_10009708
1181 rootH1_10046862
1182 rootH1_10091210
1183 rootH2_10003807
1184 rootL2_10001066
1185 rootL2_10044783
1186 rootL2_10093618
1187 rootL2_10123098
1188 JGI26128J50194_1001242
1189 JGI25160J50197_1000367
1190 Ga0006556J51387_1023961
1191 Ga0006560J51390_1017447
1192 Ga0055538_1000017
1193 Ga0055538_1000085
1194 Ga0055538_1003429
1195 Ga0055539_1000022
1196 Ga0055539_1000126
1197 Ga0055539_1000214
1198 Ga0055533_1000030
1199 Ga0055533_1000133
1200 Ga0055533_1000605
1201 Ga0055533_1001088
1202 Ga0055532_1000040
1203 Ga0055532_1000044
1204 Ga0055525_1000034
1205 Ga0055525_1000054
1206 Ga0055525_1000174
1207 Ga0055525_1000420
1208 Ga0055535_1000029
1209 Ga0055542_1006798
1210 Ga0055529_1000055
1211 Ga0055529_1000945
1212 Ga0055526_1002077
1213 Ga0055526_1003730
1214 Ga0055526_1007791
1215 Ga0055537_1000114
1216 Ga0055524_1000550
1217 Ga0055524_1001670
1218 Ga0055524_1013761
1219 Ga0055524_1015430
1220 Ga0055536_1000031
1221 Ga0055534_1000259
1222 Ga0055534_1001330
1223 Ga0055534_1002212
1224 Ga0055534_1004644
1225 Ga0055528_1000059
1226 Ga0055531_10000042
1227 Ga0055541_1000015
1228 Ga0055541_1000085
1229 Ga0055541_1000760
1230 Ga0065165_1000474
1231 Ga0065165_1000621
1232 Ga0065165_1001219
1233 Ga0065165_1001544
1234 Ga0070658_10027022
1235 Ga0070658_10561836
1236 Ga0070676_10000434
1237 Ga0070690_100001931
1238 Ga0070670_100011920
1239 Ga0070670_100023566
1240 Ga0070670_100024473
1241 Ga0070670_100030033
1242 Ga0070670_100057768
1243 Ga0070670_100139592
1244 Ga0070670_100309540
1245 Ga0070670_100420808
1246 Ga0070677_10002998
1247 Ga0070677_10088019
1248 Ga0070677_10134184
1249 Ga0068869_100035950
1250 Ga0068869_100052968
1251 Ga0068869_100073084
1252 Ga0068869_100150690
1253 Ga0070666_10002319
1254 Ga0070666_10143697
1255 Ga0070666_10255356
1256 Ga0070680_100001090
1257 Ga0070682_100064094
1258 Ga0068868_100002885
1259 Ga0068868_100022383
1260 Ga0068868_100045059
1261 Ga0068868_100211881
1262 Ga0068868_100235499
1263 Ga0070660_100062262
1264 Ga0070660_100181019
1265 Ga0070689_100140805
1266 Ga0070689_100189617
1267 Ga0070689_100262479
1268 Ga0070687_100001074
1269 Ga0070661_100000037
1270 Ga0070668_100000210
1271 Ga0070668_100047815
1272 Ga0070668_100169199
1273 Ga0070669_100000370
1274 Ga0070669_100030221
1275 Ga0070669_100152920
1276 Ga0070669_100277617
1277 Ga0070675_100000692
1278 Ga0070675_100014685
1279 Ga0070675_100024652
1280 Ga0070675_100171157
1281 Ga0070675_100441032
1282 Ga0070671_100001030
1283 Ga0070671_100025332
1284 Ga0070671_100048387
1285 Ga0070671_100052291
1286 Ga0070671_100103137
1287 Ga0070671_100148744
1288 Ga0070671_100189936
1289 Ga0070674_100001560
1290 Ga0070674_100017826
1291 Ga0070674_100031238
1292 Ga0070674_100353523
1293 Ga0070673_100005042
1294 Ga0070673_100017993
1295 Ga0070673_100044461
1296 Ga0070688_100072165
1297 Ga0070659_100000268
1298 Ga0070667_100000294
1299 Ga0070667_100003264
1300 Ga0070667_100022091
1301 Ga0070667_100137649
1302 Ga0070667_100144573
1303 Ga0070667_100369742
1304 Ga0070667_100398929
1305 Ga0070713_100095071
1306 Ga0070701_10065313
1307 Ga0070708_100639403
1308 Ga0070663_100000001
1309 Ga0070678_100002211
1310 Ga0070678_100004854
1311 Ga0070678_100064650
1312 Ga0070678_100091383
1313 Ga0070678_100208545
1314 Ga0070662_100014012
1315 Ga0070662_100046171
1316 Ga0070662_100076345
1317 Ga0070662_100195539
1318 Ga0068867_100001702
1319 Ga0068867_100002661
1320 Ga0068867_100008359
1321 Ga0068867_100025546
1322 Ga0068867_100034937
1323 Ga0068867_100127994
1324 Ga0068867_100184109
