F491035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1163 | 495 | 1162 | 51 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100561947|Ga0070660_1005619472 |
| Length | 57 |
| Sequence | VTEAGMRIVYALVMIMGLGAVVADHLASPSSARAVSPEDFAGACAPCGAPCPSAQKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 18 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 137 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 138 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 139 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 140 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 158 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 244 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 251 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 252 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 253 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 255 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 256 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 257 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 258 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 270 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 276 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 287 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 288 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 289 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 292 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 293 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 294 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 295 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 298 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 299 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 300 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 301 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 302 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 303 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 304 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 305 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 306 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 307 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 308 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 309 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 310 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 311 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 312 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 313 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 314 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 315 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 316 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 317 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 318 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 319 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 320 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 321 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 322 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 323 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 324 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 325 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 398 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 399 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 400 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 401 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 402 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 403 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 406 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 407 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 408 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 409 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 410 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 413 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 447 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 448 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 450 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 451 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 452 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 453 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 467 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 468 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 471 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 473 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 474 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 475 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 476 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 478 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 479 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 480 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 481 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 482 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 484 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 485 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 486 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 488 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 489 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 491 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 493 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 495 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.65 |
| Nodule | 0 |
| Rhizoplane | 3.18 |
| Rhizosphere | 88.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1214090 | 2162886007 | Bacteria | 1159 |
| 2 | 2214544925 | 2209111006 | Bacteria | 18798 |
| 3 | ARcpr5oldR_c000010 | 3300000041 | Bacteria | 39074 |
| 4 | ARSoilYngRDRAFT_c00196 | 3300000042 | Bacteria | 10143 |
| 5 | ARcpr5yngRDRAFT_c000115 | 3300000043 | Bacteria | 12589 |
| 6 | ARSoilOldRDRAFT_c000011 | 3300000044 | Bacteria | 42914 |
| 7 | ARCol0oldRDRAFT_c01232 | 3300000045 | Bacteria | 1823 |
| 8 | ARCol0yngRDRAFT_1000146 | 3300000652 | Bacteria | 12593 |
| 9 | JGI24739J22299_10259205 | 3300001989 | Bacteria | 509 |
| 10 | JGI24737J22298_10014667 | 3300001990 | Bacteria | 2542 |
| 11 | JGI24750J21931_1090863 | 3300002070 | Bacteria | 517 |
| 12 | JGI25406J46586_10042133 | 3300003203 | Bacteria | 1600 |
| 13 | JGI25153J46596_10076793 | 3300003215 | Bacteria | 845 |
| 14 | JGI26129J50193_1003592 | 3300003349 | Bacteria | 1089 |
| 15 | JGI25404J52841_10002795 | 3300003659 | Bacteria | 3361 |
| 16 | Ga0065717_1009073 | 3300005276 | Bacteria | 664 |
| 17 | Ga0065716_1002355 | 3300005277 | Bacteria | 1886 |
| 18 | Ga0065704_10183801 | 3300005289 | Bacteria | 1223 |
| 19 | Ga0065712_10002020 | 3300005290 | Bacteria | 5377 |
| 20 | Ga0065715_10003793 | 3300005293 | Bacteria | 6299 |
| 21 | Ga0065707_10116796 | 3300005295 | Bacteria | 2227 |
| 22 | Ga0065707_10343487 | 3300005295 | Bacteria | 930 |
| 23 | Ga0070658_10847216 | 3300005327 | Unclassified | 794 |
| 24 | Ga0070658_11112861 | 3300005327 | Bacteria | 687 |
| 25 | Ga0070658_11702795 | 3300005327 | Bacteria | 546 |
| 26 | Ga0070676_10017457 | 3300005328 | Bacteria | 3972 |
| 27 | Ga0070676_10063935 | 3300005328 | Unclassified | 2193 |
| 28 | Ga0070683_100086846 | 3300005329 | Bacteria | 2933 |
| 29 | Ga0070683_100243897 | 3300005329 | Unclassified | 1709 |
| 30 | Ga0070683_101340326 | 3300005329 | Bacteria | 688 |
| 31 | Ga0070690_100022382 | 3300005330 | Bacteria | 3867 |
| 32 | Ga0070690_100176254 | 3300005330 | Bacteria | 1475 |
| 33 | Ga0070690_100348198 | 3300005330 | Bacteria | 1075 |
| 34 | Ga0070690_100766720 | 3300005330 | Bacteria | 746 |
| 35 | Ga0070670_100357373 | 3300005331 | Bacteria | 1284 |
| 36 | Ga0070677_10002078 | 3300005333 | Bacteria | 6383 |
| 37 | Ga0068869_100324936 | 3300005334 | Bacteria | 1248 |
| 38 | Ga0070666_10445212 | 3300005335 | Bacteria | 935 |
| 39 | Ga0070666_10988766 | 3300005335 | Bacteria | 624 |
| 40 | Ga0070680_100008129 | 3300005336 | Bacteria | 8013 |
| 41 | Ga0070680_100021792 | 3300005336 | Bacteria | 5096 |
| 42 | Ga0070680_100114301 | 3300005336 | Bacteria | 2249 |
| 43 | Ga0070680_100392690 | 3300005336 | Bacteria | 1182 |
| 44 | Ga0070680_100754257 | 3300005336 | Bacteria | 838 |
| 45 | Ga0070682_100159994 | 3300005337 | Unclassified | 1554 |
| 46 | Ga0068868_100248350 | 3300005338 | Bacteria | 1497 |
| 47 | Ga0068868_100548965 | 3300005338 | Bacteria | 1018 |
| 48 | Ga0070660_100042110 | 3300005339 | Bacteria | 3484 |
| 49 | Ga0070660_100561947 | 3300005339 | Unclassified | 952 |
| 50 | Ga0070689_100034111 | 3300005340 | Bacteria | 3882 |
| 51 | Ga0070689_100124157 | 3300005340 | Bacteria | 2064 |
| 52 | Ga0070689_101003481 | 3300005340 | Unclassified | 743 |
| 53 | Ga0070689_101343683 | 3300005340 | Bacteria | 644 |
| 54 | Ga0070689_101441850 | 3300005340 | Bacteria | 623 |
| 55 | Ga0070687_100002894 | 3300005343 | Bacteria | 6569 |
| 56 | Ga0070687_100429389 | 3300005343 | Bacteria | 874 |
| 57 | Ga0070661_100333288 | 3300005344 | Unclassified | 1187 |
| 58 | Ga0070661_100349766 | 3300005344 | Bacteria | 1159 |
| 59 | Ga0070661_100740684 | 3300005344 | Bacteria | 803 |
| 60 | Ga0070661_101394325 | 3300005344 | Unclassified | 589 |
| 61 | Ga0070692_10032024 | 3300005345 | Bacteria | 2640 |
| 62 | Ga0070668_100306545 | 3300005347 | Bacteria | 1333 |
| 63 | Ga0070669_100060274 | 3300005353 | Unclassified | 2787 |
| 64 | Ga0070669_100513055 | 3300005353 | Bacteria | 996 |
| 65 | Ga0070675_100024911 | 3300005354 | Bacteria | 4795 |
| 66 | Ga0070675_100056848 | 3300005354 | Unclassified | 3225 |
| 67 | Ga0070675_100235788 | 3300005354 | Bacteria | 1597 |
| 68 | Ga0070671_100072923 | 3300005355 | Bacteria | 2867 |
| 69 | Ga0070671_101392630 | 3300005355 | Bacteria | 619 |
| 70 | Ga0070671_101399153 | 3300005355 | Bacteria | 618 |
| 71 | Ga0070674_100021304 | 3300005356 | Bacteria | 4157 |
| 72 | Ga0070673_100152218 | 3300005364 | Bacteria | 1960 |
| 73 | Ga0070673_100258603 | 3300005364 | Unclassified | 1520 |
| 74 | Ga0070673_100350324 | 3300005364 | Bacteria | 1310 |
| 75 | Ga0070688_100004335 | 3300005365 | Bacteria | 7377 |
| 76 | Ga0070688_100780516 | 3300005365 | Bacteria | 746 |
| 77 | Ga0070688_101045932 | 3300005365 | Bacteria | 650 |
| 78 | Ga0070688_101696642 | 3300005365 | Unclassified | 517 |
| 79 | Ga0070659_100013250 | 3300005366 | Bacteria | 6132 |
| 80 | Ga0070659_101181398 | 3300005366 | Bacteria | 676 |
| 81 | Ga0070659_101416066 | 3300005366 | Bacteria | 618 |
| 82 | Ga0070667_100012258 | 3300005367 | Bacteria | 7091 |
| 83 | Ga0070667_100070526 | 3300005367 | Bacteria | 2974 |
| 84 | Ga0070703_10012592 | 3300005406 | Unclassified | 2397 |
| 85 | Ga0070709_10589086 | 3300005434 | Bacteria | 855 |
| 86 | Ga0070709_10992065 | 3300005434 | Bacteria | 668 |
| 87 | Ga0070714_100033988 | 3300005435 | Bacteria | 4269 |
| 88 | Ga0070714_101307291 | 3300005435 | Bacteria | 708 |
| 89 | Ga0070714_101955220 | 3300005435 | Unclassified | 572 |
| 90 | Ga0070713_100070085 | 3300005436 | Bacteria | 2959 |
| 91 | Ga0070713_101616260 | 3300005436 | Unclassified | 629 |
| 92 | Ga0070710_10581970 | 3300005437 | Bacteria | 777 |
| 93 | Ga0070701_10002296 | 3300005438 | Bacteria | 7329 |
| 94 | Ga0070711_100031787 | 3300005439 | Bacteria | 3507 |
| 95 | Ga0070711_100225952 | 3300005439 | Bacteria | 1457 |
| 96 | Ga0070711_100323548 | 3300005439 | Bacteria | 1233 |
| 97 | Ga0070705_100051740 | 3300005440 | Bacteria | 2397 |
| 98 | Ga0070700_100016513 | 3300005441 | Bacteria | 4206 |
| 99 | Ga0070694_100021216 | 3300005444 | Bacteria | 4147 |
| 100 | Ga0070694_101881352 | 3300005444 | Bacteria | 511 |
| 101 | Ga0070708_100556564 | 3300005445 | Unclassified | 1082 |
| 102 | Ga0070663_100042652 | 3300005455 | Unclassified | 3189 |
| 103 | Ga0070663_100915330 | 3300005455 | Bacteria | 758 |
| 104 | Ga0070678_100059493 | 3300005456 | Bacteria | 2808 |
| 105 | Ga0070678_100338504 | 3300005456 | Bacteria | 1290 |
| 106 | Ga0070662_100021643 | 3300005457 | Bacteria | 4393 |
| 107 | Ga0070662_100073671 | 3300005457 | Bacteria | 2524 |
| 108 | Ga0070662_100499880 | 3300005457 | Bacteria | 1014 |
| 109 | Ga0070662_101097925 | 3300005457 | Bacteria | 682 |
| 110 | Ga0070681_10034403 | 3300005458 | Bacteria | 5087 |
| 111 | Ga0070681_10038531 | 3300005458 | Bacteria | 4792 |
| 112 | Ga0070681_10280762 | 3300005458 | Unclassified | 1576 |
| 113 | Ga0070681_11147386 | 3300005458 | Bacteria | 698 |
| 114 | Ga0070681_11304468 | 3300005458 | Bacteria | 649 |
| 115 | Ga0070681_11857453 | 3300005458 | Bacteria | 530 |
| 116 | Ga0068867_100086031 | 3300005459 | Unclassified | 2378 |
| 117 | Ga0068867_101301038 | 3300005459 | Bacteria | 671 |
| 118 | Ga0068867_101716385 | 3300005459 | Bacteria | 589 |
| 119 | Ga0070685_10074904 | 3300005466 | Unclassified | 2015 |
| 120 | Ga0070685_10225230 | 3300005466 | Bacteria | 1230 |
| 121 | Ga0070685_10740150 | 3300005466 | Bacteria | 720 |
| 122 | Ga0070706_101707530 | 3300005467 | Bacteria | 573 |
| 123 | Ga0070707_100241054 | 3300005468 | Unclassified | 1760 |
| 124 | Ga0070698_102199578 | 3300005471 | Bacteria | 505 |
| 125 | Ga0070679_100023893 | 3300005530 | Bacteria | 5989 |
| 126 | Ga0070679_100185779 | 3300005530 | Bacteria | 2049 |
| 127 | Ga0070679_100342553 | 3300005530 | Bacteria | 1443 |
| 128 | Ga0070679_101062693 | 3300005530 | Unclassified | 754 |
| 129 | Ga0070684_100066522 | 3300005535 | Bacteria | 3164 |
| 130 | Ga0070684_100098652 | 3300005535 | Unclassified | 2606 |
| 131 | Ga0068853_100016002 | 3300005539 | Bacteria | 6168 |
| 132 | Ga0068853_100588724 | 3300005539 | Bacteria | 1056 |
| 133 | Ga0068853_101104213 | 3300005539 | Bacteria | 765 |
| 134 | Ga0068853_101365465 | 3300005539 | Unclassified | 685 |
| 135 | Ga0068853_101468616 | 3300005539 | Bacteria | 660 |
| 136 | Ga0068853_101985081 | 3300005539 | Bacteria | 564 |
| 137 | Ga0070672_100235384 | 3300005543 | Bacteria | 1539 |
| 138 | Ga0070672_100273427 | 3300005543 | Bacteria | 1427 |
| 139 | Ga0070686_100005464 | 3300005544 | Bacteria | 7037 |
| 140 | Ga0070686_100092484 | 3300005544 | Bacteria | 2026 |
| 141 | Ga0070686_100382250 | 3300005544 | Bacteria | 1066 |
| 142 | Ga0070695_100010952 | 3300005545 | Bacteria | 5420 |
| 143 | Ga0070696_100030566 | 3300005546 | Bacteria | 3689 |
| 144 | Ga0070696_100424080 | 3300005546 | Bacteria | 1045 |
| 145 | Ga0070693_100122059 | 3300005547 | Unclassified | 1617 |
| 146 | Ga0070665_100308742 | 3300005548 | Unclassified | 1585 |
| 147 | Ga0070665_100927629 | 3300005548 | Bacteria | 883 |
| 148 | Ga0070704_100015476 | 3300005549 | Bacteria | 4792 |
| 149 | Ga0068855_100364369 | 3300005563 | Bacteria | 1590 |
| 150 | Ga0068855_101822000 | 3300005563 | Bacteria | 618 |
| 151 | Ga0068855_102427093 | 3300005563 | Bacteria | 523 |
| 152 | Ga0070664_100055807 | 3300005564 | Bacteria | 3356 |
| 153 | Ga0070664_100482383 | 3300005564 | Bacteria | 1141 |
| 154 | Ga0068857_100256916 | 3300005577 | Unclassified | 1603 |
| 155 | Ga0068857_100639145 | 3300005577 | Bacteria | 1008 |
| 156 | Ga0068857_100971006 | 3300005577 | Bacteria | 817 |
| 157 | Ga0068857_101792118 | 3300005577 | Bacteria | 601 |
| 158 | Ga0068857_101996283 | 3300005577 | Bacteria | 569 |
| 159 | Ga0068854_101832540 | 3300005578 | Bacteria | 557 |
| 160 | Ga0068854_102128939 | 3300005578 | Bacteria | 518 |
| 161 | Ga0068856_100734966 | 3300005614 | Bacteria | 1007 |
| 162 | Ga0068856_101010213 | 3300005614 | Bacteria | 850 |
| 163 | Ga0070702_100153487 | 3300005615 | Bacteria | 1481 |
| 164 | Ga0070702_101301647 | 3300005615 | Bacteria | 590 |
| 165 | Ga0068852_100107673 | 3300005616 | Bacteria | 2529 |
| 166 | Ga0068859_100016485 | 3300005617 | Bacteria | 7420 |
| 167 | Ga0068859_100328662 | 3300005617 | Bacteria | 1623 |
| 168 | Ga0068864_100143861 | 3300005618 | Bacteria | 2153 |
| 169 | Ga0068864_101534092 | 3300005618 | Bacteria | 669 |
| 170 | Ga0068864_102455977 | 3300005618 | Bacteria | 527 |
| 171 | Ga0068866_10188515 | 3300005718 | Bacteria | 1224 |
| 172 | Ga0068861_100025172 | 3300005719 | Bacteria | 4313 |
| 173 | Ga0068861_100242617 | 3300005719 | Bacteria | 1533 |
| 174 | Ga0068861_102044978 | 3300005719 | Unclassified | 572 |
| 175 | Ga0068861_102240319 | 3300005719 | Bacteria | 548 |
| 176 | Ga0068870_10762329 | 3300005840 | Unclassified | 673 |
| 177 | Ga0068863_101276898 | 3300005841 | Bacteria | 741 |
| 178 | Ga0068858_100021667 | 3300005842 | Bacteria | 6006 |
| 179 | Ga0068858_100022184 | 3300005842 | Bacteria | 5929 |
| 180 | Ga0068858_102004267 | 3300005842 | Unclassified | 572 |
| 181 | Ga0068860_100323614 | 3300005843 | Bacteria | 1514 |
| 182 | Ga0068860_101251682 | 3300005843 | Bacteria | 762 |
| 183 | Ga0068860_101560943 | 3300005843 | Bacteria | 682 |
| 184 | Ga0068860_102053112 | 3300005843 | Bacteria | 593 |
| 185 | Ga0068862_100020703 | 3300005844 | Bacteria | 5495 |
| 186 | Ga0081455_10005815 | 3300005937 | Bacteria | 13429 |
| 187 | Ga0081455_10022516 | 3300005937 | Bacteria | 5888 |
| 188 | Ga0081538_10009018 | 3300005981 | Bacteria | 8377 |
| 189 | Ga0081538_10101327 | 3300005981 | Unclassified | 1449 |
| 190 | Ga0081540_1000075 | 3300005983 | Bacteria | 106804 |
| 191 | Ga0081539_10001975 | 3300005985 | Bacteria | 31233 |
| 192 | Ga0081539_10047978 | 3300005985 | Bacteria | 2433 |
| 193 | Ga0075365_10476354 | 3300006038 | Bacteria | 882 |
| 194 | Ga0075365_10762792 | 3300006038 | Bacteria | 683 |
| 195 | Ga0075365_10773087 | 3300006038 | Bacteria | 678 |
| 196 | Ga0075365_10773670 | 3300006038 | Bacteria | 678 |
| 197 | Ga0075368_10012277 | 3300006042 | Bacteria | 3127 |
| 198 | Ga0075368_10561133 | 3300006042 | Bacteria | 514 |
| 199 | Ga0075368_10588371 | 3300006042 | Bacteria | 503 |
| 200 | Ga0075363_100005447 | 3300006048 | Bacteria | 5662 |
| 201 | Ga0075363_100072719 | 3300006048 | Bacteria | 1870 |
| 202 | Ga0075363_100601611 | 3300006048 | Bacteria | 659 |
| 203 | Ga0075364_10036593 | 3300006051 | Bacteria | 3174 |
| 204 | Ga0075432_10000577 | 3300006058 | Bacteria | 11069 |
| 205 | Ga0075432_10117725 | 3300006058 | Bacteria | 995 |
| 206 | Ga0070715_10227625 | 3300006163 | Bacteria | 962 |
| 207 | Ga0070716_100462006 | 3300006173 | Bacteria | 928 |
| 208 | Ga0070716_100549316 | 3300006173 | Bacteria | 861 |
| 209 | Ga0070716_100708141 | 3300006173 | Bacteria | 770 |
| 210 | Ga0070712_100189311 | 3300006175 | Bacteria | 1609 |
| 211 | Ga0075362_10066001 | 3300006177 | Bacteria | 1644 |
| 212 | Ga0075362_10076370 | 3300006177 | Bacteria | 1538 |
| 213 | Ga0075367_10207894 | 3300006178 | Bacteria | 1223 |
| 214 | Ga0075369_10176798 | 3300006186 | Bacteria | 981 |
| 215 | Ga0075369_10198132 | 3300006186 | Unclassified | 926 |
| 216 | Ga0075366_10001029 | 3300006195 | Bacteria | 13679 |
| 217 | Ga0075366_10036597 | 3300006195 | Bacteria | 2894 |
| 218 | Ga0075366_10211729 | 3300006195 | Bacteria | 1180 |
| 219 | Ga0075366_11024841 | 3300006195 | Bacteria | 515 |
| 220 | Ga0097621_100457846 | 3300006237 | Bacteria | 1150 |
| 221 | Ga0097621_100687644 | 3300006237 | Bacteria | 941 |
| 222 | Ga0075370_10805019 | 3300006353 | Bacteria | 573 |
| 223 | Ga0068871_100041833 | 3300006358 | Bacteria | 3676 |
| 224 | Ga0068871_102402405 | 3300006358 | Bacteria | 503 |
| 225 | Ga0075428_100006232 | 3300006844 | Bacteria | 13264 |
| 226 | Ga0075428_101113511 | 3300006844 | Bacteria | 834 |
| 227 | Ga0075428_101539688 | 3300006844 | Bacteria | 696 |
| 228 | Ga0075430_100000094 | 3300006846 | Bacteria | 52204 |
| 229 | Ga0075430_100638606 | 3300006846 | Bacteria | 878 |
| 230 | Ga0075431_100002415 | 3300006847 | Bacteria | 17982 |
| 231 | Ga0075431_100132392 | 3300006847 | Bacteria | 2572 |
| 232 | Ga0075431_100498158 | 3300006847 | Bacteria | 1210 |
| 233 | Ga0075433_10000311 | 3300006852 | Bacteria | 29567 |
| 234 | Ga0075433_10343719 | 3300006852 | Bacteria | 1319 |
| 235 | Ga0075433_10728426 | 3300006852 | Bacteria | 868 |
| 236 | Ga0075434_100000299 | 3300006871 | Bacteria | 35320 |
| 237 | Ga0075434_100080185 | 3300006871 | Bacteria | 3260 |
| 238 | Ga0075434_100114325 | 3300006871 | Unclassified | 2712 |
| 239 | Ga0075434_101467440 | 3300006871 | Bacteria | 692 |
| 240 | Ga0075434_101709577 | 3300006871 | Bacteria | 637 |
| 241 | Ga0075434_102598391 | 3300006871 | Bacteria | 507 |
| 242 | Ga0075429_100001750 | 3300006880 | Bacteria | 17982 |
| 243 | Ga0075429_100463759 | 3300006880 | Unclassified | 1110 |
| 244 | Ga0068865_100079384 | 3300006881 | Unclassified | 2351 |
| 245 | Ga0068865_101374145 | 3300006881 | Bacteria | 630 |
| 246 | Ga0075436_100530442 | 3300006914 | Bacteria | 863 |
| 247 | Ga0075436_100586862 | 3300006914 | Unclassified | 820 |
| 248 | Ga0075436_101262704 | 3300006914 | Bacteria | 558 |
| 249 | Ga0097620_100016485 | 3300006931 | Bacteria | 7420 |
| 250 | Ga0097620_100328633 | 3300006931 | Bacteria | 1623 |
| 251 | Ga0075435_100006776 | 3300007076 | Bacteria | 8127 |
| 252 | Ga0105240_10318508 | 3300009093 | Bacteria | 1773 |
| 253 | Ga0111539_10002742 | 3300009094 | Bacteria | 23379 |
| 254 | Ga0111539_10016215 | 3300009094 | Bacteria | 9242 |
| 255 | Ga0111539_10625885 | 3300009094 | Bacteria | 1253 |
| 256 | Ga0111539_10649574 | 3300009094 | Bacteria | 1228 |
| 257 | Ga0111539_11152998 | 3300009094 | Bacteria | 901 |
| 258 | Ga0105245_10000837 | 3300009098 | Bacteria | 28055 |
| 259 | Ga0105245_10342051 | 3300009098 | Bacteria | 1480 |
| 260 | Ga0105245_11318287 | 3300009098 | Unclassified | 771 |
| 261 | Ga0105245_11635564 | 3300009098 | Bacteria | 696 |
| 262 | Ga0105247_10163923 | 3300009101 | Bacteria | 1474 |
| 263 | Ga0105247_11841681 | 3300009101 | Bacteria | 505 |
| 264 | Ga0114129_10006608 | 3300009147 | Bacteria | 16462 |
| 265 | Ga0114129_11835118 | 3300009147 | Bacteria | 736 |
| 266 | Ga0114129_12425815 | 3300009147 | Bacteria | 628 |
| 267 | Ga0105243_10013871 | 3300009148 | Bacteria | 6100 |
| 268 | Ga0105243_10047935 | 3300009148 | Bacteria | 3366 |
| 269 | Ga0105243_10050222 | 3300009148 | Bacteria | 3294 |
| 270 | Ga0105243_10234808 | 3300009148 | Bacteria | 1629 |
| 271 | Ga0105243_11940449 | 3300009148 | Bacteria | 622 |
| 272 | Ga0105243_11963706 | 3300009148 | Unclassified | 619 |
| 273 | Ga0105242_10189931 | 3300009176 | Bacteria | 1818 |
| 274 | Ga0105242_10192414 | 3300009176 | Bacteria | 1807 |
| 275 | Ga0105242_10901510 | 3300009176 | Bacteria | 884 |
| 276 | Ga0105242_13141477 | 3300009176 | Unclassified | 512 |
| 277 | Ga0105248_10014747 | 3300009177 | Bacteria | 8605 |
| 278 | Ga0105248_10531532 | 3300009177 | Bacteria | 1326 |
| 279 | Ga0105248_10760951 | 3300009177 | Bacteria | 1093 |
| 280 | Ga0105248_11769999 | 3300009177 | Bacteria | 701 |
| 281 | Ga0105237_10105666 | 3300009545 | Unclassified | 2807 |
| 282 | Ga0105238_10027021 | 3300009551 | Bacteria | 5849 |
| 283 | Ga0105238_10092667 | 3300009551 | Bacteria | 3009 |
| 284 | Ga0105238_10279234 | 3300009551 | Bacteria | 1651 |
| 285 | Ga0105238_12704342 | 3300009551 | Bacteria | 533 |
| 286 | Ga0105249_10012767 | 3300009553 | Bacteria | 7407 |
| 287 | Ga0105249_10079208 | 3300009553 | Bacteria | 3050 |
| 288 | Ga0105249_10467482 | 3300009553 | Bacteria | 1302 |
| 289 | Ga0105249_12236427 | 3300009553 | Bacteria | 620 |
| 290 | Ga0105239_10063436 | 3300010375 | Bacteria | 4057 |
| 291 | Ga0105246_10105187 | 3300011119 | Bacteria | 2062 |
| 292 | Ga0105246_10326236 | 3300011119 | Bacteria | 1250 |
| 293 | Ga0105246_11672389 | 3300011119 | Bacteria | 604 |
| 294 | Ga0157320_1027432 | 3300012481 | Bacteria | 556 |
| 295 | Ga0157318_1001371 | 3300012482 | Unclassified | 1212 |
| 296 | Ga0157343_1000283 | 3300012488 | Unclassified | 1931 |
| 297 | Ga0157319_1024999 | 3300012497 | Bacteria | 608 |
| 298 | Ga0157314_1007673 | 3300012500 | Bacteria | 875 |
| 299 | Ga0157373_11207809 | 3300013100 | Bacteria | 570 |
| 300 | Ga0157370_10326121 | 3300013104 | Bacteria | 1416 |
| 301 | Ga0157370_10448039 | 3300013104 | Bacteria | 1187 |
| 302 | Ga0157370_10505031 | 3300013104 | Bacteria | 1110 |
| 303 | Ga0157369_10337612 | 3300013105 | Bacteria | 1565 |
| 304 | Ga0157374_10192064 | 3300013296 | Bacteria | 1997 |
| 305 | Ga0157378_10381387 | 3300013297 | Bacteria | 1384 |
| 306 | Ga0157378_10492968 | 3300013297 | Bacteria | 1223 |
| 307 | Ga0157378_10554333 | 3300013297 | Bacteria | 1155 |
| 308 | Ga0163162_10024488 | 3300013306 | Bacteria | 5957 |
| 309 | Ga0163162_12258430 | 3300013306 | Bacteria | 625 |
| 310 | Ga0163162_13040374 | 3300013306 | Bacteria | 539 |
| 311 | Ga0163162_13209038 | 3300013306 | Bacteria | 525 |
| 312 | Ga0163162_13401461 | 3300013306 | Bacteria | 508 |
| 313 | Ga0157375_10745746 | 3300013308 | Bacteria | 1131 |
| 314 | Ga0163163_10329236 | 3300014325 | Bacteria | 1582 |
| 315 | Ga0163163_11432966 | 3300014325 | Bacteria | 752 |
| 316 | Ga0163163_12731329 | 3300014325 | Bacteria | 551 |
| 317 | Ga0157380_10102648 | 3300014326 | Bacteria | 2385 |
| 318 | Ga0157380_10363305 | 3300014326 | Bacteria | 1359 |
| 319 | Ga0157380_10453399 | 3300014326 | Bacteria | 1232 |
| 320 | Ga0157380_11316599 | 3300014326 | Bacteria | 770 |
| 321 | Ga0157380_11382406 | 3300014326 | Bacteria | 754 |
| 322 | Ga0157380_12264480 | 3300014326 | Bacteria | 608 |
| 323 | Ga0157380_13157472 | 3300014326 | Bacteria | 526 |
| 324 | Ga0182008_10268819 | 3300014497 | Unclassified | 884 |
| 325 | Ga0157377_10065171 | 3300014745 | Bacteria | 2092 |
| 326 | Ga0157377_10491884 | 3300014745 | Bacteria | 855 |
| 327 | Ga0157377_11521481 | 3300014745 | Bacteria | 533 |
| 328 | Ga0157379_12248064 | 3300014968 | Bacteria | 542 |
| 329 | Ga0157379_12317276 | 3300014968 | Bacteria | 535 |
| 330 | Ga0157376_10340392 | 3300014969 | Bacteria | 1432 |
| 331 | Ga0182006_1135221 | 3300015261 | Bacteria | 846 |
| 332 | Ga0182005_1163733 | 3300015265 | Unclassified | 653 |
| 333 | Ga0163161_10445901 | 3300017792 | Bacteria | 1045 |
| 334 | Ga0163161_11899805 | 3300017792 | Bacteria | 530 |
| 335 | Ga0213876_10054333 | 3300021384 | Bacteria | 2115 |
| 336 | Ga0207666_1019663 | 3300025271 | Bacteria | 987 |
| 337 | Ga0209758_1000798 | 3300025297 | Bacteria | 44669 |
| 338 | Ga0209758_1180940 | 3300025297 | Unclassified | 507 |
| 339 | Ga0207426_1042818 | 3300025302 | Bacteria | 1395 |
| 340 | Ga0207697_10003830 | 3300025315 | Bacteria | 7346 |
| 341 | Ga0207653_10026551 | 3300025885 | Unclassified | 1857 |
| 342 | Ga0207682_10006252 | 3300025893 | Bacteria | 4809 |
| 343 | Ga0207692_10004680 | 3300025898 | Bacteria | 5427 |
| 344 | Ga0207692_10381151 | 3300025898 | Bacteria | 875 |
| 345 | Ga0207642_10317492 | 3300025899 | Bacteria | 909 |
| 346 | Ga0207642_10469141 | 3300025899 | Bacteria | 766 |
| 347 | Ga0207710_10046897 | 3300025900 | Bacteria | 1930 |
| 348 | Ga0207688_10025803 | 3300025901 | Unclassified | 3230 |
| 349 | Ga0207688_10214346 | 3300025901 | Bacteria | 1158 |
| 350 | Ga0207680_10284043 | 3300025903 | Bacteria | 1150 |
| 351 | Ga0207680_10532843 | 3300025903 | Bacteria | 838 |
| 352 | Ga0207680_10540781 | 3300025903 | Bacteria | 831 |
| 353 | Ga0207647_10048235 | 3300025904 | Bacteria | 2645 |
| 354 | Ga0207699_10348899 | 3300025906 | Bacteria | 1044 |
| 355 | Ga0207699_10498340 | 3300025906 | Bacteria | 879 |
| 356 | Ga0207699_10841626 | 3300025906 | Bacteria | 675 |
| 357 | Ga0207645_10015866 | 3300025907 | Bacteria | 4991 |
| 358 | Ga0207645_10296887 | 3300025907 | Bacteria | 1075 |
| 359 | Ga0207643_10152148 | 3300025908 | Bacteria | 1388 |
| 360 | Ga0207643_10386112 | 3300025908 | Bacteria | 883 |
| 361 | Ga0207705_10979514 | 3300025909 | Bacteria | 654 |
| 362 | Ga0207705_11428421 | 3300025909 | Bacteria | 525 |
| 363 | Ga0207684_11449145 | 3300025910 | Bacteria | 560 |
| 364 | Ga0207707_10145572 | 3300025912 | Bacteria | 2071 |
| 365 | Ga0207707_10682271 | 3300025912 | Bacteria | 864 |
| 366 | Ga0207695_10676283 | 3300025913 | Bacteria | 913 |
| 367 | Ga0207671_10012740 | 3300025914 | Bacteria | 6744 |
| 368 | Ga0207693_10013335 | 3300025915 | Bacteria | 6626 |
| 369 | Ga0207693_10205875 | 3300025915 | Bacteria | 1547 |
| 370 | Ga0207663_10010773 | 3300025916 | Bacteria | 4882 |
| 371 | Ga0207663_10151907 | 3300025916 | Bacteria | 1625 |
| 372 | Ga0207660_10037682 | 3300025917 | Bacteria | 3371 |
| 373 | Ga0207660_10070303 | 3300025917 | Unclassified | 2544 |
| 374 | Ga0207660_11530847 | 3300025917 | Bacteria | 538 |
| 375 | Ga0207662_10004510 | 3300025918 | Bacteria | 7335 |
| 376 | Ga0207662_10536520 | 3300025918 | Bacteria | 809 |
| 377 | Ga0207657_10037566 | 3300025919 | Bacteria | 4322 |
| 378 | Ga0207657_10065282 | 3300025919 | Bacteria | 3103 |
| 379 | Ga0207657_10476574 | 3300025919 | Unclassified | 978 |
| 380 | Ga0207649_10327908 | 3300025920 | Unclassified | 1127 |
| 381 | Ga0207649_10745954 | 3300025920 | Bacteria | 761 |
| 382 | Ga0207652_10195406 | 3300025921 | Bacteria | 1820 |
| 383 | Ga0207652_10335270 | 3300025921 | Unclassified | 1365 |
| 384 | Ga0207652_10732886 | 3300025921 | Bacteria | 881 |
| 385 | Ga0207652_11068783 | 3300025921 | Unclassified | 707 |
| 386 | Ga0207681_10355019 | 3300025923 | Bacteria | 1174 |
| 387 | Ga0207681_10920390 | 3300025923 | Bacteria | 732 |
| 388 | Ga0207694_10046790 | 3300025924 | Bacteria | 3344 |
| 389 | Ga0207694_10173001 | 3300025924 | Bacteria | 1749 |
| 390 | Ga0207650_10181060 | 3300025925 | Bacteria | 1679 |
| 391 | Ga0207650_10290673 | 3300025925 | Bacteria | 1333 |
| 392 | Ga0207659_10313053 | 3300025926 | Bacteria | 1293 |
| 393 | Ga0207659_11161378 | 3300025926 | Bacteria | 664 |
| 394 | Ga0207659_11259377 | 3300025926 | Bacteria | 635 |
| 395 | Ga0207687_10038274 | 3300025927 | Bacteria | 3277 |
| 396 | Ga0207687_10489703 | 3300025927 | Bacteria | 1025 |
| 397 | Ga0207700_10380428 | 3300025928 | Bacteria | 1234 |
| 398 | Ga0207664_10069426 | 3300025929 | Bacteria | 2833 |
| 399 | Ga0207644_10211681 | 3300025931 | Bacteria | 1533 |
| 400 | Ga0207644_10661445 | 3300025931 | Unclassified | 870 |
| 401 | Ga0207644_11215047 | 3300025931 | Bacteria | 634 |
| 402 | Ga0207690_10066347 | 3300025932 | Unclassified | 2471 |
| 403 | Ga0207690_11001808 | 3300025932 | Bacteria | 695 |
| 404 | Ga0207706_10023449 | 3300025933 | Bacteria | 5541 |
| 405 | Ga0207706_10027637 | 3300025933 | Bacteria | 5072 |
| 406 | Ga0207706_10054087 | 3300025933 | Bacteria | 3543 |
| 407 | Ga0207706_10169749 | 3300025933 | Bacteria | 1917 |
| 408 | Ga0207686_10038012 | 3300025934 | Bacteria | 2909 |
| 409 | Ga0207686_10444914 | 3300025934 | Bacteria | 996 |
| 410 | Ga0207709_10007235 | 3300025935 | Bacteria | 6191 |
| 411 | Ga0207709_10007780 | 3300025935 | Bacteria | 5940 |
| 412 | Ga0207709_10247735 | 3300025935 | Bacteria | 1300 |
| 413 | Ga0207709_10375518 | 3300025935 | Bacteria | 1080 |
| 414 | Ga0207670_10014485 | 3300025936 | Bacteria | 4682 |
| 415 | Ga0207670_10161141 | 3300025936 | Bacteria | 1674 |
| 416 | Ga0207670_11174328 | 3300025936 | Bacteria | 649 |
| 417 | Ga0207670_11479209 | 3300025936 | Bacteria | 577 |
| 418 | Ga0207669_10018985 | 3300025937 | Bacteria | 3569 |
| 419 | Ga0207669_11414722 | 3300025937 | Bacteria | 592 |
| 420 | Ga0207704_10086909 | 3300025938 | Bacteria | 2041 |
| 421 | Ga0207704_10885122 | 3300025938 | Bacteria | 750 |
| 422 | Ga0207665_10431019 | 3300025939 | Bacteria | 1009 |
| 423 | Ga0207691_10000720 | 3300025940 | Bacteria | 32686 |
| 424 | Ga0207711_10071442 | 3300025941 | Bacteria | 3011 |
| 425 | Ga0207711_11397676 | 3300025941 | Bacteria | 642 |
| 426 | Ga0207689_10381238 | 3300025942 | Bacteria | 1174 |
| 427 | Ga0207689_11108087 | 3300025942 | Bacteria | 667 |
| 428 | Ga0207661_10088130 | 3300025944 | Bacteria | 2579 |
| 429 | Ga0207661_10103086 | 3300025944 | Unclassified | 2401 |
| 430 | Ga0207661_10916790 | 3300025944 | Bacteria | 807 |
| 431 | Ga0207679_10052691 | 3300025945 | Bacteria | 2985 |
| 432 | Ga0207679_10219002 | 3300025945 | Unclassified | 1601 |
| 433 | Ga0207679_10337273 | 3300025945 | Bacteria | 1310 |
| 434 | Ga0207679_10523583 | 3300025945 | Unclassified | 1061 |
| 435 | Ga0207679_11259111 | 3300025945 | Bacteria | 679 |
| 436 | Ga0207667_10278870 | 3300025949 | Bacteria | 1708 |
| 437 | Ga0207667_11830837 | 3300025949 | Unclassified | 570 |
| 438 | Ga0207651_10025997 | 3300025960 | Bacteria | 3649 |
| 439 | Ga0207651_10103103 | 3300025960 | Bacteria | 2122 |
| 440 | Ga0207651_11656253 | 3300025960 | Bacteria | 576 |
| 441 | Ga0207712_10599892 | 3300025961 | Unclassified | 952 |
| 442 | Ga0207668_10220124 | 3300025972 | Bacteria | 1524 |
| 443 | Ga0207640_11288579 | 3300025981 | Bacteria | 652 |
| 444 | Ga0207658_10595139 | 3300025986 | Bacteria | 993 |
| 445 | Ga0207658_10753879 | 3300025986 | Bacteria | 882 |
| 446 | Ga0207677_10264896 | 3300026023 | Bacteria | 1403 |
| 447 | Ga0207677_10858222 | 3300026023 | Bacteria | 816 |
| 448 | Ga0207677_10863729 | 3300026023 | Bacteria | 814 |
| 449 | Ga0207677_11239392 | 3300026023 | Bacteria | 684 |
| 450 | Ga0207703_10077193 | 3300026035 | Bacteria | 2765 |
| 451 | Ga0207703_10232594 | 3300026035 | Bacteria | 1653 |
| 452 | Ga0207639_10032263 | 3300026041 | Bacteria | 3855 |
| 453 | Ga0207639_10604342 | 3300026041 | Bacteria | 1012 |
| 454 | Ga0207639_11170148 | 3300026041 | Bacteria | 722 |
| 455 | Ga0207678_10366266 | 3300026067 | Bacteria | 1244 |
| 456 | Ga0207678_11078533 | 3300026067 | Bacteria | 711 |
| 457 | Ga0207678_11504327 | 3300026067 | Bacteria | 594 |
| 458 | Ga0207708_10012300 | 3300026075 | Bacteria | 6379 |
| 459 | Ga0207708_10435030 | 3300026075 | Bacteria | 1090 |
| 460 | Ga0207708_11321268 | 3300026075 | Bacteria | 632 |
| 461 | Ga0207708_11628343 | 3300026075 | Bacteria | 567 |
| 462 | Ga0207641_10145346 | 3300026088 | Bacteria | 2144 |
| 463 | Ga0207641_10336421 | 3300026088 | Unclassified | 1435 |
| 464 | Ga0207641_10747251 | 3300026088 | Bacteria | 965 |
| 465 | Ga0207648_10023107 | 3300026089 | Bacteria | 5577 |
| 466 | Ga0207648_10122011 | 3300026089 | Unclassified | 2291 |
| 467 | Ga0207648_11267791 | 3300026089 | Bacteria | 692 |
| 468 | Ga0207676_10176079 | 3300026095 | Bacteria | 1868 |
| 469 | Ga0207676_10374266 | 3300026095 | Bacteria | 1324 |
| 470 | Ga0207676_10545721 | 3300026095 | Bacteria | 1107 |
| 471 | Ga0207674_10180058 | 3300026116 | Bacteria | 2065 |
| 472 | Ga0207674_10381897 | 3300026116 | Bacteria | 1362 |
| 473 | Ga0207674_11754504 | 3300026116 | Bacteria | 588 |
| 474 | Ga0207675_100012891 | 3300026118 | Bacteria | 7809 |
| 475 | Ga0207675_100220277 | 3300026118 | Bacteria | 1828 |
| 476 | Ga0207675_100512641 | 3300026118 | Bacteria | 1195 |
| 477 | Ga0207675_100533597 | 3300026118 | Bacteria | 1171 |
| 478 | Ga0207675_101748477 | 3300026118 | Bacteria | 641 |
| 479 | Ga0207675_102302017 | 3300026118 | Bacteria | 552 |
| 480 | Ga0207683_10021228 | 3300026121 | Bacteria | 5556 |
| 481 | Ga0207698_10176364 | 3300026142 | Bacteria | 1888 |
| 482 | Ga0207698_10226587 | 3300026142 | Unclassified | 1693 |
| 483 | Ga0209971_1075032 | 3300027682 | Bacteria | 822 |
| 484 | Ga0209966_1000765 | 3300027695 | Bacteria | 6635 |
| 485 | Ga0209998_10001832 | 3300027717 | Bacteria | 5038 |
| 486 | Ga0209813_10112120 | 3300027866 | Bacteria | 941 |
| 487 | Ga0209974_10009008 | 3300027876 | Unclassified | 3394 |
| 488 | Ga0207428_10000626 | 3300027907 | Bacteria | 41522 |
| 489 | Ga0268266_10457774 | 3300028379 | Bacteria | 1214 |
| 490 | Ga0268266_10508637 | 3300028379 | Bacteria | 1151 |
| 491 | Ga0268266_10903907 | 3300028379 | Bacteria | 854 |
| 492 | Ga0268266_11129297 | 3300028379 | Bacteria | 758 |
| 493 | Ga0268265_10068531 | 3300028380 | Bacteria | 2751 |
| 494 | Ga0268265_12583363 | 3300028380 | Bacteria | 514 |
| 495 | Ga0268264_10134107 | 3300028381 | Bacteria | 2199 |
| 496 | Ga0268264_10583484 | 3300028381 | Bacteria | 1100 |
| 497 | Ga0265337_1001215 | 3300028556 | Bacteria | 13090 |
| 498 | Ga0265338_10056921 | 3300028800 | Bacteria | 3463 |
| 499 | Ga0265338_10400752 | 3300028800 | Bacteria | 978 |
| 500 | Ga0265324_10163841 | 3300029957 | Bacteria | 755 |
| 501 | Ga0265330_10064148 | 3300031235 | Bacteria | 1596 |
| 502 | Ga0265330_10490772 | 3300031235 | Bacteria | 522 |
| 503 | Ga0265325_10002862 | 3300031241 | Bacteria | 11509 |
| 504 | Ga0265325_10043453 | 3300031241 | Bacteria | 2345 |
| 505 | Ga0265325_10084258 | 3300031241 | Bacteria | 1576 |
| 506 | Ga0265325_10372151 | 3300031241 | Bacteria | 629 |
| 507 | Ga0265329_10031927 | 3300031242 | Bacteria | 1708 |
| 508 | Ga0265340_10023153 | 3300031247 | Bacteria | 3169 |
| 509 | Ga0265340_10031944 | 3300031247 | Bacteria | 2630 |
| 510 | Ga0265340_10035170 | 3300031247 | Bacteria | 2489 |
| 511 | Ga0265340_10228324 | 3300031247 | Bacteria | 833 |
| 512 | Ga0265340_10339852 | 3300031247 | Bacteria | 664 |
| 513 | Ga0265340_10491399 | 3300031247 | Unclassified | 540 |
| 514 | Ga0265339_10463770 | 3300031249 | Unclassified | 587 |
| 515 | Ga0265316_10038361 | 3300031344 | Bacteria | 3861 |
| 516 | Ga0265316_10058161 | 3300031344 | Bacteria | 3013 |
| 517 | Ga0265316_10242658 | 3300031344 | Bacteria | 1325 |
| 518 | Ga0307513_10097427 | 3300031456 | Bacteria | 2976 |
| 519 | Ga0307513_10158733 | 3300031456 | Bacteria | 2157 |
| 520 | Ga0307408_101897712 | 3300031548 | Bacteria | 571 |
| 521 | Ga0265313_10015939 | 3300031595 | Bacteria | 4347 |
| 522 | Ga0265314_10000439 | 3300031711 | Bacteria | 55613 |
| 523 | Ga0265314_10006193 | 3300031711 | Bacteria | 10622 |
| 524 | Ga0265314_10549595 | 3300031711 | Bacteria | 601 |
| 525 | Ga0265342_10073571 | 3300031712 | Bacteria | 1987 |
| 526 | Ga0265342_10103288 | 3300031712 | Bacteria | 1621 |
| 527 | Ga0307405_11610809 | 3300031731 | Bacteria | 573 |
| 528 | Ga0326468_10004264 | 3300031889 | Bacteria | 1242 |
| 529 | Ga0307406_11535796 | 3300031901 | Bacteria | 587 |
| 530 | Ga0307411_11587491 | 3300032005 | Bacteria | 603 |
| 531 | Ga0307411_11839705 | 3300032005 | Bacteria | 563 |
| 532 | Ga0373930_0001573 | 3300034816 | Bacteria | 3425 |
| 533 | Ga0373930_0153446 | 3300034816 | Bacteria | 579 |
| 534 | Ga0373948_0007324 | 3300034817 | Unclassified | 1852 |
| 535 | Ga0373950_0001736 | 3300034818 | Unclassified | 2890 |
| 536 | Ga0373950_0011444 | 3300034818 | Bacteria | 1449 |
| 537 | Ga0373958_0000026 | 3300034819 | Bacteria | 16079 |
| 538 | Ga0373959_0000446 | 3300034820 | Bacteria | 7792 |
| 539 | Ga0373938_0000337 | 3300034957 | Bacteria | 7445 |
| 540 | Ga0373926_0026336 | 3300035083 | Bacteria | 2033 |
| 541 | Ga0373926_0123542 | 3300035083 | Bacteria | 977 |
| 542 | Ga0373926_0274714 | 3300035083 | Unclassified | 655 |
| 543 | Ga0373928_0000487 | 3300035084 | Bacteria | 7804 |
| 544 | Ga0373928_0000532 | 3300035084 | Bacteria | 7414 |
| 545 | Ga0373929_0000110 | 3300035085 | Bacteria | 13537 |
| 546 | Ga0373929_0059002 | 3300035085 | Bacteria | 894 |
| 547 | Ga0373934_0145045 | 3300035086 | Bacteria | 971 |
| 548 | Ga0373940_0000116 | 3300035088 | Bacteria | 9967 |
| 549 | Ga0373944_0135993 | 3300035089 | Bacteria | 857 |
| 550 | Ga0373944_0294123 | 3300035089 | Bacteria | 608 |
| 551 | Ga0373949_0001975 | 3300035090 | Bacteria | 5489 |
| 552 | Ga0373951_0000638 | 3300035091 | Bacteria | 9666 |
| 553 | Ga0373951_0014347 | 3300035091 | Bacteria | 1781 |
| 554 | Ga0373952_0001416 | 3300035092 | Bacteria | 4379 |
| 555 | Ga0373952_0029826 | 3300035092 | Bacteria | 1205 |
| 556 | Ga0373923_0002974 | 3300035111 | Bacteria | 5345 |
| 557 | Ga0373923_0133212 | 3300035111 | Bacteria | 1118 |
| 558 | Ga0373932_0004843 | 3300035112 | Unclassified | 3171 |
| 559 | Ga0373936_0007985 | 3300035113 | Bacteria | 3976 |
| 560 | Ga0373936_0016239 | 3300035113 | Bacteria | 2863 |
| 561 | Ga0373936_0022976 | 3300035113 | Bacteria | 2428 |
| 562 | Ga0373936_0399512 | 3300035113 | Bacteria | 631 |
| 563 | Ga0373939_0011346 | 3300035114 | Unclassified | 2245 |
| 564 | Ga0373939_0262975 | 3300035114 | Bacteria | 676 |
| 565 | Ga0373941_0000177 | 3300035115 | Bacteria | 11867 |
| 566 | Ga0373941_0052696 | 3300035115 | Bacteria | 1299 |
| 567 | Ga0373941_0465608 | 3300035115 | Bacteria | 533 |
| 568 | Ga0373945_0013190 | 3300035116 | Bacteria | 2754 |
| 569 | Ga0373945_0080896 | 3300035116 | Bacteria | 1245 |
| 570 | Ga0373945_0112441 | 3300035116 | Bacteria | 1075 |
| 571 | Ga0373953_0004119 | 3300035117 | Bacteria | 4610 |
| 572 | Ga0373953_0035605 | 3300035117 | Bacteria | 1957 |
| 573 | Ga0373954_0037704 | 3300035118 | Bacteria | 2247 |
| 574 | Ga0373954_0074757 | 3300035118 | Bacteria | 1613 |
| 575 | Ga0373954_0101210 | 3300035118 | Bacteria | 1390 |
| 576 | Ga0373954_0207498 | 3300035118 | Bacteria | 963 |
| 577 | Ga0373954_0265227 | 3300035118 | Bacteria | 846 |
| 578 | Ga0373956_0011159 | 3300035119 | Bacteria | 3700 |
| 579 | Ga0373956_0047253 | 3300035119 | Bacteria | 1925 |
| 580 | Ga0373956_0093600 | 3300035119 | Bacteria | 1388 |
| 581 | Ga0373956_0182312 | 3300035119 | Bacteria | 993 |
| 582 | Ga0373956_0298529 | 3300035119 | Bacteria | 767 |
| 583 | Ga0373957_0004295 | 3300035120 | Bacteria | 4324 |
| 584 | Ga0373957_0018552 | 3300035120 | Bacteria | 2439 |
| 585 | Ga0373957_0230343 | 3300035120 | Bacteria | 777 |
| 586 | Ga0373957_0252678 | 3300035120 | Unclassified | 742 |
| 587 | Ga0373960_0003980 | 3300035121 | Bacteria | 3369 |
| 588 | Ga0373943_0004455 | 3300035170 | Bacteria | 6340 |
| 589 | Ga0373943_0095454 | 3300035170 | Unclassified | 1546 |
| 590 | Ga0373943_0496996 | 3300035170 | Bacteria | 712 |
| 591 | Ga0373946_0007076 | 3300035171 | Bacteria | 4094 |
| 592 | Ga0373946_0012082 | 3300035171 | Bacteria | 3229 |
| 593 | Ga0373955_0000509 | 3300035172 | Bacteria | 16517 |
| 594 | Ga0373955_0007958 | 3300035172 | Bacteria | 4899 |
| 595 | Ga0373955_0008788 | 3300035172 | Bacteria | 4706 |
| 596 | Ga0373955_0040130 | 3300035172 | Bacteria | 2501 |
| 597 | Ga0373955_0295497 | 3300035172 | Bacteria | 976 |
| 598 | Ga0373942_0002386 | 3300035207 | Bacteria | 4564 |
| 599 | Ga0373942_0028123 | 3300035207 | Bacteria | 1467 |
| 600 | Ga0373942_0090969 | 3300035207 | Bacteria | 920 |
| 601 | Ga0373942_0197046 | 3300035207 | Unclassified | 666 |
| 602 | Ga0373961_0001126 | 3300035241 | Bacteria | 8418 |
| 603 | Ga0373962_0009256 | 3300035242 | Bacteria | 2436 |
| 604 | Ga0373962_0010843 | 3300035242 | Bacteria | 2278 |
| 605 | Ga0373924_0010900 | 3300035410 | Bacteria | 3364 |
| 606 | Ga0373924_0016524 | 3300035410 | Bacteria | 2817 |
| 607 | Ga0373924_0018675 | 3300035410 | Bacteria | 2676 |
| 608 | Ga0373924_0163200 | 3300035410 | Bacteria | 977 |
| 609 | Ga0373931_0021710 | 3300035691 | Bacteria | 3222 |
| 610 | Ga0373935_0024574 | 3300035692 | Bacteria | 3709 |
| 611 | Ga0373935_0697246 | 3300035692 | Unclassified | 746 |
| 612 | Ga0373935_1178271 | 3300035692 | Bacteria | 571 |
| 613 | Ga0373927_0021223 | 3300035695 | Bacteria | 4255 |
| 614 | Ga0373927_0196561 | 3300035695 | Bacteria | 1323 |
| 615 | Ga0373927_0847915 | 3300035695 | Bacteria | 603 |
| 616 | Ga0373933_0001541 | 3300035724 | Bacteria | 13482 |
| 617 | Ga0373933_0043969 | 3300035724 | Bacteria | 2644 |
| 618 | Ga0373933_0305040 | 3300035724 | Bacteria | 1031 |
| 619 | Ga0373933_0343979 | 3300035724 | Bacteria | 968 |
| 620 | Ga0373933_0983754 | 3300035724 | Bacteria | 556 |
| 621 | Ga0373933_1101789 | 3300035724 | Bacteria | 523 |
| 622 | Ga0373947_0017782 | 3300035725 | Bacteria | 4090 |
| 623 | Ga0373947_0252500 | 3300035725 | Bacteria | 1166 |
| 624 | Ga0373947_0347804 | 3300035725 | Bacteria | 994 |
| 625 | Ga0373947_0492468 | 3300035725 | Unclassified | 832 |
| 626 | Ga0373937_0006385 | 3300036401 | Bacteria | 10173 |
| 627 | Ga0373937_0130085 | 3300036401 | Bacteria | 2351 |
| 628 | Ga0373937_0158313 | 3300036401 | Bacteria | 2123 |
| 629 | Ga0373937_0236309 | 3300036401 | Bacteria | 1721 |
| 630 | Ga0373937_0237316 | 3300036401 | Bacteria | 1717 |
| 631 | Ga0373937_0611734 | 3300036401 | Bacteria | 1034 |
| 632 | Ga0373937_0642406 | 3300036401 | Bacteria | 1006 |
| 633 | Ga0373937_0865207 | 3300036401 | Bacteria | 852 |
| 634 | Ga0373937_1050266 | 3300036401 | Bacteria | 763 |
| 635 | Ga0373925_0001273 | 3300037068 | Bacteria | 22250 |
| 636 | Ga0373925_0047796 | 3300037068 | Bacteria | 3187 |
| 637 | Ga0373925_0105184 | 3300037068 | Bacteria | 2174 |
| 638 | Ga0373925_0242647 | 3300037068 | Bacteria | 1443 |
| 639 | Ga0242419_020650 | 3300038698 | Bacteria | 550 |
| 640 | Ga0242420_000887 | 3300038996 | Bacteria | 3713 |
| 641 | Ga0436365_0169472 | 3300039437 | Bacteria | 3228 |
| 642 | Ga0436365_0548422 | 3300039437 | Bacteria | 512 |
| 643 | Ga0436365_1076647 | 3300039437 | Unclassified | 1068 |
| 644 | Ga0436365_1298767 | 3300039437 | Bacteria | 688 |
| 645 | Ga0439453_0000106 | 3300041408 | Bacteria | 6745 |
| 646 | Ga0451793_0093313 | 3300041452 | Bacteria | 556 |
| 647 | Ga0451807_1006014 | 3300041486 | Bacteria | 540 |
| 648 | Ga0451845_0439394 | 3300041501 | Bacteria | 646 |
| 649 | Ga0451855_1205704 | 3300041511 | Bacteria | 559 |
| 650 | Ga0439437_055629 | 3300042000 | Unclassified | 531 |
| 651 | Ga0439441_063145 | 3300042001 | Bacteria | 783 |
| 652 | Ga0439441_111744 | 3300042001 | Bacteria | 620 |
| 653 | Ga0439443_020032 | 3300042003 | Unclassified | 1047 |
| 654 | Ga0439450_023182 | 3300042008 | Unclassified | 1345 |
| 655 | Ga0439455_0082629 | 3300042012 | Bacteria | 874 |
| 656 | Ga0439463_122214 | 3300042016 | Bacteria | 673 |
| 657 | Ga0450914_057810 | 3300042118 | Unclassified | 521 |
| 658 | Ga0450906_083918 | 3300042145 | Unclassified | 576 |
| 659 | Ga0450908_043822 | 3300042184 | Unclassified | 776 |
| 660 | Ga0439435_0000370 | 3300042436 | Bacteria | 6880 |
| 661 | Ga0439435_0232470 | 3300042436 | Bacteria | 616 |
| 662 | Ga0439444_0042475 | 3300042437 | Unclassified | 898 |
| 663 | Ga0439459_0119527 | 3300042438 | Bacteria | 663 |
| 664 | Ga0439464_0010042 | 3300042439 | Unclassified | 2497 |
| 665 | Ga0439460_0068356 | 3300042461 | Unclassified | 1096 |
| 666 | Ga0439460_0100815 | 3300042461 | Unclassified | 927 |
| 667 | Ga0451577_0042439 | 3300042876 | Bacteria | 4080 |
| 668 | Ga0439440_0023527 | 3300042993 | Unclassified | 1406 |
| 669 | Ga0439440_0079560 | 3300042993 | Bacteria | 865 |
| 670 | Ga0453683_0236175 | 3300044673 | Bacteria | 1164 |
| 671 | Ga0466966_0080184 | 3300044684 | Bacteria | 2034 |
| 672 | Ga0466966_0928577 | 3300044684 | Bacteria | 525 |
| 673 | Ga0466961_0164926 | 3300044693 | Unclassified | 1380 |
| 674 | Ga0466963_0191670 | 3300044694 | Unclassified | 1428 |
| 675 | Ga0466963_0533340 | 3300044694 | Bacteria | 829 |
| 676 | Ga0453684_0057645 | 3300044712 | Bacteria | 5025 |
| 677 | Ga0453684_1926619 | 3300044712 | Bacteria | 597 |
| 678 | Ga0466971_0141346 | 3300044719 | Bacteria | 1121 |
| 679 | Ga0466971_0395370 | 3300044719 | Bacteria | 673 |
| 680 | Ga0466957_0329076 | 3300044842 | Bacteria | 1032 |
| 681 | Ga0466957_1348258 | 3300044842 | Unclassified | 518 |
| 682 | Ga0466960_0544725 | 3300044901 | Unclassified | 684 |
| 683 | Ga0466960_0946467 | 3300044901 | Bacteria | 527 |
| 684 | Ga0466959_0472214 | 3300045049 | Unclassified | 849 |
| 685 | Ga0451576_0087001 | 3300045051 | Bacteria | 3250 |
| 686 | Ga0466958_0201370 | 3300045836 | Bacteria | 1267 |
| 687 | Ga0466958_0336726 | 3300045836 | Bacteria | 971 |
| 688 | Ga0466967_0149240 | 3300045976 | Bacteria | 2184 |
| 689 | Ga0466967_0216103 | 3300045976 | Bacteria | 1820 |
| 690 | Ga0466967_0786880 | 3300045976 | Bacteria | 944 |
| 691 | Ga0495592_0023347 | 3300046454 | Bacteria | 4703 |
| 692 | Ga0495592_0086679 | 3300046454 | Bacteria | 2254 |
| 693 | Ga0495592_0385201 | 3300046454 | Bacteria | 891 |
| 694 | Ga0495603_0018201 | 3300046455 | Bacteria | 4250 |
| 695 | Ga0495603_0065563 | 3300046455 | Bacteria | 2140 |
| 696 | Ga0495590_0153664 | 3300046457 | Bacteria | 835 |
| 697 | Ga0495629_0792342 | 3300046459 | Bacteria | 625 |
| 698 | Ga0495638_0028464 | 3300046460 | Bacteria | 3608 |
| 699 | Ga0495641_0014894 | 3300046461 | Bacteria | 4187 |
| 700 | Ga0495641_0158608 | 3300046461 | Unclassified | 1012 |
| 701 | Ga0495651_0024840 | 3300046462 | Bacteria | 4662 |
| 702 | Ga0495651_0027684 | 3300046462 | Bacteria | 4417 |
| 703 | Ga0495651_0028851 | 3300046462 | Bacteria | 4326 |
| 704 | Ga0495651_0206341 | 3300046462 | Bacteria | 1371 |
| 705 | Ga0495651_0423628 | 3300046462 | Bacteria | 865 |
| 706 | Ga0495651_0463609 | 3300046462 | Bacteria | 817 |
| 707 | Ga0495653_0118639 | 3300046463 | Bacteria | 1889 |
| 708 | Ga0495653_0127576 | 3300046463 | Bacteria | 1805 |
| 709 | Ga0495653_0194059 | 3300046463 | Bacteria | 1383 |
| 710 | Ga0495653_0287572 | 3300046463 | Bacteria | 1077 |
| 711 | Ga0495580_0983689 | 3300046472 | Unclassified | 538 |
| 712 | Ga0495582_0049796 | 3300046473 | Bacteria | 2307 |
| 713 | Ga0495582_0076771 | 3300046473 | Bacteria | 1852 |
| 714 | Ga0495605_0488129 | 3300046474 | Bacteria | 504 |
| 715 | Ga0495639_0004864 | 3300046475 | Bacteria | 5764 |
| 716 | Ga0495639_0103744 | 3300046475 | Bacteria | 1344 |
| 717 | Ga0495662_0011898 | 3300046476 | Bacteria | 4252 |
| 718 | Ga0495662_0125968 | 3300046476 | Bacteria | 1258 |
| 719 | Ga0495664_0002672 | 3300046477 | Bacteria | 9604 |
| 720 | Ga0495664_0006545 | 3300046477 | Bacteria | 6436 |
| 721 | Ga0495664_0035617 | 3300046477 | Bacteria | 2932 |
| 722 | Ga0495664_0343334 | 3300046477 | Unclassified | 899 |
| 723 | Ga0495664_0696686 | 3300046477 | Bacteria | 600 |
| 724 | Ga0495594_0026904 | 3300046499 | Bacteria | 3097 |
| 725 | Ga0495607_0010006 | 3300046501 | Bacteria | 6390 |
| 726 | Ga0495608_0000557 | 3300046511 | Bacteria | 25706 |
| 727 | Ga0495608_0015588 | 3300046511 | Bacteria | 5266 |
| 728 | Ga0495608_0028419 | 3300046511 | Bacteria | 3801 |
| 729 | Ga0495608_0164099 | 3300046511 | Bacteria | 1411 |
| 730 | Ga0495616_0426090 | 3300046513 | Unclassified | 541 |
| 731 | Ga0495618_0393534 | 3300046514 | Unclassified | 849 |
| 732 | Ga0495618_0405482 | 3300046514 | Bacteria | 833 |
| 733 | Ga0495620_0074315 | 3300046515 | Bacteria | 1384 |
| 734 | Ga0495628_0001465 | 3300046516 | Bacteria | 21652 |
| 735 | Ga0495628_0037692 | 3300046516 | Bacteria | 3875 |
| 736 | Ga0495628_0928444 | 3300046516 | Unclassified | 602 |
| 737 | Ga0495630_0441245 | 3300046517 | Bacteria | 997 |
| 738 | Ga0495630_0463588 | 3300046517 | Bacteria | 971 |
| 739 | Ga0495643_0127748 | 3300046522 | Bacteria | 1279 |
| 740 | Ga0495644_0380952 | 3300046523 | Unclassified | 557 |
| 741 | Ga0495666_0033133 | 3300046526 | Bacteria | 2525 |
| 742 | Ga0495666_0033310 | 3300046526 | Bacteria | 2517 |
| 743 | Ga0495652_0002359 | 3300046529 | Bacteria | 19593 |
| 744 | Ga0495652_0053207 | 3300046529 | Bacteria | 3451 |
| 745 | Ga0495652_0188561 | 3300046529 | Bacteria | 1576 |
| 746 | Ga0495652_1025771 | 3300046529 | Bacteria | 539 |
| 747 | Ga0495665_0067398 | 3300046531 | Bacteria | 1888 |
| 748 | Ga0495665_0069847 | 3300046531 | Bacteria | 1851 |
| 749 | Ga0495665_0520799 | 3300046531 | Bacteria | 598 |
| 750 | Ga0495640_0131267 | 3300046533 | Bacteria | 1621 |
| 751 | Ga0495640_0201292 | 3300046533 | Bacteria | 1262 |
| 752 | Ga0495640_0297700 | 3300046533 | Unclassified | 1002 |
| 753 | Ga0495640_0570189 | 3300046533 | Bacteria | 685 |
| 754 | Ga0495586_0034869 | 3300046535 | Bacteria | 2703 |
| 755 | Ga0495586_0244719 | 3300046535 | Bacteria | 1023 |
| 756 | Ga0495587_0031834 | 3300046536 | Bacteria | 3191 |
| 757 | Ga0495587_0245789 | 3300046536 | Bacteria | 1006 |
| 758 | Ga0495587_0771954 | 3300046536 | Bacteria | 525 |
| 759 | Ga0495598_0004138 | 3300046537 | Bacteria | 3125 |
| 760 | Ga0495609_0170486 | 3300046538 | Bacteria | 919 |
| 761 | Ga0495621_0048691 | 3300046539 | Bacteria | 1510 |
| 762 | Ga0495645_0002006 | 3300046543 | Bacteria | 13860 |
| 763 | Ga0495645_0035666 | 3300046543 | Bacteria | 3626 |
| 764 | Ga0495622_0169368 | 3300046557 | Bacteria | 982 |
| 765 | Ga0495622_0446356 | 3300046557 | Unclassified | 555 |
| 766 | Ga0495633_0002198 | 3300046558 | Bacteria | 13962 |
| 767 | Ga0495667_0002889 | 3300046559 | Bacteria | 11519 |
| 768 | Ga0495667_0015972 | 3300046559 | Bacteria | 5073 |
| 769 | Ga0495667_0041062 | 3300046559 | Bacteria | 3069 |
| 770 | Ga0495667_0415458 | 3300046559 | Bacteria | 847 |
| 771 | Ga0495634_0167244 | 3300046642 | Bacteria | 1383 |
| 772 | Ga0495634_0247000 | 3300046642 | Bacteria | 1093 |
| 773 | Ga0495634_0334238 | 3300046642 | Bacteria | 910 |
| 774 | Ga0495634_0619076 | 3300046642 | Bacteria | 627 |
| 775 | Ga0495611_0003383 | 3300046648 | Bacteria | 7040 |
| 776 | Ga0495611_0572628 | 3300046648 | Unclassified | 511 |
| 777 | Ga0495625_0817033 | 3300046660 | Bacteria | 541 |
| 778 | Ga0495635_0003603 | 3300046663 | Bacteria | 10728 |
| 779 | Ga0495635_0061445 | 3300046663 | Bacteria | 2581 |
| 780 | Ga0495635_0149588 | 3300046663 | Unclassified | 1589 |
| 781 | Ga0495635_0498040 | 3300046663 | Bacteria | 802 |
| 782 | Ga0495661_0067702 | 3300046665 | Bacteria | 2097 |
| 783 | Ga0495588_0009109 | 3300046674 | Bacteria | 4577 |
| 784 | Ga0495588_0372213 | 3300046674 | Unclassified | 750 |
| 785 | Ga0495657_0020739 | 3300046675 | Bacteria | 4725 |
| 786 | Ga0495657_0023491 | 3300046675 | Bacteria | 4404 |
| 787 | Ga0495657_0654207 | 3300046675 | Bacteria | 606 |
| 788 | Ga0495599_0004135 | 3300046678 | Bacteria | 8571 |
| 789 | Ga0495599_0005971 | 3300046678 | Bacteria | 7324 |
| 790 | Ga0495623_0413858 | 3300046679 | Bacteria | 723 |
| 791 | Ga0495646_0020139 | 3300046680 | Bacteria | 4218 |
| 792 | Ga0495646_0053496 | 3300046680 | Bacteria | 2434 |
| 793 | Ga0495647_0003659 | 3300046681 | Bacteria | 4935 |
| 794 | Ga0495647_0031914 | 3300046681 | Bacteria | 1960 |
| 795 | Ga0495647_0507716 | 3300046681 | Bacteria | 561 |
| 796 | Ga0495658_0007904 | 3300046683 | Bacteria | 5264 |
| 797 | Ga0495658_0012613 | 3300046683 | Bacteria | 4287 |
| 798 | Ga0495658_0151377 | 3300046683 | Bacteria | 1425 |
| 799 | Ga0495669_0552341 | 3300046684 | Bacteria | 560 |
| 800 | Ga0495613_0079381 | 3300046689 | Bacteria | 2386 |
| 801 | Ga0495613_0557627 | 3300046689 | Bacteria | 766 |
| 802 | Ga0495613_0677271 | 3300046689 | Unclassified | 681 |
| 803 | Ga0495624_0102522 | 3300046690 | Unclassified | 1761 |
| 804 | Ga0495670_0000870 | 3300046691 | Bacteria | 14648 |
| 805 | Ga0495670_0314893 | 3300046691 | Bacteria | 840 |
| 806 | Ga0495600_0002049 | 3300046809 | Bacteria | 11360 |
| 807 | Ga0495600_0069850 | 3300046809 | Bacteria | 2295 |
| 808 | Ga0495600_0260938 | 3300046809 | Bacteria | 1100 |
| 809 | Ga0495600_0408600 | 3300046809 | Unclassified | 844 |
| 810 | Ga0495581_0048792 | 3300047315 | Bacteria | 2444 |
| 811 | Ga0495581_0058530 | 3300047315 | Bacteria | 2225 |
| 812 | Ga0495581_0345605 | 3300047315 | Bacteria | 868 |
| 813 | Ga0495604_0010650 | 3300047317 | Bacteria | 7293 |
| 814 | Ga0495604_0052471 | 3300047317 | Bacteria | 3157 |
| 815 | Ga0495674_0011272 | 3300047319 | Bacteria | 8439 |
| 816 | Ga0495674_0035712 | 3300047319 | Bacteria | 4481 |
| 817 | Ga0495674_0042925 | 3300047319 | Bacteria | 4029 |
| 818 | Ga0495674_0186903 | 3300047319 | Bacteria | 1724 |
| 819 | Ga0495676_0278352 | 3300047321 | Unclassified | 1133 |
| 820 | Ga0495676_0581090 | 3300047321 | Bacteria | 730 |
| 821 | Ga0495676_1106675 | 3300047321 | Bacteria | 504 |
| 822 | Ga0495680_0005770 | 3300047322 | Bacteria | 11590 |
| 823 | Ga0495680_0014947 | 3300047322 | Bacteria | 6706 |
| 824 | Ga0495680_0020201 | 3300047322 | Bacteria | 5610 |
| 825 | Ga0495680_0309648 | 3300047322 | Unclassified | 1107 |
| 826 | Ga0495680_0355282 | 3300047322 | Unclassified | 1019 |
| 827 | Ga0495680_0956366 | 3300047322 | Bacteria | 550 |
| 828 | Ga0495675_0000740 | 3300047444 | Bacteria | 20363 |
| 829 | Ga0495675_0082688 | 3300047444 | Bacteria | 2022 |
| 830 | Ga0495675_0217902 | 3300047444 | Bacteria | 1156 |
| 831 | Ga0495675_0284711 | 3300047444 | Archaea | 985 |
| 832 | Ga0495677_0248898 | 3300047445 | Bacteria | 695 |
| 833 | Ga0495685_115550 | 3300047447 | Bacteria | 882 |
| 834 | Ga0495685_224657 | 3300047447 | Unclassified | 599 |
| 835 | Ga0495684_0068395 | 3300047471 | Bacteria | 2700 |
| 836 | Ga0495684_0290792 | 3300047471 | Bacteria | 1176 |
| 837 | Ga0495686_0284600 | 3300047472 | Bacteria | 918 |
| 838 | Ga0495593_0419159 | 3300047673 | Bacteria | 670 |
| 839 | Ga0495602_0002218 | 3300048088 | Bacteria | 19614 |
| 840 | Ga0495602_0013696 | 3300048088 | Bacteria | 8272 |
| 841 | Ga0495602_0037475 | 3300048088 | Bacteria | 4500 |
| 842 | Ga0495602_0063070 | 3300048088 | Bacteria | 3213 |
| 843 | Ga0495602_0150527 | 3300048088 | Bacteria | 1830 |
| 844 | Ga0495614_0048355 | 3300048089 | Bacteria | 1823 |
| 845 | Ga0495614_0259467 | 3300048089 | Unclassified | 796 |
| 846 | Ga0495615_0059894 | 3300048090 | Bacteria | 1002 |
| 847 | Ga0496100_0189818 | 3300048903 | Bacteria | 1491 |
| 848 | Ga0496101_0001349 | 3300048904 | Bacteria | 14712 |
| 849 | Ga0496101_0059537 | 3300048904 | Bacteria | 2768 |
| 850 | Ga0496102_0002354 | 3300048905 | Bacteria | 16125 |
| 851 | Ga0496102_0017521 | 3300048905 | Bacteria | 6273 |
| 852 | Ga0496103_0048757 | 3300048906 | Unclassified | 2618 |
| 853 | Ga0496104_0000126 | 3300048907 | Bacteria | 70488 |
| 854 | Ga0496104_0065771 | 3300048907 | Bacteria | 3441 |
| 855 | Ga0496104_0253403 | 3300048907 | Bacteria | 1673 |
| 856 | Ga0496105_0000117 | 3300048908 | Bacteria | 54274 |
| 857 | Ga0496106_0000557 | 3300048909 | Bacteria | 26528 |
| 858 | Ga0496106_0047156 | 3300048909 | Bacteria | 3242 |
| 859 | Ga0496106_0052745 | 3300048909 | Bacteria | 3069 |
| 860 | Ga0496107_0019064 | 3300048910 | Bacteria | 4838 |
| 861 | Ga0496107_0019668 | 3300048910 | Bacteria | 4764 |
| 862 | Ga0496108_0037745 | 3300048911 | Bacteria | 4025 |
| 863 | Ga0496109_0004864 | 3300048912 | Bacteria | 11211 |
| 864 | Ga0496109_0038200 | 3300048912 | Bacteria | 4340 |
| 865 | Ga0496110_0054572 | 3300048913 | Unclassified | 3515 |
| 866 | Ga0496111_0096583 | 3300048914 | Unclassified | 2169 |
| 867 | Ga0496112_0086388 | 3300048915 | Bacteria | 3103 |
| 868 | Ga0496112_0217980 | 3300048915 | Bacteria | 1865 |
| 869 | Ga0496112_0724967 | 3300048915 | Bacteria | 921 |
| 870 | Ga0496112_0976941 | 3300048915 | Bacteria | 767 |
| 871 | Ga0496112_1646631 | 3300048915 | Unclassified | 555 |
| 872 | Ga0496113_0015747 | 3300048916 | Bacteria | 5207 |
| 873 | Ga0496113_0252736 | 3300048916 | Bacteria | 1407 |
| 874 | Ga0496113_0969549 | 3300048916 | Unclassified | 671 |
| 875 | Ga0496114_0072327 | 3300048917 | Bacteria | 2900 |
| 876 | Ga0496114_0345346 | 3300048917 | Bacteria | 1316 |
| 877 | Ga0496115_0018679 | 3300048918 | Bacteria | 5329 |
| 878 | Ga0496115_0036386 | 3300048918 | Bacteria | 3898 |
| 879 | Ga0496115_0245055 | 3300048918 | Bacteria | 1477 |
| 880 | Ga0496115_0508590 | 3300048918 | Bacteria | 967 |
| 881 | Ga0496115_0543685 | 3300048918 | Bacteria | 929 |
| 882 | Ga0496121_0751335 | 3300048924 | Unclassified | 580 |
| 883 | Ga0496126_0131972 | 3300048929 | Bacteria | 2158 |
| 884 | Ga0496126_0647370 | 3300048929 | Bacteria | 827 |
| 885 | Ga0501031_0006160 | 3300049568 | Bacteria | 7831 |
| 886 | Ga0501031_0113961 | 3300049568 | Bacteria | 1766 |
| 887 | Ga0501031_0913327 | 3300049568 | Bacteria | 562 |
| 888 | Ga0501031_0929218 | 3300049568 | Bacteria | 556 |
| 889 | Ga0501032_0002502 | 3300049569 | Bacteria | 14350 |
| 890 | Ga0501033_0026683 | 3300049570 | Bacteria | 4345 |
| 891 | Ga0501033_0228381 | 3300049570 | Bacteria | 1323 |
| 892 | Ga0501033_0276787 | 3300049570 | Bacteria | 1185 |
| 893 | Ga0501034_0023206 | 3300049571 | Bacteria | 6321 |
| 894 | Ga0501034_0046159 | 3300049571 | Bacteria | 4402 |
| 895 | Ga0501034_0088744 | 3300049571 | Bacteria | 3090 |
| 896 | Ga0501034_0163432 | 3300049571 | Bacteria | 2196 |
| 897 | Ga0501034_0192227 | 3300049571 | Bacteria | 2003 |
| 898 | Ga0501034_0293709 | 3300049571 | Bacteria | 1563 |
| 899 | Ga0501034_0600209 | 3300049571 | Bacteria | 1006 |
| 900 | Ga0501034_0616819 | 3300049571 | Bacteria | 989 |
| 901 | Ga0501034_0627646 | 3300049571 | Bacteria | 978 |
| 902 | Ga0501034_0919986 | 3300049571 | Bacteria | 762 |
| 903 | Ga0501034_1214588 | 3300049571 | Bacteria | 632 |
| 904 | Ga0501034_1357579 | 3300049571 | Bacteria | 586 |
| 905 | Ga0501036_0012785 | 3300049572 | Bacteria | 6963 |
| 906 | Ga0501036_0119528 | 3300049572 | Bacteria | 2225 |
| 907 | Ga0501036_0273997 | 3300049572 | Bacteria | 1412 |
| 908 | Ga0501036_0334881 | 3300049572 | Bacteria | 1264 |
| 909 | Ga0501037_0007235 | 3300049573 | Bacteria | 8109 |
| 910 | Ga0501037_0010967 | 3300049573 | Bacteria | 6664 |
| 911 | Ga0501037_0131872 | 3300049573 | Bacteria | 1792 |
| 912 | Ga0501037_0856328 | 3300049573 | Bacteria | 598 |
| 913 | Ga0501038_0004064 | 3300049574 | Bacteria | 13606 |
| 914 | Ga0501038_0082157 | 3300049574 | Bacteria | 2713 |
| 915 | Ga0501038_0085007 | 3300049574 | Bacteria | 2661 |
| 916 | Ga0501038_0125210 | 3300049574 | Bacteria | 2116 |
| 917 | Ga0501039_0015100 | 3300049575 | Bacteria | 5908 |
| 918 | Ga0501039_0238558 | 3300049575 | Bacteria | 1430 |
| 919 | Ga0501039_0388010 | 3300049575 | Bacteria | 1097 |
| 920 | Ga0501039_1434623 | 3300049575 | Bacteria | 531 |
| 921 | Ga0501039_1516249 | 3300049575 | Bacteria | 515 |
| 922 | Ga0501040_0317674 | 3300049576 | Bacteria | 1114 |
| 923 | Ga0501040_1275635 | 3300049576 | Unclassified | 533 |
| 924 | Ga0501041_0220912 | 3300049577 | Bacteria | 1189 |
| 925 | Ga0501042_0032536 | 3300049578 | Bacteria | 3694 |
| 926 | Ga0501042_0222621 | 3300049578 | Bacteria | 1361 |
| 927 | Ga0501042_1217403 | 3300049578 | Bacteria | 549 |
| 928 | Ga0501043_0031616 | 3300049579 | Bacteria | 4160 |
| 929 | Ga0501046_0004620 | 3300049580 | Bacteria | 12437 |
| 930 | Ga0501046_0124968 | 3300049580 | Bacteria | 1955 |
| 931 | Ga0501047_0014677 | 3300049581 | Bacteria | 7454 |
| 932 | Ga0501047_0082757 | 3300049581 | Bacteria | 3085 |
| 933 | Ga0501047_0100323 | 3300049581 | Bacteria | 2774 |
| 934 | Ga0501047_1204133 | 3300049581 | Bacteria | 571 |
| 935 | Ga0501048_0019145 | 3300049582 | Bacteria | 5026 |
| 936 | Ga0501048_0260560 | 3300049582 | Bacteria | 1232 |
| 937 | Ga0501048_0379929 | 3300049582 | Bacteria | 1009 |
| 938 | Ga0501067_0003146 | 3300049583 | Bacteria | 9114 |
| 939 | Ga0501068_0093062 | 3300049584 | Bacteria | 1862 |
| 940 | Ga0501068_0395056 | 3300049584 | Bacteria | 891 |
| 941 | Ga0501068_0578833 | 3300049584 | Bacteria | 731 |
| 942 | Ga0501069_0003163 | 3300049585 | Bacteria | 8437 |
| 943 | Ga0501069_0068986 | 3300049585 | Bacteria | 1979 |
| 944 | Ga0501069_0286906 | 3300049585 | Bacteria | 964 |
| 945 | Ga0501069_0360288 | 3300049585 | Bacteria | 858 |
| 946 | Ga0501069_0696963 | 3300049585 | Bacteria | 612 |
| 947 | Ga0501069_1037381 | 3300049585 | Bacteria | 501 |
| 948 | Ga0501070_0021944 | 3300049586 | Bacteria | 5349 |
| 949 | Ga0501070_0059924 | 3300049586 | Bacteria | 3155 |
| 950 | Ga0501070_0068845 | 3300049586 | Bacteria | 2930 |
| 951 | Ga0501070_0125154 | 3300049586 | Bacteria | 2124 |
| 952 | Ga0501070_0136867 | 3300049586 | Bacteria | 2022 |
| 953 | Ga0501070_0138228 | 3300049586 | Bacteria | 2011 |
| 954 | Ga0501070_0160373 | 3300049586 | Bacteria | 1854 |
| 955 | Ga0501070_0380165 | 3300049586 | Bacteria | 1144 |
| 956 | Ga0501070_0519677 | 3300049586 | Bacteria | 955 |
| 957 | Ga0501070_0529665 | 3300049586 | Bacteria | 945 |
| 958 | Ga0501071_0019296 | 3300049587 | Bacteria | 4732 |
| 959 | Ga0501071_0031082 | 3300049587 | Bacteria | 3782 |
| 960 | Ga0501071_1321645 | 3300049587 | Bacteria | 557 |
| 961 | Ga0501071_1379481 | 3300049587 | Unclassified | 544 |
| 962 | Ga0501072_0136759 | 3300049588 | Bacteria | 1953 |
| 963 | Ga0501072_0206092 | 3300049588 | Bacteria | 1568 |
| 964 | Ga0501072_0283321 | 3300049588 | Bacteria | 1318 |
| 965 | Ga0501072_0352471 | 3300049588 | Bacteria | 1168 |
| 966 | Ga0501072_0746599 | 3300049588 | Bacteria | 768 |
| 967 | Ga0501072_1010253 | 3300049588 | Bacteria | 648 |
| 968 | Ga0501072_1126436 | 3300049588 | Bacteria | 610 |
| 969 | Ga0501073_0001123 | 3300049589 | Bacteria | 19412 |
| 970 | Ga0501073_0260130 | 3300049589 | Bacteria | 1198 |
| 971 | Ga0501073_0272271 | 3300049589 | Bacteria | 1168 |
| 972 | Ga0501073_0877677 | 3300049589 | Bacteria | 618 |
| 973 | Ga0501073_1034504 | 3300049589 | Bacteria | 565 |
| 974 | Ga0501074_0004631 | 3300049590 | Bacteria | 9849 |
| 975 | Ga0501074_0322129 | 3300049590 | Bacteria | 1098 |
| 976 | Ga0501074_0500393 | 3300049590 | Bacteria | 861 |
| 977 | Ga0501074_0634529 | 3300049590 | Bacteria | 755 |
| 978 | Ga0501074_0855275 | 3300049590 | Bacteria | 640 |
| 979 | Ga0501075_0153437 | 3300049591 | Bacteria | 1756 |
| 980 | Ga0501075_0334557 | 3300049591 | Bacteria | 1154 |
| 981 | Ga0501075_1215610 | 3300049591 | Bacteria | 572 |
| 982 | Ga0501075_1242020 | 3300049591 | Bacteria | 565 |
| 983 | Ga0501076_0165934 | 3300049592 | Bacteria | 1800 |
| 984 | Ga0501077_0310518 | 3300049593 | Bacteria | 1005 |
| 985 | Ga0501077_0372447 | 3300049593 | Bacteria | 912 |
| 986 | Ga0501077_0386885 | 3300049593 | Bacteria | 894 |
| 987 | Ga0501079_0045066 | 3300049741 | Bacteria | 3404 |
| 988 | Ga0501079_0108919 | 3300049741 | Bacteria | 2151 |
| 989 | Ga0501079_0811133 | 3300049741 | Bacteria | 737 |
| 990 | Ga0501079_0937301 | 3300049741 | Bacteria | 682 |
| 991 | Ga0501079_1624177 | 3300049741 | Bacteria | 508 |
| 992 | Ga0501080_0005918 | 3300049742 | Bacteria | 10953 |
| 993 | Ga0501080_0025350 | 3300049742 | Bacteria | 5502 |
| 994 | Ga0501080_0049111 | 3300049742 | Bacteria | 3927 |
| 995 | Ga0501080_0385101 | 3300049742 | Bacteria | 1263 |
| 996 | Ga0501080_0436636 | 3300049742 | Bacteria | 1175 |
| 997 | Ga0501080_0951813 | 3300049742 | Bacteria | 746 |
| 998 | Ga0501080_1056169 | 3300049742 | Bacteria | 702 |
| 999 | Ga0501080_1217666 | 3300049742 | Bacteria | 647 |
| 1000 | Ga0501081_0298704 | 3300049743 | Bacteria | 1181 |
| 1001 | Ga0501081_0674666 | 3300049743 | Bacteria | 775 |
| 1002 | Ga0501081_1289507 | 3300049743 | Unclassified | 554 |
| 1003 | Ga0501081_1460913 | 3300049743 | Bacteria | 519 |
| 1004 | Ga0501083_0003568 | 3300049744 | Bacteria | 10904 |
| 1005 | Ga0501083_0027818 | 3300049744 | Bacteria | 3899 |
| 1006 | Ga0501083_0030644 | 3300049744 | Bacteria | 3694 |
| 1007 | Ga0501083_0045461 | 3300049744 | Bacteria | 2971 |
| 1008 | Ga0501083_0142892 | 3300049744 | Bacteria | 1567 |
| 1009 | Ga0501083_0248523 | 3300049744 | Bacteria | 1158 |
| 1010 | Ga0501083_0260533 | 3300049744 | Bacteria | 1128 |
| 1011 | Ga0501083_0484894 | 3300049744 | Bacteria | 804 |
| 1012 | Ga0501083_0773588 | 3300049744 | Bacteria | 625 |
| 1013 | Ga0501083_0845226 | 3300049744 | Bacteria | 596 |
| 1014 | Ga0501083_1010162 | 3300049744 | Bacteria | 541 |
| 1015 | Ga0501035_0001398 | 3300049822 | Bacteria | 24778 |
| 1016 | Ga0501035_0006244 | 3300049822 | Bacteria | 11206 |
| 1017 | Ga0501035_0217381 | 3300049822 | Bacteria | 1633 |
| 1018 | Ga0501035_0282585 | 3300049822 | Bacteria | 1402 |
| 1019 | Ga0501035_0945237 | 3300049822 | Bacteria | 680 |
| 1020 | Ga0501044_0000144 | 3300049823 | Bacteria | 87628 |
| 1021 | Ga0501044_0039381 | 3300049823 | Bacteria | 4931 |
| 1022 | Ga0501044_0053820 | 3300049823 | Bacteria | 4139 |
| 1023 | Ga0501044_0142628 | 3300049823 | Bacteria | 2383 |
| 1024 | Ga0501044_0143647 | 3300049823 | Bacteria | 2374 |
| 1025 | Ga0501044_0427071 | 3300049823 | Bacteria | 1235 |
| 1026 | Ga0501044_0728509 | 3300049823 | Bacteria | 875 |
| 1027 | Ga0501044_0734446 | 3300049823 | Bacteria | 870 |
| 1028 | Ga0501044_1337423 | 3300049823 | Bacteria | 582 |
| 1029 | Ga0501045_0014266 | 3300049824 | Bacteria | 5631 |
| 1030 | Ga0501045_0191157 | 3300049824 | Bacteria | 1526 |
| 1031 | nmdc:mga03683_113970_c1 | 3300050489 | Bacteria | 1198 |
| 1032 | nmdc:mga03683_136052_c1 | 3300050489 | Bacteria | 1102 |
| 1033 | nmdc:mga03n38_21471_c1 | 3300050490 | Bacteria | 2598 |
| 1034 | nmdc:mga03n38_74265_c1 | 3300050490 | Bacteria | 1581 |
| 1035 | nmdc:mga03n38_912634_c1 | 3300050490 | Bacteria | 517 |
| 1036 | nmdc:mga00v17_119937_c1 | 3300050491 | Bacteria | 1674 |
| 1037 | nmdc:mga00v17_212083_c1 | 3300050491 | Bacteria | 1253 |
| 1038 | nmdc:mga00v17_62461_c1 | 3300050491 | Bacteria | 2292 |
| 1039 | nmdc:mga00v17_862119_c1 | 3300050491 | Unclassified | 575 |
| 1040 | nmdc:mga0yw44_22649_c1 | 3300050492 | Bacteria | 3526 |
| 1041 | nmdc:mga0yw44_329362_c1 | 3300050492 | Unclassified | 1026 |
| 1042 | nmdc:mga0yw44_419147_c1 | 3300050492 | Bacteria | 906 |
| 1043 | nmdc:mga0yw44_642101_c1 | 3300050492 | Bacteria | 721 |
| 1044 | nmdc:mga0k408_18358_c1 | 3300050493 | Bacteria | 3904 |
| 1045 | nmdc:mga0k408_272184_c1 | 3300050493 | Bacteria | 572 |
| 1046 | nmdc:mga0k408_294496_c1 | 3300050493 | Bacteria | 968 |
| 1047 | nmdc:mga0k408_33376_c1 | 3300050493 | Bacteria | 2944 |
| 1048 | nmdc:mga0k408_39346_c2 | 3300050493 | Bacteria | 729 |
| 1049 | nmdc:mga06z11_115359_c1 | 3300050494 | Bacteria | 1492 |
| 1050 | nmdc:mga06z11_15335_c1 | 3300050494 | Bacteria | 3418 |
| 1051 | nmdc:mga06z11_336974_c1 | 3300050494 | Bacteria | 901 |
| 1052 | nmdc:mga06z11_356368_c1 | 3300050494 | Bacteria | 876 |
| 1053 | nmdc:mga04h51_146652_c1 | 3300050495 | Bacteria | 899 |
| 1054 | nmdc:mga07m45_166500_c1 | 3300050496 | Bacteria | 1280 |
| 1055 | nmdc:mga07m45_804514_c1 | 3300050496 | Bacteria | 539 |
| 1056 | nmdc:mga05p37_11125_c1 | 3300050507 | Bacteria | 10695 |
| 1057 | nmdc:mga05p37_1385311_c1 | 3300050507 | Bacteria | 709 |
| 1058 | nmdc:mga05p37_947858_c1 | 3300050507 | Bacteria | 921 |
| 1059 | nmdc:mga09592_34712_c1 | 3300050508 | Bacteria | 4218 |
| 1060 | nmdc:mga09592_441356_c1 | 3300050508 | Unclassified | 1123 |
| 1061 | nmdc:mga0qj67_179390_c1 | 3300050509 | Bacteria | 1720 |
| 1062 | nmdc:mga0qj67_276_c1 | 3300050509 | Bacteria | 35718 |
| 1063 | nmdc:mga0qj67_591110_c1 | 3300050509 | Unclassified | 888 |
| 1064 | nmdc:mga06r32_1575399_c1 | 3300050510 | Unclassified | 596 |
| 1065 | nmdc:mga06r32_7663_c1 | 3300050510 | Bacteria | 9710 |
| 1066 | nmdc:mga06r32_783718_c1 | 3300050510 | Bacteria | 915 |
| 1067 | nmdc:mga08y16_373765_c1 | 3300050511 | Bacteria | 1462 |
| 1068 | nmdc:mga08y16_3857_c1 | 3300050511 | Bacteria | 15589 |
| 1069 | nmdc:mga08y16_3921_c1 | 3300050511 | Bacteria | 15490 |
| 1070 | nmdc:mga08y16_4944_c1 | 3300050511 | Bacteria | 13928 |
| 1071 | nmdc:mga08y16_601643_c1 | 3300050511 | Bacteria | 1108 |
| 1072 | nmdc:mga0n895_1246330_c1 | 3300050512 | Bacteria | 716 |
| 1073 | nmdc:mga0n895_150292_c1 | 3300050512 | Bacteria | 2359 |
| 1074 | nmdc:mga0n895_183619_c1 | 3300050512 | Bacteria | 2123 |
| 1075 | nmdc:mga0n895_36674_c1 | 3300050512 | Bacteria | 4736 |
| 1076 | nmdc:mga0n895_43874_c1 | 3300050512 | Bacteria | 4360 |
| 1077 | nmdc:mga0rr50_3124_c1 | 3300050513 | Bacteria | 9465 |
| 1078 | nmdc:mga08x19_1121739_c1 | 3300050514 | Bacteria | 558 |
| 1079 | nmdc:mga08x19_38060_c1 | 3300050514 | Bacteria | 3054 |
| 1080 | nmdc:mga08x19_504912_c1 | 3300050514 | Unclassified | 854 |
| 1081 | nmdc:mga08x19_924325_c1 | 3300050514 | Unclassified | 620 |
| 1082 | nmdc:mga0a205_1633_c1 | 3300050515 | Bacteria | 19288 |
| 1083 | nmdc:mga0a205_6204_c1 | 3300050515 | Bacteria | 10789 |
| 1084 | nmdc:mga0a205_750252_c1 | 3300050515 | Bacteria | 825 |
| 1085 | nmdc:mga0sz30_51691_c1 | 3300050516 | Bacteria | 1744 |
| 1086 | nmdc:mga0sz30_66522_c1 | 3300050516 | Bacteria | 1546 |
| 1087 | nmdc:mga0sz30_77064_c1 | 3300050516 | Bacteria | 1440 |
| 1088 | Ga0495601_0000128 | 3300053077 | Bacteria | 42850 |
| 1089 | Ga0495601_0004569 | 3300053077 | Bacteria | 8005 |
| 1090 | Ga0495601_0021624 | 3300053077 | Bacteria | 3940 |
| 1091 | Ga0495601_0324568 | 3300053077 | Bacteria | 1002 |
| 1092 | Ga0495612_0002324 | 3300053078 | Bacteria | 7835 |
| 1093 | Ga0495612_0026565 | 3300053078 | Bacteria | 2326 |
| 1094 | Ga0495612_0040582 | 3300053078 | Bacteria | 1896 |
| 1095 | Ga0495612_0056227 | 3300053078 | Bacteria | 1623 |
| 1096 | Ga0500610_0076252 | 3300053079 | Bacteria | 1748 |
| 1097 | Ga0500635_0085652 | 3300053080 | Bacteria | 1139 |
| 1098 | Ga0495595_0000754 | 3300053084 | Bacteria | 12270 |
| 1099 | Ga0495595_0022079 | 3300053084 | Bacteria | 2789 |
| 1100 | Ga0495595_0042886 | 3300053084 | Bacteria | 2073 |
| 1101 | Ga0495595_0284564 | 3300053084 | Unclassified | 830 |
| 1102 | Ga0495595_0443666 | 3300053084 | Bacteria | 659 |
| 1103 | Ga0495619_0000252 | 3300053085 | Bacteria | 38976 |
| 1104 | Ga0495619_0014409 | 3300053085 | Bacteria | 4992 |
| 1105 | Ga0495619_0058073 | 3300053085 | Bacteria | 2567 |
| 1106 | Ga0495619_0209561 | 3300053085 | Bacteria | 1350 |
| 1107 | Ga0495619_0257904 | 3300053085 | Unclassified | 1208 |
| 1108 | Ga0495619_0288798 | 3300053085 | Bacteria | 1136 |
| 1109 | Ga0495619_0517880 | 3300053085 | Unclassified | 819 |
| 1110 | Ga0495619_0721079 | 3300053085 | Bacteria | 677 |
| 1111 | Ga0500643_003892 | 3300053087 | Bacteria | 6935 |
| 1112 | Ga0500644_0170246 | 3300053088 | Unclassified | 885 |
| 1113 | Ga0500646_0019777 | 3300053090 | Bacteria | 1784 |
| 1114 | Ga0500583_0173540 | 3300053092 | Bacteria | 1074 |
| 1115 | Ga0500651_0034932 | 3300053093 | Bacteria | 3169 |
| 1116 | Ga0500651_0266704 | 3300053093 | Bacteria | 991 |
| 1117 | Ga0500566_0050359 | 3300053094 | Bacteria | 2385 |
| 1118 | Ga0500566_0196625 | 3300053094 | Bacteria | 1022 |
| 1119 | Ga0500641_0037364 | 3300053096 | Bacteria | 1946 |
| 1120 | Ga0500641_0083814 | 3300053096 | Bacteria | 1355 |
| 1121 | Ga0500650_0012656 | 3300053098 | Bacteria | 3516 |
| 1122 | Ga0500562_164288 | 3300053108 | Unclassified | 604 |
| 1123 | Ga0500593_003271 | 3300053117 | Bacteria | 6098 |
| 1124 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1125 | Ga0500595_003306 | 3300053119 | Bacteria | 7587 |
| 1126 | Ga0500595_148931 | 3300053119 | Bacteria | 655 |
| 1127 | Ga0500595_170807 | 3300053119 | Bacteria | 604 |
| 1128 | Ga0500652_000068 | 3300053131 | Bacteria | 45116 |
| 1129 | Ga0500652_144470 | 3300053131 | Bacteria | 989 |
| 1130 | Ga0500652_163002 | 3300053131 | Bacteria | 920 |
| 1131 | Ga0500658_0264437 | 3300053134 | Unclassified | 791 |
| 1132 | Ga0500658_0285502 | 3300053134 | Bacteria | 759 |
| 1133 | Ga0500658_0384893 | 3300053134 | Unclassified | 643 |
| 1134 | Ga0500573_0267100 | 3300053140 | Bacteria | 873 |
| 1135 | Ga0500577_0069654 | 3300053142 | Bacteria | 1376 |
| 1136 | Ga0500604_0259502 | 3300053151 | Bacteria | 602 |
| 1137 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1138 | Ga0500616_0197263 | 3300053153 | Bacteria | 894 |
| 1139 | Ga0500633_0176670 | 3300053160 | Bacteria | 801 |
| 1140 | Ga0500639_255786 | 3300053163 | Bacteria | 697 |
| 1141 | Ga0500636_0017818 | 3300053177 | Bacteria | 4197 |
| 1142 | Ga0500645_001000 | 3300053730 | Bacteria | 15943 |
| 1143 | Ga0500645_024140 | 3300053730 | Bacteria | 1860 |
| 1144 | Ga0501084_0131328 | 3300054114 | Bacteria | 2108 |
| 1145 | Ga0501084_0324286 | 3300054114 | Bacteria | 1301 |
| 1146 | Ga0501084_0337528 | 3300054114 | Bacteria | 1273 |
| 1147 | Ga0501084_0438027 | 3300054114 | Bacteria | 1105 |
| 1148 | Ga0501084_0516132 | 3300054114 | Bacteria | 1010 |
| 1149 | Ga0501084_0523625 | 3300054114 | Bacteria | 1002 |
| 1150 | Ga0501084_0691150 | 3300054114 | Bacteria | 860 |
| 1151 | Ga0501084_1008997 | 3300054114 | Bacteria | 699 |
| 1152 | Ga0590071_129695 | 3300059421 | Bacteria | 647 |
| 1153 | Ga0501082_0000002 | 3300060353 | Bacteria | 186546 |
| 1154 | Ga0501082_0036242 | 3300060353 | Bacteria | 4250 |
| 1155 | Ga0501082_0204626 | 3300060353 | Bacteria | 1717 |
| 1156 | Ga0501082_0208295 | 3300060353 | Bacteria | 1701 |
| 1157 | Ga0501082_1731668 | 3300060353 | Bacteria | 545 |
| 1158 | Ga0466962_0234228 | 3300061719 | Bacteria | 901 |
| 1159 | Ga0530510_0186955 | 3300061734 | Bacteria | 1537 |
| 1160 | Ga0530510_0194378 | 3300061734 | Bacteria | 1506 |
| 1161 | Ga0530510_0740144 | 3300061734 | Bacteria | 750 |
| 1162 | Ga0530510_1129293 | 3300061734 | Bacteria | 601 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_0548422 | Ga0436365_0548422_281_427 | 46 |
| 2 | iso_pu_bacteria | 2643221547 | 2643758738 | 46 |
| 3 | 3300037068 | Ga0373925_0047796 | Ga0373925_0047796_58_207 | 49 |
| 4 | 2162886007 | SwRhRL2b_contig_1214090 | SwRhRL2b_0905.00003880 | 50 |
| 5 | 2209111006 | 2214544925 | 2213593515 | 50 |
| 6 | 3300000041 | ARcpr5oldR_c000010 | ARcpr5oldR_0000102 | 50 |
| 7 | 3300000042 | ARSoilYngRDRAFT_c00196 | ARSoilYngRDRAFT_001962 | 50 |
| 8 | 3300000043 | ARcpr5yngRDRAFT_c000115 | ARcpr5yngRDRAFT_00011511 | 50 |
| 9 | 3300000044 | ARSoilOldRDRAFT_c000011 | ARSoilOldRDRAFT_00001142 | 50 |
| 10 | 3300000045 | ARCol0oldRDRAFT_c01232 | ARCol0oldRDRAFT_012322 | 50 |
| 11 | 3300000652 | ARCol0yngRDRAFT_1000146 | ARCol0yngRDRAFT_100014611 | 50 |
| 12 | 3300001989 | JGI24739J22299_10259205 | JGI24739J22299_102592052 | 50 |
| 13 | 3300001990 | JGI24737J22298_10014667 | JGI24737J22298_100146673 | 50 |
| 14 | 3300002070 | JGI24750J21931_1090863 | JGI24750J21931_10908632 | 50 |
| 15 | 3300003203 | JGI25406J46586_10042133 | JGI25406J46586_100421332 | 50 |
| 16 | 3300003215 | JGI25153J46596_10076793 | JGI25153J46596_100767932 | 50 |
| 17 | 3300003349 | JGI26129J50193_1003592 | JGI26129J50193_10035922 | 50 |
| 18 | 3300003659 | JGI25404J52841_10002795 | JGI25404J52841_100027952 | 50 |
| 19 | 3300005276 | Ga0065717_1009073 | Ga0065717_10090732 | 50 |
| 20 | 3300005277 | Ga0065716_1002355 | Ga0065716_10023553 | 50 |
| 21 | 3300005289 | Ga0065704_10183801 | Ga0065704_101838012 | 50 |
| 22 | 3300005290 | Ga0065712_10002020 | Ga0065712_100020205 | 50 |
| 23 | 3300005293 | Ga0065715_10003793 | Ga0065715_100037935 | 50 |
| 24 | 3300005295 | Ga0065707_10116796 | Ga0065707_101167963 | 50 |
| 25 | 3300005295 | Ga0065707_10343487 | Ga0065707_103434872 | 50 |
| 26 | 3300005327 | Ga0070658_10847216 | Ga0070658_108472162 | 50 |
| 27 | 3300005327 | Ga0070658_11112861 | Ga0070658_111128612 | 50 |
| 28 | 3300005327 | Ga0070658_11702795 | Ga0070658_117027951 | 50 |
| 29 | 3300005328 | Ga0070676_10017457 | Ga0070676_100174573 | 50 |
| 30 | 3300005328 | Ga0070676_10063935 | Ga0070676_100639352 | 50 |
| 31 | 3300005329 | Ga0070683_100086846 | Ga0070683_1000868463 | 50 |
| 32 | 3300005329 | Ga0070683_100243897 | Ga0070683_1002438972 | 50 |
| 33 | 3300005329 | Ga0070683_101340326 | Ga0070683_1013403262 | 50 |
| 34 | 3300005330 | Ga0070690_100022382 | Ga0070690_1000223823 | 50 |
| 35 | 3300005330 | Ga0070690_100176254 | Ga0070690_1001762542 | 50 |
| 36 | 3300005330 | Ga0070690_100348198 | Ga0070690_1003481982 | 50 |
| 37 | 3300005330 | Ga0070690_100766720 | Ga0070690_1007667202 | 50 |
| 38 | 3300005331 | Ga0070670_100357373 | Ga0070670_1003573732 | 50 |
| 39 | 3300005333 | Ga0070677_10002078 | Ga0070677_100020784 | 50 |
| 40 | 3300005334 | Ga0068869_100324936 | Ga0068869_1003249362 | 50 |
| 41 | 3300005335 | Ga0070666_10445212 | Ga0070666_104452122 | 50 |
| 42 | 3300005335 | Ga0070666_10988766 | Ga0070666_109887661 | 50 |
| 43 | 3300005336 | Ga0070680_100008129 | Ga0070680_1000081295 | 50 |
| 44 | 3300005336 | Ga0070680_100021792 | Ga0070680_1000217925 | 50 |
| 45 | 3300005336 | Ga0070680_100114301 | Ga0070680_1001143012 | 50 |
| 46 | 3300005336 | Ga0070680_100392690 | Ga0070680_1003926902 | 50 |
| 47 | 3300005336 | Ga0070680_100754257 | Ga0070680_1007542572 | 50 |
| 48 | 3300005337 | Ga0070682_100159994 | Ga0070682_1001599943 | 50 |
| 49 | 3300005338 | Ga0068868_100248350 | Ga0068868_1002483502 | 50 |
| 50 | 3300005338 | Ga0068868_100548965 | Ga0068868_1005489652 | 50 |
| 51 | 3300005339 | Ga0070660_100042110 | Ga0070660_1000421102 | 50 |
| 52 | 3300005339 | Ga0070660_100561947 | Ga0070660_1005619472 | 50 |
| 53 | 3300005340 | Ga0070689_100034111 | Ga0070689_1000341112 | 50 |
| 54 | 3300005340 | Ga0070689_100124157 | Ga0070689_1001241572 | 50 |
| 55 | 3300005340 | Ga0070689_101003481 | Ga0070689_1010034812 | 50 |
| 56 | 3300005340 | Ga0070689_101343683 | Ga0070689_1013436832 | 50 |
| 57 | 3300005340 | Ga0070689_101441850 | Ga0070689_1014418502 | 50 |
| 58 | 3300005343 | Ga0070687_100002894 | Ga0070687_1000028944 | 50 |
| 59 | 3300005343 | Ga0070687_100429389 | Ga0070687_1004293891 | 50 |
| 60 | 3300005344 | Ga0070661_100333288 | Ga0070661_1003332882 | 50 |
| 61 | 3300005344 | Ga0070661_100349766 | Ga0070661_1003497662 | 50 |
| 62 | 3300005344 | Ga0070661_100740684 | Ga0070661_1007406842 | 50 |
| 63 | 3300005344 | Ga0070661_101394325 | Ga0070661_1013943251 | 50 |
| 64 | 3300005345 | Ga0070692_10032024 | Ga0070692_100320243 | 50 |
| 65 | 3300005347 | Ga0070668_100306545 | Ga0070668_1003065452 | 50 |
| 66 | 3300005353 | Ga0070669_100060274 | Ga0070669_1000602742 | 50 |
| 67 | 3300005353 | Ga0070669_100513055 | Ga0070669_1005130552 | 50 |
| 68 | 3300005354 | Ga0070675_100024911 | Ga0070675_1000249112 | 50 |
| 69 | 3300005354 | Ga0070675_100056848 | Ga0070675_1000568483 | 50 |
| 70 | 3300005354 | Ga0070675_100235788 | Ga0070675_1002357883 | 50 |
| 71 | 3300005355 | Ga0070671_100072923 | Ga0070671_1000729232 | 50 |
| 72 | 3300005355 | Ga0070671_101392630 | Ga0070671_1013926301 | 50 |
| 73 | 3300005355 | Ga0070671_101399153 | Ga0070671_1013991531 | 50 |
| 74 | 3300005356 | Ga0070674_100021304 | Ga0070674_1000213043 | 50 |
| 75 | 3300005364 | Ga0070673_100152218 | Ga0070673_1001522181 | 50 |
| 76 | 3300005364 | Ga0070673_100258603 | Ga0070673_1002586032 | 50 |
| 77 | 3300005364 | Ga0070673_100350324 | Ga0070673_1003503242 | 50 |
| 78 | 3300005365 | Ga0070688_100004335 | Ga0070688_1000043355 | 50 |
| 79 | 3300005365 | Ga0070688_100780516 | Ga0070688_1007805162 | 50 |
| 80 | 3300005365 | Ga0070688_101045932 | Ga0070688_1010459321 | 50 |
| 81 | 3300005365 | Ga0070688_101696642 | Ga0070688_1016966422 | 50 |
| 82 | 3300005366 | Ga0070659_100013250 | Ga0070659_1000132502 | 50 |
| 83 | 3300005366 | Ga0070659_101181398 | Ga0070659_1011813982 | 50 |
| 84 | 3300005366 | Ga0070659_101416066 | Ga0070659_1014160662 | 50 |
| 85 | 3300005367 | Ga0070667_100012258 | Ga0070667_1000122582 | 50 |
| 86 | 3300005367 | Ga0070667_100070526 | Ga0070667_1000705265 | 50 |
| 87 | 3300005406 | Ga0070703_10012592 | Ga0070703_100125923 | 50 |
| 88 | 3300005434 | Ga0070709_10589086 | Ga0070709_105890862 | 50 |
| 89 | 3300005434 | Ga0070709_10992065 | Ga0070709_109920652 | 50 |
| 90 | 3300005435 | Ga0070714_100033988 | Ga0070714_1000339884 | 50 |
| 91 | 3300005435 | Ga0070714_101307291 | Ga0070714_1013072912 | 50 |
| 92 | 3300005435 | Ga0070714_101955220 | Ga0070714_1019552202 | 50 |
| 93 | 3300005436 | Ga0070713_100070085 | Ga0070713_1000700852 | 50 |
| 94 | 3300005436 | Ga0070713_101616260 | Ga0070713_1016162602 | 50 |
| 95 | 3300005437 | Ga0070710_10581970 | Ga0070710_105819702 | 50 |
| 96 | 3300005438 | Ga0070701_10002296 | Ga0070701_100022965 | 50 |
| 97 | 3300005439 | Ga0070711_100031787 | Ga0070711_1000317873 | 50 |
| 98 | 3300005439 | Ga0070711_100225952 | Ga0070711_1002259522 | 50 |
| 99 | 3300005439 | Ga0070711_100323548 | Ga0070711_1003235482 | 50 |
| 100 | 3300005440 | Ga0070705_100051740 | Ga0070705_1000517403 | 50 |
| 101 | 3300005441 | Ga0070700_100016513 | Ga0070700_1000165133 | 50 |
| 102 | 3300005444 | Ga0070694_100021216 | Ga0070694_1000212163 | 50 |
| 103 | 3300005444 | Ga0070694_101881352 | Ga0070694_1018813522 | 50 |
| 104 | 3300005445 | Ga0070708_100556564 | Ga0070708_1005565641 | 50 |
| 105 | 3300005455 | Ga0070663_100042652 | Ga0070663_1000426523 | 50 |
| 106 | 3300005455 | Ga0070663_100915330 | Ga0070663_1009153302 | 50 |
| 107 | 3300005456 | Ga0070678_100059493 | Ga0070678_1000594933 | 50 |
| 108 | 3300005456 | Ga0070678_100338504 | Ga0070678_1003385042 | 50 |
| 109 | 3300005457 | Ga0070662_100021643 | Ga0070662_1000216433 | 50 |
| 110 | 3300005457 | Ga0070662_100073671 | Ga0070662_1000736712 | 50 |
| 111 | 3300005457 | Ga0070662_100499880 | Ga0070662_1004998802 | 50 |
| 112 | 3300005457 | Ga0070662_101097925 | Ga0070662_1010979252 | 50 |
| 113 | 3300005458 | Ga0070681_10034403 | Ga0070681_100344033 | 50 |
| 114 | 3300005458 | Ga0070681_10038531 | Ga0070681_100385313 | 50 |
| 115 | 3300005458 | Ga0070681_10280762 | Ga0070681_102807622 | 50 |
| 116 | 3300005458 | Ga0070681_11147386 | Ga0070681_111473862 | 50 |
| 117 | 3300005458 | Ga0070681_11304468 | Ga0070681_113044682 | 50 |
| 118 | 3300005458 | Ga0070681_11857453 | Ga0070681_118574531 | 50 |
| 119 | 3300005459 | Ga0068867_100086031 | Ga0068867_1000860313 | 50 |
| 120 | 3300005459 | Ga0068867_101301038 | Ga0068867_1013010381 | 50 |
| 121 | 3300005459 | Ga0068867_101716385 | Ga0068867_1017163852 | 50 |
| 122 | 3300005466 | Ga0070685_10074904 | Ga0070685_100749042 | 50 |
| 123 | 3300005466 | Ga0070685_10225230 | Ga0070685_102252302 | 50 |
| 124 | 3300005466 | Ga0070685_10740150 | Ga0070685_107401502 | 50 |
| 125 | 3300005467 | Ga0070706_101707530 | Ga0070706_1017075302 | 50 |
| 126 | 3300005468 | Ga0070707_100241054 | Ga0070707_1002410542 | 50 |
| 127 | 3300005471 | Ga0070698_102199578 | Ga0070698_1021995782 | 50 |
| 128 | 3300005530 | Ga0070679_100023893 | Ga0070679_1000238935 | 50 |
| 129 | 3300005530 | Ga0070679_100185779 | Ga0070679_1001857792 | 50 |
| 130 | 3300005530 | Ga0070679_100342553 | Ga0070679_1003425532 | 50 |
| 131 | 3300005530 | Ga0070679_101062693 | Ga0070679_1010626932 | 50 |
| 132 | 3300005535 | Ga0070684_100066522 | Ga0070684_1000665221 | 50 |
| 133 | 3300005535 | Ga0070684_100098652 | Ga0070684_1000986522 | 50 |
| 134 | 3300005539 | Ga0068853_100016002 | Ga0068853_1000160025 | 50 |
| 135 | 3300005539 | Ga0068853_100588724 | Ga0068853_1005887242 | 50 |
| 136 | 3300005539 | Ga0068853_101104213 | Ga0068853_1011042132 | 50 |
| 137 | 3300005539 | Ga0068853_101365465 | Ga0068853_1013654652 | 50 |
| 138 | 3300005539 | Ga0068853_101468616 | Ga0068853_1014686162 | 50 |
| 139 | 3300005539 | Ga0068853_101985081 | Ga0068853_1019850812 | 50 |
| 140 | 3300005543 | Ga0070672_100235384 | Ga0070672_1002353842 | 50 |
| 141 | 3300005543 | Ga0070672_100273427 | Ga0070672_1002734271 | 50 |
| 142 | 3300005544 | Ga0070686_100005464 | Ga0070686_1000054645 | 50 |
| 143 | 3300005544 | Ga0070686_100092484 | Ga0070686_1000924842 | 50 |
| 144 | 3300005544 | Ga0070686_100382250 | Ga0070686_1003822502 | 50 |
| 145 | 3300005545 | Ga0070695_100010952 | Ga0070695_1000109525 | 50 |
| 146 | 3300005546 | Ga0070696_100030566 | Ga0070696_1000305663 | 50 |
| 147 | 3300005546 | Ga0070696_100424080 | Ga0070696_1004240802 | 50 |
| 148 | 3300005547 | Ga0070693_100122059 | Ga0070693_1001220593 | 50 |
| 149 | 3300005548 | Ga0070665_100308742 | Ga0070665_1003087422 | 50 |
| 150 | 3300005548 | Ga0070665_100927629 | Ga0070665_1009276292 | 50 |
| 151 | 3300005549 | Ga0070704_100015476 | Ga0070704_1000154765 | 50 |
| 152 | 3300005563 | Ga0068855_100364369 | Ga0068855_1003643692 | 50 |
| 153 | 3300005563 | Ga0068855_101822000 | Ga0068855_1018220002 | 50 |
| 154 | 3300005563 | Ga0068855_102427093 | Ga0068855_1024270932 | 50 |
| 155 | 3300005564 | Ga0070664_100055807 | Ga0070664_1000558074 | 50 |
| 156 | 3300005564 | Ga0070664_100482383 | Ga0070664_1004823832 | 50 |
| 157 | 3300005577 | Ga0068857_100256916 | Ga0068857_1002569162 | 50 |
| 158 | 3300005577 | Ga0068857_100639145 | Ga0068857_1006391452 | 50 |
| 159 | 3300005577 | Ga0068857_100971006 | Ga0068857_1009710062 | 50 |
| 160 | 3300005577 | Ga0068857_101792118 | Ga0068857_1017921182 | 50 |
| 161 | 3300005577 | Ga0068857_101996283 | Ga0068857_1019962831 | 50 |
| 162 | 3300005578 | Ga0068854_101832540 | Ga0068854_1018325401 | 50 |
| 163 | 3300005578 | Ga0068854_102128939 | Ga0068854_1021289392 | 50 |
| 164 | 3300005614 | Ga0068856_100734966 | Ga0068856_1007349662 | 50 |
| 165 | 3300005614 | Ga0068856_101010213 | Ga0068856_1010102132 | 50 |
| 166 | 3300005615 | Ga0070702_100153487 | Ga0070702_1001534873 | 50 |
| 167 | 3300005615 | Ga0070702_101301647 | Ga0070702_1013016472 | 50 |
| 168 | 3300005616 | Ga0068852_100107673 | Ga0068852_1001076732 | 50 |
| 169 | 3300005617 | Ga0068859_100016485 | Ga0068859_1000164856 | 50 |
| 170 | 3300005617 | Ga0068859_100328662 | Ga0068859_1003286622 | 50 |
| 171 | 3300005618 | Ga0068864_100143861 | Ga0068864_1001438611 | 50 |
| 172 | 3300005618 | Ga0068864_101534092 | Ga0068864_1015340922 | 50 |
| 173 | 3300005618 | Ga0068864_102455977 | Ga0068864_1024559772 | 50 |
| 174 | 3300005718 | Ga0068866_10188515 | Ga0068866_101885152 | 50 |
| 175 | 3300005719 | Ga0068861_100025172 | Ga0068861_1000251722 | 50 |
| 176 | 3300005719 | Ga0068861_100242617 | Ga0068861_1002426172 | 50 |
| 177 | 3300005719 | Ga0068861_102044978 | Ga0068861_1020449782 | 50 |
| 178 | 3300005719 | Ga0068861_102240319 | Ga0068861_1022403192 | 50 |
| 179 | 3300005840 | Ga0068870_10762329 | Ga0068870_107623292 | 50 |
| 180 | 3300005841 | Ga0068863_101276898 | Ga0068863_1012768982 | 50 |
| 181 | 3300005842 | Ga0068858_100021667 | Ga0068858_1000216673 | 50 |
| 182 | 3300005842 | Ga0068858_100022184 | Ga0068858_1000221846 | 50 |
| 183 | 3300005842 | Ga0068858_102004267 | Ga0068858_1020042672 | 50 |
| 184 | 3300005843 | Ga0068860_100323614 | Ga0068860_1003236142 | 50 |
| 185 | 3300005843 | Ga0068860_101251682 | Ga0068860_1012516821 | 50 |
| 186 | 3300005843 | Ga0068860_101560943 | Ga0068860_1015609432 | 50 |
| 187 | 3300005843 | Ga0068860_102053112 | Ga0068860_1020531122 | 50 |
| 188 | 3300005844 | Ga0068862_100020703 | Ga0068862_1000207035 | 50 |
| 189 | 3300005937 | Ga0081455_10005815 | Ga0081455_100058158 | 50 |
| 190 | 3300005937 | Ga0081455_10022516 | Ga0081455_100225163 | 50 |
| 191 | 3300005981 | Ga0081538_10009018 | Ga0081538_100090186 | 50 |
| 192 | 3300005981 | Ga0081538_10101327 | Ga0081538_101013272 | 50 |
| 193 | 3300005983 | Ga0081540_1000075 | Ga0081540_100007558 | 50 |
| 194 | 3300005985 | Ga0081539_10001975 | Ga0081539_1000197514 | 50 |
| 195 | 3300005985 | Ga0081539_10047978 | Ga0081539_100479784 | 50 |
| 196 | 3300006038 | Ga0075365_10476354 | Ga0075365_104763542 | 50 |
| 197 | 3300006038 | Ga0075365_10762792 | Ga0075365_107627922 | 50 |
| 198 | 3300006038 | Ga0075365_10773087 | Ga0075365_107730872 | 50 |
| 199 | 3300006038 | Ga0075365_10773670 | Ga0075365_107736702 | 50 |
| 200 | 3300006042 | Ga0075368_10012277 | Ga0075368_100122775 | 50 |
| 201 | 3300006042 | Ga0075368_10561133 | Ga0075368_105611332 | 50 |
| 202 | 3300006042 | Ga0075368_10588371 | Ga0075368_105883712 | 50 |
| 203 | 3300006048 | Ga0075363_100005447 | Ga0075363_1000054473 | 50 |
| 204 | 3300006048 | Ga0075363_100072719 | Ga0075363_1000727192 | 50 |
| 205 | 3300006048 | Ga0075363_100601611 | Ga0075363_1006016112 | 50 |
| 206 | 3300006051 | Ga0075364_10036593 | Ga0075364_100365933 | 50 |
| 207 | 3300006058 | Ga0075432_10000577 | Ga0075432_100005772 | 50 |
| 208 | 3300006058 | Ga0075432_10117725 | Ga0075432_101177252 | 50 |
| 209 | 3300006163 | Ga0070715_10227625 | Ga0070715_102276252 | 50 |
| 210 | 3300006173 | Ga0070716_100462006 | Ga0070716_1004620062 | 50 |
| 211 | 3300006173 | Ga0070716_100549316 | Ga0070716_1005493161 | 50 |
| 212 | 3300006173 | Ga0070716_100708141 | Ga0070716_1007081412 | 50 |
| 213 | 3300006175 | Ga0070712_100189311 | Ga0070712_1001893113 | 50 |
| 214 | 3300006177 | Ga0075362_10066001 | Ga0075362_100660012 | 50 |
| 215 | 3300006177 | Ga0075362_10076370 | Ga0075362_100763702 | 50 |
| 216 | 3300006178 | Ga0075367_10207894 | Ga0075367_102078942 | 50 |
| 217 | 3300006186 | Ga0075369_10176798 | Ga0075369_101767982 | 50 |
| 218 | 3300006186 | Ga0075369_10198132 | Ga0075369_101981322 | 50 |
| 219 | 3300006195 | Ga0075366_10001029 | Ga0075366_100010297 | 50 |
| 220 | 3300006195 | Ga0075366_10036597 | Ga0075366_100365973 | 50 |
| 221 | 3300006195 | Ga0075366_10211729 | Ga0075366_102117292 | 50 |
| 222 | 3300006195 | Ga0075366_11024841 | Ga0075366_110248411 | 50 |
| 223 | 3300006237 | Ga0097621_100457846 | Ga0097621_1004578462 | 50 |
| 224 | 3300006237 | Ga0097621_100687644 | Ga0097621_1006876442 | 50 |
| 225 | 3300006353 | Ga0075370_10805019 | Ga0075370_108050191 | 50 |
| 226 | 3300006358 | Ga0068871_100041833 | Ga0068871_1000418333 | 50 |
| 227 | 3300006358 | Ga0068871_102402405 | Ga0068871_1024024052 | 50 |
| 228 | 3300006844 | Ga0075428_100006232 | Ga0075428_10000623210 | 50 |
| 229 | 3300006844 | Ga0075428_101113511 | Ga0075428_1011135112 | 50 |
| 230 | 3300006844 | Ga0075428_101539688 | Ga0075428_1015396882 | 50 |
| 231 | 3300006846 | Ga0075430_100000094 | Ga0075430_10000009412 | 50 |
| 232 | 3300006846 | Ga0075430_100638606 | Ga0075430_1006386062 | 50 |
| 233 | 3300006847 | Ga0075431_100002415 | Ga0075431_1000024156 | 50 |
| 234 | 3300006847 | Ga0075431_100132392 | Ga0075431_1001323921 | 50 |
| 235 | 3300006847 | Ga0075431_100498158 | Ga0075431_1004981582 | 50 |
| 236 | 3300006852 | Ga0075433_10000311 | Ga0075433_1000031120 | 50 |
| 237 | 3300006852 | Ga0075433_10343719 | Ga0075433_103437192 | 50 |
| 238 | 3300006852 | Ga0075433_10728426 | Ga0075433_107284262 | 50 |
| 239 | 3300006871 | Ga0075434_100000299 | Ga0075434_1000002996 | 50 |
| 240 | 3300006871 | Ga0075434_100080185 | Ga0075434_1000801853 | 50 |
| 241 | 3300006871 | Ga0075434_100114325 | Ga0075434_1001143253 | 50 |
| 242 | 3300006871 | Ga0075434_101467440 | Ga0075434_1014674402 | 50 |
| 243 | 3300006871 | Ga0075434_101709577 | Ga0075434_1017095773 | 50 |
| 244 | 3300006871 | Ga0075434_102598391 | Ga0075434_1025983912 | 50 |
| 245 | 3300006880 | Ga0075429_100001750 | Ga0075429_1000017506 | 50 |
| 246 | 3300006880 | Ga0075429_100463759 | Ga0075429_1004637592 | 50 |
| 247 | 3300006881 | Ga0068865_100079384 | Ga0068865_1000793841 | 50 |
| 248 | 3300006881 | Ga0068865_101374145 | Ga0068865_1013741452 | 50 |
| 249 | 3300006914 | Ga0075436_100530442 | Ga0075436_1005304422 | 50 |
| 250 | 3300006914 | Ga0075436_100586862 | Ga0075436_1005868621 | 50 |
| 251 | 3300006914 | Ga0075436_101262704 | Ga0075436_1012627042 | 50 |
| 252 | 3300006931 | Ga0097620_100016485 | Ga0097620_1000164856 | 50 |
| 253 | 3300006931 | Ga0097620_100328633 | Ga0097620_1003286333 | 50 |
| 254 | 3300007076 | Ga0075435_100006776 | Ga0075435_1000067763 | 50 |
| 255 | 3300009093 | Ga0105240_10318508 | Ga0105240_103185082 | 50 |
| 256 | 3300009094 | Ga0111539_10002742 | Ga0111539_1000274215 | 50 |
| 257 | 3300009094 | Ga0111539_10016215 | Ga0111539_100162157 | 50 |
| 258 | 3300009094 | Ga0111539_10625885 | Ga0111539_106258852 | 50 |
| 259 | 3300009094 | Ga0111539_10649574 | Ga0111539_106495742 | 50 |
| 260 | 3300009094 | Ga0111539_11152998 | Ga0111539_111529981 | 50 |
| 261 | 3300009098 | Ga0105245_10000837 | Ga0105245_1000083720 | 50 |
| 262 | 3300009098 | Ga0105245_10342051 | Ga0105245_103420512 | 50 |
| 263 | 3300009098 | Ga0105245_11318287 | Ga0105245_113182872 | 50 |
| 264 | 3300009098 | Ga0105245_11635564 | Ga0105245_116355642 | 50 |
| 265 | 3300009101 | Ga0105247_10163923 | Ga0105247_101639231 | 50 |
| 266 | 3300009101 | Ga0105247_11841681 | Ga0105247_118416812 | 50 |
| 267 | 3300009147 | Ga0114129_10006608 | Ga0114129_100066083 | 50 |
| 268 | 3300009147 | Ga0114129_11835118 | Ga0114129_118351181 | 50 |
| 269 | 3300009147 | Ga0114129_12425815 | Ga0114129_124258152 | 50 |
| 270 | 3300009148 | Ga0105243_10013871 | Ga0105243_100138713 | 50 |
| 271 | 3300009148 | Ga0105243_10047935 | Ga0105243_100479352 | 50 |
| 272 | 3300009148 | Ga0105243_10050222 | Ga0105243_100502224 | 50 |
| 273 | 3300009148 | Ga0105243_10234808 | Ga0105243_102348082 | 50 |
| 274 | 3300009148 | Ga0105243_11940449 | Ga0105243_119404492 | 50 |
| 275 | 3300009148 | Ga0105243_11963706 | Ga0105243_119637062 | 50 |
| 276 | 3300009176 | Ga0105242_10189931 | Ga0105242_101899313 | 50 |
| 277 | 3300009176 | Ga0105242_10192414 | Ga0105242_101924142 | 50 |
| 278 | 3300009176 | Ga0105242_10901510 | Ga0105242_109015102 | 50 |
| 279 | 3300009176 | Ga0105242_13141477 | Ga0105242_131414772 | 50 |
| 280 | 3300009177 | Ga0105248_10014747 | Ga0105248_100147479 | 50 |
| 281 | 3300009177 | Ga0105248_10531532 | Ga0105248_105315322 | 50 |
| 282 | 3300009177 | Ga0105248_10760951 | Ga0105248_107609512 | 50 |
| 283 | 3300009177 | Ga0105248_11769999 | Ga0105248_117699991 | 50 |
| 284 | 3300009545 | Ga0105237_10105666 | Ga0105237_101056662 | 50 |
| 285 | 3300009551 | Ga0105238_10027021 | Ga0105238_100270219 | 50 |
| 286 | 3300009551 | Ga0105238_10092667 | Ga0105238_100926672 | 50 |
| 287 | 3300009551 | Ga0105238_10279234 | Ga0105238_102792342 | 50 |
| 288 | 3300009551 | Ga0105238_12704342 | Ga0105238_127043422 | 50 |
| 289 | 3300009553 | Ga0105249_10012767 | Ga0105249_100127675 | 50 |
| 290 | 3300009553 | Ga0105249_10079208 | Ga0105249_100792085 | 50 |
| 291 | 3300009553 | Ga0105249_10467482 | Ga0105249_104674821 | 50 |
| 292 | 3300009553 | Ga0105249_12236427 | Ga0105249_122364272 | 50 |
| 293 | 3300010375 | Ga0105239_10063436 | Ga0105239_100634364 | 50 |
| 294 | 3300011119 | Ga0105246_10105187 | Ga0105246_101051873 | 50 |
| 295 | 3300011119 | Ga0105246_10326236 | Ga0105246_103262362 | 50 |
| 296 | 3300011119 | Ga0105246_11672389 | Ga0105246_116723892 | 50 |
| 297 | 3300012481 | Ga0157320_1027432 | Ga0157320_10274322 | 50 |
| 298 | 3300012482 | Ga0157318_1001371 | Ga0157318_10013712 | 50 |
| 299 | 3300012488 | Ga0157343_1000283 | Ga0157343_10002832 | 50 |
| 300 | 3300012497 | Ga0157319_1024999 | Ga0157319_10249991 | 50 |
| 301 | 3300012500 | Ga0157314_1007673 | Ga0157314_10076732 | 50 |
| 302 | 3300013100 | Ga0157373_11207809 | Ga0157373_112078092 | 50 |
| 303 | 3300013104 | Ga0157370_10326121 | Ga0157370_103261212 | 50 |
| 304 | 3300013104 | Ga0157370_10448039 | Ga0157370_104480392 | 50 |
| 305 | 3300013104 | Ga0157370_10505031 | Ga0157370_105050311 | 50 |
| 306 | 3300013105 | Ga0157369_10337612 | Ga0157369_103376122 | 50 |
| 307 | 3300013296 | Ga0157374_10192064 | Ga0157374_101920643 | 50 |
| 308 | 3300013297 | Ga0157378_10381387 | Ga0157378_103813873 | 50 |
| 309 | 3300013297 | Ga0157378_10492968 | Ga0157378_104929682 | 50 |
| 310 | 3300013297 | Ga0157378_10554333 | Ga0157378_105543332 | 50 |
| 311 | 3300013306 | Ga0163162_10024488 | Ga0163162_100244884 | 50 |
| 312 | 3300013306 | Ga0163162_12258430 | Ga0163162_122584302 | 50 |
| 313 | 3300013306 | Ga0163162_13040374 | Ga0163162_130403741 | 50 |
| 314 | 3300013306 | Ga0163162_13209038 | Ga0163162_132090382 | 50 |
| 315 | 3300013306 | Ga0163162_13401461 | Ga0163162_134014612 | 50 |
| 316 | 3300013308 | Ga0157375_10745746 | Ga0157375_107457461 | 50 |
| 317 | 3300014325 | Ga0163163_10329236 | Ga0163163_103292363 | 50 |
| 318 | 3300014325 | Ga0163163_11432966 | Ga0163163_114329662 | 50 |
| 319 | 3300014325 | Ga0163163_12731329 | Ga0163163_127313292 | 50 |
| 320 | 3300014326 | Ga0157380_10102648 | Ga0157380_101026482 | 50 |
| 321 | 3300014326 | Ga0157380_10363305 | Ga0157380_103633053 | 50 |
| 322 | 3300014326 | Ga0157380_10453399 | Ga0157380_104533992 | 50 |
| 323 | 3300014326 | Ga0157380_11316599 | Ga0157380_113165993 | 50 |
| 324 | 3300014326 | Ga0157380_11382406 | Ga0157380_113824061 | 50 |
| 325 | 3300014326 | Ga0157380_12264480 | Ga0157380_122644802 | 50 |
| 326 | 3300014326 | Ga0157380_13157472 | Ga0157380_131574722 | 50 |
| 327 | 3300014497 | Ga0182008_10268819 | Ga0182008_102688192 | 50 |
| 328 | 3300014745 | Ga0157377_10065171 | Ga0157377_100651712 | 50 |
| 329 | 3300014745 | Ga0157377_10491884 | Ga0157377_104918842 | 50 |
| 330 | 3300014745 | Ga0157377_11521481 | Ga0157377_115214812 | 50 |
| 331 | 3300014968 | Ga0157379_12248064 | Ga0157379_122480641 | 50 |
| 332 | 3300014968 | Ga0157379_12317276 | Ga0157379_123172761 | 50 |
| 333 | 3300014969 | Ga0157376_10340392 | Ga0157376_103403922 | 50 |
| 334 | 3300015261 | Ga0182006_1135221 | Ga0182006_11352212 | 50 |
| 335 | 3300015265 | Ga0182005_1163733 | Ga0182005_11637331 | 50 |
| 336 | 3300017792 | Ga0163161_10445901 | Ga0163161_104459012 | 50 |
| 337 | 3300017792 | Ga0163161_11899805 | Ga0163161_118998052 | 50 |
| 338 | 3300021384 | Ga0213876_10054333 | Ga0213876_100543332 | 50 |
| 339 | 3300025271 | Ga0207666_1019663 | Ga0207666_10196632 | 50 |
| 340 | 3300025297 | Ga0209758_1000798 | Ga0209758_100079811 | 50 |
| 341 | 3300025297 | Ga0209758_1180940 | Ga0209758_11809402 | 50 |
| 342 | 3300025302 | Ga0207426_1042818 | Ga0207426_10428182 | 50 |
| 343 | 3300025315 | Ga0207697_10003830 | Ga0207697_100038305 | 50 |
| 344 | 3300025885 | Ga0207653_10026551 | Ga0207653_100265512 | 50 |
| 345 | 3300025893 | Ga0207682_10006252 | Ga0207682_100062526 | 50 |
| 346 | 3300025898 | Ga0207692_10004680 | Ga0207692_100046805 | 50 |
| 347 | 3300025898 | Ga0207692_10381151 | Ga0207692_103811512 | 50 |
| 348 | 3300025899 | Ga0207642_10317492 | Ga0207642_103174922 | 50 |
| 349 | 3300025899 | Ga0207642_10469141 | Ga0207642_104691411 | 50 |
| 350 | 3300025900 | Ga0207710_10046897 | Ga0207710_100468973 | 50 |
| 351 | 3300025901 | Ga0207688_10025803 | Ga0207688_100258033 | 50 |
| 352 | 3300025901 | Ga0207688_10214346 | Ga0207688_102143462 | 50 |
| 353 | 3300025903 | Ga0207680_10284043 | Ga0207680_102840431 | 50 |
| 354 | 3300025903 | Ga0207680_10532843 | Ga0207680_105328432 | 50 |
| 355 | 3300025903 | Ga0207680_10540781 | Ga0207680_105407812 | 50 |
| 356 | 3300025904 | Ga0207647_10048235 | Ga0207647_100482352 | 50 |
| 357 | 3300025906 | Ga0207699_10348899 | Ga0207699_103488992 | 50 |
| 358 | 3300025906 | Ga0207699_10498340 | Ga0207699_104983402 | 50 |
| 359 | 3300025906 | Ga0207699_10841626 | Ga0207699_108416262 | 50 |
| 360 | 3300025907 | Ga0207645_10015866 | Ga0207645_100158663 | 50 |
| 361 | 3300025907 | Ga0207645_10296887 | Ga0207645_102968871 | 50 |
| 362 | 3300025908 | Ga0207643_10152148 | Ga0207643_101521483 | 50 |
| 363 | 3300025908 | Ga0207643_10386112 | Ga0207643_103861122 | 50 |
| 364 | 3300025909 | Ga0207705_10979514 | Ga0207705_109795142 | 50 |
| 365 | 3300025909 | Ga0207705_11428421 | Ga0207705_114284212 | 50 |
| 366 | 3300025910 | Ga0207684_11449145 | Ga0207684_114491452 | 50 |
| 367 | 3300025912 | Ga0207707_10145572 | Ga0207707_101455723 | 50 |
| 368 | 3300025912 | Ga0207707_10682271 | Ga0207707_106822712 | 50 |
| 369 | 3300025913 | Ga0207695_10676283 | Ga0207695_106762832 | 50 |
| 370 | 3300025914 | Ga0207671_10012740 | Ga0207671_100127403 | 50 |
| 371 | 3300025915 | Ga0207693_10013335 | Ga0207693_100133356 | 50 |
| 372 | 3300025915 | Ga0207693_10205875 | Ga0207693_102058751 | 50 |
| 373 | 3300025916 | Ga0207663_10010773 | Ga0207663_100107736 | 50 |
| 374 | 3300025916 | Ga0207663_10151907 | Ga0207663_101519072 | 50 |
| 375 | 3300025917 | Ga0207660_10037682 | Ga0207660_100376823 | 50 |
| 376 | 3300025917 | Ga0207660_10070303 | Ga0207660_100703033 | 50 |
| 377 | 3300025917 | Ga0207660_11530847 | Ga0207660_115308472 | 50 |
| 378 | 3300025918 | Ga0207662_10004510 | Ga0207662_100045105 | 50 |
| 379 | 3300025918 | Ga0207662_10536520 | Ga0207662_105365201 | 50 |
| 380 | 3300025919 | Ga0207657_10037566 | Ga0207657_100375663 | 50 |
| 381 | 3300025919 | Ga0207657_10065282 | Ga0207657_100652823 | 50 |
| 382 | 3300025919 | Ga0207657_10476574 | Ga0207657_104765742 | 50 |
| 383 | 3300025920 | Ga0207649_10327908 | Ga0207649_103279082 | 50 |
| 384 | 3300025920 | Ga0207649_10745954 | Ga0207649_107459542 | 50 |
| 385 | 3300025921 | Ga0207652_10195406 | Ga0207652_101954062 | 50 |
| 386 | 3300025921 | Ga0207652_10335270 | Ga0207652_103352702 | 50 |
| 387 | 3300025921 | Ga0207652_10732886 | Ga0207652_107328862 | 50 |
| 388 | 3300025921 | Ga0207652_11068783 | Ga0207652_110687832 | 50 |
| 389 | 3300025923 | Ga0207681_10355019 | Ga0207681_103550191 | 50 |
| 390 | 3300025923 | Ga0207681_10920390 | Ga0207681_109203902 | 50 |
| 391 | 3300025924 | Ga0207694_10046790 | Ga0207694_100467905 | 50 |
| 392 | 3300025924 | Ga0207694_10173001 | Ga0207694_101730012 | 50 |
| 393 | 3300025925 | Ga0207650_10181060 | Ga0207650_101810602 | 50 |
| 394 | 3300025925 | Ga0207650_10290673 | Ga0207650_102906732 | 50 |
| 395 | 3300025926 | Ga0207659_10313053 | Ga0207659_103130532 | 50 |
| 396 | 3300025926 | Ga0207659_11161378 | Ga0207659_111613782 | 50 |
| 397 | 3300025926 | Ga0207659_11259377 | Ga0207659_112593772 | 50 |
| 398 | 3300025927 | Ga0207687_10038274 | Ga0207687_100382744 | 50 |
| 399 | 3300025927 | Ga0207687_10489703 | Ga0207687_104897032 | 50 |
| 400 | 3300025928 | Ga0207700_10380428 | Ga0207700_103804282 | 50 |
| 401 | 3300025929 | Ga0207664_10069426 | Ga0207664_100694264 | 50 |
| 402 | 3300025931 | Ga0207644_10211681 | Ga0207644_102116812 | 50 |
| 403 | 3300025931 | Ga0207644_10661445 | Ga0207644_106614452 | 50 |
| 404 | 3300025931 | Ga0207644_11215047 | Ga0207644_112150471 | 50 |
| 405 | 3300025932 | Ga0207690_10066347 | Ga0207690_100663473 | 50 |
| 406 | 3300025932 | Ga0207690_11001808 | Ga0207690_110018082 | 50 |
| 407 | 3300025933 | Ga0207706_10023449 | Ga0207706_100234492 | 50 |
| 408 | 3300025933 | Ga0207706_10027637 | Ga0207706_100276373 | 50 |
| 409 | 3300025933 | Ga0207706_10054087 | Ga0207706_100540874 | 50 |
| 410 | 3300025933 | Ga0207706_10169749 | Ga0207706_101697492 | 50 |
| 411 | 3300025934 | Ga0207686_10038012 | Ga0207686_100380122 | 50 |
| 412 | 3300025934 | Ga0207686_10444914 | Ga0207686_104449142 | 50 |
| 413 | 3300025935 | Ga0207709_10007235 | Ga0207709_100072357 | 50 |
| 414 | 3300025935 | Ga0207709_10007780 | Ga0207709_100077803 | 50 |
| 415 | 3300025935 | Ga0207709_10247735 | Ga0207709_102477353 | 50 |
| 416 | 3300025935 | Ga0207709_10375518 | Ga0207709_103755182 | 50 |
| 417 | 3300025936 | Ga0207670_10014485 | Ga0207670_100144855 | 50 |
| 418 | 3300025936 | Ga0207670_10161141 | Ga0207670_101611412 | 50 |
| 419 | 3300025936 | Ga0207670_11174328 | Ga0207670_111743282 | 50 |
| 420 | 3300025936 | Ga0207670_11479209 | Ga0207670_114792092 | 50 |
| 421 | 3300025937 | Ga0207669_10018985 | Ga0207669_100189852 | 50 |
| 422 | 3300025937 | Ga0207669_11414722 | Ga0207669_114147222 | 50 |
| 423 | 3300025938 | Ga0207704_10086909 | Ga0207704_100869092 | 50 |
| 424 | 3300025938 | Ga0207704_10885122 | Ga0207704_108851222 | 50 |
| 425 | 3300025939 | Ga0207665_10431019 | Ga0207665_104310192 | 50 |
| 426 | 3300025940 | Ga0207691_10000720 | Ga0207691_1000072027 | 50 |
| 427 | 3300025941 | Ga0207711_10071442 | Ga0207711_100714425 | 50 |
| 428 | 3300025941 | Ga0207711_11397676 | Ga0207711_113976762 | 50 |
| 429 | 3300025942 | Ga0207689_10381238 | Ga0207689_103812381 | 50 |
| 430 | 3300025942 | Ga0207689_11108087 | Ga0207689_111080872 | 50 |
| 431 | 3300025944 | Ga0207661_10088130 | Ga0207661_100881303 | 50 |
| 432 | 3300025944 | Ga0207661_10103086 | Ga0207661_101030863 | 50 |
| 433 | 3300025944 | Ga0207661_10916790 | Ga0207661_109167902 | 50 |
| 434 | 3300025945 | Ga0207679_10052691 | Ga0207679_100526913 | 50 |
| 435 | 3300025945 | Ga0207679_10219002 | Ga0207679_102190023 | 50 |
| 436 | 3300025945 | Ga0207679_10337273 | Ga0207679_103372732 | 50 |
| 437 | 3300025945 | Ga0207679_10523583 | Ga0207679_105235832 | 50 |
| 438 | 3300025945 | Ga0207679_11259111 | Ga0207679_112591112 | 50 |
| 439 | 3300025949 | Ga0207667_10278870 | Ga0207667_102788701 | 50 |
| 440 | 3300025949 | Ga0207667_11830837 | Ga0207667_118308372 | 50 |
| 441 | 3300025960 | Ga0207651_10025997 | Ga0207651_100259973 | 50 |
| 442 | 3300025960 | Ga0207651_10103103 | Ga0207651_101031032 | 50 |
| 443 | 3300025960 | Ga0207651_11656253 | Ga0207651_116562532 | 50 |
| 444 | 3300025961 | Ga0207712_10599892 | Ga0207712_105998923 | 50 |
| 445 | 3300025972 | Ga0207668_10220124 | Ga0207668_102201242 | 50 |
| 446 | 3300025981 | Ga0207640_11288579 | Ga0207640_112885792 | 50 |
| 447 | 3300025986 | Ga0207658_10595139 | Ga0207658_105951392 | 50 |
| 448 | 3300025986 | Ga0207658_10753879 | Ga0207658_107538792 | 50 |
| 449 | 3300026023 | Ga0207677_10264896 | Ga0207677_102648962 | 50 |
| 450 | 3300026023 | Ga0207677_10858222 | Ga0207677_108582222 | 50 |
| 451 | 3300026023 | Ga0207677_10863729 | Ga0207677_108637292 | 50 |
| 452 | 3300026023 | Ga0207677_11239392 | Ga0207677_112393921 | 50 |
| 453 | 3300026035 | Ga0207703_10077193 | Ga0207703_100771933 | 50 |
| 454 | 3300026035 | Ga0207703_10232594 | Ga0207703_102325943 | 50 |
| 455 | 3300026041 | Ga0207639_10032263 | Ga0207639_100322631 | 50 |
| 456 | 3300026041 | Ga0207639_10604342 | Ga0207639_106043422 | 50 |
| 457 | 3300026041 | Ga0207639_11170148 | Ga0207639_111701482 | 50 |
| 458 | 3300026067 | Ga0207678_10366266 | Ga0207678_103662662 | 50 |
| 459 | 3300026067 | Ga0207678_11078533 | Ga0207678_110785331 | 50 |
| 460 | 3300026067 | Ga0207678_11504327 | Ga0207678_115043272 | 50 |
| 461 | 3300026075 | Ga0207708_10012300 | Ga0207708_100123008 | 50 |
| 462 | 3300026075 | Ga0207708_10435030 | Ga0207708_104350302 | 50 |
| 463 | 3300026075 | Ga0207708_11321268 | Ga0207708_113212682 | 50 |
| 464 | 3300026075 | Ga0207708_11628343 | Ga0207708_116283431 | 50 |
| 465 | 3300026088 | Ga0207641_10145346 | Ga0207641_101453463 | 50 |
| 466 | 3300026088 | Ga0207641_10336421 | Ga0207641_103364212 | 50 |
| 467 | 3300026088 | Ga0207641_10747251 | Ga0207641_107472512 | 50 |
| 468 | 3300026089 | Ga0207648_10023107 | Ga0207648_100231072 | 50 |
| 469 | 3300026089 | Ga0207648_10122011 | Ga0207648_101220113 | 50 |
| 470 | 3300026089 | Ga0207648_11267791 | Ga0207648_112677912 | 50 |
| 471 | 3300026095 | Ga0207676_10176079 | Ga0207676_101760791 | 50 |
| 472 | 3300026095 | Ga0207676_10374266 | Ga0207676_103742662 | 50 |
| 473 | 3300026095 | Ga0207676_10545721 | Ga0207676_105457211 | 50 |
| 474 | 3300026116 | Ga0207674_10180058 | Ga0207674_101800583 | 50 |
| 475 | 3300026116 | Ga0207674_10381897 | Ga0207674_103818972 | 50 |
| 476 | 3300026116 | Ga0207674_11754504 | Ga0207674_117545041 | 50 |
| 477 | 3300026118 | Ga0207675_100012891 | Ga0207675_1000128916 | 50 |
| 478 | 3300026118 | Ga0207675_100220277 | Ga0207675_1002202773 | 50 |
| 479 | 3300026118 | Ga0207675_100512641 | Ga0207675_1005126412 | 50 |
| 480 | 3300026118 | Ga0207675_100533597 | Ga0207675_1005335972 | 50 |
| 481 | 3300026118 | Ga0207675_101748477 | Ga0207675_1017484772 | 50 |
| 482 | 3300026118 | Ga0207675_102302017 | Ga0207675_1023020172 | 50 |
| 483 | 3300026121 | Ga0207683_10021228 | Ga0207683_100212286 | 50 |
| 484 | 3300026142 | Ga0207698_10176364 | Ga0207698_101763642 | 50 |
| 485 | 3300026142 | Ga0207698_10226587 | Ga0207698_102265872 | 50 |
| 486 | 3300027682 | Ga0209971_1075032 | Ga0209971_10750322 | 50 |
| 487 | 3300027695 | Ga0209966_1000765 | Ga0209966_10007655 | 50 |
| 488 | 3300027717 | Ga0209998_10001832 | Ga0209998_100018325 | 50 |
| 489 | 3300027866 | Ga0209813_10112120 | Ga0209813_101121202 | 50 |
| 490 | 3300027876 | Ga0209974_10009008 | Ga0209974_100090082 | 50 |
| 491 | 3300027907 | Ga0207428_10000626 | Ga0207428_1000062612 | 50 |
| 492 | 3300028379 | Ga0268266_10457774 | Ga0268266_104577742 | 50 |
| 493 | 3300028379 | Ga0268266_10508637 | Ga0268266_105086372 | 50 |
| 494 | 3300028379 | Ga0268266_10903907 | Ga0268266_109039072 | 50 |
| 495 | 3300028379 | Ga0268266_11129297 | Ga0268266_111292972 | 50 |
| 496 | 3300028380 | Ga0268265_10068531 | Ga0268265_100685312 | 50 |
| 497 | 3300028380 | Ga0268265_12583363 | Ga0268265_125833631 | 50 |
| 498 | 3300028381 | Ga0268264_10134107 | Ga0268264_101341071 | 50 |
| 499 | 3300028381 | Ga0268264_10583484 | Ga0268264_105834841 | 50 |
| 500 | 3300028556 | Ga0265337_1001215 | Ga0265337_100121510 | 50 |
| 501 | 3300028800 | Ga0265338_10056921 | Ga0265338_100569213 | 50 |
| 502 | 3300028800 | Ga0265338_10400752 | Ga0265338_104007522 | 50 |
| 503 | 3300029957 | Ga0265324_10163841 | Ga0265324_101638412 | 50 |
| 504 | 3300031235 | Ga0265330_10064148 | Ga0265330_100641482 | 50 |
| 505 | 3300031235 | Ga0265330_10490772 | Ga0265330_104907722 | 50 |
| 506 | 3300031241 | Ga0265325_10002862 | Ga0265325_100028627 | 50 |
| 507 | 3300031241 | Ga0265325_10043453 | Ga0265325_100434533 | 50 |
| 508 | 3300031241 | Ga0265325_10084258 | Ga0265325_100842582 | 50 |
| 509 | 3300031241 | Ga0265325_10372151 | Ga0265325_103721512 | 50 |
| 510 | 3300031242 | Ga0265329_10031927 | Ga0265329_100319272 | 50 |
| 511 | 3300031247 | