F491035

General Info

Members Datasets Scaffolds Average Seq Length
1163 495 1162 51

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100561947|Ga0070660_1005619472
Length 57
Sequence VTEAGMRIVYALVMIMGLGAVVADHLASPSSARAVSPEDFAGACAPCGAPCPSAQKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
18 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
137 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
138 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
139 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
140 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
158 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
236 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
252 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
253 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
254 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
255 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
256 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
257 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
258 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
259 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
262 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
263 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
264 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
265 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
266 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
270 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
276 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
281 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
282 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
283 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
285 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
287 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
288 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
292 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
293 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
294 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
295 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
296 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
297 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
298 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
299 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
300 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
301 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
302 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
303 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
304 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
305 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
306 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
307 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
308 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
309 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
310 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
311 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
312 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
313 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
314 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
315 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
320 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
323 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
324 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
325 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
332 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
337 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
338 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
339 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
340 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
344 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
345 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
346 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
347 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
348 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
349 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
350 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
351 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
352 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
353 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
358 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
359 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
360 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
361 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
362 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
363 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
364 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
365 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
366 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
367 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
368 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
369 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
370 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
371 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
372 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
373 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
374 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
375 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
376 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
377 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
378 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
379 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
380 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
381 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
387 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
388 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
389 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
392 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
393 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
394 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
395 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
396 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
397 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
398 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
404 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
405 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
406 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
407 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
408 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
429 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
430 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
431 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
432 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
437 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
438 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
442 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
446 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
447 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
448 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
449 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
450 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
451 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
452 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
453 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
454 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
455 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
456 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
457 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
458 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
459 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
460 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
461 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
462 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
463 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
464 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
465 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
466 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
467 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
468 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
469 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
470 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
471 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
472 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
473 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
474 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
475 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
476 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
477 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
478 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
479 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
480 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
481 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
482 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
483 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
484 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
485 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
486 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
487 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
488 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
489 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
490 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
491 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
492 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
493 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
494 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
495 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0
Rhizoplane 3.18
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1214090 2162886007 Bacteria 1159
2 2214544925 2209111006 Bacteria 18798
3 ARcpr5oldR_c000010 3300000041 Bacteria 39074
4 ARSoilYngRDRAFT_c00196 3300000042 Bacteria 10143
5 ARcpr5yngRDRAFT_c000115 3300000043 Bacteria 12589
6 ARSoilOldRDRAFT_c000011 3300000044 Bacteria 42914
7 ARCol0oldRDRAFT_c01232 3300000045 Bacteria 1823
8 ARCol0yngRDRAFT_1000146 3300000652 Bacteria 12593
9 JGI24739J22299_10259205 3300001989 Bacteria 509
10 JGI24737J22298_10014667 3300001990 Bacteria 2542
11 JGI24750J21931_1090863 3300002070 Bacteria 517
12 JGI25406J46586_10042133 3300003203 Bacteria 1600
13 JGI25153J46596_10076793 3300003215 Bacteria 845
14 JGI26129J50193_1003592 3300003349 Bacteria 1089
15 JGI25404J52841_10002795 3300003659 Bacteria 3361
16 Ga0065717_1009073 3300005276 Bacteria 664
17 Ga0065716_1002355 3300005277 Bacteria 1886
18 Ga0065704_10183801 3300005289 Bacteria 1223
19 Ga0065712_10002020 3300005290 Bacteria 5377
20 Ga0065715_10003793 3300005293 Bacteria 6299
21 Ga0065707_10116796 3300005295 Bacteria 2227
22 Ga0065707_10343487 3300005295 Bacteria 930
23 Ga0070658_10847216 3300005327 Unclassified 794
24 Ga0070658_11112861 3300005327 Bacteria 687
25 Ga0070658_11702795 3300005327 Bacteria 546
26 Ga0070676_10017457 3300005328 Bacteria 3972
27 Ga0070676_10063935 3300005328 Unclassified 2193
28 Ga0070683_100086846 3300005329 Bacteria 2933
29 Ga0070683_100243897 3300005329 Unclassified 1709
30 Ga0070683_101340326 3300005329 Bacteria 688
31 Ga0070690_100022382 3300005330 Bacteria 3867
32 Ga0070690_100176254 3300005330 Bacteria 1475
33 Ga0070690_100348198 3300005330 Bacteria 1075
34 Ga0070690_100766720 3300005330 Bacteria 746
35 Ga0070670_100357373 3300005331 Bacteria 1284
36 Ga0070677_10002078 3300005333 Bacteria 6383
37 Ga0068869_100324936 3300005334 Bacteria 1248
38 Ga0070666_10445212 3300005335 Bacteria 935
39 Ga0070666_10988766 3300005335 Bacteria 624
40 Ga0070680_100008129 3300005336 Bacteria 8013
41 Ga0070680_100021792 3300005336 Bacteria 5096
42 Ga0070680_100114301 3300005336 Bacteria 2249
43 Ga0070680_100392690 3300005336 Bacteria 1182
44 Ga0070680_100754257 3300005336 Bacteria 838
45 Ga0070682_100159994 3300005337 Unclassified 1554
46 Ga0068868_100248350 3300005338 Bacteria 1497
47 Ga0068868_100548965 3300005338 Bacteria 1018
48 Ga0070660_100042110 3300005339 Bacteria 3484
49 Ga0070660_100561947 3300005339 Unclassified 952
50 Ga0070689_100034111 3300005340 Bacteria 3882
51 Ga0070689_100124157 3300005340 Bacteria 2064
52 Ga0070689_101003481 3300005340 Unclassified 743
53 Ga0070689_101343683 3300005340 Bacteria 644
54 Ga0070689_101441850 3300005340 Bacteria 623
55 Ga0070687_100002894 3300005343 Bacteria 6569
56 Ga0070687_100429389 3300005343 Bacteria 874
57 Ga0070661_100333288 3300005344 Unclassified 1187
58 Ga0070661_100349766 3300005344 Bacteria 1159
59 Ga0070661_100740684 3300005344 Bacteria 803
60 Ga0070661_101394325 3300005344 Unclassified 589
61 Ga0070692_10032024 3300005345 Bacteria 2640
62 Ga0070668_100306545 3300005347 Bacteria 1333
63 Ga0070669_100060274 3300005353 Unclassified 2787
64 Ga0070669_100513055 3300005353 Bacteria 996
65 Ga0070675_100024911 3300005354 Bacteria 4795
66 Ga0070675_100056848 3300005354 Unclassified 3225
67 Ga0070675_100235788 3300005354 Bacteria 1597
68 Ga0070671_100072923 3300005355 Bacteria 2867
69 Ga0070671_101392630 3300005355 Bacteria 619
70 Ga0070671_101399153 3300005355 Bacteria 618
71 Ga0070674_100021304 3300005356 Bacteria 4157
72 Ga0070673_100152218 3300005364 Bacteria 1960
73 Ga0070673_100258603 3300005364 Unclassified 1520
74 Ga0070673_100350324 3300005364 Bacteria 1310
75 Ga0070688_100004335 3300005365 Bacteria 7377
76 Ga0070688_100780516 3300005365 Bacteria 746
77 Ga0070688_101045932 3300005365 Bacteria 650
78 Ga0070688_101696642 3300005365 Unclassified 517
79 Ga0070659_100013250 3300005366 Bacteria 6132
80 Ga0070659_101181398 3300005366 Bacteria 676
81 Ga0070659_101416066 3300005366 Bacteria 618
82 Ga0070667_100012258 3300005367 Bacteria 7091
83 Ga0070667_100070526 3300005367 Bacteria 2974
84 Ga0070703_10012592 3300005406 Unclassified 2397
85 Ga0070709_10589086 3300005434 Bacteria 855
86 Ga0070709_10992065 3300005434 Bacteria 668
87 Ga0070714_100033988 3300005435 Bacteria 4269
88 Ga0070714_101307291 3300005435 Bacteria 708
89 Ga0070714_101955220 3300005435 Unclassified 572
90 Ga0070713_100070085 3300005436 Bacteria 2959
91 Ga0070713_101616260 3300005436 Unclassified 629
92 Ga0070710_10581970 3300005437 Bacteria 777
93 Ga0070701_10002296 3300005438 Bacteria 7329
94 Ga0070711_100031787 3300005439 Bacteria 3507
95 Ga0070711_100225952 3300005439 Bacteria 1457
96 Ga0070711_100323548 3300005439 Bacteria 1233
97 Ga0070705_100051740 3300005440 Bacteria 2397
98 Ga0070700_100016513 3300005441 Bacteria 4206
99 Ga0070694_100021216 3300005444 Bacteria 4147
100 Ga0070694_101881352 3300005444 Bacteria 511
101 Ga0070708_100556564 3300005445 Unclassified 1082
102 Ga0070663_100042652 3300005455 Unclassified 3189
103 Ga0070663_100915330 3300005455 Bacteria 758
104 Ga0070678_100059493 3300005456 Bacteria 2808
105 Ga0070678_100338504 3300005456 Bacteria 1290
106 Ga0070662_100021643 3300005457 Bacteria 4393
107 Ga0070662_100073671 3300005457 Bacteria 2524
108 Ga0070662_100499880 3300005457 Bacteria 1014
109 Ga0070662_101097925 3300005457 Bacteria 682
110 Ga0070681_10034403 3300005458 Bacteria 5087
111 Ga0070681_10038531 3300005458 Bacteria 4792
112 Ga0070681_10280762 3300005458 Unclassified 1576
113 Ga0070681_11147386 3300005458 Bacteria 698
114 Ga0070681_11304468 3300005458 Bacteria 649
115 Ga0070681_11857453 3300005458 Bacteria 530
116 Ga0068867_100086031 3300005459 Unclassified 2378
117 Ga0068867_101301038 3300005459 Bacteria 671
118 Ga0068867_101716385 3300005459 Bacteria 589
119 Ga0070685_10074904 3300005466 Unclassified 2015
120 Ga0070685_10225230 3300005466 Bacteria 1230
121 Ga0070685_10740150 3300005466 Bacteria 720
122 Ga0070706_101707530 3300005467 Bacteria 573
123 Ga0070707_100241054 3300005468 Unclassified 1760
124 Ga0070698_102199578 3300005471 Bacteria 505
125 Ga0070679_100023893 3300005530 Bacteria 5989
126 Ga0070679_100185779 3300005530 Bacteria 2049
127 Ga0070679_100342553 3300005530 Bacteria 1443
128 Ga0070679_101062693 3300005530 Unclassified 754
129 Ga0070684_100066522 3300005535 Bacteria 3164
130 Ga0070684_100098652 3300005535 Unclassified 2606
131 Ga0068853_100016002 3300005539 Bacteria 6168
132 Ga0068853_100588724 3300005539 Bacteria 1056
133 Ga0068853_101104213 3300005539 Bacteria 765
134 Ga0068853_101365465 3300005539 Unclassified 685
135 Ga0068853_101468616 3300005539 Bacteria 660
136 Ga0068853_101985081 3300005539 Bacteria 564
137 Ga0070672_100235384 3300005543 Bacteria 1539
138 Ga0070672_100273427 3300005543 Bacteria 1427
139 Ga0070686_100005464 3300005544 Bacteria 7037
140 Ga0070686_100092484 3300005544 Bacteria 2026
141 Ga0070686_100382250 3300005544 Bacteria 1066
142 Ga0070695_100010952 3300005545 Bacteria 5420
143 Ga0070696_100030566 3300005546 Bacteria 3689
144 Ga0070696_100424080 3300005546 Bacteria 1045
145 Ga0070693_100122059 3300005547 Unclassified 1617
146 Ga0070665_100308742 3300005548 Unclassified 1585
147 Ga0070665_100927629 3300005548 Bacteria 883
148 Ga0070704_100015476 3300005549 Bacteria 4792
149 Ga0068855_100364369 3300005563 Bacteria 1590
150 Ga0068855_101822000 3300005563 Bacteria 618
151 Ga0068855_102427093 3300005563 Bacteria 523
152 Ga0070664_100055807 3300005564 Bacteria 3356
153 Ga0070664_100482383 3300005564 Bacteria 1141
154 Ga0068857_100256916 3300005577 Unclassified 1603
155 Ga0068857_100639145 3300005577 Bacteria 1008
156 Ga0068857_100971006 3300005577 Bacteria 817
157 Ga0068857_101792118 3300005577 Bacteria 601
158 Ga0068857_101996283 3300005577 Bacteria 569
159 Ga0068854_101832540 3300005578 Bacteria 557
160 Ga0068854_102128939 3300005578 Bacteria 518
161 Ga0068856_100734966 3300005614 Bacteria 1007
162 Ga0068856_101010213 3300005614 Bacteria 850
163 Ga0070702_100153487 3300005615 Bacteria 1481
164 Ga0070702_101301647 3300005615 Bacteria 590
165 Ga0068852_100107673 3300005616 Bacteria 2529
166 Ga0068859_100016485 3300005617 Bacteria 7420
167 Ga0068859_100328662 3300005617 Bacteria 1623
168 Ga0068864_100143861 3300005618 Bacteria 2153
169 Ga0068864_101534092 3300005618 Bacteria 669
170 Ga0068864_102455977 3300005618 Bacteria 527
171 Ga0068866_10188515 3300005718 Bacteria 1224
172 Ga0068861_100025172 3300005719 Bacteria 4313
173 Ga0068861_100242617 3300005719 Bacteria 1533
174 Ga0068861_102044978 3300005719 Unclassified 572
175 Ga0068861_102240319 3300005719 Bacteria 548
176 Ga0068870_10762329 3300005840 Unclassified 673
177 Ga0068863_101276898 3300005841 Bacteria 741
178 Ga0068858_100021667 3300005842 Bacteria 6006
179 Ga0068858_100022184 3300005842 Bacteria 5929
180 Ga0068858_102004267 3300005842 Unclassified 572
181 Ga0068860_100323614 3300005843 Bacteria 1514
182 Ga0068860_101251682 3300005843 Bacteria 762
183 Ga0068860_101560943 3300005843 Bacteria 682
184 Ga0068860_102053112 3300005843 Bacteria 593
185 Ga0068862_100020703 3300005844 Bacteria 5495
186 Ga0081455_10005815 3300005937 Bacteria 13429
187 Ga0081455_10022516 3300005937 Bacteria 5888
188 Ga0081538_10009018 3300005981 Bacteria 8377
189 Ga0081538_10101327 3300005981 Unclassified 1449
190 Ga0081540_1000075 3300005983 Bacteria 106804
191 Ga0081539_10001975 3300005985 Bacteria 31233
192 Ga0081539_10047978 3300005985 Bacteria 2433
193 Ga0075365_10476354 3300006038 Bacteria 882
194 Ga0075365_10762792 3300006038 Bacteria 683
195 Ga0075365_10773087 3300006038 Bacteria 678
196 Ga0075365_10773670 3300006038 Bacteria 678
197 Ga0075368_10012277 3300006042 Bacteria 3127
198 Ga0075368_10561133 3300006042 Bacteria 514
199 Ga0075368_10588371 3300006042 Bacteria 503
200 Ga0075363_100005447 3300006048 Bacteria 5662
201 Ga0075363_100072719 3300006048 Bacteria 1870
202 Ga0075363_100601611 3300006048 Bacteria 659
203 Ga0075364_10036593 3300006051 Bacteria 3174
204 Ga0075432_10000577 3300006058 Bacteria 11069
205 Ga0075432_10117725 3300006058 Bacteria 995
206 Ga0070715_10227625 3300006163 Bacteria 962
207 Ga0070716_100462006 3300006173 Bacteria 928
208 Ga0070716_100549316 3300006173 Bacteria 861
209 Ga0070716_100708141 3300006173 Bacteria 770
210 Ga0070712_100189311 3300006175 Bacteria 1609
211 Ga0075362_10066001 3300006177 Bacteria 1644
212 Ga0075362_10076370 3300006177 Bacteria 1538
213 Ga0075367_10207894 3300006178 Bacteria 1223
214 Ga0075369_10176798 3300006186 Bacteria 981
215 Ga0075369_10198132 3300006186 Unclassified 926
216 Ga0075366_10001029 3300006195 Bacteria 13679
217 Ga0075366_10036597 3300006195 Bacteria 2894
218 Ga0075366_10211729 3300006195 Bacteria 1180
219 Ga0075366_11024841 3300006195 Bacteria 515
220 Ga0097621_100457846 3300006237 Bacteria 1150
221 Ga0097621_100687644 3300006237 Bacteria 941
222 Ga0075370_10805019 3300006353 Bacteria 573
223 Ga0068871_100041833 3300006358 Bacteria 3676
224 Ga0068871_102402405 3300006358 Bacteria 503
225 Ga0075428_100006232 3300006844 Bacteria 13264
226 Ga0075428_101113511 3300006844 Bacteria 834
227 Ga0075428_101539688 3300006844 Bacteria 696
228 Ga0075430_100000094 3300006846 Bacteria 52204
229 Ga0075430_100638606 3300006846 Bacteria 878
230 Ga0075431_100002415 3300006847 Bacteria 17982
231 Ga0075431_100132392 3300006847 Bacteria 2572
232 Ga0075431_100498158 3300006847 Bacteria 1210
233 Ga0075433_10000311 3300006852 Bacteria 29567
234 Ga0075433_10343719 3300006852 Bacteria 1319
235 Ga0075433_10728426 3300006852 Bacteria 868
236 Ga0075434_100000299 3300006871 Bacteria 35320
237 Ga0075434_100080185 3300006871 Bacteria 3260
238 Ga0075434_100114325 3300006871 Unclassified 2712
239 Ga0075434_101467440 3300006871 Bacteria 692
240 Ga0075434_101709577 3300006871 Bacteria 637
241 Ga0075434_102598391 3300006871 Bacteria 507
242 Ga0075429_100001750 3300006880 Bacteria 17982
243 Ga0075429_100463759 3300006880 Unclassified 1110
244 Ga0068865_100079384 3300006881 Unclassified 2351
245 Ga0068865_101374145 3300006881 Bacteria 630
246 Ga0075436_100530442 3300006914 Bacteria 863
247 Ga0075436_100586862 3300006914 Unclassified 820
248 Ga0075436_101262704 3300006914 Bacteria 558
249 Ga0097620_100016485 3300006931 Bacteria 7420
250 Ga0097620_100328633 3300006931 Bacteria 1623
251 Ga0075435_100006776 3300007076 Bacteria 8127
252 Ga0105240_10318508 3300009093 Bacteria 1773
253 Ga0111539_10002742 3300009094 Bacteria 23379
254 Ga0111539_10016215 3300009094 Bacteria 9242
255 Ga0111539_10625885 3300009094 Bacteria 1253
256 Ga0111539_10649574 3300009094 Bacteria 1228
257 Ga0111539_11152998 3300009094 Bacteria 901
258 Ga0105245_10000837 3300009098 Bacteria 28055
259 Ga0105245_10342051 3300009098 Bacteria 1480
260 Ga0105245_11318287 3300009098 Unclassified 771
261 Ga0105245_11635564 3300009098 Bacteria 696
262 Ga0105247_10163923 3300009101 Bacteria 1474
263 Ga0105247_11841681 3300009101 Bacteria 505
264 Ga0114129_10006608 3300009147 Bacteria 16462
265 Ga0114129_11835118 3300009147 Bacteria 736
266 Ga0114129_12425815 3300009147 Bacteria 628
267 Ga0105243_10013871 3300009148 Bacteria 6100
268 Ga0105243_10047935 3300009148 Bacteria 3366
269 Ga0105243_10050222 3300009148 Bacteria 3294
270 Ga0105243_10234808 3300009148 Bacteria 1629
271 Ga0105243_11940449 3300009148 Bacteria 622
272 Ga0105243_11963706 3300009148 Unclassified 619
273 Ga0105242_10189931 3300009176 Bacteria 1818
274 Ga0105242_10192414 3300009176 Bacteria 1807
275 Ga0105242_10901510 3300009176 Bacteria 884
276 Ga0105242_13141477 3300009176 Unclassified 512
277 Ga0105248_10014747 3300009177 Bacteria 8605
278 Ga0105248_10531532 3300009177 Bacteria 1326
279 Ga0105248_10760951 3300009177 Bacteria 1093
280 Ga0105248_11769999 3300009177 Bacteria 701
281 Ga0105237_10105666 3300009545 Unclassified 2807
282 Ga0105238_10027021 3300009551 Bacteria 5849
283 Ga0105238_10092667 3300009551 Bacteria 3009
284 Ga0105238_10279234 3300009551 Bacteria 1651
285 Ga0105238_12704342 3300009551 Bacteria 533
286 Ga0105249_10012767 3300009553 Bacteria 7407
287 Ga0105249_10079208 3300009553 Bacteria 3050
288 Ga0105249_10467482 3300009553 Bacteria 1302
289 Ga0105249_12236427 3300009553 Bacteria 620
290 Ga0105239_10063436 3300010375 Bacteria 4057
291 Ga0105246_10105187 3300011119 Bacteria 2062
292 Ga0105246_10326236 3300011119 Bacteria 1250
293 Ga0105246_11672389 3300011119 Bacteria 604
294 Ga0157320_1027432 3300012481 Bacteria 556
295 Ga0157318_1001371 3300012482 Unclassified 1212
296 Ga0157343_1000283 3300012488 Unclassified 1931
297 Ga0157319_1024999 3300012497 Bacteria 608
298 Ga0157314_1007673 3300012500 Bacteria 875
299 Ga0157373_11207809 3300013100 Bacteria 570
300 Ga0157370_10326121 3300013104 Bacteria 1416
301 Ga0157370_10448039 3300013104 Bacteria 1187
302 Ga0157370_10505031 3300013104 Bacteria 1110
303 Ga0157369_10337612 3300013105 Bacteria 1565
304 Ga0157374_10192064 3300013296 Bacteria 1997
305 Ga0157378_10381387 3300013297 Bacteria 1384
306 Ga0157378_10492968 3300013297 Bacteria 1223
307 Ga0157378_10554333 3300013297 Bacteria 1155
308 Ga0163162_10024488 3300013306 Bacteria 5957
309 Ga0163162_12258430 3300013306 Bacteria 625
310 Ga0163162_13040374 3300013306 Bacteria 539
311 Ga0163162_13209038 3300013306 Bacteria 525
312 Ga0163162_13401461 3300013306 Bacteria 508
313 Ga0157375_10745746 3300013308 Bacteria 1131
314 Ga0163163_10329236 3300014325 Bacteria 1582
315 Ga0163163_11432966 3300014325 Bacteria 752
316 Ga0163163_12731329 3300014325 Bacteria 551
317 Ga0157380_10102648 3300014326 Bacteria 2385
318 Ga0157380_10363305 3300014326 Bacteria 1359
319 Ga0157380_10453399 3300014326 Bacteria 1232
320 Ga0157380_11316599 3300014326 Bacteria 770
321 Ga0157380_11382406 3300014326 Bacteria 754
322 Ga0157380_12264480 3300014326 Bacteria 608
323 Ga0157380_13157472 3300014326 Bacteria 526
324 Ga0182008_10268819 3300014497 Unclassified 884
325 Ga0157377_10065171 3300014745 Bacteria 2092
326 Ga0157377_10491884 3300014745 Bacteria 855
327 Ga0157377_11521481 3300014745 Bacteria 533
328 Ga0157379_12248064 3300014968 Bacteria 542
329 Ga0157379_12317276 3300014968 Bacteria 535
330 Ga0157376_10340392 3300014969 Bacteria 1432
331 Ga0182006_1135221 3300015261 Bacteria 846
332 Ga0182005_1163733 3300015265 Unclassified 653
333 Ga0163161_10445901 3300017792 Bacteria 1045
334 Ga0163161_11899805 3300017792 Bacteria 530
335 Ga0213876_10054333 3300021384 Bacteria 2115
336 Ga0207666_1019663 3300025271 Bacteria 987
337 Ga0209758_1000798 3300025297 Bacteria 44669
338 Ga0209758_1180940 3300025297 Unclassified 507
339 Ga0207426_1042818 3300025302 Bacteria 1395
340 Ga0207697_10003830 3300025315 Bacteria 7346
341 Ga0207653_10026551 3300025885 Unclassified 1857
342 Ga0207682_10006252 3300025893 Bacteria 4809
343 Ga0207692_10004680 3300025898 Bacteria 5427
344 Ga0207692_10381151 3300025898 Bacteria 875
345 Ga0207642_10317492 3300025899 Bacteria 909
346 Ga0207642_10469141 3300025899 Bacteria 766
347 Ga0207710_10046897 3300025900 Bacteria 1930
348 Ga0207688_10025803 3300025901 Unclassified 3230
349 Ga0207688_10214346 3300025901 Bacteria 1158
350 Ga0207680_10284043 3300025903 Bacteria 1150
351 Ga0207680_10532843 3300025903 Bacteria 838
352 Ga0207680_10540781 3300025903 Bacteria 831
353 Ga0207647_10048235 3300025904 Bacteria 2645
354 Ga0207699_10348899 3300025906 Bacteria 1044
355 Ga0207699_10498340 3300025906 Bacteria 879
356 Ga0207699_10841626 3300025906 Bacteria 675
357 Ga0207645_10015866 3300025907 Bacteria 4991
358 Ga0207645_10296887 3300025907 Bacteria 1075
359 Ga0207643_10152148 3300025908 Bacteria 1388
360 Ga0207643_10386112 3300025908 Bacteria 883
361 Ga0207705_10979514 3300025909 Bacteria 654
362 Ga0207705_11428421 3300025909 Bacteria 525
363 Ga0207684_11449145 3300025910 Bacteria 560
364 Ga0207707_10145572 3300025912 Bacteria 2071
365 Ga0207707_10682271 3300025912 Bacteria 864
366 Ga0207695_10676283 3300025913 Bacteria 913
367 Ga0207671_10012740 3300025914 Bacteria 6744
368 Ga0207693_10013335 3300025915 Bacteria 6626
369 Ga0207693_10205875 3300025915 Bacteria 1547
370 Ga0207663_10010773 3300025916 Bacteria 4882
371 Ga0207663_10151907 3300025916 Bacteria 1625
372 Ga0207660_10037682 3300025917 Bacteria 3371
373 Ga0207660_10070303 3300025917 Unclassified 2544
374 Ga0207660_11530847 3300025917 Bacteria 538
375 Ga0207662_10004510 3300025918 Bacteria 7335
376 Ga0207662_10536520 3300025918 Bacteria 809
377 Ga0207657_10037566 3300025919 Bacteria 4322
378 Ga0207657_10065282 3300025919 Bacteria 3103
379 Ga0207657_10476574 3300025919 Unclassified 978
380 Ga0207649_10327908 3300025920 Unclassified 1127
381 Ga0207649_10745954 3300025920 Bacteria 761
382 Ga0207652_10195406 3300025921 Bacteria 1820
383 Ga0207652_10335270 3300025921 Unclassified 1365
384 Ga0207652_10732886 3300025921 Bacteria 881
385 Ga0207652_11068783 3300025921 Unclassified 707
386 Ga0207681_10355019 3300025923 Bacteria 1174
387 Ga0207681_10920390 3300025923 Bacteria 732
388 Ga0207694_10046790 3300025924 Bacteria 3344
389 Ga0207694_10173001 3300025924 Bacteria 1749
390 Ga0207650_10181060 3300025925 Bacteria 1679
391 Ga0207650_10290673 3300025925 Bacteria 1333
392 Ga0207659_10313053 3300025926 Bacteria 1293
393 Ga0207659_11161378 3300025926 Bacteria 664
394 Ga0207659_11259377 3300025926 Bacteria 635
395 Ga0207687_10038274 3300025927 Bacteria 3277
396 Ga0207687_10489703 3300025927 Bacteria 1025
397 Ga0207700_10380428 3300025928 Bacteria 1234
398 Ga0207664_10069426 3300025929 Bacteria 2833
399 Ga0207644_10211681 3300025931 Bacteria 1533
400 Ga0207644_10661445 3300025931 Unclassified 870
401 Ga0207644_11215047 3300025931 Bacteria 634
402 Ga0207690_10066347 3300025932 Unclassified 2471
403 Ga0207690_11001808 3300025932 Bacteria 695
404 Ga0207706_10023449 3300025933 Bacteria 5541
405 Ga0207706_10027637 3300025933 Bacteria 5072
406 Ga0207706_10054087 3300025933 Bacteria 3543
407 Ga0207706_10169749 3300025933 Bacteria 1917
408 Ga0207686_10038012 3300025934 Bacteria 2909
409 Ga0207686_10444914 3300025934 Bacteria 996
410 Ga0207709_10007235 3300025935 Bacteria 6191
411 Ga0207709_10007780 3300025935 Bacteria 5940
412 Ga0207709_10247735 3300025935 Bacteria 1300
413 Ga0207709_10375518 3300025935 Bacteria 1080
414 Ga0207670_10014485 3300025936 Bacteria 4682
415 Ga0207670_10161141 3300025936 Bacteria 1674
416 Ga0207670_11174328 3300025936 Bacteria 649
417 Ga0207670_11479209 3300025936 Bacteria 577
418 Ga0207669_10018985 3300025937 Bacteria 3569
419 Ga0207669_11414722 3300025937 Bacteria 592
420 Ga0207704_10086909 3300025938 Bacteria 2041
421 Ga0207704_10885122 3300025938 Bacteria 750
422 Ga0207665_10431019 3300025939 Bacteria 1009
423 Ga0207691_10000720 3300025940 Bacteria 32686
424 Ga0207711_10071442 3300025941 Bacteria 3011
425 Ga0207711_11397676 3300025941 Bacteria 642
426 Ga0207689_10381238 3300025942 Bacteria 1174
427 Ga0207689_11108087 3300025942 Bacteria 667
428 Ga0207661_10088130 3300025944 Bacteria 2579
429 Ga0207661_10103086 3300025944 Unclassified 2401
430 Ga0207661_10916790 3300025944 Bacteria 807
431 Ga0207679_10052691 3300025945 Bacteria 2985
432 Ga0207679_10219002 3300025945 Unclassified 1601
433 Ga0207679_10337273 3300025945 Bacteria 1310
434 Ga0207679_10523583 3300025945 Unclassified 1061
435 Ga0207679_11259111 3300025945 Bacteria 679
436 Ga0207667_10278870 3300025949 Bacteria 1708
437 Ga0207667_11830837 3300025949 Unclassified 570
438 Ga0207651_10025997 3300025960 Bacteria 3649
439 Ga0207651_10103103 3300025960 Bacteria 2122
440 Ga0207651_11656253 3300025960 Bacteria 576
441 Ga0207712_10599892 3300025961 Unclassified 952
442 Ga0207668_10220124 3300025972 Bacteria 1524
443 Ga0207640_11288579 3300025981 Bacteria 652
444 Ga0207658_10595139 3300025986 Bacteria 993
445 Ga0207658_10753879 3300025986 Bacteria 882
446 Ga0207677_10264896 3300026023 Bacteria 1403
447 Ga0207677_10858222 3300026023 Bacteria 816
448 Ga0207677_10863729 3300026023 Bacteria 814
449 Ga0207677_11239392 3300026023 Bacteria 684
450 Ga0207703_10077193 3300026035 Bacteria 2765
451 Ga0207703_10232594 3300026035 Bacteria 1653
452 Ga0207639_10032263 3300026041 Bacteria 3855
453 Ga0207639_10604342 3300026041 Bacteria 1012
454 Ga0207639_11170148 3300026041 Bacteria 722
455 Ga0207678_10366266 3300026067 Bacteria 1244
456 Ga0207678_11078533 3300026067 Bacteria 711
457 Ga0207678_11504327 3300026067 Bacteria 594
458 Ga0207708_10012300 3300026075 Bacteria 6379
459 Ga0207708_10435030 3300026075 Bacteria 1090
460 Ga0207708_11321268 3300026075 Bacteria 632
461 Ga0207708_11628343 3300026075 Bacteria 567
462 Ga0207641_10145346 3300026088 Bacteria 2144
463 Ga0207641_10336421 3300026088 Unclassified 1435
464 Ga0207641_10747251 3300026088 Bacteria 965
465 Ga0207648_10023107 3300026089 Bacteria 5577
466 Ga0207648_10122011 3300026089 Unclassified 2291
467 Ga0207648_11267791 3300026089 Bacteria 692
468 Ga0207676_10176079 3300026095 Bacteria 1868
469 Ga0207676_10374266 3300026095 Bacteria 1324
470 Ga0207676_10545721 3300026095 Bacteria 1107
471 Ga0207674_10180058 3300026116 Bacteria 2065
472 Ga0207674_10381897 3300026116 Bacteria 1362
473 Ga0207674_11754504 3300026116 Bacteria 588
474 Ga0207675_100012891 3300026118 Bacteria 7809
475 Ga0207675_100220277 3300026118 Bacteria 1828
476 Ga0207675_100512641 3300026118 Bacteria 1195
477 Ga0207675_100533597 3300026118 Bacteria 1171
478 Ga0207675_101748477 3300026118 Bacteria 641
479 Ga0207675_102302017 3300026118 Bacteria 552
480 Ga0207683_10021228 3300026121 Bacteria 5556
481 Ga0207698_10176364 3300026142 Bacteria 1888
482 Ga0207698_10226587 3300026142 Unclassified 1693
483 Ga0209971_1075032 3300027682 Bacteria 822
484 Ga0209966_1000765 3300027695 Bacteria 6635
485 Ga0209998_10001832 3300027717 Bacteria 5038
486 Ga0209813_10112120 3300027866 Bacteria 941
487 Ga0209974_10009008 3300027876 Unclassified 3394
488 Ga0207428_10000626 3300027907 Bacteria 41522
489 Ga0268266_10457774 3300028379 Bacteria 1214
490 Ga0268266_10508637 3300028379 Bacteria 1151
491 Ga0268266_10903907 3300028379 Bacteria 854
492 Ga0268266_11129297 3300028379 Bacteria 758
493 Ga0268265_10068531 3300028380 Bacteria 2751
494 Ga0268265_12583363 3300028380 Bacteria 514
495 Ga0268264_10134107 3300028381 Bacteria 2199
496 Ga0268264_10583484 3300028381 Bacteria 1100
497 Ga0265337_1001215 3300028556 Bacteria 13090
498 Ga0265338_10056921 3300028800 Bacteria 3463
499 Ga0265338_10400752 3300028800 Bacteria 978
500 Ga0265324_10163841 3300029957 Bacteria 755
501 Ga0265330_10064148 3300031235 Bacteria 1596
502 Ga0265330_10490772 3300031235 Bacteria 522
503 Ga0265325_10002862 3300031241 Bacteria 11509
504 Ga0265325_10043453 3300031241 Bacteria 2345
505 Ga0265325_10084258 3300031241 Bacteria 1576
506 Ga0265325_10372151 3300031241 Bacteria 629
507 Ga0265329_10031927 3300031242 Bacteria 1708
508 Ga0265340_10023153 3300031247 Bacteria 3169
509 Ga0265340_10031944 3300031247 Bacteria 2630
510 Ga0265340_10035170 3300031247 Bacteria 2489
511 Ga0265340_10228324 3300031247 Bacteria 833
512 Ga0265340_10339852 3300031247 Bacteria 664
513 Ga0265340_10491399 3300031247 Unclassified 540
514 Ga0265339_10463770 3300031249 Unclassified 587
515 Ga0265316_10038361 3300031344 Bacteria 3861
516 Ga0265316_10058161 3300031344 Bacteria 3013
517 Ga0265316_10242658 3300031344 Bacteria 1325
518 Ga0307513_10097427 3300031456 Bacteria 2976
519 Ga0307513_10158733 3300031456 Bacteria 2157
520 Ga0307408_101897712 3300031548 Bacteria 571
521 Ga0265313_10015939 3300031595 Bacteria 4347
522 Ga0265314_10000439 3300031711 Bacteria 55613
523 Ga0265314_10006193 3300031711 Bacteria 10622
524 Ga0265314_10549595 3300031711 Bacteria 601
525 Ga0265342_10073571 3300031712 Bacteria 1987
526 Ga0265342_10103288 3300031712 Bacteria 1621
527 Ga0307405_11610809 3300031731 Bacteria 573
528 Ga0326468_10004264 3300031889 Bacteria 1242
529 Ga0307406_11535796 3300031901 Bacteria 587
530 Ga0307411_11587491 3300032005 Bacteria 603
531 Ga0307411_11839705 3300032005 Bacteria 563
532 Ga0373930_0001573 3300034816 Bacteria 3425
533 Ga0373930_0153446 3300034816 Bacteria 579
534 Ga0373948_0007324 3300034817 Unclassified 1852
535 Ga0373950_0001736 3300034818 Unclassified 2890
536 Ga0373950_0011444 3300034818 Bacteria 1449
537 Ga0373958_0000026 3300034819 Bacteria 16079
538 Ga0373959_0000446 3300034820 Bacteria 7792
539 Ga0373938_0000337 3300034957 Bacteria 7445
540 Ga0373926_0026336 3300035083 Bacteria 2033
541 Ga0373926_0123542 3300035083 Bacteria 977
542 Ga0373926_0274714 3300035083 Unclassified 655
543 Ga0373928_0000487 3300035084 Bacteria 7804
544 Ga0373928_0000532 3300035084 Bacteria 7414
545 Ga0373929_0000110 3300035085 Bacteria 13537
546 Ga0373929_0059002 3300035085 Bacteria 894
547 Ga0373934_0145045 3300035086 Bacteria 971
548 Ga0373940_0000116 3300035088 Bacteria 9967
549 Ga0373944_0135993 3300035089 Bacteria 857
550 Ga0373944_0294123 3300035089 Bacteria 608
551 Ga0373949_0001975 3300035090 Bacteria 5489
552 Ga0373951_0000638 3300035091 Bacteria 9666
553 Ga0373951_0014347 3300035091 Bacteria 1781
554 Ga0373952_0001416 3300035092 Bacteria 4379
555 Ga0373952_0029826 3300035092 Bacteria 1205
556 Ga0373923_0002974 3300035111 Bacteria 5345
557 Ga0373923_0133212 3300035111 Bacteria 1118
558 Ga0373932_0004843 3300035112 Unclassified 3171
559 Ga0373936_0007985 3300035113 Bacteria 3976
560 Ga0373936_0016239 3300035113 Bacteria 2863
561 Ga0373936_0022976 3300035113 Bacteria 2428
562 Ga0373936_0399512 3300035113 Bacteria 631
563 Ga0373939_0011346 3300035114 Unclassified 2245
564 Ga0373939_0262975 3300035114 Bacteria 676
565 Ga0373941_0000177 3300035115 Bacteria 11867
566 Ga0373941_0052696 3300035115 Bacteria 1299
567 Ga0373941_0465608 3300035115 Bacteria 533
568 Ga0373945_0013190 3300035116 Bacteria 2754
569 Ga0373945_0080896 3300035116 Bacteria 1245
570 Ga0373945_0112441 3300035116 Bacteria 1075
571 Ga0373953_0004119 3300035117 Bacteria 4610
572 Ga0373953_0035605 3300035117 Bacteria 1957
573 Ga0373954_0037704 3300035118 Bacteria 2247
574 Ga0373954_0074757 3300035118 Bacteria 1613
575 Ga0373954_0101210 3300035118 Bacteria 1390
576 Ga0373954_0207498 3300035118 Bacteria 963
577 Ga0373954_0265227 3300035118 Bacteria 846
578 Ga0373956_0011159 3300035119 Bacteria 3700
579 Ga0373956_0047253 3300035119 Bacteria 1925
580 Ga0373956_0093600 3300035119 Bacteria 1388
581 Ga0373956_0182312 3300035119 Bacteria 993
582 Ga0373956_0298529 3300035119 Bacteria 767
583 Ga0373957_0004295 3300035120 Bacteria 4324
584 Ga0373957_0018552 3300035120 Bacteria 2439
585 Ga0373957_0230343 3300035120 Bacteria 777
586 Ga0373957_0252678 3300035120 Unclassified 742
587 Ga0373960_0003980 3300035121 Bacteria 3369
588 Ga0373943_0004455 3300035170 Bacteria 6340
589 Ga0373943_0095454 3300035170 Unclassified 1546
590 Ga0373943_0496996 3300035170 Bacteria 712
591 Ga0373946_0007076 3300035171 Bacteria 4094
592 Ga0373946_0012082 3300035171 Bacteria 3229
593 Ga0373955_0000509 3300035172 Bacteria 16517
594 Ga0373955_0007958 3300035172 Bacteria 4899
595 Ga0373955_0008788 3300035172 Bacteria 4706
596 Ga0373955_0040130 3300035172 Bacteria 2501
597 Ga0373955_0295497 3300035172 Bacteria 976
598 Ga0373942_0002386 3300035207 Bacteria 4564
599 Ga0373942_0028123 3300035207 Bacteria 1467
600 Ga0373942_0090969 3300035207 Bacteria 920
601 Ga0373942_0197046 3300035207 Unclassified 666
602 Ga0373961_0001126 3300035241 Bacteria 8418
603 Ga0373962_0009256 3300035242 Bacteria 2436
604 Ga0373962_0010843 3300035242 Bacteria 2278
605 Ga0373924_0010900 3300035410 Bacteria 3364
606 Ga0373924_0016524 3300035410 Bacteria 2817
607 Ga0373924_0018675 3300035410 Bacteria 2676
608 Ga0373924_0163200 3300035410 Bacteria 977
609 Ga0373931_0021710 3300035691 Bacteria 3222
610 Ga0373935_0024574 3300035692 Bacteria 3709
611 Ga0373935_0697246 3300035692 Unclassified 746
612 Ga0373935_1178271 3300035692 Bacteria 571
613 Ga0373927_0021223 3300035695 Bacteria 4255
614 Ga0373927_0196561 3300035695 Bacteria 1323
615 Ga0373927_0847915 3300035695 Bacteria 603
616 Ga0373933_0001541 3300035724 Bacteria 13482
617 Ga0373933_0043969 3300035724 Bacteria 2644
618 Ga0373933_0305040 3300035724 Bacteria 1031
619 Ga0373933_0343979 3300035724 Bacteria 968
620 Ga0373933_0983754 3300035724 Bacteria 556
621 Ga0373933_1101789 3300035724 Bacteria 523
622 Ga0373947_0017782 3300035725 Bacteria 4090
623 Ga0373947_0252500 3300035725 Bacteria 1166
624 Ga0373947_0347804 3300035725 Bacteria 994
625 Ga0373947_0492468 3300035725 Unclassified 832
626 Ga0373937_0006385 3300036401 Bacteria 10173
627 Ga0373937_0130085 3300036401 Bacteria 2351
628 Ga0373937_0158313 3300036401 Bacteria 2123
629 Ga0373937_0236309 3300036401 Bacteria 1721
630 Ga0373937_0237316 3300036401 Bacteria 1717
631 Ga0373937_0611734 3300036401 Bacteria 1034
632 Ga0373937_0642406 3300036401 Bacteria 1006
633 Ga0373937_0865207 3300036401 Bacteria 852
634 Ga0373937_1050266 3300036401 Bacteria 763
635 Ga0373925_0001273 3300037068 Bacteria 22250
636 Ga0373925_0047796 3300037068 Bacteria 3187
637 Ga0373925_0105184 3300037068 Bacteria 2174
638 Ga0373925_0242647 3300037068 Bacteria 1443
639 Ga0242419_020650 3300038698 Bacteria 550
640 Ga0242420_000887 3300038996 Bacteria 3713
641 Ga0436365_0169472 3300039437 Bacteria 3228
642 Ga0436365_0548422 3300039437 Bacteria 512
643 Ga0436365_1076647 3300039437 Unclassified 1068
644 Ga0436365_1298767 3300039437 Bacteria 688
645 Ga0439453_0000106 3300041408 Bacteria 6745
646 Ga0451793_0093313 3300041452 Bacteria 556
647 Ga0451807_1006014 3300041486 Bacteria 540
648 Ga0451845_0439394 3300041501 Bacteria 646
649 Ga0451855_1205704 3300041511 Bacteria 559
650 Ga0439437_055629 3300042000 Unclassified 531
651 Ga0439441_063145 3300042001 Bacteria 783
652 Ga0439441_111744 3300042001 Bacteria 620
653 Ga0439443_020032 3300042003 Unclassified 1047
654 Ga0439450_023182 3300042008 Unclassified 1345
655 Ga0439455_0082629 3300042012 Bacteria 874
656 Ga0439463_122214 3300042016 Bacteria 673
657 Ga0450914_057810 3300042118 Unclassified 521
658 Ga0450906_083918 3300042145 Unclassified 576
659 Ga0450908_043822 3300042184 Unclassified 776
660 Ga0439435_0000370 3300042436 Bacteria 6880
661 Ga0439435_0232470 3300042436 Bacteria 616
662 Ga0439444_0042475 3300042437 Unclassified 898
663 Ga0439459_0119527 3300042438 Bacteria 663
664 Ga0439464_0010042 3300042439 Unclassified 2497
665 Ga0439460_0068356 3300042461 Unclassified 1096
666 Ga0439460_0100815 3300042461 Unclassified 927
667 Ga0451577_0042439 3300042876 Bacteria 4080
668 Ga0439440_0023527 3300042993 Unclassified 1406
669 Ga0439440_0079560 3300042993 Bacteria 865
670 Ga0453683_0236175 3300044673 Bacteria 1164
671 Ga0466966_0080184 3300044684 Bacteria 2034
672 Ga0466966_0928577 3300044684 Bacteria 525
673 Ga0466961_0164926 3300044693 Unclassified 1380
674 Ga0466963_0191670 3300044694 Unclassified 1428
675 Ga0466963_0533340 3300044694 Bacteria 829
676 Ga0453684_0057645 3300044712 Bacteria 5025
677 Ga0453684_1926619 3300044712 Bacteria 597
678 Ga0466971_0141346 3300044719 Bacteria 1121
679 Ga0466971_0395370 3300044719 Bacteria 673
680 Ga0466957_0329076 3300044842 Bacteria 1032
681 Ga0466957_1348258 3300044842 Unclassified 518
682 Ga0466960_0544725 3300044901 Unclassified 684
683 Ga0466960_0946467 3300044901 Bacteria 527
684 Ga0466959_0472214 3300045049 Unclassified 849
685 Ga0451576_0087001 3300045051 Bacteria 3250
686 Ga0466958_0201370 3300045836 Bacteria 1267
687 Ga0466958_0336726 3300045836 Bacteria 971
688 Ga0466967_0149240 3300045976 Bacteria 2184
689 Ga0466967_0216103 3300045976 Bacteria 1820
690 Ga0466967_0786880 3300045976 Bacteria 944
691 Ga0495592_0023347 3300046454 Bacteria 4703
692 Ga0495592_0086679 3300046454 Bacteria 2254
693 Ga0495592_0385201 3300046454 Bacteria 891
694 Ga0495603_0018201 3300046455 Bacteria 4250
695 Ga0495603_0065563 3300046455 Bacteria 2140
696 Ga0495590_0153664 3300046457 Bacteria 835
697 Ga0495629_0792342 3300046459 Bacteria 625
698 Ga0495638_0028464 3300046460 Bacteria 3608
699 Ga0495641_0014894 3300046461 Bacteria 4187
700 Ga0495641_0158608 3300046461 Unclassified 1012
701 Ga0495651_0024840 3300046462 Bacteria 4662
702 Ga0495651_0027684 3300046462 Bacteria 4417
703 Ga0495651_0028851 3300046462 Bacteria 4326
704 Ga0495651_0206341 3300046462 Bacteria 1371
705 Ga0495651_0423628 3300046462 Bacteria 865
706 Ga0495651_0463609 3300046462 Bacteria 817
707 Ga0495653_0118639 3300046463 Bacteria 1889
708 Ga0495653_0127576 3300046463 Bacteria 1805
709 Ga0495653_0194059 3300046463 Bacteria 1383
710 Ga0495653_0287572 3300046463 Bacteria 1077
711 Ga0495580_0983689 3300046472 Unclassified 538
712 Ga0495582_0049796 3300046473 Bacteria 2307
713 Ga0495582_0076771 3300046473 Bacteria 1852
714 Ga0495605_0488129 3300046474 Bacteria 504
715 Ga0495639_0004864 3300046475 Bacteria 5764
716 Ga0495639_0103744 3300046475 Bacteria 1344
717 Ga0495662_0011898 3300046476 Bacteria 4252
718 Ga0495662_0125968 3300046476 Bacteria 1258
719 Ga0495664_0002672 3300046477 Bacteria 9604
720 Ga0495664_0006545 3300046477 Bacteria 6436
721 Ga0495664_0035617 3300046477 Bacteria 2932
722 Ga0495664_0343334 3300046477 Unclassified 899
723 Ga0495664_0696686 3300046477 Bacteria 600
724 Ga0495594_0026904 3300046499 Bacteria 3097
725 Ga0495607_0010006 3300046501 Bacteria 6390
726 Ga0495608_0000557 3300046511 Bacteria 25706
727 Ga0495608_0015588 3300046511 Bacteria 5266
728 Ga0495608_0028419 3300046511 Bacteria 3801
729 Ga0495608_0164099 3300046511 Bacteria 1411
730 Ga0495616_0426090 3300046513 Unclassified 541
731 Ga0495618_0393534 3300046514 Unclassified 849
732 Ga0495618_0405482 3300046514 Bacteria 833
733 Ga0495620_0074315 3300046515 Bacteria 1384
734 Ga0495628_0001465 3300046516 Bacteria 21652
735 Ga0495628_0037692 3300046516 Bacteria 3875
736 Ga0495628_0928444 3300046516 Unclassified 602
737 Ga0495630_0441245 3300046517 Bacteria 997
738 Ga0495630_0463588 3300046517 Bacteria 971
739 Ga0495643_0127748 3300046522 Bacteria 1279
740 Ga0495644_0380952 3300046523 Unclassified 557
741 Ga0495666_0033133 3300046526 Bacteria 2525
742 Ga0495666_0033310 3300046526 Bacteria 2517
743 Ga0495652_0002359 3300046529 Bacteria 19593
744 Ga0495652_0053207 3300046529 Bacteria 3451
745 Ga0495652_0188561 3300046529 Bacteria 1576
746 Ga0495652_1025771 3300046529 Bacteria 539
747 Ga0495665_0067398 3300046531 Bacteria 1888
748 Ga0495665_0069847 3300046531 Bacteria 1851
749 Ga0495665_0520799 3300046531 Bacteria 598
750 Ga0495640_0131267 3300046533 Bacteria 1621
751 Ga0495640_0201292 3300046533 Bacteria 1262
752 Ga0495640_0297700 3300046533 Unclassified 1002
753 Ga0495640_0570189 3300046533 Bacteria 685
754 Ga0495586_0034869 3300046535 Bacteria 2703
755 Ga0495586_0244719 3300046535 Bacteria 1023
756 Ga0495587_0031834 3300046536 Bacteria 3191
757 Ga0495587_0245789 3300046536 Bacteria 1006
758 Ga0495587_0771954 3300046536 Bacteria 525
759 Ga0495598_0004138 3300046537 Bacteria 3125
760 Ga0495609_0170486 3300046538 Bacteria 919
761 Ga0495621_0048691 3300046539 Bacteria 1510
762 Ga0495645_0002006 3300046543 Bacteria 13860
763 Ga0495645_0035666 3300046543 Bacteria 3626
764 Ga0495622_0169368 3300046557 Bacteria 982
765 Ga0495622_0446356 3300046557 Unclassified 555
766 Ga0495633_0002198 3300046558 Bacteria 13962
767 Ga0495667_0002889 3300046559 Bacteria 11519
768 Ga0495667_0015972 3300046559 Bacteria 5073
769 Ga0495667_0041062 3300046559 Bacteria 3069
770 Ga0495667_0415458 3300046559 Bacteria 847
771 Ga0495634_0167244 3300046642 Bacteria 1383
772 Ga0495634_0247000 3300046642 Bacteria 1093
773 Ga0495634_0334238 3300046642 Bacteria 910
774 Ga0495634_0619076 3300046642 Bacteria 627
775 Ga0495611_0003383 3300046648 Bacteria 7040
776 Ga0495611_0572628 3300046648 Unclassified 511
777 Ga0495625_0817033 3300046660 Bacteria 541
778 Ga0495635_0003603 3300046663 Bacteria 10728
779 Ga0495635_0061445 3300046663 Bacteria 2581
780 Ga0495635_0149588 3300046663 Unclassified 1589
781 Ga0495635_0498040 3300046663 Bacteria 802
782 Ga0495661_0067702 3300046665 Bacteria 2097
783 Ga0495588_0009109 3300046674 Bacteria 4577
784 Ga0495588_0372213 3300046674 Unclassified 750
785 Ga0495657_0020739 3300046675 Bacteria 4725
786 Ga0495657_0023491 3300046675 Bacteria 4404
787 Ga0495657_0654207 3300046675 Bacteria 606
788 Ga0495599_0004135 3300046678 Bacteria 8571
789 Ga0495599_0005971 3300046678 Bacteria 7324
790 Ga0495623_0413858 3300046679 Bacteria 723
791 Ga0495646_0020139 3300046680 Bacteria 4218
792 Ga0495646_0053496 3300046680 Bacteria 2434
793 Ga0495647_0003659 3300046681 Bacteria 4935
794 Ga0495647_0031914 3300046681 Bacteria 1960
795 Ga0495647_0507716 3300046681 Bacteria 561
796 Ga0495658_0007904 3300046683 Bacteria 5264
797 Ga0495658_0012613 3300046683 Bacteria 4287
798 Ga0495658_0151377 3300046683 Bacteria 1425
799 Ga0495669_0552341 3300046684 Bacteria 560
800 Ga0495613_0079381 3300046689 Bacteria 2386
801 Ga0495613_0557627 3300046689 Bacteria 766
802 Ga0495613_0677271 3300046689 Unclassified 681
803 Ga0495624_0102522 3300046690 Unclassified 1761
804 Ga0495670_0000870 3300046691 Bacteria 14648
805 Ga0495670_0314893 3300046691 Bacteria 840
806 Ga0495600_0002049 3300046809 Bacteria 11360
807 Ga0495600_0069850 3300046809 Bacteria 2295
808 Ga0495600_0260938 3300046809 Bacteria 1100
809 Ga0495600_0408600 3300046809 Unclassified 844
810 Ga0495581_0048792 3300047315 Bacteria 2444
811 Ga0495581_0058530 3300047315 Bacteria 2225
812 Ga0495581_0345605 3300047315 Bacteria 868
813 Ga0495604_0010650 3300047317 Bacteria 7293
814 Ga0495604_0052471 3300047317 Bacteria 3157
815 Ga0495674_0011272 3300047319 Bacteria 8439
816 Ga0495674_0035712 3300047319 Bacteria 4481
817 Ga0495674_0042925 3300047319 Bacteria 4029
818 Ga0495674_0186903 3300047319 Bacteria 1724
819 Ga0495676_0278352 3300047321 Unclassified 1133
820 Ga0495676_0581090 3300047321 Bacteria 730
821 Ga0495676_1106675 3300047321 Bacteria 504
822 Ga0495680_0005770 3300047322 Bacteria 11590
823 Ga0495680_0014947 3300047322 Bacteria 6706
824 Ga0495680_0020201 3300047322 Bacteria 5610
825 Ga0495680_0309648 3300047322 Unclassified 1107
826 Ga0495680_0355282 3300047322 Unclassified 1019
827 Ga0495680_0956366 3300047322 Bacteria 550
828 Ga0495675_0000740 3300047444 Bacteria 20363
829 Ga0495675_0082688 3300047444 Bacteria 2022
830 Ga0495675_0217902 3300047444 Bacteria 1156
831 Ga0495675_0284711 3300047444 Archaea 985
832 Ga0495677_0248898 3300047445 Bacteria 695
833 Ga0495685_115550 3300047447 Bacteria 882
834 Ga0495685_224657 3300047447 Unclassified 599
835 Ga0495684_0068395 3300047471 Bacteria 2700
836 Ga0495684_0290792 3300047471 Bacteria 1176
837 Ga0495686_0284600 3300047472 Bacteria 918
838 Ga0495593_0419159 3300047673 Bacteria 670
839 Ga0495602_0002218 3300048088 Bacteria 19614
840 Ga0495602_0013696 3300048088 Bacteria 8272
841 Ga0495602_0037475 3300048088 Bacteria 4500
842 Ga0495602_0063070 3300048088 Bacteria 3213
843 Ga0495602_0150527 3300048088 Bacteria 1830
844 Ga0495614_0048355 3300048089 Bacteria 1823
845 Ga0495614_0259467 3300048089 Unclassified 796
846 Ga0495615_0059894 3300048090 Bacteria 1002
847 Ga0496100_0189818 3300048903 Bacteria 1491
848 Ga0496101_0001349 3300048904 Bacteria 14712
849 Ga0496101_0059537 3300048904 Bacteria 2768
850 Ga0496102_0002354 3300048905 Bacteria 16125
851 Ga0496102_0017521 3300048905 Bacteria 6273
852 Ga0496103_0048757 3300048906 Unclassified 2618
853 Ga0496104_0000126 3300048907 Bacteria 70488
854 Ga0496104_0065771 3300048907 Bacteria 3441
855 Ga0496104_0253403 3300048907 Bacteria 1673
856 Ga0496105_0000117 3300048908 Bacteria 54274
857 Ga0496106_0000557 3300048909 Bacteria 26528
858 Ga0496106_0047156 3300048909 Bacteria 3242
859 Ga0496106_0052745 3300048909 Bacteria 3069
860 Ga0496107_0019064 3300048910 Bacteria 4838
861 Ga0496107_0019668 3300048910 Bacteria 4764
862 Ga0496108_0037745 3300048911 Bacteria 4025
863 Ga0496109_0004864 3300048912 Bacteria 11211
864 Ga0496109_0038200 3300048912 Bacteria 4340
865 Ga0496110_0054572 3300048913 Unclassified 3515
866 Ga0496111_0096583 3300048914 Unclassified 2169
867 Ga0496112_0086388 3300048915 Bacteria 3103
868 Ga0496112_0217980 3300048915 Bacteria 1865
869 Ga0496112_0724967 3300048915 Bacteria 921
870 Ga0496112_0976941 3300048915 Bacteria 767
871 Ga0496112_1646631 3300048915 Unclassified 555
872 Ga0496113_0015747 3300048916 Bacteria 5207
873 Ga0496113_0252736 3300048916 Bacteria 1407
874 Ga0496113_0969549 3300048916 Unclassified 671
875 Ga0496114_0072327 3300048917 Bacteria 2900
876 Ga0496114_0345346 3300048917 Bacteria 1316
877 Ga0496115_0018679 3300048918 Bacteria 5329
878 Ga0496115_0036386 3300048918 Bacteria 3898
879 Ga0496115_0245055 3300048918 Bacteria 1477
880 Ga0496115_0508590 3300048918 Bacteria 967
881 Ga0496115_0543685 3300048918 Bacteria 929
882 Ga0496121_0751335 3300048924 Unclassified 580
883 Ga0496126_0131972 3300048929 Bacteria 2158
884 Ga0496126_0647370 3300048929 Bacteria 827
885 Ga0501031_0006160 3300049568 Bacteria 7831
886 Ga0501031_0113961 3300049568 Bacteria 1766
887 Ga0501031_0913327 3300049568 Bacteria 562
888 Ga0501031_0929218 3300049568 Bacteria 556
889 Ga0501032_0002502 3300049569 Bacteria 14350
890 Ga0501033_0026683 3300049570 Bacteria 4345
891 Ga0501033_0228381 3300049570 Bacteria 1323
892 Ga0501033_0276787 3300049570 Bacteria 1185
893 Ga0501034_0023206 3300049571 Bacteria 6321
894 Ga0501034_0046159 3300049571 Bacteria 4402
895 Ga0501034_0088744 3300049571 Bacteria 3090
896 Ga0501034_0163432 3300049571 Bacteria 2196
897 Ga0501034_0192227 3300049571 Bacteria 2003
898 Ga0501034_0293709 3300049571 Bacteria 1563
899 Ga0501034_0600209 3300049571 Bacteria 1006
900 Ga0501034_0616819 3300049571 Bacteria 989
901 Ga0501034_0627646 3300049571 Bacteria 978
902 Ga0501034_0919986 3300049571 Bacteria 762
903 Ga0501034_1214588 3300049571 Bacteria 632
904 Ga0501034_1357579 3300049571 Bacteria 586
905 Ga0501036_0012785 3300049572 Bacteria 6963
906 Ga0501036_0119528 3300049572 Bacteria 2225
907 Ga0501036_0273997 3300049572 Bacteria 1412
908 Ga0501036_0334881 3300049572 Bacteria 1264
909 Ga0501037_0007235 3300049573 Bacteria 8109
910 Ga0501037_0010967 3300049573 Bacteria 6664
911 Ga0501037_0131872 3300049573 Bacteria 1792
912 Ga0501037_0856328 3300049573 Bacteria 598
913 Ga0501038_0004064 3300049574 Bacteria 13606
914 Ga0501038_0082157 3300049574 Bacteria 2713
915 Ga0501038_0085007 3300049574 Bacteria 2661
916 Ga0501038_0125210 3300049574 Bacteria 2116
917 Ga0501039_0015100 3300049575 Bacteria 5908
918 Ga0501039_0238558 3300049575 Bacteria 1430
919 Ga0501039_0388010 3300049575 Bacteria 1097
920 Ga0501039_1434623 3300049575 Bacteria 531
921 Ga0501039_1516249 3300049575 Bacteria 515
922 Ga0501040_0317674 3300049576 Bacteria 1114
923 Ga0501040_1275635 3300049576 Unclassified 533
924 Ga0501041_0220912 3300049577 Bacteria 1189
925 Ga0501042_0032536 3300049578 Bacteria 3694
926 Ga0501042_0222621 3300049578 Bacteria 1361
927 Ga0501042_1217403 3300049578 Bacteria 549
928 Ga0501043_0031616 3300049579 Bacteria 4160
929 Ga0501046_0004620 3300049580 Bacteria 12437
930 Ga0501046_0124968 3300049580 Bacteria 1955
931 Ga0501047_0014677 3300049581 Bacteria 7454
932 Ga0501047_0082757 3300049581 Bacteria 3085
933 Ga0501047_0100323 3300049581 Bacteria 2774
934 Ga0501047_1204133 3300049581 Bacteria 571
935 Ga0501048_0019145 3300049582 Bacteria 5026
936 Ga0501048_0260560 3300049582 Bacteria 1232
937 Ga0501048_0379929 3300049582 Bacteria 1009
938 Ga0501067_0003146 3300049583 Bacteria 9114
939 Ga0501068_0093062 3300049584 Bacteria 1862
940 Ga0501068_0395056 3300049584 Bacteria 891
941 Ga0501068_0578833 3300049584 Bacteria 731
942 Ga0501069_0003163 3300049585 Bacteria 8437
943 Ga0501069_0068986 3300049585 Bacteria 1979
944 Ga0501069_0286906 3300049585 Bacteria 964
945 Ga0501069_0360288 3300049585 Bacteria 858
946 Ga0501069_0696963 3300049585 Bacteria 612
947 Ga0501069_1037381 3300049585 Bacteria 501
948 Ga0501070_0021944 3300049586 Bacteria 5349
949 Ga0501070_0059924 3300049586 Bacteria 3155
950 Ga0501070_0068845 3300049586 Bacteria 2930
951 Ga0501070_0125154 3300049586 Bacteria 2124
952 Ga0501070_0136867 3300049586 Bacteria 2022
953 Ga0501070_0138228 3300049586 Bacteria 2011
954 Ga0501070_0160373 3300049586 Bacteria 1854
955 Ga0501070_0380165 3300049586 Bacteria 1144
956 Ga0501070_0519677 3300049586 Bacteria 955
957 Ga0501070_0529665 3300049586 Bacteria 945
958 Ga0501071_0019296 3300049587 Bacteria 4732
959 Ga0501071_0031082 3300049587 Bacteria 3782
960 Ga0501071_1321645 3300049587 Bacteria 557
961 Ga0501071_1379481 3300049587 Unclassified 544
962 Ga0501072_0136759 3300049588 Bacteria 1953
963 Ga0501072_0206092 3300049588 Bacteria 1568
964 Ga0501072_0283321 3300049588 Bacteria 1318
965 Ga0501072_0352471 3300049588 Bacteria 1168
966 Ga0501072_0746599 3300049588 Bacteria 768
967 Ga0501072_1010253 3300049588 Bacteria 648
968 Ga0501072_1126436 3300049588 Bacteria 610
969 Ga0501073_0001123 3300049589 Bacteria 19412
970 Ga0501073_0260130 3300049589 Bacteria 1198
971 Ga0501073_0272271 3300049589 Bacteria 1168
972 Ga0501073_0877677 3300049589 Bacteria 618
973 Ga0501073_1034504 3300049589 Bacteria 565
974 Ga0501074_0004631 3300049590 Bacteria 9849
975 Ga0501074_0322129 3300049590 Bacteria 1098
976 Ga0501074_0500393 3300049590 Bacteria 861
977 Ga0501074_0634529 3300049590 Bacteria 755
978 Ga0501074_0855275 3300049590 Bacteria 640
979 Ga0501075_0153437 3300049591 Bacteria 1756
980 Ga0501075_0334557 3300049591 Bacteria 1154
981 Ga0501075_1215610 3300049591 Bacteria 572
982 Ga0501075_1242020 3300049591 Bacteria 565
983 Ga0501076_0165934 3300049592 Bacteria 1800
984 Ga0501077_0310518 3300049593 Bacteria 1005
985 Ga0501077_0372447 3300049593 Bacteria 912
986 Ga0501077_0386885 3300049593 Bacteria 894
987 Ga0501079_0045066 3300049741 Bacteria 3404
988 Ga0501079_0108919 3300049741 Bacteria 2151
989 Ga0501079_0811133 3300049741 Bacteria 737
990 Ga0501079_0937301 3300049741 Bacteria 682
991 Ga0501079_1624177 3300049741 Bacteria 508
992 Ga0501080_0005918 3300049742 Bacteria 10953
993 Ga0501080_0025350 3300049742 Bacteria 5502
994 Ga0501080_0049111 3300049742 Bacteria 3927
995 Ga0501080_0385101 3300049742 Bacteria 1263
996 Ga0501080_0436636 3300049742 Bacteria 1175
997 Ga0501080_0951813 3300049742 Bacteria 746
998 Ga0501080_1056169 3300049742 Bacteria 702
999 Ga0501080_1217666 3300049742 Bacteria 647
1000 Ga0501081_0298704 3300049743 Bacteria 1181
1001 Ga0501081_0674666 3300049743 Bacteria 775
1002 Ga0501081_1289507 3300049743 Unclassified 554
1003 Ga0501081_1460913 3300049743 Bacteria 519
1004 Ga0501083_0003568 3300049744 Bacteria 10904
1005 Ga0501083_0027818 3300049744 Bacteria 3899
1006 Ga0501083_0030644 3300049744 Bacteria 3694
1007 Ga0501083_0045461 3300049744 Bacteria 2971
1008 Ga0501083_0142892 3300049744 Bacteria 1567
1009 Ga0501083_0248523 3300049744 Bacteria 1158
1010 Ga0501083_0260533 3300049744 Bacteria 1128
1011 Ga0501083_0484894 3300049744 Bacteria 804
1012 Ga0501083_0773588 3300049744 Bacteria 625
1013 Ga0501083_0845226 3300049744 Bacteria 596
1014 Ga0501083_1010162 3300049744 Bacteria 541
1015 Ga0501035_0001398 3300049822 Bacteria 24778
1016 Ga0501035_0006244 3300049822 Bacteria 11206
1017 Ga0501035_0217381 3300049822 Bacteria 1633
1018 Ga0501035_0282585 3300049822 Bacteria 1402
1019 Ga0501035_0945237 3300049822 Bacteria 680
1020 Ga0501044_0000144 3300049823 Bacteria 87628
1021 Ga0501044_0039381 3300049823 Bacteria 4931
1022 Ga0501044_0053820 3300049823 Bacteria 4139
1023 Ga0501044_0142628 3300049823 Bacteria 2383
1024 Ga0501044_0143647 3300049823 Bacteria 2374
1025 Ga0501044_0427071 3300049823 Bacteria 1235
1026 Ga0501044_0728509 3300049823 Bacteria 875
1027 Ga0501044_0734446 3300049823 Bacteria 870
1028 Ga0501044_1337423 3300049823 Bacteria 582
1029 Ga0501045_0014266 3300049824 Bacteria 5631
1030 Ga0501045_0191157 3300049824 Bacteria 1526
1031 nmdc:mga03683_113970_c1 3300050489 Bacteria 1198
1032 nmdc:mga03683_136052_c1 3300050489 Bacteria 1102
1033 nmdc:mga03n38_21471_c1 3300050490 Bacteria 2598
1034 nmdc:mga03n38_74265_c1 3300050490 Bacteria 1581
1035 nmdc:mga03n38_912634_c1 3300050490 Bacteria 517
1036 nmdc:mga00v17_119937_c1 3300050491 Bacteria 1674
1037 nmdc:mga00v17_212083_c1 3300050491 Bacteria 1253
1038 nmdc:mga00v17_62461_c1 3300050491 Bacteria 2292
1039 nmdc:mga00v17_862119_c1 3300050491 Unclassified 575
1040 nmdc:mga0yw44_22649_c1 3300050492 Bacteria 3526
1041 nmdc:mga0yw44_329362_c1 3300050492 Unclassified 1026
1042 nmdc:mga0yw44_419147_c1 3300050492 Bacteria 906
1043 nmdc:mga0yw44_642101_c1 3300050492 Bacteria 721
1044 nmdc:mga0k408_18358_c1 3300050493 Bacteria 3904
1045 nmdc:mga0k408_272184_c1 3300050493 Bacteria 572
1046 nmdc:mga0k408_294496_c1 3300050493 Bacteria 968
1047 nmdc:mga0k408_33376_c1 3300050493 Bacteria 2944
1048 nmdc:mga0k408_39346_c2 3300050493 Bacteria 729
1049 nmdc:mga06z11_115359_c1 3300050494 Bacteria 1492
1050 nmdc:mga06z11_15335_c1 3300050494 Bacteria 3418
1051 nmdc:mga06z11_336974_c1 3300050494 Bacteria 901
1052 nmdc:mga06z11_356368_c1 3300050494 Bacteria 876
1053 nmdc:mga04h51_146652_c1 3300050495 Bacteria 899
1054 nmdc:mga07m45_166500_c1 3300050496 Bacteria 1280
1055 nmdc:mga07m45_804514_c1 3300050496 Bacteria 539
1056 nmdc:mga05p37_11125_c1 3300050507 Bacteria 10695
1057 nmdc:mga05p37_1385311_c1 3300050507 Bacteria 709
1058 nmdc:mga05p37_947858_c1 3300050507 Bacteria 921
1059 nmdc:mga09592_34712_c1 3300050508 Bacteria 4218
1060 nmdc:mga09592_441356_c1 3300050508 Unclassified 1123
1061 nmdc:mga0qj67_179390_c1 3300050509 Bacteria 1720
1062 nmdc:mga0qj67_276_c1 3300050509 Bacteria 35718
1063 nmdc:mga0qj67_591110_c1 3300050509 Unclassified 888
1064 nmdc:mga06r32_1575399_c1 3300050510 Unclassified 596
1065 nmdc:mga06r32_7663_c1 3300050510 Bacteria 9710
1066 nmdc:mga06r32_783718_c1 3300050510 Bacteria 915
1067 nmdc:mga08y16_373765_c1 3300050511 Bacteria 1462
1068 nmdc:mga08y16_3857_c1 3300050511 Bacteria 15589
1069 nmdc:mga08y16_3921_c1 3300050511 Bacteria 15490
1070 nmdc:mga08y16_4944_c1 3300050511 Bacteria 13928
1071 nmdc:mga08y16_601643_c1 3300050511 Bacteria 1108
1072 nmdc:mga0n895_1246330_c1 3300050512 Bacteria 716
1073 nmdc:mga0n895_150292_c1 3300050512 Bacteria 2359
1074 nmdc:mga0n895_183619_c1 3300050512 Bacteria 2123
1075 nmdc:mga0n895_36674_c1 3300050512 Bacteria 4736
1076 nmdc:mga0n895_43874_c1 3300050512 Bacteria 4360
1077 nmdc:mga0rr50_3124_c1 3300050513 Bacteria 9465
1078 nmdc:mga08x19_1121739_c1 3300050514 Bacteria 558
1079 nmdc:mga08x19_38060_c1 3300050514 Bacteria 3054
1080 nmdc:mga08x19_504912_c1 3300050514 Unclassified 854
1081 nmdc:mga08x19_924325_c1 3300050514 Unclassified 620
1082 nmdc:mga0a205_1633_c1 3300050515 Bacteria 19288
1083 nmdc:mga0a205_6204_c1 3300050515 Bacteria 10789
1084 nmdc:mga0a205_750252_c1 3300050515 Bacteria 825
1085 nmdc:mga0sz30_51691_c1 3300050516 Bacteria 1744
1086 nmdc:mga0sz30_66522_c1 3300050516 Bacteria 1546
1087 nmdc:mga0sz30_77064_c1 3300050516 Bacteria 1440
1088 Ga0495601_0000128 3300053077 Bacteria 42850
1089 Ga0495601_0004569 3300053077 Bacteria 8005
1090 Ga0495601_0021624 3300053077 Bacteria 3940
1091 Ga0495601_0324568 3300053077 Bacteria 1002
1092 Ga0495612_0002324 3300053078 Bacteria 7835
1093 Ga0495612_0026565 3300053078 Bacteria 2326
1094 Ga0495612_0040582 3300053078 Bacteria 1896
1095 Ga0495612_0056227 3300053078 Bacteria 1623
1096 Ga0500610_0076252 3300053079 Bacteria 1748
1097 Ga0500635_0085652 3300053080 Bacteria 1139
1098 Ga0495595_0000754 3300053084 Bacteria 12270
1099 Ga0495595_0022079 3300053084 Bacteria 2789
1100 Ga0495595_0042886 3300053084 Bacteria 2073
1101 Ga0495595_0284564 3300053084 Unclassified 830
1102 Ga0495595_0443666 3300053084 Bacteria 659
1103 Ga0495619_0000252 3300053085 Bacteria 38976
1104 Ga0495619_0014409 3300053085 Bacteria 4992
1105 Ga0495619_0058073 3300053085 Bacteria 2567
1106 Ga0495619_0209561 3300053085 Bacteria 1350
1107 Ga0495619_0257904 3300053085 Unclassified 1208
1108 Ga0495619_0288798 3300053085 Bacteria 1136
1109 Ga0495619_0517880 3300053085 Unclassified 819
1110 Ga0495619_0721079 3300053085 Bacteria 677
1111 Ga0500643_003892 3300053087 Bacteria 6935
1112 Ga0500644_0170246 3300053088 Unclassified 885
1113 Ga0500646_0019777 3300053090 Bacteria 1784
1114 Ga0500583_0173540 3300053092 Bacteria 1074
1115 Ga0500651_0034932 3300053093 Bacteria 3169
1116 Ga0500651_0266704 3300053093 Bacteria 991
1117 Ga0500566_0050359 3300053094 Bacteria 2385
1118 Ga0500566_0196625 3300053094 Bacteria 1022
1119 Ga0500641_0037364 3300053096 Bacteria 1946
1120 Ga0500641_0083814 3300053096 Bacteria 1355
1121 Ga0500650_0012656 3300053098 Bacteria 3516
1122 Ga0500562_164288 3300053108 Unclassified 604
1123 Ga0500593_003271 3300053117 Bacteria 6098
1124 Ga0500595_000010 3300053119 Bacteria 275806
1125 Ga0500595_003306 3300053119 Bacteria 7587
1126 Ga0500595_148931 3300053119 Bacteria 655
1127 Ga0500595_170807 3300053119 Bacteria 604
1128 Ga0500652_000068 3300053131 Bacteria 45116
1129 Ga0500652_144470 3300053131 Bacteria 989
1130 Ga0500652_163002 3300053131 Bacteria 920
1131 Ga0500658_0264437 3300053134 Unclassified 791
1132 Ga0500658_0285502 3300053134 Bacteria 759
1133 Ga0500658_0384893 3300053134 Unclassified 643
1134 Ga0500573_0267100 3300053140 Bacteria 873
1135 Ga0500577_0069654 3300053142 Bacteria 1376
1136 Ga0500604_0259502 3300053151 Bacteria 602
1137 Ga0500616_0000001 3300053153 Bacteria 1986011
1138 Ga0500616_0197263 3300053153 Bacteria 894
1139 Ga0500633_0176670 3300053160 Bacteria 801
1140 Ga0500639_255786 3300053163 Bacteria 697
1141 Ga0500636_0017818 3300053177 Bacteria 4197
1142 Ga0500645_001000 3300053730 Bacteria 15943
1143 Ga0500645_024140 3300053730 Bacteria 1860
1144 Ga0501084_0131328 3300054114 Bacteria 2108
1145 Ga0501084_0324286 3300054114 Bacteria 1301
1146 Ga0501084_0337528 3300054114 Bacteria 1273
1147 Ga0501084_0438027 3300054114 Bacteria 1105
1148 Ga0501084_0516132 3300054114 Bacteria 1010
1149 Ga0501084_0523625 3300054114 Bacteria 1002
1150 Ga0501084_0691150 3300054114 Bacteria 860
1151 Ga0501084_1008997 3300054114 Bacteria 699
1152 Ga0590071_129695 3300059421 Bacteria 647
1153 Ga0501082_0000002 3300060353 Bacteria 186546
1154 Ga0501082_0036242 3300060353 Bacteria 4250
1155 Ga0501082_0204626 3300060353 Bacteria 1717
1156 Ga0501082_0208295 3300060353 Bacteria 1701
1157 Ga0501082_1731668 3300060353 Bacteria 545
1158 Ga0466962_0234228 3300061719 Bacteria 901
1159 Ga0530510_0186955 3300061734 Bacteria 1537
1160 Ga0530510_0194378 3300061734 Bacteria 1506
1161 Ga0530510_0740144 3300061734 Bacteria 750
1162 Ga0530510_1129293 3300061734 Bacteria 601

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0548422 Ga0436365_0548422_281_427 46
2 iso_pu_bacteria 2643221547 2643758738 46
3 3300037068 Ga0373925_0047796 Ga0373925_0047796_58_207 49
4 2162886007 SwRhRL2b_contig_1214090 SwRhRL2b_0905.00003880 50
5 2209111006 2214544925 2213593515 50
6 3300000041 ARcpr5oldR_c000010 ARcpr5oldR_0000102 50
7 3300000042 ARSoilYngRDRAFT_c00196 ARSoilYngRDRAFT_001962 50
8 3300000043 ARcpr5yngRDRAFT_c000115 ARcpr5yngRDRAFT_00011511 50
9 3300000044 ARSoilOldRDRAFT_c000011 ARSoilOldRDRAFT_00001142 50
10 3300000045 ARCol0oldRDRAFT_c01232 ARCol0oldRDRAFT_012322 50
11 3300000652 ARCol0yngRDRAFT_1000146 ARCol0yngRDRAFT_100014611 50
12 3300001989 JGI24739J22299_10259205 JGI24739J22299_102592052 50
13 3300001990 JGI24737J22298_10014667 JGI24737J22298_100146673 50
14 3300002070 JGI24750J21931_1090863 JGI24750J21931_10908632 50
15 3300003203 JGI25406J46586_10042133 JGI25406J46586_100421332 50
16 3300003215 JGI25153J46596_10076793 JGI25153J46596_100767932 50
17 3300003349 JGI26129J50193_1003592 JGI26129J50193_10035922 50
18 3300003659 JGI25404J52841_10002795 JGI25404J52841_100027952 50
19 3300005276 Ga0065717_1009073 Ga0065717_10090732 50
20 3300005277 Ga0065716_1002355 Ga0065716_10023553 50
21 3300005289 Ga0065704_10183801 Ga0065704_101838012 50
22 3300005290 Ga0065712_10002020 Ga0065712_100020205 50
23 3300005293 Ga0065715_10003793 Ga0065715_100037935 50
24 3300005295 Ga0065707_10116796 Ga0065707_101167963 50
25 3300005295 Ga0065707_10343487 Ga0065707_103434872 50
26 3300005327 Ga0070658_10847216 Ga0070658_108472162 50
27 3300005327 Ga0070658_11112861 Ga0070658_111128612 50
28 3300005327 Ga0070658_11702795 Ga0070658_117027951 50
29 3300005328 Ga0070676_10017457 Ga0070676_100174573 50
30 3300005328 Ga0070676_10063935 Ga0070676_100639352 50
31 3300005329 Ga0070683_100086846 Ga0070683_1000868463 50
32 3300005329 Ga0070683_100243897 Ga0070683_1002438972 50
33 3300005329 Ga0070683_101340326 Ga0070683_1013403262 50
34 3300005330 Ga0070690_100022382 Ga0070690_1000223823 50
35 3300005330 Ga0070690_100176254 Ga0070690_1001762542 50
36 3300005330 Ga0070690_100348198 Ga0070690_1003481982 50
37 3300005330 Ga0070690_100766720 Ga0070690_1007667202 50
38 3300005331 Ga0070670_100357373 Ga0070670_1003573732 50
39 3300005333 Ga0070677_10002078 Ga0070677_100020784 50
40 3300005334 Ga0068869_100324936 Ga0068869_1003249362 50
41 3300005335 Ga0070666_10445212 Ga0070666_104452122 50
42 3300005335 Ga0070666_10988766 Ga0070666_109887661 50
43 3300005336 Ga0070680_100008129 Ga0070680_1000081295 50
44 3300005336 Ga0070680_100021792 Ga0070680_1000217925 50
45 3300005336 Ga0070680_100114301 Ga0070680_1001143012 50
46 3300005336 Ga0070680_100392690 Ga0070680_1003926902 50
47 3300005336 Ga0070680_100754257 Ga0070680_1007542572 50
48 3300005337 Ga0070682_100159994 Ga0070682_1001599943 50
49 3300005338 Ga0068868_100248350 Ga0068868_1002483502 50
50 3300005338 Ga0068868_100548965 Ga0068868_1005489652 50
51 3300005339 Ga0070660_100042110 Ga0070660_1000421102 50
52 3300005339 Ga0070660_100561947 Ga0070660_1005619472 50
53 3300005340 Ga0070689_100034111 Ga0070689_1000341112 50
54 3300005340 Ga0070689_100124157 Ga0070689_1001241572 50
55 3300005340 Ga0070689_101003481 Ga0070689_1010034812 50
56 3300005340 Ga0070689_101343683 Ga0070689_1013436832 50
57 3300005340 Ga0070689_101441850 Ga0070689_1014418502 50
58 3300005343 Ga0070687_100002894 Ga0070687_1000028944 50
59 3300005343 Ga0070687_100429389 Ga0070687_1004293891 50
60 3300005344 Ga0070661_100333288 Ga0070661_1003332882 50
61 3300005344 Ga0070661_100349766 Ga0070661_1003497662 50
62 3300005344 Ga0070661_100740684 Ga0070661_1007406842 50
63 3300005344 Ga0070661_101394325 Ga0070661_1013943251 50
64 3300005345 Ga0070692_10032024 Ga0070692_100320243 50
65 3300005347 Ga0070668_100306545 Ga0070668_1003065452 50
66 3300005353 Ga0070669_100060274 Ga0070669_1000602742 50
67 3300005353 Ga0070669_100513055 Ga0070669_1005130552 50
68 3300005354 Ga0070675_100024911 Ga0070675_1000249112 50
69 3300005354 Ga0070675_100056848 Ga0070675_1000568483 50
70 3300005354 Ga0070675_100235788 Ga0070675_1002357883 50
71 3300005355 Ga0070671_100072923 Ga0070671_1000729232 50
72 3300005355 Ga0070671_101392630 Ga0070671_1013926301 50
73 3300005355 Ga0070671_101399153 Ga0070671_1013991531 50
74 3300005356 Ga0070674_100021304 Ga0070674_1000213043 50
75 3300005364 Ga0070673_100152218 Ga0070673_1001522181 50
76 3300005364 Ga0070673_100258603 Ga0070673_1002586032 50
77 3300005364 Ga0070673_100350324 Ga0070673_1003503242 50
78 3300005365 Ga0070688_100004335 Ga0070688_1000043355 50
79 3300005365 Ga0070688_100780516 Ga0070688_1007805162 50
80 3300005365 Ga0070688_101045932 Ga0070688_1010459321 50
81 3300005365 Ga0070688_101696642 Ga0070688_1016966422 50
82 3300005366 Ga0070659_100013250 Ga0070659_1000132502 50
83 3300005366 Ga0070659_101181398 Ga0070659_1011813982 50
84 3300005366 Ga0070659_101416066 Ga0070659_1014160662 50
85 3300005367 Ga0070667_100012258 Ga0070667_1000122582 50
86 3300005367 Ga0070667_100070526 Ga0070667_1000705265 50
87 3300005406 Ga0070703_10012592 Ga0070703_100125923 50
88 3300005434 Ga0070709_10589086 Ga0070709_105890862 50
89 3300005434 Ga0070709_10992065 Ga0070709_109920652 50
90 3300005435 Ga0070714_100033988 Ga0070714_1000339884 50
91 3300005435 Ga0070714_101307291 Ga0070714_1013072912 50
92 3300005435 Ga0070714_101955220 Ga0070714_1019552202 50
93 3300005436 Ga0070713_100070085 Ga0070713_1000700852 50
94 3300005436 Ga0070713_101616260 Ga0070713_1016162602 50
95 3300005437 Ga0070710_10581970 Ga0070710_105819702 50
96 3300005438 Ga0070701_10002296 Ga0070701_100022965 50
97 3300005439 Ga0070711_100031787 Ga0070711_1000317873 50
98 3300005439 Ga0070711_100225952 Ga0070711_1002259522 50
99 3300005439 Ga0070711_100323548 Ga0070711_1003235482 50
100 3300005440 Ga0070705_100051740 Ga0070705_1000517403 50
101 3300005441 Ga0070700_100016513 Ga0070700_1000165133 50
102 3300005444 Ga0070694_100021216 Ga0070694_1000212163 50
103 3300005444 Ga0070694_101881352 Ga0070694_1018813522 50
104 3300005445 Ga0070708_100556564 Ga0070708_1005565641 50
105 3300005455 Ga0070663_100042652 Ga0070663_1000426523 50
106 3300005455 Ga0070663_100915330 Ga0070663_1009153302 50
107 3300005456 Ga0070678_100059493 Ga0070678_1000594933 50
108 3300005456 Ga0070678_100338504 Ga0070678_1003385042 50
109 3300005457 Ga0070662_100021643 Ga0070662_1000216433 50
110 3300005457 Ga0070662_100073671 Ga0070662_1000736712 50
111 3300005457 Ga0070662_100499880 Ga0070662_1004998802 50
112 3300005457 Ga0070662_101097925 Ga0070662_1010979252 50
113 3300005458 Ga0070681_10034403 Ga0070681_100344033 50
114 3300005458 Ga0070681_10038531 Ga0070681_100385313 50
115 3300005458 Ga0070681_10280762 Ga0070681_102807622 50
116 3300005458 Ga0070681_11147386 Ga0070681_111473862 50
117 3300005458 Ga0070681_11304468 Ga0070681_113044682 50
118 3300005458 Ga0070681_11857453 Ga0070681_118574531 50
119 3300005459 Ga0068867_100086031 Ga0068867_1000860313 50
120 3300005459 Ga0068867_101301038 Ga0068867_1013010381 50
121 3300005459 Ga0068867_101716385 Ga0068867_1017163852 50
122 3300005466 Ga0070685_10074904 Ga0070685_100749042 50
123 3300005466 Ga0070685_10225230 Ga0070685_102252302 50
124 3300005466 Ga0070685_10740150 Ga0070685_107401502 50
125 3300005467 Ga0070706_101707530 Ga0070706_1017075302 50
126 3300005468 Ga0070707_100241054 Ga0070707_1002410542 50
127 3300005471 Ga0070698_102199578 Ga0070698_1021995782 50
128 3300005530 Ga0070679_100023893 Ga0070679_1000238935 50
129 3300005530 Ga0070679_100185779 Ga0070679_1001857792 50
130 3300005530 Ga0070679_100342553 Ga0070679_1003425532 50
131 3300005530 Ga0070679_101062693 Ga0070679_1010626932 50
132 3300005535 Ga0070684_100066522 Ga0070684_1000665221 50
133 3300005535 Ga0070684_100098652 Ga0070684_1000986522 50
134 3300005539 Ga0068853_100016002 Ga0068853_1000160025 50
135 3300005539 Ga0068853_100588724 Ga0068853_1005887242 50
136 3300005539 Ga0068853_101104213 Ga0068853_1011042132 50
137 3300005539 Ga0068853_101365465 Ga0068853_1013654652 50
138 3300005539 Ga0068853_101468616 Ga0068853_1014686162 50
139 3300005539 Ga0068853_101985081 Ga0068853_1019850812 50
140 3300005543 Ga0070672_100235384 Ga0070672_1002353842 50
141 3300005543 Ga0070672_100273427 Ga0070672_1002734271 50
142 3300005544 Ga0070686_100005464 Ga0070686_1000054645 50
143 3300005544 Ga0070686_100092484 Ga0070686_1000924842 50
144 3300005544 Ga0070686_100382250 Ga0070686_1003822502 50
145 3300005545 Ga0070695_100010952 Ga0070695_1000109525 50
146 3300005546 Ga0070696_100030566 Ga0070696_1000305663 50
147 3300005546 Ga0070696_100424080 Ga0070696_1004240802 50
148 3300005547 Ga0070693_100122059 Ga0070693_1001220593 50
149 3300005548 Ga0070665_100308742 Ga0070665_1003087422 50
150 3300005548 Ga0070665_100927629 Ga0070665_1009276292 50
151 3300005549 Ga0070704_100015476 Ga0070704_1000154765 50
152 3300005563 Ga0068855_100364369 Ga0068855_1003643692 50
153 3300005563 Ga0068855_101822000 Ga0068855_1018220002 50
154 3300005563 Ga0068855_102427093 Ga0068855_1024270932 50
155 3300005564 Ga0070664_100055807 Ga0070664_1000558074 50
156 3300005564 Ga0070664_100482383 Ga0070664_1004823832 50
157 3300005577 Ga0068857_100256916 Ga0068857_1002569162 50
158 3300005577 Ga0068857_100639145 Ga0068857_1006391452 50
159 3300005577 Ga0068857_100971006 Ga0068857_1009710062 50
160 3300005577 Ga0068857_101792118 Ga0068857_1017921182 50
161 3300005577 Ga0068857_101996283 Ga0068857_1019962831 50
162 3300005578 Ga0068854_101832540 Ga0068854_1018325401 50
163 3300005578 Ga0068854_102128939 Ga0068854_1021289392 50
164 3300005614 Ga0068856_100734966 Ga0068856_1007349662 50
165 3300005614 Ga0068856_101010213 Ga0068856_1010102132 50
166 3300005615 Ga0070702_100153487 Ga0070702_1001534873 50
167 3300005615 Ga0070702_101301647 Ga0070702_1013016472 50
168 3300005616 Ga0068852_100107673 Ga0068852_1001076732 50
169 3300005617 Ga0068859_100016485 Ga0068859_1000164856 50
170 3300005617 Ga0068859_100328662 Ga0068859_1003286622 50
171 3300005618 Ga0068864_100143861 Ga0068864_1001438611 50
172 3300005618 Ga0068864_101534092 Ga0068864_1015340922 50
173 3300005618 Ga0068864_102455977 Ga0068864_1024559772 50
174 3300005718 Ga0068866_10188515 Ga0068866_101885152 50
175 3300005719 Ga0068861_100025172 Ga0068861_1000251722 50
176 3300005719 Ga0068861_100242617 Ga0068861_1002426172 50
177 3300005719 Ga0068861_102044978 Ga0068861_1020449782 50
178 3300005719 Ga0068861_102240319 Ga0068861_1022403192 50
179 3300005840 Ga0068870_10762329 Ga0068870_107623292 50
180 3300005841 Ga0068863_101276898 Ga0068863_1012768982 50
181 3300005842 Ga0068858_100021667 Ga0068858_1000216673 50
182 3300005842 Ga0068858_100022184 Ga0068858_1000221846 50
183 3300005842 Ga0068858_102004267 Ga0068858_1020042672 50
184 3300005843 Ga0068860_100323614 Ga0068860_1003236142 50
185 3300005843 Ga0068860_101251682 Ga0068860_1012516821 50
186 3300005843 Ga0068860_101560943 Ga0068860_1015609432 50
187 3300005843 Ga0068860_102053112 Ga0068860_1020531122 50
188 3300005844 Ga0068862_100020703 Ga0068862_1000207035 50
189 3300005937 Ga0081455_10005815 Ga0081455_100058158 50
190 3300005937 Ga0081455_10022516 Ga0081455_100225163 50
191 3300005981 Ga0081538_10009018 Ga0081538_100090186 50
192 3300005981 Ga0081538_10101327 Ga0081538_101013272 50
193 3300005983 Ga0081540_1000075 Ga0081540_100007558 50
194 3300005985 Ga0081539_10001975 Ga0081539_1000197514 50
195 3300005985 Ga0081539_10047978 Ga0081539_100479784 50
196 3300006038 Ga0075365_10476354 Ga0075365_104763542 50
197 3300006038 Ga0075365_10762792 Ga0075365_107627922 50
198 3300006038 Ga0075365_10773087 Ga0075365_107730872 50
199 3300006038 Ga0075365_10773670 Ga0075365_107736702 50
200 3300006042 Ga0075368_10012277 Ga0075368_100122775 50
201 3300006042 Ga0075368_10561133 Ga0075368_105611332 50
202 3300006042 Ga0075368_10588371 Ga0075368_105883712 50
203 3300006048 Ga0075363_100005447 Ga0075363_1000054473 50
204 3300006048 Ga0075363_100072719 Ga0075363_1000727192 50
205 3300006048 Ga0075363_100601611 Ga0075363_1006016112 50
206 3300006051 Ga0075364_10036593 Ga0075364_100365933 50
207 3300006058 Ga0075432_10000577 Ga0075432_100005772 50
208 3300006058 Ga0075432_10117725 Ga0075432_101177252 50
209 3300006163 Ga0070715_10227625 Ga0070715_102276252 50
210 3300006173 Ga0070716_100462006 Ga0070716_1004620062 50
211 3300006173 Ga0070716_100549316 Ga0070716_1005493161 50
212 3300006173 Ga0070716_100708141 Ga0070716_1007081412 50
213 3300006175 Ga0070712_100189311 Ga0070712_1001893113 50
214 3300006177 Ga0075362_10066001 Ga0075362_100660012 50
215 3300006177 Ga0075362_10076370 Ga0075362_100763702 50
216 3300006178 Ga0075367_10207894 Ga0075367_102078942 50
217 3300006186 Ga0075369_10176798 Ga0075369_101767982 50
218 3300006186 Ga0075369_10198132 Ga0075369_101981322 50
219 3300006195 Ga0075366_10001029 Ga0075366_100010297 50
220 3300006195 Ga0075366_10036597 Ga0075366_100365973 50
221 3300006195 Ga0075366_10211729 Ga0075366_102117292 50
222 3300006195 Ga0075366_11024841 Ga0075366_110248411 50
223 3300006237 Ga0097621_100457846 Ga0097621_1004578462 50
224 3300006237 Ga0097621_100687644 Ga0097621_1006876442 50
225 3300006353 Ga0075370_10805019 Ga0075370_108050191 50
226 3300006358 Ga0068871_100041833 Ga0068871_1000418333 50
227 3300006358 Ga0068871_102402405 Ga0068871_1024024052 50
228 3300006844 Ga0075428_100006232 Ga0075428_10000623210 50
229 3300006844 Ga0075428_101113511 Ga0075428_1011135112 50
230 3300006844 Ga0075428_101539688 Ga0075428_1015396882 50
231 3300006846 Ga0075430_100000094 Ga0075430_10000009412 50
232 3300006846 Ga0075430_100638606 Ga0075430_1006386062 50
233 3300006847 Ga0075431_100002415 Ga0075431_1000024156 50
234 3300006847 Ga0075431_100132392 Ga0075431_1001323921 50
235 3300006847 Ga0075431_100498158 Ga0075431_1004981582 50
236 3300006852 Ga0075433_10000311 Ga0075433_1000031120 50
237 3300006852 Ga0075433_10343719 Ga0075433_103437192 50
238 3300006852 Ga0075433_10728426 Ga0075433_107284262 50
239 3300006871 Ga0075434_100000299 Ga0075434_1000002996 50
240 3300006871 Ga0075434_100080185 Ga0075434_1000801853 50
241 3300006871 Ga0075434_100114325 Ga0075434_1001143253 50
242 3300006871 Ga0075434_101467440 Ga0075434_1014674402 50
243 3300006871 Ga0075434_101709577 Ga0075434_1017095773 50
244 3300006871 Ga0075434_102598391 Ga0075434_1025983912 50
245 3300006880 Ga0075429_100001750 Ga0075429_1000017506 50
246 3300006880 Ga0075429_100463759 Ga0075429_1004637592 50
247 3300006881 Ga0068865_100079384 Ga0068865_1000793841 50
248 3300006881 Ga0068865_101374145 Ga0068865_1013741452 50
249 3300006914 Ga0075436_100530442 Ga0075436_1005304422 50
250 3300006914 Ga0075436_100586862 Ga0075436_1005868621 50
251 3300006914 Ga0075436_101262704 Ga0075436_1012627042 50
252 3300006931 Ga0097620_100016485 Ga0097620_1000164856 50
253 3300006931 Ga0097620_100328633 Ga0097620_1003286333 50
254 3300007076 Ga0075435_100006776 Ga0075435_1000067763 50
255 3300009093 Ga0105240_10318508 Ga0105240_103185082 50
256 3300009094 Ga0111539_10002742 Ga0111539_1000274215 50
257 3300009094 Ga0111539_10016215 Ga0111539_100162157 50
258 3300009094 Ga0111539_10625885 Ga0111539_106258852 50
259 3300009094 Ga0111539_10649574 Ga0111539_106495742 50
260 3300009094 Ga0111539_11152998 Ga0111539_111529981 50
261 3300009098 Ga0105245_10000837 Ga0105245_1000083720 50
262 3300009098 Ga0105245_10342051 Ga0105245_103420512 50
263 3300009098 Ga0105245_11318287 Ga0105245_113182872 50
264 3300009098 Ga0105245_11635564 Ga0105245_116355642 50
265 3300009101 Ga0105247_10163923 Ga0105247_101639231 50
266 3300009101 Ga0105247_11841681 Ga0105247_118416812 50
267 3300009147 Ga0114129_10006608 Ga0114129_100066083 50
268 3300009147 Ga0114129_11835118 Ga0114129_118351181 50
269 3300009147 Ga0114129_12425815 Ga0114129_124258152 50
270 3300009148 Ga0105243_10013871 Ga0105243_100138713 50
271 3300009148 Ga0105243_10047935 Ga0105243_100479352 50
272 3300009148 Ga0105243_10050222 Ga0105243_100502224 50
273 3300009148 Ga0105243_10234808 Ga0105243_102348082 50
274 3300009148 Ga0105243_11940449 Ga0105243_119404492 50
275 3300009148 Ga0105243_11963706 Ga0105243_119637062 50
276 3300009176 Ga0105242_10189931 Ga0105242_101899313 50
277 3300009176 Ga0105242_10192414 Ga0105242_101924142 50
278 3300009176 Ga0105242_10901510 Ga0105242_109015102 50
279 3300009176 Ga0105242_13141477 Ga0105242_131414772 50
280 3300009177 Ga0105248_10014747 Ga0105248_100147479 50
281 3300009177 Ga0105248_10531532 Ga0105248_105315322 50
282 3300009177 Ga0105248_10760951 Ga0105248_107609512 50
283 3300009177 Ga0105248_11769999 Ga0105248_117699991 50
284 3300009545 Ga0105237_10105666 Ga0105237_101056662 50
285 3300009551 Ga0105238_10027021 Ga0105238_100270219 50
286 3300009551 Ga0105238_10092667 Ga0105238_100926672 50
287 3300009551 Ga0105238_10279234 Ga0105238_102792342 50
288 3300009551 Ga0105238_12704342 Ga0105238_127043422 50
289 3300009553 Ga0105249_10012767 Ga0105249_100127675 50
290 3300009553 Ga0105249_10079208 Ga0105249_100792085 50
291 3300009553 Ga0105249_10467482 Ga0105249_104674821 50
292 3300009553 Ga0105249_12236427 Ga0105249_122364272 50
293 3300010375 Ga0105239_10063436 Ga0105239_100634364 50
294 3300011119 Ga0105246_10105187 Ga0105246_101051873 50
295 3300011119 Ga0105246_10326236 Ga0105246_103262362 50
296 3300011119 Ga0105246_11672389 Ga0105246_116723892 50
297 3300012481 Ga0157320_1027432 Ga0157320_10274322 50
298 3300012482 Ga0157318_1001371 Ga0157318_10013712 50
299 3300012488 Ga0157343_1000283 Ga0157343_10002832 50
300 3300012497 Ga0157319_1024999 Ga0157319_10249991 50
301 3300012500 Ga0157314_1007673 Ga0157314_10076732 50
302 3300013100 Ga0157373_11207809 Ga0157373_112078092 50
303 3300013104 Ga0157370_10326121 Ga0157370_103261212 50
304 3300013104 Ga0157370_10448039 Ga0157370_104480392 50
305 3300013104 Ga0157370_10505031 Ga0157370_105050311 50
306 3300013105 Ga0157369_10337612 Ga0157369_103376122 50
307 3300013296 Ga0157374_10192064 Ga0157374_101920643 50
308 3300013297 Ga0157378_10381387 Ga0157378_103813873 50
309 3300013297 Ga0157378_10492968 Ga0157378_104929682 50
310 3300013297 Ga0157378_10554333 Ga0157378_105543332 50
311 3300013306 Ga0163162_10024488 Ga0163162_100244884 50
312 3300013306 Ga0163162_12258430 Ga0163162_122584302 50
313 3300013306 Ga0163162_13040374 Ga0163162_130403741 50
314 3300013306 Ga0163162_13209038 Ga0163162_132090382 50
315 3300013306 Ga0163162_13401461 Ga0163162_134014612 50
316 3300013308 Ga0157375_10745746 Ga0157375_107457461 50
317 3300014325 Ga0163163_10329236 Ga0163163_103292363 50
318 3300014325 Ga0163163_11432966 Ga0163163_114329662 50
319 3300014325 Ga0163163_12731329 Ga0163163_127313292 50
320 3300014326 Ga0157380_10102648 Ga0157380_101026482 50
321 3300014326 Ga0157380_10363305 Ga0157380_103633053 50
322 3300014326 Ga0157380_10453399 Ga0157380_104533992 50
323 3300014326 Ga0157380_11316599 Ga0157380_113165993 50
324 3300014326 Ga0157380_11382406 Ga0157380_113824061 50
325 3300014326 Ga0157380_12264480 Ga0157380_122644802 50
326 3300014326 Ga0157380_13157472 Ga0157380_131574722 50
327 3300014497 Ga0182008_10268819 Ga0182008_102688192 50
328 3300014745 Ga0157377_10065171 Ga0157377_100651712 50
329 3300014745 Ga0157377_10491884 Ga0157377_104918842 50
330 3300014745 Ga0157377_11521481 Ga0157377_115214812 50
331 3300014968 Ga0157379_12248064 Ga0157379_122480641 50
332 3300014968 Ga0157379_12317276 Ga0157379_123172761 50
333 3300014969 Ga0157376_10340392 Ga0157376_103403922 50
334 3300015261 Ga0182006_1135221 Ga0182006_11352212 50
335 3300015265 Ga0182005_1163733 Ga0182005_11637331 50
336 3300017792 Ga0163161_10445901 Ga0163161_104459012 50
337 3300017792 Ga0163161_11899805 Ga0163161_118998052 50
338 3300021384 Ga0213876_10054333 Ga0213876_100543332 50
339 3300025271 Ga0207666_1019663 Ga0207666_10196632 50
340 3300025297 Ga0209758_1000798 Ga0209758_100079811 50
341 3300025297 Ga0209758_1180940 Ga0209758_11809402 50
342 3300025302 Ga0207426_1042818 Ga0207426_10428182 50
343 3300025315 Ga0207697_10003830 Ga0207697_100038305 50
344 3300025885 Ga0207653_10026551 Ga0207653_100265512 50
345 3300025893 Ga0207682_10006252 Ga0207682_100062526 50
346 3300025898 Ga0207692_10004680 Ga0207692_100046805 50
347 3300025898 Ga0207692_10381151 Ga0207692_103811512 50
348 3300025899 Ga0207642_10317492 Ga0207642_103174922 50
349 3300025899 Ga0207642_10469141 Ga0207642_104691411 50
350 3300025900 Ga0207710_10046897 Ga0207710_100468973 50
351 3300025901 Ga0207688_10025803 Ga0207688_100258033 50
352 3300025901 Ga0207688_10214346 Ga0207688_102143462 50
353 3300025903 Ga0207680_10284043 Ga0207680_102840431 50
354 3300025903 Ga0207680_10532843 Ga0207680_105328432 50
355 3300025903 Ga0207680_10540781 Ga0207680_105407812 50
356 3300025904 Ga0207647_10048235 Ga0207647_100482352 50
357 3300025906 Ga0207699_10348899 Ga0207699_103488992 50
358 3300025906 Ga0207699_10498340 Ga0207699_104983402 50
359 3300025906 Ga0207699_10841626 Ga0207699_108416262 50
360 3300025907 Ga0207645_10015866 Ga0207645_100158663 50
361 3300025907 Ga0207645_10296887 Ga0207645_102968871 50
362 3300025908 Ga0207643_10152148 Ga0207643_101521483 50
363 3300025908 Ga0207643_10386112 Ga0207643_103861122 50
364 3300025909 Ga0207705_10979514 Ga0207705_109795142 50
365 3300025909 Ga0207705_11428421 Ga0207705_114284212 50
366 3300025910 Ga0207684_11449145 Ga0207684_114491452 50
367 3300025912 Ga0207707_10145572 Ga0207707_101455723 50
368 3300025912 Ga0207707_10682271 Ga0207707_106822712 50
369 3300025913 Ga0207695_10676283 Ga0207695_106762832 50
370 3300025914 Ga0207671_10012740 Ga0207671_100127403 50
371 3300025915 Ga0207693_10013335 Ga0207693_100133356 50
372 3300025915 Ga0207693_10205875 Ga0207693_102058751 50
373 3300025916 Ga0207663_10010773 Ga0207663_100107736 50
374 3300025916 Ga0207663_10151907 Ga0207663_101519072 50
375 3300025917 Ga0207660_10037682 Ga0207660_100376823 50
376 3300025917 Ga0207660_10070303 Ga0207660_100703033 50
377 3300025917 Ga0207660_11530847 Ga0207660_115308472 50
378 3300025918 Ga0207662_10004510 Ga0207662_100045105 50
379 3300025918 Ga0207662_10536520 Ga0207662_105365201 50
380 3300025919 Ga0207657_10037566 Ga0207657_100375663 50
381 3300025919 Ga0207657_10065282 Ga0207657_100652823 50
382 3300025919 Ga0207657_10476574 Ga0207657_104765742 50
383 3300025920 Ga0207649_10327908 Ga0207649_103279082 50
384 3300025920 Ga0207649_10745954 Ga0207649_107459542 50
385 3300025921 Ga0207652_10195406 Ga0207652_101954062 50
386 3300025921 Ga0207652_10335270 Ga0207652_103352702 50
387 3300025921 Ga0207652_10732886 Ga0207652_107328862 50
388 3300025921 Ga0207652_11068783 Ga0207652_110687832 50
389 3300025923 Ga0207681_10355019 Ga0207681_103550191 50
390 3300025923 Ga0207681_10920390 Ga0207681_109203902 50
391 3300025924 Ga0207694_10046790 Ga0207694_100467905 50
392 3300025924 Ga0207694_10173001 Ga0207694_101730012 50
393 3300025925 Ga0207650_10181060 Ga0207650_101810602 50
394 3300025925 Ga0207650_10290673 Ga0207650_102906732 50
395 3300025926 Ga0207659_10313053 Ga0207659_103130532 50
396 3300025926 Ga0207659_11161378 Ga0207659_111613782 50
397 3300025926 Ga0207659_11259377 Ga0207659_112593772 50
398 3300025927 Ga0207687_10038274 Ga0207687_100382744 50
399 3300025927 Ga0207687_10489703 Ga0207687_104897032 50
400 3300025928 Ga0207700_10380428 Ga0207700_103804282 50
401 3300025929 Ga0207664_10069426 Ga0207664_100694264 50
402 3300025931 Ga0207644_10211681 Ga0207644_102116812 50
403 3300025931 Ga0207644_10661445 Ga0207644_106614452 50
404 3300025931 Ga0207644_11215047 Ga0207644_112150471 50
405 3300025932 Ga0207690_10066347 Ga0207690_100663473 50
406 3300025932 Ga0207690_11001808 Ga0207690_110018082 50
407 3300025933 Ga0207706_10023449 Ga0207706_100234492 50
408 3300025933 Ga0207706_10027637 Ga0207706_100276373 50
409 3300025933 Ga0207706_10054087 Ga0207706_100540874 50
410 3300025933 Ga0207706_10169749 Ga0207706_101697492 50
411 3300025934 Ga0207686_10038012 Ga0207686_100380122 50
412 3300025934 Ga0207686_10444914 Ga0207686_104449142 50
413 3300025935 Ga0207709_10007235 Ga0207709_100072357 50
414 3300025935 Ga0207709_10007780 Ga0207709_100077803 50
415 3300025935 Ga0207709_10247735 Ga0207709_102477353 50
416 3300025935 Ga0207709_10375518 Ga0207709_103755182 50
417 3300025936 Ga0207670_10014485 Ga0207670_100144855 50
418 3300025936 Ga0207670_10161141 Ga0207670_101611412 50
419 3300025936 Ga0207670_11174328 Ga0207670_111743282 50
420 3300025936 Ga0207670_11479209 Ga0207670_114792092 50
421 3300025937 Ga0207669_10018985 Ga0207669_100189852 50
422 3300025937 Ga0207669_11414722 Ga0207669_114147222 50
423 3300025938 Ga0207704_10086909 Ga0207704_100869092 50
424 3300025938 Ga0207704_10885122 Ga0207704_108851222 50
425 3300025939 Ga0207665_10431019 Ga0207665_104310192 50
426 3300025940 Ga0207691_10000720 Ga0207691_1000072027 50
427 3300025941 Ga0207711_10071442 Ga0207711_100714425 50
428 3300025941 Ga0207711_11397676 Ga0207711_113976762 50
429 3300025942 Ga0207689_10381238 Ga0207689_103812381 50
430 3300025942 Ga0207689_11108087 Ga0207689_111080872 50
431 3300025944 Ga0207661_10088130 Ga0207661_100881303 50
432 3300025944 Ga0207661_10103086 Ga0207661_101030863 50
433 3300025944 Ga0207661_10916790 Ga0207661_109167902 50
434 3300025945 Ga0207679_10052691 Ga0207679_100526913 50
435 3300025945 Ga0207679_10219002 Ga0207679_102190023 50
436 3300025945 Ga0207679_10337273 Ga0207679_103372732 50
437 3300025945 Ga0207679_10523583 Ga0207679_105235832 50
438 3300025945 Ga0207679_11259111 Ga0207679_112591112 50
439 3300025949 Ga0207667_10278870 Ga0207667_102788701 50
440 3300025949 Ga0207667_11830837 Ga0207667_118308372 50
441 3300025960 Ga0207651_10025997 Ga0207651_100259973 50
442 3300025960 Ga0207651_10103103 Ga0207651_101031032 50
443 3300025960 Ga0207651_11656253 Ga0207651_116562532 50
444 3300025961 Ga0207712_10599892 Ga0207712_105998923 50
445 3300025972 Ga0207668_10220124 Ga0207668_102201242 50
446 3300025981 Ga0207640_11288579 Ga0207640_112885792 50
447 3300025986 Ga0207658_10595139 Ga0207658_105951392 50
448 3300025986 Ga0207658_10753879 Ga0207658_107538792 50
449 3300026023 Ga0207677_10264896 Ga0207677_102648962 50
450 3300026023 Ga0207677_10858222 Ga0207677_108582222 50
451 3300026023 Ga0207677_10863729 Ga0207677_108637292 50
452 3300026023 Ga0207677_11239392 Ga0207677_112393921 50
453 3300026035 Ga0207703_10077193 Ga0207703_100771933 50
454 3300026035 Ga0207703_10232594 Ga0207703_102325943 50
455 3300026041 Ga0207639_10032263 Ga0207639_100322631 50
456 3300026041 Ga0207639_10604342 Ga0207639_106043422 50
457 3300026041 Ga0207639_11170148 Ga0207639_111701482 50
458 3300026067 Ga0207678_10366266 Ga0207678_103662662 50
459 3300026067 Ga0207678_11078533 Ga0207678_110785331 50
460 3300026067 Ga0207678_11504327 Ga0207678_115043272 50
461 3300026075 Ga0207708_10012300 Ga0207708_100123008 50
462 3300026075 Ga0207708_10435030 Ga0207708_104350302 50
463 3300026075 Ga0207708_11321268 Ga0207708_113212682 50
464 3300026075 Ga0207708_11628343 Ga0207708_116283431 50
465 3300026088 Ga0207641_10145346 Ga0207641_101453463 50
466 3300026088 Ga0207641_10336421 Ga0207641_103364212 50
467 3300026088 Ga0207641_10747251 Ga0207641_107472512 50
468 3300026089 Ga0207648_10023107 Ga0207648_100231072 50
469 3300026089 Ga0207648_10122011 Ga0207648_101220113 50
470 3300026089 Ga0207648_11267791 Ga0207648_112677912 50
471 3300026095 Ga0207676_10176079 Ga0207676_101760791 50
472 3300026095 Ga0207676_10374266 Ga0207676_103742662 50
473 3300026095 Ga0207676_10545721 Ga0207676_105457211 50
474 3300026116 Ga0207674_10180058 Ga0207674_101800583 50
475 3300026116 Ga0207674_10381897 Ga0207674_103818972 50
476 3300026116 Ga0207674_11754504 Ga0207674_117545041 50
477 3300026118 Ga0207675_100012891 Ga0207675_1000128916 50
478 3300026118 Ga0207675_100220277 Ga0207675_1002202773 50
479 3300026118 Ga0207675_100512641 Ga0207675_1005126412 50
480 3300026118 Ga0207675_100533597 Ga0207675_1005335972 50
481 3300026118 Ga0207675_101748477 Ga0207675_1017484772 50
482 3300026118 Ga0207675_102302017 Ga0207675_1023020172 50
483 3300026121 Ga0207683_10021228 Ga0207683_100212286 50
484 3300026142 Ga0207698_10176364 Ga0207698_101763642 50
485 3300026142 Ga0207698_10226587 Ga0207698_102265872 50
486 3300027682 Ga0209971_1075032 Ga0209971_10750322 50
487 3300027695 Ga0209966_1000765 Ga0209966_10007655 50
488 3300027717 Ga0209998_10001832 Ga0209998_100018325 50
489 3300027866 Ga0209813_10112120 Ga0209813_101121202 50
490 3300027876 Ga0209974_10009008 Ga0209974_100090082 50
491 3300027907 Ga0207428_10000626 Ga0207428_1000062612 50
492 3300028379 Ga0268266_10457774 Ga0268266_104577742 50
493 3300028379 Ga0268266_10508637 Ga0268266_105086372 50
494 3300028379 Ga0268266_10903907 Ga0268266_109039072 50
495 3300028379 Ga0268266_11129297 Ga0268266_111292972 50
496 3300028380 Ga0268265_10068531 Ga0268265_100685312 50
497 3300028380 Ga0268265_12583363 Ga0268265_125833631 50
498 3300028381 Ga0268264_10134107 Ga0268264_101341071 50
499 3300028381 Ga0268264_10583484 Ga0268264_105834841 50
500 3300028556 Ga0265337_1001215 Ga0265337_100121510 50
501 3300028800 Ga0265338_10056921 Ga0265338_100569213 50
502 3300028800 Ga0265338_10400752 Ga0265338_104007522 50
503 3300029957 Ga0265324_10163841 Ga0265324_101638412 50
504 3300031235 Ga0265330_10064148 Ga0265330_100641482 50
505 3300031235 Ga0265330_10490772 Ga0265330_104907722 50
506 3300031241 Ga0265325_10002862 Ga0265325_100028627 50
507 3300031241 Ga0265325_10043453 Ga0265325_100434533 50
508 3300031241 Ga0265325_10084258 Ga0265325_100842582 50
509 3300031241 Ga0265325_10372151 Ga0265325_103721512 50
510 3300031242 Ga0265329_10031927 Ga0265329_100319272 50
511 3300031247 Ga0265340_10023153 Ga0265340_100231532 50
512 3300031247 Ga0265340_10031944 Ga0265340_100319443 50
513 3300031247 Ga0265340_10035170 Ga0265340_100351702 50
514 3300031247 Ga0265340_10228324 Ga0265340_102283242 50
515 3300031247 Ga0265340_10339852 Ga0265340_103398521 50
516 3300031247 Ga0265340_10491399 Ga0265340_104913992 50
517 3300031249 Ga0265339_10463770 Ga0265339_104637702 50
518 3300031344 Ga0265316_10038361 Ga0265316_100383613 50
519 3300031344 Ga0265316_10058161 Ga0265316_100581613 50
520 3300031344 Ga0265316_10242658 Ga0265316_102426582 50
521 3300031456 Ga0307513_10097427 Ga0307513_100974274 50
522 3300031456 Ga0307513_10158733 Ga0307513_101587333 50
523 3300031548 Ga0307408_101897712 Ga0307408_1018977122 50
524 3300031595 Ga0265313_10015939 Ga0265313_100159395 50
525 3300031711 Ga0265314_10000439 Ga0265314_100004392 50
526 3300031711 Ga0265314_10006193 Ga0265314_100061938 50
527 3300031711 Ga0265314_10549595 Ga0265314_105495952 50
528 3300031712 Ga0265342_10073571 Ga0265342_100735712 50
529 3300031712 Ga0265342_10103288 Ga0265342_101032882 50
530 3300031731 Ga0307405_11610809 Ga0307405_116108091 50
531 3300031889 Ga0326468_10004264 Ga0326468_100042641 50
532 3300031901 Ga0307406_11535796 Ga0307406_115357962 50
533 3300032005 Ga0307411_11587491 Ga0307411_115874912 50
534 3300032005 Ga0307411_11839705 Ga0307411_118397052 50
535 3300034816 Ga0373930_0001573 Ga0373930_0001573_2413_2565 50
536 3300034816 Ga0373930_0153446 Ga0373930_0153446_359_517 50
537 3300034817 Ga0373948_0007324 Ga0373948_0007324_721_873 50
538 3300034818 Ga0373950_0001736 Ga0373950_0001736_1857_2009 50
539 3300034818 Ga0373950_0011444 Ga0373950_0011444_827_979 50
540 3300034819 Ga0373958_0000026 Ga0373958_0000026_3538_3690 50
541 3300034820 Ga0373959_0000446 Ga0373959_0000446_30_182 50
542 3300034957 Ga0373938_0000337 Ga0373938_0000337_875_1027 50
543 3300035083 Ga0373926_0026336 Ga0373926_0026336_1532_1684 50
544 3300035083 Ga0373926_0123542 Ga0373926_0123542_335_487 50
545 3300035083 Ga0373926_0274714 Ga0373926_0274714_144_296 50
546 3300035084 Ga0373928_0000487 Ga0373928_0000487_3675_3827 50
547 3300035084 Ga0373928_0000532 Ga0373928_0000532_3587_3739 50
548 3300035085 Ga0373929_0000110 Ga0373929_0000110_1531_1683 50
549 3300035085 Ga0373929_0059002 Ga0373929_0059002_278_430 50
550 3300035086 Ga0373934_0145045 Ga0373934_0145045_477_629 50
551 3300035088 Ga0373940_0000116 Ga0373940_0000116_7087_7239 50
552 3300035089 Ga0373944_0135993 Ga0373944_0135993_123_275 50
553 3300035089 Ga0373944_0294123 Ga0373944_0294123_70_222 50
554 3300035090 Ga0373949_0001975 Ga0373949_0001975_3352_3504 50
555 3300035091 Ga0373951_0000638 Ga0373951_0000638_7808_7960 50
556 3300035091 Ga0373951_0014347 Ga0373951_0014347_1066_1218 50
557 3300035092 Ga0373952_0001416 Ga0373952_0001416_3606_3758 50
558 3300035092 Ga0373952_0029826 Ga0373952_0029826_703_855 50
559 3300035111 Ga0373923_0002974 Ga0373923_0002974_456_608 50
560 3300035111 Ga0373923_0133212 Ga0373923_0133212_362_514 50
561 3300035112 Ga0373932_0004843 Ga0373932_0004843_2116_2268 50
562 3300035113 Ga0373936_0007985 Ga0373936_0007985_723_875 50
563 3300035113 Ga0373936_0016239 Ga0373936_0016239_1556_1708 50
564 3300035113 Ga0373936_0022976 Ga0373936_0022976_2058_2216 50
565 3300035113 Ga0373936_0399512 Ga0373936_0399512_256_408 50
566 3300035114 Ga0373939_0011346 Ga0373939_0011346_1233_1385 50
567 3300035114 Ga0373939_0262975 Ga0373939_0262975_313_471 50
568 3300035115 Ga0373941_0000177 Ga0373941_0000177_6721_6873 50
569 3300035115 Ga0373941_0052696 Ga0373941_0052696_990_1142 50
570 3300035115 Ga0373941_0465608 Ga0373941_0465608_239_394 50
571 3300035116 Ga0373945_0013190 Ga0373945_0013190_1337_1489 50
572 3300035116 Ga0373945_0080896 Ga0373945_0080896_529_681 50
573 3300035116 Ga0373945_0112441 Ga0373945_0112441_668_820 50
574 3300035117 Ga0373953_0004119 Ga0373953_0004119_3313_3465 50
575 3300035117 Ga0373953_0035605 Ga0373953_0035605_671_823 50
576 3300035118 Ga0373954_0037704 Ga0373954_0037704_1665_1817 50
577 3300035118 Ga0373954_0074757 Ga0373954_0074757_1071_1223 50
578 3300035118 Ga0373954_0101210 Ga0373954_0101210_669_821 50
579 3300035118 Ga0373954_0207498 Ga0373954_0207498_228_386 50
580 3300035118 Ga0373954_0265227 Ga0373954_0265227_163_315 50
581 3300035119 Ga0373956_0011159 Ga0373956_0011159_599_751 50
582 3300035119 Ga0373956_0047253 Ga0373956_0047253_1032_1184 50
583 3300035119 Ga0373956_0093600 Ga0373956_0093600_486_638 50
584 3300035119 Ga0373956_0182312 Ga0373956_0182312_411_563 50
585 3300035119 Ga0373956_0298529 Ga0373956_0298529_175_327 50
586 3300035120 Ga0373957_0004295 Ga0373957_0004295_4117_4269 50
587 3300035120 Ga0373957_0018552 Ga0373957_0018552_543_695 50
588 3300035120 Ga0373957_0230343 Ga0373957_0230343_24_176 50
589 3300035120 Ga0373957_0252678 Ga0373957_0252678_215_370 50
590 3300035121 Ga0373960_0003980 Ga0373960_0003980_1985_2137 50
591 3300035170 Ga0373943_0004455 Ga0373943_0004455_1168_1320 50
592 3300035170 Ga0373943_0095454 Ga0373943_0095454_1041_1193 50
593 3300035170 Ga0373943_0496996 Ga0373943_0496996_383_535 50
594 3300035171 Ga0373946_0007076 Ga0373946_0007076_2154_2306 50
595 3300035171 Ga0373946_0012082 Ga0373946_0012082_913_1065 50
596 3300035172 Ga0373955_0000509 Ga0373955_0000509_11352_11504 50
597 3300035172 Ga0373955_0007958 Ga0373955_0007958_3840_3992 50
598 3300035172 Ga0373955_0008788 Ga0373955_0008788_1764_1916 50
599 3300035172 Ga0373955_0040130 Ga0373955_0040130_1827_1979 50
600 3300035172 Ga0373955_0295497 Ga0373955_0295497_34_189 50
601 3300035207 Ga0373942_0002386 Ga0373942_0002386_738_890 50
602 3300035207 Ga0373942_0028123 Ga0373942_0028123_60_212 50
603 3300035207 Ga0373942_0090969 Ga0373942_0090969_320_472 50
604 3300035207 Ga0373942_0197046 Ga0373942_0197046_55_210 50
605 3300035241 Ga0373961_0001126 Ga0373961_0001126_3808_3960 50
606 3300035242 Ga0373962_0009256 Ga0373962_0009256_2065_2217 50
607 3300035242 Ga0373962_0010843 Ga0373962_0010843_453_605 50
608 3300035410 Ga0373924_0010900 Ga0373924_0010900_2808_2960 50
609 3300035410 Ga0373924_0016524 Ga0373924_0016524_894_1046 50
610 3300035410 Ga0373924_0018675 Ga0373924_0018675_1116_1274 50
611 3300035410 Ga0373924_0163200 Ga0373924_0163200_592_744 50
612 3300035691 Ga0373931_0021710 Ga0373931_0021710_2375_2527 50
613 3300035692 Ga0373935_0024574 Ga0373935_0024574_3341_3493 50
614 3300035692 Ga0373935_0697246 Ga0373935_0697246_253_405 50
615 3300035692 Ga0373935_1178271 Ga0373935_1178271_29_181 50
616 3300035695 Ga0373927_0021223 Ga0373927_0021223_3029_3181 50
617 3300035695 Ga0373927_0196561 Ga0373927_0196561_594_746 50
618 3300035695 Ga0373927_0847915 Ga0373927_0847915_422_580 50
619 3300035724 Ga0373933_0001541 Ga0373933_0001541_3917_4069 50
620 3300035724 Ga0373933_0043969 Ga0373933_0043969_675_827 50
621 3300035724 Ga0373933_0305040 Ga0373933_0305040_56_211 50
622 3300035724 Ga0373933_0343979 Ga0373933_0343979_742_894 50
623 3300035724 Ga0373933_0983754 Ga0373933_0983754_282_440 50
624 3300035724 Ga0373933_1101789 Ga0373933_1101789_162_314 50
625 3300035725 Ga0373947_0017782 Ga0373947_0017782_3310_3468 50
626 3300035725 Ga0373947_0252500 Ga0373947_0252500_581_733 50
627 3300035725 Ga0373947_0347804 Ga0373947_0347804_378_530 50
628 3300035725 Ga0373947_0492468 Ga0373947_0492468_241_393 50
629 3300036401 Ga0373937_0006385 Ga0373937_0006385_3537_3689 50
630 3300036401 Ga0373937_0130085 Ga0373937_0130085_309_461 50
631 3300036401 Ga0373937_0158313 Ga0373937_0158313_421_573 50
632 3300036401 Ga0373937_0236309 Ga0373937_0236309_423_578 50
633 3300036401 Ga0373937_0237316 Ga0373937_0237316_633_785 50
634 3300036401 Ga0373937_0611734 Ga0373937_0611734_506_664 50
635 3300036401 Ga0373937_0642406 Ga0373937_0642406_360_512 50
636 3300036401 Ga0373937_0865207 Ga0373937_0865207_440_592 50
637 3300036401 Ga0373937_1050266 Ga0373937_1050266_556_708 50
638 3300037068 Ga0373925_0001273 Ga0373925_0001273_8765_8917 50
639 3300037068 Ga0373925_0105184 Ga0373925_0105184_855_1007 50
640 3300037068 Ga0373925_0242647 Ga0373925_0242647_1147_1305 50
641 3300038698 Ga0242419_020650 Ga0242419_020650_298_450 50
642 3300038996 Ga0242420_000887 Ga0242420_000887_354_506 50
643 3300039437 Ga0436365_0169472 Ga0436365_0169472_1091_1255 50
644 3300039437 Ga0436365_1076647 Ga0436365_1076647_93_248 50
645 3300039437 Ga0436365_1298767 Ga0436365_1298767_98_250 50
646 3300041408 Ga0439453_0000106 Ga0439453_0000106_2358_2516 50
647 3300041452 Ga0451793_0093313 Ga0451793_0093313_13_171 50
648 3300041486 Ga0451807_1006014 Ga0451807_1006014_155_313 50
649 3300041501 Ga0451845_0439394 Ga0451845_0439394_226_384 50
650 3300041511 Ga0451855_1205704 Ga0451855_1205704_254_412 50
651 3300042000 Ga0439437_055629 Ga0439437_055629_214_366 50
652 3300042001 Ga0439441_063145 Ga0439441_063145_36_188 50
653 3300042001 Ga0439441_111744 Ga0439441_111744_311_469 50
654 3300042003 Ga0439443_020032 Ga0439443_020032_97_255 50
655 3300042008 Ga0439450_023182 Ga0439450_023182_709_861 50
656 3300042012 Ga0439455_0082629 Ga0439455_0082629_585_737 50
657 3300042016 Ga0439463_122214 Ga0439463_122214_202_354 50
658 3300042118 Ga0450914_057810 Ga0450914_057810_96_248 50
659 3300042145 Ga0450906_083918 Ga0450906_083918_182_340 50
660 3300042184 Ga0450908_043822 Ga0450908_043822_495_653 50
661 3300042436 Ga0439435_0000370 Ga0439435_0000370_4153_4311 50
662 3300042436 Ga0439435_0232470 Ga0439435_0232470_69_221 50
663 3300042437 Ga0439444_0042475 Ga0439444_0042475_567_719 50
664 3300042438 Ga0439459_0119527 Ga0439459_0119527_314_472 50
665 3300042439 Ga0439464_0010042 Ga0439464_0010042_1469_1621 50
666 3300042461 Ga0439460_0068356 Ga0439460_0068356_171_323 50
667 3300042461 Ga0439460_0100815 Ga0439460_0100815_689_847 50
668 3300042876 Ga0451577_0042439 Ga0451577_0042439_3559_3711 50
669 3300042993 Ga0439440_0023527 Ga0439440_0023527_631_789 50
670 3300042993 Ga0439440_0079560 Ga0439440_0079560_468_620 50
671 3300044673 Ga0453683_0236175 Ga0453683_0236175_699_851 50
672 3300044684 Ga0466966_0080184 Ga0466966_0080184_1419_1571 50
673 3300044684 Ga0466966_0928577 Ga0466966_0928577_79_237 50
674 3300044693 Ga0466961_0164926 Ga0466961_0164926_353_505 50
675 3300044694 Ga0466963_0191670 Ga0466963_0191670_991_1143 50
676 3300044694 Ga0466963_0533340 Ga0466963_0533340_635_787 50
677 3300044712 Ga0453684_0057645 Ga0453684_0057645_668_820 50
678 3300044712 Ga0453684_1926619 Ga0453684_1926619_218_373 50
679 3300044719 Ga0466971_0141346 Ga0466971_0141346_109_261 50
680 3300044719 Ga0466971_0395370 Ga0466971_0395370_319_471 50
681 3300044842 Ga0466957_0329076 Ga0466957_0329076_845_997 50
682 3300044842 Ga0466957_1348258 Ga0466957_1348258_331_483 50
683 3300044901 Ga0466960_0544725 Ga0466960_0544725_269_421 50
684 3300044901 Ga0466960_0946467 Ga0466960_0946467_285_443 50
685 3300045049 Ga0466959_0472214 Ga0466959_0472214_405_557 50
686 3300045051 Ga0451576_0087001 Ga0451576_0087001_2806_2958 50
687 3300045836 Ga0466958_0201370 Ga0466958_0201370_619_771 50
688 3300045836 Ga0466958_0336726 Ga0466958_0336726_316_468 50
689 3300045976 Ga0466967_0149240 Ga0466967_0149240_441_593 50
690 3300045976 Ga0466967_0216103 Ga0466967_0216103_272_424 50
691 3300045976 Ga0466967_0786880 Ga0466967_0786880_151_303 50
692 3300046454 Ga0495592_0023347 Ga0495592_0023347_1540_1692 50
693 3300046454 Ga0495592_0086679 Ga0495592_0086679_754_906 50
694 3300046454 Ga0495592_0385201 Ga0495592_0385201_419_571 50
695 3300046455 Ga0495603_0018201 Ga0495603_0018201_209_361 50
696 3300046455 Ga0495603_0065563 Ga0495603_0065563_1030_1182 50
697 3300046457 Ga0495590_0153664 Ga0495590_0153664_554_706 50
698 3300046459 Ga0495629_0792342 Ga0495629_0792342_161_319 50
699 3300046460 Ga0495638_0028464 Ga0495638_0028464_985_1143 50
700 3300046461 Ga0495641_0014894 Ga0495641_0014894_817_969 50
701 3300046461 Ga0495641_0158608 Ga0495641_0158608_152_304 50
702 3300046462 Ga0495651_0024840 Ga0495651_0024840_4289_4441 50
703 3300046462 Ga0495651_0027684 Ga0495651_0027684_1905_2057 50
704 3300046462 Ga0495651_0028851 Ga0495651_0028851_3064_3216 50
705 3300046462 Ga0495651_0206341 Ga0495651_0206341_1055_1207 50
706 3300046462 Ga0495651_0423628 Ga0495651_0423628_511_663 50
707 3300046462 Ga0495651_0463609 Ga0495651_0463609_487_645 50
708 3300046463 Ga0495653_0118639 Ga0495653_0118639_1235_1387 50
709 3300046463 Ga0495653_0127576 Ga0495653_0127576_47_199 50
710 3300046463 Ga0495653_0194059 Ga0495653_0194059_1120_1272 50
711 3300046463 Ga0495653_0287572 Ga0495653_0287572_836_994 50
712 3300046472 Ga0495580_0983689 Ga0495580_0983689_333_485 50
713 3300046473 Ga0495582_0049796 Ga0495582_0049796_1471_1623 50
714 3300046473 Ga0495582_0076771 Ga0495582_0076771_690_842 50
715 3300046474 Ga0495605_0488129 Ga0495605_0488129_284_436 50
716 3300046475 Ga0495639_0004864 Ga0495639_0004864_3352_3504 50
717 3300046475 Ga0495639_0103744 Ga0495639_0103744_815_967 50
718 3300046476 Ga0495662_0011898 Ga0495662_0011898_3401_3553 50
719 3300046476 Ga0495662_0125968 Ga0495662_0125968_634_786 50
720 3300046477 Ga0495664_0002672 Ga0495664_0002672_2190_2342 50
721 3300046477 Ga0495664_0006545 Ga0495664_0006545_5931_6083 50
722 3300046477 Ga0495664_0035617 Ga0495664_0035617_468_620 50
723 3300046477 Ga0495664_0343334 Ga0495664_0343334_424_576 50
724 3300046477 Ga0495664_0696686 Ga0495664_0696686_365_523 50
725 3300046499 Ga0495594_0026904 Ga0495594_0026904_470_622 50
726 3300046501 Ga0495607_0010006 Ga0495607_0010006_2633_2785 50
727 3300046511 Ga0495608_0000557 Ga0495608_0000557_22515_22667 50
728 3300046511 Ga0495608_0015588 Ga0495608_0015588_1682_1834 50
729 3300046511 Ga0495608_0028419 Ga0495608_0028419_2313_2465 50
730 3300046511 Ga0495608_0164099 Ga0495608_0164099_1107_1259 50
731 3300046513 Ga0495616_0426090 Ga0495616_0426090_326_484 50
732 3300046514 Ga0495618_0393534 Ga0495618_0393534_333_485 50
733 3300046514 Ga0495618_0405482 Ga0495618_0405482_144_296 50
734 3300046515 Ga0495620_0074315 Ga0495620_0074315_67_225 50
735 3300046516 Ga0495628_0001465 Ga0495628_0001465_18096_18248 50
736 3300046516 Ga0495628_0037692 Ga0495628_0037692_948_1100 50
737 3300046516 Ga0495628_0928444 Ga0495628_0928444_161_313 50
738 3300046517 Ga0495630_0441245 Ga0495630_0441245_209_361 50
739 3300046517 Ga0495630_0463588 Ga0495630_0463588_57_215 50
740 3300046522 Ga0495643_0127748 Ga0495643_0127748_453_611 50
741 3300046523 Ga0495644_0380952 Ga0495644_0380952_371_523 50
742 3300046526 Ga0495666_0033133 Ga0495666_0033133_2353_2505 50
743 3300046526 Ga0495666_0033310 Ga0495666_0033310_722_874 50
744 3300046529 Ga0495652_0002359 Ga0495652_0002359_16149_16301 50
745 3300046529 Ga0495652_0053207 Ga0495652_0053207_1393_1545 50
746 3300046529 Ga0495652_0188561 Ga0495652_0188561_1036_1188 50
747 3300046529 Ga0495652_1025771 Ga0495652_1025771_123_281 50
748 3300046531 Ga0495665_0067398 Ga0495665_0067398_630_782 50
749 3300046531 Ga0495665_0069847 Ga0495665_0069847_914_1066 50
750 3300046531 Ga0495665_0520799 Ga0495665_0520799_366_524 50
751 3300046533 Ga0495640_0131267 Ga0495640_0131267_792_944 50
752 3300046533 Ga0495640_0201292 Ga0495640_0201292_897_1049 50
753 3300046533 Ga0495640_0297700 Ga0495640_0297700_332_484 50
754 3300046533 Ga0495640_0570189 Ga0495640_0570189_111_269 50
755 3300046535 Ga0495586_0034869 Ga0495586_0034869_909_1061 50
756 3300046535 Ga0495586_0244719 Ga0495586_0244719_222_380 50
757 3300046536 Ga0495587_0031834 Ga0495587_0031834_2455_2607 50
758 3300046536 Ga0495587_0245789 Ga0495587_0245789_710_862 50
759 3300046536 Ga0495587_0771954 Ga0495587_0771954_306_458 50
760 3300046537 Ga0495598_0004138 Ga0495598_0004138_1849_2007 50
761 3300046538 Ga0495609_0170486 Ga0495609_0170486_18_170 50
762 3300046539 Ga0495621_0048691 Ga0495621_0048691_954_1112 50
763 3300046543 Ga0495645_0002006 Ga0495645_0002006_3133_3285 50
764 3300046543 Ga0495645_0035666 Ga0495645_0035666_2480_2632 50
765 3300046557 Ga0495622_0169368 Ga0495622_0169368_625_777 50
766 3300046557 Ga0495622_0446356 Ga0495622_0446356_157_309 50
767 3300046558 Ga0495633_0002198 Ga0495633_0002198_9285_9437 50
768 3300046559 Ga0495667_0002889 Ga0495667_0002889_3366_3518 50
769 3300046559 Ga0495667_0015972 Ga0495667_0015972_1055_1207 50
770 3300046559 Ga0495667_0041062 Ga0495667_0041062_38_190 50
771 3300046559 Ga0495667_0415458 Ga0495667_0415458_463_621 50
772 3300046642 Ga0495634_0167244 Ga0495634_0167244_950_1102 50
773 3300046642 Ga0495634_0247000 Ga0495634_0247000_489_647 50
774 3300046642 Ga0495634_0334238 Ga0495634_0334238_343_501 50
775 3300046642 Ga0495634_0619076 Ga0495634_0619076_298_450 50
776 3300046648 Ga0495611_0003383 Ga0495611_0003383_1315_1467 50
777 3300046648 Ga0495611_0572628 Ga0495611_0572628_24_176 50
778 3300046660 Ga0495625_0817033 Ga0495625_0817033_82_234 50
779 3300046663 Ga0495635_0003603 Ga0495635_0003603_5167_5319 50
780 3300046663 Ga0495635_0061445 Ga0495635_0061445_1263_1415 50
781 3300046663 Ga0495635_0149588 Ga0495635_0149588_240_392 50
782 3300046663 Ga0495635_0498040 Ga0495635_0498040_427_579 50
783 3300046665 Ga0495661_0067702 Ga0495661_0067702_631_783 50
784 3300046674 Ga0495588_0009109 Ga0495588_0009109_3668_3820 50
785 3300046674 Ga0495588_0372213 Ga0495588_0372213_343_495 50
786 3300046675 Ga0495657_0020739 Ga0495657_0020739_2215_2367 50
787 3300046675 Ga0495657_0023491 Ga0495657_0023491_3022_3174 50
788 3300046675 Ga0495657_0654207 Ga0495657_0654207_247_405 50
789 3300046678 Ga0495599_0004135 Ga0495599_0004135_6597_6749 50
790 3300046678 Ga0495599_0005971 Ga0495599_0005971_3218_3370 50
791 3300046679 Ga0495623_0413858 Ga0495623_0413858_499_651 50
792 3300046680 Ga0495646_0020139 Ga0495646_0020139_1045_1197 50
793 3300046680 Ga0495646_0053496 Ga0495646_0053496_2153_2305 50
794 3300046681 Ga0495647_0003659 Ga0495647_0003659_665_817 50
795 3300046681 Ga0495647_0031914 Ga0495647_0031914_1189_1341 50
796 3300046681 Ga0495647_0507716 Ga0495647_0507716_69_221 50
797 3300046683 Ga0495658_0007904 Ga0495658_0007904_4713_4865 50
798 3300046683 Ga0495658_0012613 Ga0495658_0012613_3413_3565 50
799 3300046683 Ga0495658_0151377 Ga0495658_0151377_888_1046 50
800 3300046684 Ga0495669_0552341 Ga0495669_0552341_137_289 50
801 3300046689 Ga0495613_0079381 Ga0495613_0079381_783_935 50
802 3300046689 Ga0495613_0557627 Ga0495613_0557627_166_324 50
803 3300046689 Ga0495613_0677271 Ga0495613_0677271_125_277 50
804 3300046690 Ga0495624_0102522 Ga0495624_0102522_1087_1239 50
805 3300046691 Ga0495670_0000870 Ga0495670_0000870_2743_2895 50
806 3300046691 Ga0495670_0314893 Ga0495670_0314893_327_485 50
807 3300046809 Ga0495600_0002049 Ga0495600_0002049_11109_11261 50
808 3300046809 Ga0495600_0069850 Ga0495600_0069850_239_391 50
809 3300046809 Ga0495600_0260938 Ga0495600_0260938_649_801 50
810 3300046809 Ga0495600_0408600 Ga0495600_0408600_622_774 50
811 3300047315 Ga0495581_0048792 Ga0495581_0048792_879_1031 50
812 3300047315 Ga0495581_0058530 Ga0495581_0058530_296_448 50
813 3300047315 Ga0495581_0345605 Ga0495581_0345605_629_781 50
814 3300047317 Ga0495604_0010650 Ga0495604_0010650_6120_6272 50
815 3300047317 Ga0495604_0052471 Ga0495604_0052471_2127_2279 50
816 3300047319 Ga0495674_0011272 Ga0495674_0011272_1837_1989 50
817 3300047319 Ga0495674_0035712 Ga0495674_0035712_1111_1263 50
818 3300047319 Ga0495674_0042925 Ga0495674_0042925_1889_2041 50
819 3300047319 Ga0495674_0186903 Ga0495674_0186903_304_462 50
820 3300047321 Ga0495676_0278352 Ga0495676_0278352_750_902 50
821 3300047321 Ga0495676_0581090 Ga0495676_0581090_169_321 50
822 3300047321 Ga0495676_1106675 Ga0495676_1106675_70_228 50
823 3300047322 Ga0495680_0005770 Ga0495680_0005770_5330_5482 50
824 3300047322 Ga0495680_0014947 Ga0495680_0014947_1098_1250 50
825 3300047322 Ga0495680_0020201 Ga0495680_0020201_2227_2379 50
826 3300047322 Ga0495680_0309648 Ga0495680_0309648_378_530 50
827 3300047322 Ga0495680_0355282 Ga0495680_0355282_125_277 50
828 3300047322 Ga0495680_0956366 Ga0495680_0956366_95_247 50
829 3300047444 Ga0495675_0000740 Ga0495675_0000740_19207_19359 50
830 3300047444 Ga0495675_0082688 Ga0495675_0082688_119_271 50
831 3300047444 Ga0495675_0217902 Ga0495675_0217902_580_732 50
832 3300047444 Ga0495675_0284711 Ga0495675_0284711_103_255 50
833 3300047445 Ga0495677_0248898 Ga0495677_0248898_100_258 50
834 3300047447 Ga0495685_115550 Ga0495685_115550_289_447 50
835 3300047447 Ga0495685_224657 Ga0495685_224657_292_450 50
836 3300047471 Ga0495684_0068395 Ga0495684_0068395_1156_1308 50
837 3300047471 Ga0495684_0290792 Ga0495684_0290792_655_807 50
838 3300047472 Ga0495686_0284600 Ga0495686_0284600_477_635 50
839 3300047673 Ga0495593_0419159 Ga0495593_0419159_306_458 50
840 3300048088 Ga0495602_0002218 Ga0495602_0002218_1727_1879 50
841 3300048088 Ga0495602_0013696 Ga0495602_0013696_1363_1515 50
842 3300048088 Ga0495602_0037475 Ga0495602_0037475_297_449 50
843 3300048088 Ga0495602_0063070 Ga0495602_0063070_426_584 50
844 3300048088 Ga0495602_0150527 Ga0495602_0150527_1475_1627 50
845 3300048089 Ga0495614_0048355 Ga0495614_0048355_1299_1451 50
846 3300048089 Ga0495614_0259467 Ga0495614_0259467_255_407 50
847 3300048090 Ga0495615_0059894 Ga0495615_0059894_834_992 50
848 3300048903 Ga0496100_0189818 Ga0496100_0189818_1194_1352 50
849 3300048904 Ga0496101_0001349 Ga0496101_0001349_868_1020 50
850 3300048904 Ga0496101_0059537 Ga0496101_0059537_1005_1157 50
851 3300048905 Ga0496102_0002354 Ga0496102_0002354_868_1020 50
852 3300048905 Ga0496102_0017521 Ga0496102_0017521_2458_2610 50
853 3300048906 Ga0496103_0048757 Ga0496103_0048757_63_215 50
854 3300048907 Ga0496104_0000126 Ga0496104_0000126_33178_33330 50
855 3300048907 Ga0496104_0065771 Ga0496104_0065771_2073_2225 50
856 3300048907 Ga0496104_0253403 Ga0496104_0253403_1430_1582 50
857 3300048908 Ga0496105_0000117 Ga0496105_0000117_26195_26347 50
858 3300048909 Ga0496106_0000557 Ga0496106_0000557_21880_22032 50
859 3300048909 Ga0496106_0047156 Ga0496106_0047156_767_919 50
860 3300048909 Ga0496106_0052745 Ga0496106_0052745_1707_1859 50
861 3300048910 Ga0496107_0019064 Ga0496107_0019064_19_171 50
862 3300048910 Ga0496107_0019668 Ga0496107_0019668_1396_1548 50
863 3300048911 Ga0496108_0037745 Ga0496108_0037745_2929_3081 50
864 3300048912 Ga0496109_0004864 Ga0496109_0004864_9562_9714 50
865 3300048912 Ga0496109_0038200 Ga0496109_0038200_2408_2560 50
866 3300048913 Ga0496110_0054572 Ga0496110_0054572_1084_1236 50
867 3300048914 Ga0496111_0096583 Ga0496111_0096583_1025_1177 50
868 3300048915 Ga0496112_0086388 Ga0496112_0086388_122_274 50
869 3300048915 Ga0496112_0217980 Ga0496112_0217980_388_540 50
870 3300048915 Ga0496112_0724967 Ga0496112_0724967_353_505 50
871 3300048915 Ga0496112_0976941 Ga0496112_0976941_411_569 50
872 3300048915 Ga0496112_1646631 Ga0496112_1646631_99_251 50
873 3300048916 Ga0496113_0015747 Ga0496113_0015747_1349_1501 50
874 3300048916 Ga0496113_0252736 Ga0496113_0252736_872_1024 50
875 3300048916 Ga0496113_0969549 Ga0496113_0969549_91_249 50
876 3300048917 Ga0496114_0072327 Ga0496114_0072327_1303_1455 50
877 3300048917 Ga0496114_0345346 Ga0496114_0345346_450_602 50
878 3300048918 Ga0496115_0018679 Ga0496115_0018679_928_1086 50
879 3300048918 Ga0496115_0036386 Ga0496115_0036386_382_534 50
880 3300048918 Ga0496115_0245055 Ga0496115_0245055_771_923 50
881 3300048918 Ga0496115_0508590 Ga0496115_0508590_755_907 50
882 3300048918 Ga0496115_0543685 Ga0496115_0543685_554_706 50
883 3300048924 Ga0496121_0751335 Ga0496121_0751335_160_312 50
884 3300048929 Ga0496126_0131972 Ga0496126_0131972_1370_1522 50
885 3300048929 Ga0496126_0647370 Ga0496126_0647370_272_424 50
886 3300049568 Ga0501031_0006160 Ga0501031_0006160_4478_4636 50
887 3300049568 Ga0501031_0113961 Ga0501031_0113961_957_1109 50
888 3300049568 Ga0501031_0913327 Ga0501031_0913327_253_411 50
889 3300049568 Ga0501031_0929218 Ga0501031_0929218_209_364 50
890 3300049569 Ga0501032_0002502 Ga0501032_0002502_5118_5276 50
891 3300049570 Ga0501033_0026683 Ga0501033_0026683_1291_1449 50
892 3300049570 Ga0501033_0228381 Ga0501033_0228381_506_658 50
893 3300049570 Ga0501033_0276787 Ga0501033_0276787_286_441 50
894 3300049571 Ga0501034_0023206 Ga0501034_0023206_2897_3055 50
895 3300049571 Ga0501034_0046159 Ga0501034_0046159_2684_2836 50
896 3300049571 Ga0501034_0088744 Ga0501034_0088744_283_438 50
897 3300049571 Ga0501034_0163432 Ga0501034_0163432_189_353 50
898 3300049571 Ga0501034_0192227 Ga0501034_0192227_439_594 50
899 3300049571 Ga0501034_0293709 Ga0501034_0293709_836_994 50
900 3300049571 Ga0501034_0600209 Ga0501034_0600209_267_422 50
901 3300049571 Ga0501034_0616819 Ga0501034_0616819_605_757 50
902 3300049571 Ga0501034_0627646 Ga0501034_0627646_728_886 50
903 3300049571 Ga0501034_0919986 Ga0501034_0919986_590_742 50
904 3300049571 Ga0501034_1214588 Ga0501034_1214588_195_353 50
905 3300049571 Ga0501034_1357579 Ga0501034_1357579_241_396 50
906 3300049572 Ga0501036_0012785 Ga0501036_0012785_3466_3624 50
907 3300049572 Ga0501036_0119528 Ga0501036_0119528_1108_1263 50
908 3300049572 Ga0501036_0273997 Ga0501036_0273997_58_213 50
909 3300049572 Ga0501036_0334881 Ga0501036_0334881_527_685 50
910 3300049573 Ga0501037_0007235 Ga0501037_0007235_6533_6691 50
911 3300049573 Ga0501037_0010967 Ga0501037_0010967_5667_5822 50
912 3300049573 Ga0501037_0131872 Ga0501037_0131872_308_463 50
913 3300049573 Ga0501037_0856328 Ga0501037_0856328_91_243 50
914 3300049574 Ga0501038_0004064 Ga0501038_0004064_2897_3055 50
915 3300049574 Ga0501038_0082157 Ga0501038_0082157_2148_2303 50
916 3300049574 Ga0501038_0085007 Ga0501038_0085007_188_343 50
917 3300049574 Ga0501038_0125210 Ga0501038_0125210_1521_1679 50
918 3300049575 Ga0501039_0015100 Ga0501039_0015100_5039_5197 50
919 3300049575 Ga0501039_0238558 Ga0501039_0238558_756_914 50
920 3300049575 Ga0501039_0388010 Ga0501039_0388010_526_678 50
921 3300049575 Ga0501039_1434623 Ga0501039_1434623_61_216 50
922 3300049575 Ga0501039_1516249 Ga0501039_1516249_18_173 50
923 3300049576 Ga0501040_0317674 Ga0501040_0317674_226_384 50
924 3300049576 Ga0501040_1275635 Ga0501040_1275635_201_359 50
925 3300049577 Ga0501041_0220912 Ga0501041_0220912_879_1037 50
926 3300049578 Ga0501042_0032536 Ga0501042_0032536_2260_2418 50
927 3300049578 Ga0501042_0222621 Ga0501042_0222621_369_527 50
928 3300049578 Ga0501042_1217403 Ga0501042_1217403_382_537 50
929 3300049579 Ga0501043_0031616 Ga0501043_0031616_3028_3186 50
930 3300049580 Ga0501046_0004620 Ga0501046_0004620_10059_10217 50
931 3300049580 Ga0501046_0124968 Ga0501046_0124968_444_602 50
932 3300049581 Ga0501047_0014677 Ga0501047_0014677_975_1133 50
933 3300049581 Ga0501047_0082757 Ga0501047_0082757_2219_2383 50
934 3300049581 Ga0501047_0100323 Ga0501047_0100323_56_208 50
935 3300049581 Ga0501047_1204133 Ga0501047_1204133_328_486 50
936 3300049582 Ga0501048_0019145 Ga0501048_0019145_3894_4052 50
937 3300049582 Ga0501048_0260560 Ga0501048_0260560_594_749 50
938 3300049582 Ga0501048_0379929 Ga0501048_0379929_222_380 50
939 3300049583 Ga0501067_0003146 Ga0501067_0003146_4170_4328 50
940 3300049584 Ga0501068_0093062 Ga0501068_0093062_689_847 50
941 3300049584 Ga0501068_0395056 Ga0501068_0395056_395_550 50
942 3300049584 Ga0501068_0578833 Ga0501068_0578833_68_223 50
943 3300049585 Ga0501069_0003163 Ga0501069_0003163_5014_5172 50
944 3300049585 Ga0501069_0068986 Ga0501069_0068986_118_273 50
945 3300049585 Ga0501069_0286906 Ga0501069_0286906_779_931 50
946 3300049585 Ga0501069_0360288 Ga0501069_0360288_92_244 50
947 3300049585 Ga0501069_0696963 Ga0501069_0696963_394_558 50
948 3300049585 Ga0501069_1037381 Ga0501069_1037381_29_181 50
949 3300049586 Ga0501070_0021944 Ga0501070_0021944_4874_5029 50
950 3300049586 Ga0501070_0059924 Ga0501070_0059924_2931_3086 50
951 3300049586 Ga0501070_0068845 Ga0501070_0068845_1291_1443 50
952 3300049586 Ga0501070_0125154 Ga0501070_0125154_1489_1644 50
953 3300049586 Ga0501070_0136867 Ga0501070_0136867_1431_1586 50
954 3300049586 Ga0501070_0138228 Ga0501070_0138228_975_1133 50
955 3300049586 Ga0501070_0160373 Ga0501070_0160373_640_795 50
956 3300049586 Ga0501070_0380165 Ga0501070_0380165_750_905 50
957 3300049586 Ga0501070_0519677 Ga0501070_0519677_194_352 50
958 3300049586 Ga0501070_0529665 Ga0501070_0529665_431_586 50
959 3300049587 Ga0501071_0019296 Ga0501071_0019296_491_646 50
960 3300049587 Ga0501071_0031082 Ga0501071_0031082_514_672 50
961 3300049587 Ga0501071_1321645 Ga0501071_1321645_138_293 50
962 3300049587 Ga0501071_1379481 Ga0501071_1379481_232_390 50
963 3300049588 Ga0501072_0136759 Ga0501072_0136759_1640_1798 50
964 3300049588 Ga0501072_0206092 Ga0501072_0206092_1373_1531 50
965 3300049588 Ga0501072_0283321 Ga0501072_0283321_195_350 50
966 3300049588 Ga0501072_0352471 Ga0501072_0352471_250_405 50
967 3300049588 Ga0501072_0746599 Ga0501072_0746599_366_524 50
968 3300049588 Ga0501072_1010253 Ga0501072_1010253_147_305 50
969 3300049588 Ga0501072_1126436 Ga0501072_1126436_349_504 50
970 3300049589 Ga0501073_0001123 Ga0501073_0001123_10144_10302 50
971 3300049589 Ga0501073_0260130 Ga0501073_0260130_540_698 50
972 3300049589 Ga0501073_0272271 Ga0501073_0272271_811_975 50
973 3300049589 Ga0501073_0877677 Ga0501073_0877677_144_296 50
974 3300049589 Ga0501073_1034504 Ga0501073_1034504_69_224 50
975 3300049590 Ga0501074_0004631 Ga0501074_0004631_4797_4955 50
976 3300049590 Ga0501074_0322129 Ga0501074_0322129_790_942 50
977 3300049590 Ga0501074_0500393 Ga0501074_0500393_128_286 50
978 3300049590 Ga0501074_0634529 Ga0501074_0634529_404_559 50
979 3300049590 Ga0501074_0855275 Ga0501074_0855275_35_190 50
980 3300049591 Ga0501075_0153437 Ga0501075_0153437_812_970 50
981 3300049591 Ga0501075_0334557 Ga0501075_0334557_348_503 50
982 3300049591 Ga0501075_1215610 Ga0501075_1215610_238_393 50
983 3300049591 Ga0501075_1242020 Ga0501075_1242020_309_461 50
984 3300049592 Ga0501076_0165934 Ga0501076_0165934_1114_1269 50
985 3300049593 Ga0501077_0310518 Ga0501077_0310518_308_466 50
986 3300049593 Ga0501077_0372447 Ga0501077_0372447_200_358 50
987 3300049593 Ga0501077_0386885 Ga0501077_0386885_724_882 50
988 3300049741 Ga0501079_0045066 Ga0501079_0045066_2903_3061 50
989 3300049741 Ga0501079_0108919 Ga0501079_0108919_1741_1899 50
990 3300049741 Ga0501079_0811133 Ga0501079_0811133_127_282 50
991 3300049741 Ga0501079_0937301 Ga0501079_0937301_429_587 50
992 3300049741 Ga0501079_1624177 Ga0501079_1624177_190_345 50
993 3300049742 Ga0501080_0005918 Ga0501080_0005918_9804_9962 50
994 3300049742 Ga0501080_0025350 Ga0501080_0025350_3784_3939 50
995 3300049742 Ga0501080_0049111 Ga0501080_0049111_2654_2818 50
996 3300049742 Ga0501080_0385101 Ga0501080_0385101_165_320 50
997 3300049742 Ga0501080_0436636 Ga0501080_0436636_515_673 50
998 3300049742 Ga0501080_0951813 Ga0501080_0951813_39_191 50
999 3300049742 Ga0501080_1056169 Ga0501080_1056169_418_573 50
1000 3300049742 Ga0501080_1217666 Ga0501080_1217666_300_452 50
1001 3300049743 Ga0501081_0298704 Ga0501081_0298704_299_457 50
1002 3300049743 Ga0501081_0674666 Ga0501081_0674666_197_352 50
1003 3300049743 Ga0501081_1289507 Ga0501081_1289507_180_338 50
1004 3300049743 Ga0501081_1460913 Ga0501081_1460913_128_286 50
1005 3300049744 Ga0501083_0003568 Ga0501083_0003568_10644_10796 50
1006 3300049744 Ga0501083_0027818 Ga0501083_0027818_1306_1464 50
1007 3300049744 Ga0501083_0030644 Ga0501083_0030644_2549_2707 50
1008 3300049744 Ga0501083_0045461 Ga0501083_0045461_435_587 50
1009 3300049744 Ga0501083_0142892 Ga0501083_0142892_351_509 50
1010 3300049744 Ga0501083_0248523 Ga0501083_0248523_329_481 50
1011 3300049744 Ga0501083_0260533 Ga0501083_0260533_953_1105 50
1012 3300049744 Ga0501083_0484894 Ga0501083_0484894_573_731 50
1013 3300049744 Ga0501083_0773588 Ga0501083_0773588_369_521 50
1014 3300049744 Ga0501083_0845226 Ga0501083_0845226_14_178 50
1015 3300049744 Ga0501083_1010162 Ga0501083_1010162_367_522 50
1016 3300049822 Ga0501035_0001398 Ga0501035_0001398_7986_8141 50
1017 3300049822 Ga0501035_0006244 Ga0501035_0006244_5836_5994 50
1018 3300049822 Ga0501035_0217381 Ga0501035_0217381_1284_1439 50
1019 3300049822 Ga0501035_0282585 Ga0501035_0282585_530_685 50
1020 3300049822 Ga0501035_0945237 Ga0501035_0945237_377_535 50
1021 3300049823 Ga0501044_0000144 Ga0501044_0000144_28586_28744 50
1022 3300049823 Ga0501044_0039381 Ga0501044_0039381_975_1133 50
1023 3300049823 Ga0501044_0053820 Ga0501044_0053820_1976_2131 50
1024 3300049823 Ga0501044_0142628 Ga0501044_0142628_1205_1360 50
1025 3300049823 Ga0501044_0143647 Ga0501044_0143647_1449_1601 50
1026 3300049823 Ga0501044_0427071 Ga0501044_0427071_957_1118 50
1027 3300049823 Ga0501044_0728509 Ga0501044_0728509_150_305 50
1028 3300049823 Ga0501044_0734446 Ga0501044_0734446_203_361 50
1029 3300049823 Ga0501044_1337423 Ga0501044_1337423_79_231 50
1030 3300049824 Ga0501045_0014266 Ga0501045_0014266_2038_2196 50
1031 3300049824 Ga0501045_0191157 Ga0501045_0191157_1164_1322 50
1032 3300050489 nmdc:mga03683_113970_c1 nmdc:mga03683_113970_c1_90_248 50
1033 3300050489 nmdc:mga03683_136052_c1 nmdc:mga03683_136052_c1_344_496 50
1034 3300050490 nmdc:mga03n38_21471_c1 nmdc:mga03n38_21471_c1_1923_2081 50
1035 3300050490 nmdc:mga03n38_74265_c1 nmdc:mga03n38_74265_c1_769_927 50
1036 3300050490 nmdc:mga03n38_912634_c1 nmdc:mga03n38_912634_c1_119_277 50
1037 3300050491 nmdc:mga00v17_119937_c1 nmdc:mga00v17_119937_c1_470_628 50
1038 3300050491 nmdc:mga00v17_212083_c1 nmdc:mga00v17_212083_c1_928_1080 50
1039 3300050491 nmdc:mga00v17_62461_c1 nmdc:mga00v17_62461_c1_1911_2063 50
1040 3300050491 nmdc:mga00v17_862119_c1 nmdc:mga00v17_862119_c1_273_431 50
1041 3300050492 nmdc:mga0yw44_22649_c1 nmdc:mga0yw44_22649_c1_1310_1462 50
1042 3300050492 nmdc:mga0yw44_329362_c1 nmdc:mga0yw44_329362_c1_221_373 50
1043 3300050492 nmdc:mga0yw44_419147_c1 nmdc:mga0yw44_419147_c1_339_497 50
1044 3300050492 nmdc:mga0yw44_642101_c1 nmdc:mga0yw44_642101_c1_378_536 50
1045 3300050493 nmdc:mga0k408_18358_c1 nmdc:mga0k408_18358_c1_2406_2564 50
1046 3300050493 nmdc:mga0k408_272184_c1 nmdc:mga0k408_272184_c1_340_492 50
1047 3300050493 nmdc:mga0k408_294496_c1 nmdc:mga0k408_294496_c1_801_953 50
1048 3300050493 nmdc:mga0k408_33376_c1 nmdc:mga0k408_33376_c1_472_630 50
1049 3300050493 nmdc:mga0k408_39346_c2 nmdc:mga0k408_39346_c2_542_700 50
1050 3300050494 nmdc:mga06z11_115359_c1 nmdc:mga06z11_115359_c1_594_752 50
1051 3300050494 nmdc:mga06z11_15335_c1 nmdc:mga06z11_15335_c1_1456_1608 50
1052 3300050494 nmdc:mga06z11_336974_c1 nmdc:mga06z11_336974_c1_734_886 50
1053 3300050494 nmdc:mga06z11_356368_c1 nmdc:mga06z11_356368_c1_150_302 50
1054 3300050495 nmdc:mga04h51_146652_c1 nmdc:mga04h51_146652_c1_176_334 50
1055 3300050496 nmdc:mga07m45_166500_c1 nmdc:mga07m45_166500_c1_11_163 50
1056 3300050496 nmdc:mga07m45_804514_c1 nmdc:mga07m45_804514_c1_270_428 50
1057 3300050507 nmdc:mga05p37_11125_c1 nmdc:mga05p37_11125_c1_6823_6975 50
1058 3300050507 nmdc:mga05p37_1385311_c1 nmdc:mga05p37_1385311_c1_510_668 50
1059 3300050507 nmdc:mga05p37_947858_c1 nmdc:mga05p37_947858_c1_641_796 50
1060 3300050508 nmdc:mga09592_34712_c1 nmdc:mga09592_34712_c1_2085_2237 50
1061 3300050508 nmdc:mga09592_441356_c1 nmdc:mga09592_441356_c1_306_461 50
1062 3300050509 nmdc:mga0qj67_179390_c1 nmdc:mga0qj67_179390_c1_374_529 50
1063 3300050509 nmdc:mga0qj67_276_c1 nmdc:mga0qj67_276_c1_25419_25571 50
1064 3300050509 nmdc:mga0qj67_591110_c1 nmdc:mga0qj67_591110_c1_343_498 50
1065 3300050510 nmdc:mga06r32_1575399_c1 nmdc:mga06r32_1575399_c1_388_543 50
1066 3300050510 nmdc:mga06r32_7663_c1 nmdc:mga06r32_7663_c1_2840_2992 50
1067 3300050510 nmdc:mga06r32_783718_c1 nmdc:mga06r32_783718_c1_649_804 50
1068 3300050511 nmdc:mga08y16_373765_c1 nmdc:mga08y16_373765_c1_388_540 50
1069 3300050511 nmdc:mga08y16_3857_c1 nmdc:mga08y16_3857_c1_7775_7927 50
1070 3300050511 nmdc:mga08y16_3921_c1 nmdc:mga08y16_3921_c1_5799_5951 50
1071 3300050511 nmdc:mga08y16_4944_c1 nmdc:mga08y16_4944_c1_7058_7210 50
1072 3300050511 nmdc:mga08y16_601643_c1 nmdc:mga08y16_601643_c1_461_619 50
1073 3300050512 nmdc:mga0n895_1246330_c1 nmdc:mga0n895_1246330_c1_240_398 50
1074 3300050512 nmdc:mga0n895_150292_c1 nmdc:mga0n895_150292_c1_198_356 50
1075 3300050512 nmdc:mga0n895_183619_c1 nmdc:mga0n895_183619_c1_701_853 50
1076 3300050512 nmdc:mga0n895_36674_c1 nmdc:mga0n895_36674_c1_3717_3869 50
1077 3300050512 nmdc:mga0n895_43874_c1 nmdc:mga0n895_43874_c1_2099_2251 50
1078 3300050513 nmdc:mga0rr50_3124_c1 nmdc:mga0rr50_3124_c1_316_468 50
1079 3300050514 nmdc:mga08x19_1121739_c1 nmdc:mga08x19_1121739_c1_192_344 50
1080 3300050514 nmdc:mga08x19_38060_c1 nmdc:mga08x19_38060_c1_1808_1960 50
1081 3300050514 nmdc:mga08x19_504912_c1 nmdc:mga08x19_504912_c1_76_228 50
1082 3300050514 nmdc:mga08x19_924325_c1 nmdc:mga08x19_924325_c1_47_205 50
1083 3300050515 nmdc:mga0a205_1633_c1 nmdc:mga0a205_1633_c1_4563_4715 50
1084 3300050515 nmdc:mga0a205_6204_c1 nmdc:mga0a205_6204_c1_2329_2481 50
1085 3300050515 nmdc:mga0a205_750252_c1 nmdc:mga0a205_750252_c1_96_248 50
1086 3300050516 nmdc:mga0sz30_51691_c1 nmdc:mga0sz30_51691_c1_102_254 50
1087 3300050516 nmdc:mga0sz30_66522_c1 nmdc:mga0sz30_66522_c1_247_405 50
1088 3300050516 nmdc:mga0sz30_77064_c1 nmdc:mga0sz30_77064_c1_767_925 50
1089 3300053077 Ga0495601_0000128 Ga0495601_0000128_28908_29060 50
1090 3300053077 Ga0495601_0004569 Ga0495601_0004569_2821_2973 50
1091 3300053077 Ga0495601_0021624 Ga0495601_0021624_1913_2065 50
1092 3300053077 Ga0495601_0324568 Ga0495601_0324568_726_878 50
1093 3300053078 Ga0495612_0002324 Ga0495612_0002324_763_915 50
1094 3300053078 Ga0495612_0026565 Ga0495612_0026565_148_300 50
1095 3300053078 Ga0495612_0040582 Ga0495612_0040582_496_648 50
1096 3300053078 Ga0495612_0056227 Ga0495612_0056227_1234_1386 50
1097 3300053079 Ga0500610_0076252 Ga0500610_0076252_1470_1628 50
1098 3300053080 Ga0500635_0085652 Ga0500635_0085652_68_226 50
1099 3300053084 Ga0495595_0000754 Ga0495595_0000754_6494_6646 50
1100 3300053084 Ga0495595_0022079 Ga0495595_0022079_2564_2716 50
1101 3300053084 Ga0495595_0042886 Ga0495595_0042886_1876_2028 50
1102 3300053084 Ga0495595_0284564 Ga0495595_0284564_137_289 50
1103 3300053084 Ga0495595_0443666 Ga0495595_0443666_369_521 50
1104 3300053085 Ga0495619_0000252 Ga0495619_0000252_27262_27414 50
1105 3300053085 Ga0495619_0014409 Ga0495619_0014409_2149_2301 50
1106 3300053085 Ga0495619_0058073 Ga0495619_0058073_836_988 50
1107 3300053085 Ga0495619_0209561 Ga0495619_0209561_309_461 50
1108 3300053085 Ga0495619_0257904 Ga0495619_0257904_288_440 50
1109 3300053085 Ga0495619_0288798 Ga0495619_0288798_952_1104 50
1110 3300053085 Ga0495619_0517880 Ga0495619_0517880_351_503 50
1111 3300053085 Ga0495619_0721079 Ga0495619_0721079_74_232 50
1112 3300053087 Ga0500643_003892 Ga0500643_003892_6409_6561 50
1113 3300053088 Ga0500644_0170246 Ga0500644_0170246_701_853 50
1114 3300053090 Ga0500646_0019777 Ga0500646_0019777_1233_1391 50
1115 3300053092 Ga0500583_0173540 Ga0500583_0173540_581_739 50
1116 3300053093 Ga0500651_0034932 Ga0500651_0034932_1419_1571 50
1117 3300053093 Ga0500651_0266704 Ga0500651_0266704_519_671 50
1118 3300053094 Ga0500566_0050359 Ga0500566_0050359_1360_1512 50
1119 3300053094 Ga0500566_0196625 Ga0500566_0196625_400_552 50
1120 3300053096 Ga0500641_0037364 Ga0500641_0037364_1118_1276 50
1121 3300053096 Ga0500641_0083814 Ga0500641_0083814_562_714 50
1122 3300053098 Ga0500650_0012656 Ga0500650_0012656_1650_1808 50
1123 3300053108 Ga0500562_164288 Ga0500562_164288_229_387 50
1124 3300053117 Ga0500593_003271 Ga0500593_003271_5190_5348 50
1125 3300053119 Ga0500595_000010 Ga0500595_000010_227416_227568 50
1126 3300053119 Ga0500595_003306 Ga0500595_003306_2322_2474 50
1127 3300053119 Ga0500595_148931 Ga0500595_148931_126_284 50
1128 3300053119 Ga0500595_170807 Ga0500595_170807_155_307 50
1129 3300053131 Ga0500652_000068 Ga0500652_000068_3172_3324 50
1130 3300053131 Ga0500652_144470 Ga0500652_144470_220_378 50
1131 3300053131 Ga0500652_163002 Ga0500652_163002_366_518 50
1132 3300053134 Ga0500658_0264437 Ga0500658_0264437_134_292 50
1133 3300053134 Ga0500658_0285502 Ga0500658_0285502_374_532 50
1134 3300053134 Ga0500658_0384893 Ga0500658_0384893_100_258 50
1135 3300053140 Ga0500573_0267100 Ga0500573_0267100_35_187 50
1136 3300053142 Ga0500577_0069654 Ga0500577_0069654_726_884 50
1137 3300053151 Ga0500604_0259502 Ga0500604_0259502_223_378 50
1138 3300053153 Ga0500616_0000001 Ga0500616_0000001_600321_600473 50
1139 3300053153 Ga0500616_0197263 Ga0500616_0197263_175_333 50
1140 3300053160 Ga0500633_0176670 Ga0500633_0176670_494_649 50
1141 3300053163 Ga0500639_255786 Ga0500639_255786_90_248 50
1142 3300053177 Ga0500636_0017818 Ga0500636_0017818_982_1134 50
1143 3300053730 Ga0500645_001000 Ga0500645_001000_12081_12233 50
1144 3300053730 Ga0500645_024140 Ga0500645_024140_733_885 50
1145 3300054114 Ga0501084_0131328 Ga0501084_0131328_1505_1663 50
1146 3300054114 Ga0501084_0324286 Ga0501084_0324286_771_929 50
1147 3300054114 Ga0501084_0337528 Ga0501084_0337528_519_677 50
1148 3300054114 Ga0501084_0438027 Ga0501084_0438027_401_559 50
1149 3300054114 Ga0501084_0516132 Ga0501084_0516132_393_548 50
1150 3300054114 Ga0501084_0523625 Ga0501084_0523625_101_259 50
1151 3300054114 Ga0501084_0691150 Ga0501084_0691150_243_401 50
1152 3300054114 Ga0501084_1008997 Ga0501084_1008997_237_395 50
1153 3300059421 Ga0590071_129695 Ga0590071_129695_77_232 50
1154 3300060353 Ga0501082_0000002 Ga0501082_0000002_79474_79632 50
1155 3300060353 Ga0501082_0036242 Ga0501082_0036242_1554_1706 50
1156 3300060353 Ga0501082_0204626 Ga0501082_0204626_598_756 50
1157 3300060353 Ga0501082_0208295 Ga0501082_0208295_873_1025 50
1158 3300060353 Ga0501082_1731668 Ga0501082_1731668_322_486 50
1159 3300061719 Ga0466962_0234228 Ga0466962_0234228_356_508 50
1160 3300061734 Ga0530510_0186955 Ga0530510_0186955_24_194 50
1161 3300061734 Ga0530510_0194378 Ga0530510_0194378_645_803 50
1162 3300061734 Ga0530510_0740144 Ga0530510_0740144_529_687 50
1163 3300061734 Ga0530510_1129293 Ga0530510_1129293_62_220 50

Feature Viewer

pLDDT pTM Quality
76.96 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map