1325 Ga0068867_100203951
1326 Ga0068867_100240701
1327 Ga0070706_100003301
1328 Ga0070707_100035771
1329 Ga0068853_100009360
1330 Ga0068853_100478194
1331 Ga0070672_100000286
1332 Ga0070672_100000712
1333 Ga0070672_100006372
1334 Ga0070672_100018646
1335 Ga0070672_100027706
1336 Ga0070672_100109913
1337 Ga0070686_100247415
1338 Ga0070693_100032105
1339 Ga0070665_100330310
1340 Ga0070665_100639660
1341 Ga0068855_100005276
1342 Ga0068855_100147077
1343 Ga0068855_100170676
1344 Ga0068855_100175969
1345 Ga0068855_100354541
1346 Ga0070664_100000006
1347 Ga0070664_100262573
1348 Ga0068857_100048044
1349 Ga0068857_100097295
1350 Ga0068857_100122293
1351 Ga0068857_100299431
1352 Ga0068854_100002991
1353 Ga0068854_100061897
1354 Ga0068854_100173028
1355 Ga0068856_100000032
1356 Ga0070702_100172958
1357 Ga0070702_100254733
1358 Ga0068852_100006988
1359 Ga0068852_100024872
1360 Ga0068852_100054367
1361 Ga0068852_100071258
1362 Ga0068852_100170213
1363 Ga0068852_100477932
1364 Ga0068859_100120053
1365 Ga0068859_100176440
1366 Ga0068859_100378623
1367 Ga0068864_100000417
1368 Ga0068864_100018136
1369 Ga0068864_100071218
1370 Ga0068864_100110450
1371 Ga0068864_100569551
1372 Ga0068866_10005226
1373 Ga0068861_100000398
1374 Ga0068861_100010875
1375 Ga0068861_100027316
1376 Ga0068861_100173269
1377 Ga0068851_10008763
1378 Ga0068870_10055112
1379 Ga0068870_10221762
1380 Ga0068863_100000638
1381 Ga0068863_100021605
1382 Ga0068863_100095002
1383 Ga0068863_100116242
1384 Ga0068863_100116455
1385 Ga0068858_100000623
1386 Ga0068858_100004551
1387 Ga0068858_100042716
1388 Ga0068858_100353339
1389 Ga0068860_100001020
1390 Ga0068860_100002539
1391 Ga0068860_100047148
1392 Ga0068862_100003087
1393 Ga0068862_100039734
1394 Ga0068862_100053450
1395 Ga0068862_100098908
1396 Ga0075368_10010902
1397 Ga0075368_10015811
1398 Ga0075363_100086454
1399 Ga0075364_10067075
1400 Ga0075362_10018818
1401 Ga0075367_10027649
1402 Ga0075367_10048135
1403 Ga0075366_10003944
1404 Ga0075366_10004375
1405 Ga0075366_10004423
1406 Ga0075366_10016373
1407 Ga0075366_10027032
1408 Ga0075366_10065018
1409 Ga0075366_10085433
1410 Ga0075366_10209799
1411 Ga0097621_100010671
1412 Ga0097621_100031314
1413 Ga0097621_100138552
1414 Ga0097621_100253122
1415 Ga0097621_100260001
1416 Ga0075370_10000291
1417 Ga0075370_10000595
1418 Ga0075370_10006650
1419 Ga0075370_10027042
1420 Ga0075370_10041151
1421 Ga0068871_100094720
1422 Ga0068871_100257770
1423 Ga0075430_100211114
1424 Ga0075434_100685126
1425 Ga0075429_100000224
1426 Ga0068865_100000504
1427 Ga0068865_100006531
1428 Ga0068865_100051687
1429 Ga0068865_100104594
1430 Ga0097620_100120048
1431 Ga0097620_100176445
1432 Ga0097620_100378658
1433 Ga0099823_1000559
1434 Ga0079104_1010957
1435 Ga0105251_10072277
1436 Ga0105251_10149572
1437 Ga0105240_10015068
1438 Ga0105240_10022053
1439 Ga0105240_10077623
1440 Ga0105240_10174543
1441 Ga0105240_10196467
1442 Ga0105240_10295608
1443 Ga0105240_10413203
1444 Ga0105240_10413204
1445 Ga0105245_10012144
1446 Ga0105245_10046369
1447 Ga0105245_10197412
1448 Ga0114129_10975478
1449 Ga0105243_10006497
1450 Ga0105243_10039272
1451 Ga0105243_10107642
1452 Ga0105243_10119821
1453 Ga0105241_10348034
1454 Ga0105242_10018196
1455 Ga0105248_10027320
1456 Ga0105248_10116277
1457 Ga0105248_10150457
1458 Ga0105237_10033144
1459 Ga0105237_10080569
1460 Ga0105237_10097519
1461 Ga0105238_10000038
1462 Ga0105238_10007405
1463 Ga0105249_10002938
1464 Ga0105249_10052983
1465 Ga0105249_10166150
1466 Ga0105239_10004364
1467 Ga0105239_10138089
1468 Ga0157319_1000005
1469 Ga0157373_10079106
1470 Ga0157373_10080356
1471 Ga0157373_10364764
1472 Ga0157371_10000106
1473 Ga0157370_10000062
1474 Ga0157369_10019944
1475 Ga0157374_10024366
1476 Ga0157374_10130406
1477 Ga0157374_10253714
1478 Ga0157378_10053754
1479 Ga0157378_10382849
1480 Ga0157378_10736485
1481 Ga0163162_10000701
1482 Ga0163162_10051946
1483 Ga0163162_10274052
1484 Ga0163162_10525009
1485 Ga0163162_10563620
1486 Ga0157372_10000108
1487 Ga0157372_10107117
1488 Ga0157375_10006514
1489 Ga0157375_10009924
1490 Ga0157375_10153266
1491 Ga0163163_10195108
1492 Ga0163163_10205725
1493 Ga0163163_10231195
1494 Ga0157380_10000472
1495 Ga0157380_10033017
1496 Ga0157380_10145419
1497 Ga0182008_10042885
1498 Ga0182008_10112057
1499 Ga0157377_10000034
1500 Ga0157377_10039116
1501 Ga0157379_10001128
1502 Ga0157379_10002106
1503 Ga0157379_10005918
1504 Ga0157379_10050097
1505 Ga0157379_10072142
1506 Ga0157379_10422105
1507 Ga0157376_10021689
1508 Ga0157376_10039629
1509 Ga0157376_10185936
1510 Ga0157376_10236372
1511 Ga0157376_10360986
1512 Ga0157376_10552731
1513 Ga0182006_1001438
1514 Ga0182006_1012816
1515 Ga0182006_1020296
1516 Ga0182006_1028442
1517 Ga0182006_1076641
1518 Ga0182007_10013248
1519 Ga0182007_10020262
1520 Ga0182005_1000142
1521 Ga0183361_10001
1522 Ga0163161_10001102
1523 Ga0163161_10012016
1524 Ga0163161_10076474
1525 Ga0206355_1625393
1526 Ga0206351_10698205
1527 Ga0154015_1545624
1528 Ga0213872_10000861
1529 Ga0213872_10000883
1530 Ga0213872_10000982
1531 Ga0213872_10004235
1532 Ga0213872_10006327
1533 Ga0213872_10007165
1534 Ga0209435_100004
1535 Ga0209435_100891
1536 Ga0209760_101145
1537 Ga0209784_100006
1538 Ga0209784_100021
1539 Ga0209784_100034
1540 Ga0209784_100559
1541 Ga0209566_100002
1542 Ga0209566_100038
1543 Ga0209566_100039
1544 Ga0209566_100678
1545 Ga0209566_102039
1546 Ga0209566_102609
1547 Ga0209674_100010
1548 Ga0209674_100036
1549 Ga0209674_100056
1550 Ga0209674_100060
1551 Ga0209674_100076
1552 Ga0209674_106794
1553 Ga0209672_101956
1554 Ga0209672_108353
1555 Ga0209147_100011
1556 Ga0209147_100018
1557 Ga0209563_100040
1558 Ga0209563_100041
1559 Ga0209563_100057
1560 Ga0209563_100075
1561 Ga0209563_106287
1562 Ga0207427_103609
1563 Ga0209437_100071
1564 Ga0209437_100393
1565 Ga0209258_100028
1566 Ga0209258_106057
1567 Ga0209646_1000043
1568 Ga0209646_1000149
1569 Ga0209646_1000191
1570 Ga0209646_1000233
1571 Ga0209026_1000066
1572 Ga0209026_1002225
1573 Ga0209026_1009862
1574 Ga0209677_100007
1575 Ga0209677_100023
1576 Ga0209677_100035
1577 Ga0209677_102676
1578 Ga0209148_1000162
1579 Ga0209759_1000072
1580 Ga0209759_1000182
1581 Ga0209759_1001347
1582 Ga0209759_1003723
1583 Ga0209129_1004031
1584 Ga0209233_1000094
1585 Ga0209565_1000032
1586 Ga0209565_1000611
1587 Ga0207666_1013333
1588 Ga0209455_1000065
1589 Ga0209455_1001116
1590 Ga0209455_1010351
1591 Ga0209673_1000029
1592 Ga0209673_1004669
1593 Ga0209673_1009458
1594 Ga0209675_1000019
1595 Ga0209675_1000231
1596 Ga0209675_1001472
1597 Ga0209675_1009719
1598 Ga0209676_1000036
1599 Ga0209025_1000345
1600 Ga0209025_1000860
1601 Ga0209025_1000885
1602 Ga0209025_1002236
1603 Ga0209025_1003617
1604 Ga0209025_1020816
1605 Ga0209564_1000021
1606 Ga0209564_1000291
1607 Ga0209564_1001814
1608 Ga0209564_1002897
1609 Ga0209564_1003347
1610 Ga0209758_1014888
1611 Ga0209050_1001572
1612 Ga0209256_1000244
1613 Ga0209256_1000309
1614 Ga0209256_1001175
1615 Ga0209256_1003136
1616 Ga0209256_1012735
1617 Ga0207426_1000007
1618 Ga0209051_1002025
1619 Ga0209051_1003442
1620 Ga0209257_1000016
1621 Ga0209257_1000981
1622 Ga0209257_1003659
1623 Ga0209257_1021536
1624 Ga0207697_10005788
1625 Ga0207656_10007965
1626 Ga0207656_10049107
1627 Ga0207713_1077262
1628 Ga0207682_10001283
1629 Ga0207682_10066783
1630 Ga0207682_10067497
1631 Ga0207682_10128893
1632 Ga0207642_10005579
1633 Ga0207642_10014175
1634 Ga0207642_10041206
1635 Ga0207688_10055694
1636 Ga0207680_10002133
1637 Ga0207680_10048731
1638 Ga0207680_10283664
1639 Ga0207647_10053550
1640 Ga0207645_10001321
1641 Ga0207645_10002041
1642 Ga0207645_10004182
1643 Ga0207645_10034575
1644 Ga0207645_10163414
1645 Ga0207643_10159082
1646 Ga0207643_10263413
1647 Ga0207705_10053592
1648 Ga0207684_10012702
1649 Ga0207654_10065427
1650 Ga0207695_10000979
1651 Ga0207695_10001817
1652 Ga0207695_10002079
1653 Ga0207695_10082442
1654 Ga0207695_10108766
1655 Ga0207695_10550327
1656 Ga0207671_10001710
1657 Ga0207671_10182234
1658 Ga0207660_10006825
1659 Ga0207662_10163295
1660 Ga0207657_10127064
1661 Ga0207649_10000477
1662 Ga0207649_10095109
1663 Ga0207681_10001157
1664 Ga0207681_10012075
1665 Ga0207694_10000069
1666 Ga0207694_10011272
1667 Ga0207694_10025608
1668 Ga0207694_10145325
1669 Ga0207650_10000603
1670 Ga0207650_10001006
1671 Ga0207650_10032175
1672 Ga0207650_10048101
1673 Ga0207650_10320901
1674 Ga0207659_10000488
1675 Ga0207659_10003135
1676 Ga0207659_10033524
1677 Ga0207659_10038095
1678 Ga0207659_10162824
1679 Ga0207687_10019791
1680 Ga0207687_10022125
1681 Ga0207700_10059448
1682 Ga0207644_10019134
1683 Ga0207644_10021105
1684 Ga0207644_10043820
1685 Ga0207644_10183703
1686 Ga0207644_10386487
1687 Ga0207690_10001542
1688 Ga0207690_10061546
1689 Ga0207706_10005604
1690 Ga0207706_10023257
1691 Ga0207706_10067960
1692 Ga0207686_10161890
1693 Ga0207709_10022617
1694 Ga0207709_10077907
1695 Ga0207709_10166238
1696 Ga0207670_10137243
1697 Ga0207670_10137759
1698 Ga0207669_10002675
1699 Ga0207669_10010185
1700 Ga0207704_10002511
1701 Ga0207704_10003713
1702 Ga0207704_10164572
1703 Ga0207665_10275322
1704 Ga0207691_10001925
1705 Ga0207691_10002589
1706 Ga0207691_10026069
1707 Ga0207691_10029199
1708 Ga0207691_10044567
1709 Ga0207691_10066955
1710 Ga0207691_10076817
1711 Ga0207691_10105579
1712 Ga0207711_10009121
1713 Ga0207711_10057113
1714 Ga0207711_10469707
1715 Ga0207711_10604105
1716 Ga0207689_10000415
1717 Ga0207689_10032225
1718 Ga0207689_10205596
1719 Ga0207689_10217162
1720 Ga0207661_10146534
1721 Ga0207679_10000012
1722 Ga0207679_10021183
1723 Ga0207679_10072028
1724 Ga0207679_10368181
1725 Ga0207667_10000043
1726 Ga0207667_10025668
1727 Ga0207667_10066892
1728 Ga0207667_10268643
1729 Ga0207651_10031644
1730 Ga0207651_10062810
1731 Ga0207712_10002826
1732 Ga0207712_10046807
1733 Ga0207712_10188467
1734 Ga0207712_10328714
1735 Ga0207668_10257076
1736 Ga0207668_10272165
1737 Ga0207640_10000012
1738 Ga0207640_10007512
1739 Ga0207640_10567072
1740 Ga0207658_10000212
1741 Ga0207658_10006064
1742 Ga0207658_10030972
1743 Ga0207658_10136734
1744 Ga0207658_10534647
1745 Ga0207677_10007613
1746 Ga0207677_10086434
1747 Ga0207677_10107251
1748 Ga0207677_10195898
1749 Ga0207677_10267004
1750 Ga0207703_10002429
1751 Ga0207703_10003032
1752 Ga0207703_10009710
1753 Ga0207703_10413025
1754 Ga0207639_10054234
1755 Ga0207639_10151752
1756 Ga0207639_10166052
1757 Ga0207678_10000009
1758 Ga0207678_10006113
1759 Ga0207678_10063109
1760 Ga0207678_10584938
1761 Ga0207708_10043164
1762 Ga0207702_10000028
1763 Ga0207641_10009276
1764 Ga0207641_10097769
1765 Ga0207641_10153136
1766 Ga0207641_10205166
1767 Ga0207641_10396913
1768 Ga0207648_10000054
1769 Ga0207648_10005336
1770 Ga0207648_10008160
1771 Ga0207648_10037529
1772 Ga0207648_10120747
1773 Ga0207648_10142370
1774 Ga0207648_10251892
1775 Ga0207676_10039147
1776 Ga0207676_10044261
1777 Ga0207676_10057970
1778 Ga0207676_10075167
1779 Ga0207676_10078899
1780 Ga0207676_10083234
1781 Ga0207676_10296744
1782 Ga0207674_10010925
1783 Ga0207674_10068252
1784 Ga0207674_10093730
1785 Ga0207674_10336626
1786 Ga0207674_10573987
1787 Ga0207675_100000177
1788 Ga0207675_100002649
1789 Ga0207675_100006060
1790 Ga0207683_10011037
1791 Ga0207683_10056721
1792 Ga0207683_10105509
1793 Ga0207683_10125588
1794 Ga0207698_10005873
1795 Ga0207698_10006654
1796 Ga0207698_10016463
1797 Ga0207698_10040883
1798 Ga0207698_10104678
1799 Ga0209281_1007147
1800 Ga0209389_1006254
1801 Ga0209996_1007401
1802 Ga0209968_1000442
1803 Ga0209282_1000021
1804 Ga0209813_10097025
1805 Ga0209974_10090038
1806 Ga0207428_10174560
1807 Ga0268266_10254014
1808 Ga0268266_10280483
1809 Ga0268266_10421137
1810 Ga0268265_10038444
1811 Ga0268265_10042591
1812 Ga0268265_10089362
1813 Ga0268265_10103325
1814 Ga0268264_10004393
1815 Ga0268264_10020354
1816 Ga0307517_10012331
1817 Ga0307517_10142360
1818 Ga0307515_10000089
1819 Ga0307515_10000096
1820 Ga0307515_10007484
1821 Ga0307515_10041885
1822 Ga0307515_10080610
1823 Ga0307515_10089153
1824 Ga0307515_10297510
1825 Ga0265338_10000258
1826 Ga0265338_10001135
1827 Ga0265324_10002038
1828 Ga0265324_10035527
1829 Ga0307512_10051922
1830 Ga0307512_10052334
1831 Ga0265332_10049707
1832 Ga0265328_10006255
1833 Ga0265325_10010371
1834 Ga0265331_10006099
1835 Ga0265327_10000080
1836 Ga0265327_10017033
1837 Ga0265316_10309929
1838 Ga0265316_10326724
1839 Ga0307513_10005057
1840 Ga0307513_10016545
1841 Ga0307513_10035292
1842 Ga0307509_10000032
1843 Ga0307509_10001647
1844 Ga0307509_10006706
1845 Ga0307509_10013664
1846 Ga0307408_100000006
1847 Ga0307408_100037196
1848 Ga0307408_100051736
1849 Ga0307508_10000028
1850 Ga0307508_10001377
1851 Ga0307508_10065069
1852 Ga0316575_10000063
1853 Ga0265314_10003091
1854 Ga0265314_10032720
1855 Ga0265314_10043851
1856 Ga0265314_10166143
1857 Ga0307516_10001972
1858 Ga0307516_10177718
1859 Ga0307405_10028317
1860 Ga0307405_10089539
1861 Ga0307405_10413528
1862 Ga0307413_10052421
1863 Ga0307407_10442262
1864 Ga0307412_10034330
1865 Ga0307412_10117010
1866 Ga0307409_100019603
1867 Ga0307409_100084584
1868 Ga0307409_100336573
1869 Ga0307416_100017160
1870 Ga0307416_100032323
1871 Ga0307416_100243962
1872 Ga0307414_10042417
1873 Ga0307414_10333943
1874 Ga0307414_10608346
1875 Ga0307411_10000288
1876 Ga0307411_10006128
1877 Ga0307411_10008111
1878 Ga0307411_10329331
1879 Ga0307415_100109353
1880 Ga0307510_10038927
1881 Ga0307510_10060241
1882 Ga0307510_10094301
1883 Ga0307510_10249400
1884 Ga0307510_10251756
1885 Ga0373934_0074756
1886 Ga0373940_0013736
1887 Ga0373932_0065646
1888 Ga0373939_0000019
1889 Ga0373954_0012937
1890 Ga0373960_0000625
1891 Ga0373943_0211349
1892 Ga0373946_0062880
1893 Ga0373931_0000679
1894 Ga0373931_0048610
1895 Ga0373947_0043758
1896 Ga0373937_0073412
1897 Ga0373937_0094160
1898 Ga0373925_0003513
1899 Ga0395899_0004383
1900 Ga0395899_0175410
1901 Ga0395900_0013773
1902 Ga0395900_0124976
1903 Ga0395900_0195119
1904 Ga0395900_0228891
1905 Ga0395900_0452826
1906 Ga0395898_0012659
1907 Ga0395898_0021873
1908 Ga0395898_0227363
1909 Ga0395905_0000176
1910 Ga0395905_0001424
1911 Ga0395905_0001639
1912 Ga0395905_0003250
1913 Ga0395905_0056444
1914 Ga0395905_0099973
1915 Ga0395905_0182943
1916 Ga0395905_0342059
1917 Ga0436364_1473161
1918 Ga0395901_0007843
1919 Ga0395901_0081520
1920 Ga0395901_0125401
1921 Ga0395901_0258231
1922 Ga0400491_02286
1923 Ga0436361_0004926
1924 Ga0436361_0027317
1925 Ga0436361_0046388
1926 Ga0436361_0799645
1927 Ga0436361_0968600
1928 Ga0436361_1048468
1929 Ga0436362_0709755
1930 Ga0439436_0079053
1931 Ga0439453_0018184
1932 Ga0439461_0007811
1933 Ga0439461_0019390
1934 Ga0451847_0330048
1935 Ga0451853_3142898
1936 Ga0451853_3427827
1937 Ga0450917_000993
1938 Ga0450888_000191
1939 Ga0450890_009711
1940 Ga0450897_005099
1941 Ga0450891_000071
1942 Ga0450903_020238
1943 Ga0450904_008647
1944 Ga0450905_004917
1945 Ga0450889_000069
1946 Ga0439446_0014075
1947 Ga0450909_009486
1948 Ga0439459_0001762
1949 Ga0439460_0012999
1950 Ga0450893_0001280
1951 Ga0451577_0000002
1952 Ga0451577_0001738
1953 Ga0451577_0002438
1954 Ga0451577_0022885
1955 Ga0451577_0033629
1956 Ga0451577_0174819
1957 Ga0451577_0235067
1958 Ga0451577_0273374
1959 Ga0451577_0273461
1960 Ga0451577_0312740
1961 Ga0451577_0344687
1962 Ga0451577_0395006
1963 Ga0451577_0583350
1964 Ga0466986_0063558
1965 Ga0466969_0000929
1966 Ga0466969_0044748
1967 Ga0466977_0000690
1968 Ga0453683_0000013
1969 Ga0466965_0000237
1970 Ga0466966_0002735
1971 Ga0466966_0120370
1972 Ga0466961_0012022
1973 Ga0466961_0142232
1974 Ga0466963_0016316
1975 Ga0466963_0031985
1976 Ga0453684_0000002
1977 Ga0453684_0005486
1978 Ga0453684_0008430
1979 Ga0453684_0034698
1980 Ga0453684_0042904
1981 Ga0453684_0093099
1982 Ga0453684_0117420
1983 Ga0453684_0159885
1984 Ga0453684_0316764
1985 Ga0453684_0454880
1986 Ga0466971_0002984
1987 Ga0466968_0004214
1988 Ga0466970_0027008
1989 Ga0466957_0000447
1990 Ga0466957_0125266
1991 Ga0466959_0027748
1992 Ga0466959_0073287
1993 Ga0451576_0000037
1994 Ga0451576_0001760
1995 Ga0451576_0002464
1996 Ga0451576_0009103
1997 Ga0451576_0015201
1998 Ga0451576_0021486
1999 Ga0451576_0111564
2000 Ga0451576_0118778
2001 Ga0451576_0168250
2002 Ga0451576_0202520
2003 Ga0451576_0261405
2004 Ga0466958_0090299
2005 Ga0466958_0151304
2006 Ga0466967_0546697
2007 Ga0495592_0019120
2008 Ga0495592_0034924
2009 Ga0495592_0188472
2010 Ga0495590_0003935
2011 Ga0495590_0036912
2012 Ga0495590_0062264
2013 Ga0495629_0047432
2014 Ga0495638_0062244
2015 Ga0495651_0005769
2016 Ga0495651_0072318
2017 Ga0495651_0221611
2018 Ga0495653_0034300
2019 Ga0495650_0024295
2020 Ga0495650_0061097
2021 Ga0495582_0042043
2022 Ga0495605_0006736
2023 Ga0495605_0061328
2024 Ga0495664_0325460
2025 Ga0495584_0010102
2026 Ga0495596_0000385
2027 Ga0495596_0134958
2028 Ga0495607_0077829
2029 Ga0495583_0040632
2030 Ga0495606_0012870
2031 Ga0495608_0265627
2032 Ga0495610_0009756
2033 Ga0495616_0003889
2034 Ga0495620_0031763
2035 Ga0495628_0001234
2036 Ga0495628_0048653
2037 Ga0495628_0064766
2038 Ga0495630_0041291
2039 Ga0495632_0009387
2040 Ga0495642_0022222
2041 Ga0495642_0033764
2042 Ga0495652_0123393
2043 Ga0495652_0223499
2044 Ga0495609_0000136
2045 Ga0495609_0001940
2046 Ga0495609_0068091
2047 Ga0495621_0006088
2048 Ga0495597_0012048
2049 Ga0495645_0026599
2050 Ga0495633_0040028
2051 Ga0495667_0129864
2052 Ga0495668_0000029
2053 Ga0495668_0033309
2054 Ga0495668_0085564
2055 Ga0495625_0002966
2056 Ga0495625_0022770
2057 Ga0495625_0033839
2058 Ga0495635_0061843
2059 Ga0495646_0004580
2060 Ga0495646_0070868
2061 Ga0495647_0068643
2062 Ga0495669_0001803
2063 Ga0495670_0026463
2064 Ga0495671_0125627
2065 Ga0495649_0000541
2066 Ga0495649_0059878
2067 Ga0495589_0071998
2068 Ga0495600_0065179
2069 Ga0495600_0110953
2070 Ga0495660_0063546
2071 Ga0495660_0108014
2072 Ga0495604_0149320
2073 Ga0495636_0008030
2074 Ga0495636_0022950
2075 Ga0495674_0013839
2076 Ga0495683_0196721
2077 Ga0495687_001991
2078 Ga0495687_006560
2079 Ga0495687_014896
2080 Ga0495687_062118
2081 Ga0495679_006268
2082 Ga0495685_008022
2083 Ga0495673_0146820
2084 Ga0495681_0014798
2085 Ga0495684_0062323
2086 Ga0495686_0007111
2087 Ga0495593_0056385
2088 Ga0495602_0144374
2089 Ga0495602_0170371
2090 Ga0495626_0089455
2091 Ga0496100_0023701
2092 Ga0496100_0503784
2093 Ga0496101_0013511
2094 Ga0496101_0195147
2095 Ga0496102_0027430
2096 Ga0496102_0033963
2097 Ga0496103_0055059
2098 Ga0496104_0044408
2099 Ga0496104_0215855
2100 Ga0496104_0279502
2101 Ga0496104_0314276
2102 Ga0496104_0481158
2103 Ga0496105_0110051
2104 Ga0496106_0000011
2105 Ga0496106_0006072
2106 Ga0496106_0459919
2107 Ga0496107_0141916
2108 Ga0496107_0208243
2109 Ga0496108_0017021
2110 Ga0496109_0129150
2111 Ga0496110_0007472
2112 Ga0496111_0205344
2113 Ga0496111_0345940
2114 Ga0496113_0043484
2115 Ga0496114_0007646
2116 Ga0496114_0164755
2117 Ga0496114_0255612
2118 Ga0496115_0007917
2119 Ga0496116_0021901
2120 Ga0496117_0028852
2121 Ga0496118_0041792
2122 Ga0496118_0101239
2123 Ga0496118_0156283
2124 Ga0496119_0110012
2125 Ga0496121_0010887
2126 Ga0496121_0023777
2127 Ga0496121_0042796
2128 Ga0496121_0137378
2129 Ga0496121_0265552
2130 Ga0496122_0003149
2131 Ga0496122_0021327
2132 Ga0496123_0000916
2133 Ga0496123_0027948
2134 Ga0496124_0066161
2135 Ga0496125_0004292
2136 Ga0496126_0002068
2137 Ga0496126_0026637
2138 Ga0496126_0194871
2139 Ga0495682_0084323
2140 Ga0501292_005344
2141 Ga0501297_000437
2142 Ga0501297_001705
2143 Ga0501300_005125
2144 Ga0501318_005591
2145 Ga0501034_0000092
2146 Ga0501043_0000058
2147 Ga0501043_0104737
2148 Ga0501043_0257990
2149 Ga0501046_0000051
2150 Ga0501046_0037420
2151 Ga0501047_0000003
2152 Ga0501047_0027508
2153 Ga0501048_0000321
2154 Ga0501198_000007
2155 Ga0501211_001859
2156 Ga0501222_000005
2157 Ga0501222_000600
2158 Ga0501223_008762
2159 Ga0501235_006815
2160 Ga0501221_000150
2161 Ga0501225_0018533
2162 Ga0501232_001083
2163 Ga0501262_001378
2164 Ga0501265_001507
2165 Ga0501267_001311
2166 Ga0501272_004940
2167 Ga0501282_006018
2168 Ga0501283_005329
2169 Ga0501035_0007072
2170 Ga0501035_0208416
2171 Ga0501044_0013104
2172 Ga0501044_0273189
2173 Ga0501045_0075630
2174 Ga0501045_0312017
2175 nmdc:mga03683_113732_c1
2176 nmdc:mga03683_41512_c1
2177 nmdc:mga0yw44_64903_c1
2178 nmdc:mga0k408_121887_c1
2179 nmdc:mga0k408_19056_c1
2180 nmdc:mga0k408_20391_c1
2181 nmdc:mga0k408_23723_c1
2182 nmdc:mga0k408_30466_c1
2183 nmdc:mga0k408_370_c1
2184 nmdc:mga0k408_4315_c1
2185 nmdc:mga06z11_181621_c1
2186 nmdc:mga06z11_34181_c1
2187 nmdc:mga06z11_80032_c1
2188 nmdc:mga04h51_9044_c1
2189 nmdc:mga07m45_110530_c1
2190 nmdc:mga07m45_14825_c1
2191 nmdc:mga07m45_1517_c1
2192 nmdc:mga07m45_18156_c1
2193 nmdc:mga07m45_25005_c1
2194 nmdc:mga07m45_32728_c1
2195 nmdc:mga07m45_43356_c1
2196 nmdc:mga07m45_54331_c1
2197 nmdc:mga07m45_61286_c1
2198 nmdc:mga07m45_7007_c1
2199 nmdc:mga09592_176549_c1
2200 nmdc:mga09592_819_c1
2201 nmdc:mga0qj67_191552_c1
2202 nmdc:mga0sz30_26990_c2
2203 Ga0495601_0055940
2204 Ga0495612_0039580
2205 Ga0495595_0057445
2206 Ga0500647_0117247
2207 Ga0500583_0104323
2208 Ga0500651_0080149
2209 Ga0500650_0073375
2210 Ga0500593_001896
2211 Ga0500593_007810
2212 Ga0500594_0001004
2213 Ga0500595_003933
2214 Ga0500618_000765
2215 Ga0500618_001461
2216 Ga0500658_0008109
2217 Ga0500559_0000694
2218 Ga0500564_019933
2219 Ga0500568_0033439
2220 Ga0500590_023706
2221 Ga0500619_003712
2222 Ga0500622_0002460
2223 Ga0500622_0005187
2224 Ga0500587_003270
2225 Ga0587098_001158
2226 Ga0587067_000132
2227 Ga0587072_000426
2228 Ga0530510_0350864
2229 2501073722
2230 2501078483
2231 2501410241
2232 2511090177
2233 2511095559
2234 2511102196
2235 2511249570
2236 2511384104
2237 2513554616
2238 2513563567
2239 2513957329
2240 2514044772
2241 2514050637
2242 2515688179
2243 2516018595
2244 2519457415
2245 2521560228
2246 2547376340
2247 2550695367
2248 2553005030
2249 2563055625
2250 2585292034
2251 2587725981
2252 2587735643
2253 2588292810
2254 2597029377
2255 2599447397
2256 2600813160
2257 2643744130
2258 2643932397
2259 2643967918
2260 2644028182
2261 2644143182
2262 2644219799
2263 2644256270
2264 2644271730
2265 2644301121
2266 2644313648
2267 2644338510
2268 2713478727
2269 2723875888
2270 2739054699
2271 2739249710
2272 2753568769
2273 2765571400
2274 2792836902
2275 2808982437
2276 2809129736
2277 2809149209
2278 2817259609
2279 2817277276
2280 2817452248
2281 2819542336
2282 2819592953
2283 2819616585
2284 2831867658
2285 2834644221
2286 2839098688
2287 2842717422
2288 2843694597
2289 2846035025
2290 2852619350
2291 2856292321
2292 2857365466
2293 2858698061
2294 2883096222
2295 2884812065
2296 2884838535
2297 2884854826
2298 2886849101
2299 2886850283
2300 2886850446
2301 2886853446
2302 2894024001
2303 2896156505
2304 2901304086
2305 2904440731
2306 2904535330
2307 2904589191
2308 2904594591
2309 2904605818
2310 2919048896
2311 2919084099
2312 2921653674
2313 2923513981
2314 2928060769
2315 2928134745
2316 2928170282
2317 644746524
2318 8003401927
2319 8003960314
2320 8020812577
2321 8040172493
2322 8040177097
2323 8048747194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

4

278

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zpt-assembly1.cif.gz_A escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 0.9621 3 275
7th5-assembly1.cif.gz_B thermus thermophilus methylenetetrahydrofolate reductase 0.958 1 275
8eac-assembly1.cif.gz_B thermus thermophilus methylenetetrahydrofolate reductase 0.9562 4 275
3fst-assembly1.cif.gz_C crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 0.9556 4 275
3fst-assembly1.cif.gz_E crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 0.9529 3 275
ID Description Score Start End Superfamily
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9509 4 276 3.20.20.220
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9434 3 275 3.20.20.220
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9397 4 275 3.20.20.220
af_Q5AEI0_1_296_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9391 2 275 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9375 4 276 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A537CWC8-F1-model_v4 Methylenetetrahydrofolate reductase 0.9983 166 275 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A3D2SPX2-F1-model_v4 Methylenetetrahydrofolate reductase 0.9983 166 275 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A3D0SQY7-F1-model_v4 Methylenetetrahydrofolate reductase 0.9981 163 276 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A4V1TXD1-F1-model_v4 Methylenetetrahydrofolate reductase 0.9927 150 275 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A3D0K3A7-F1-model_v4 deleted 0.9911 187 276

Map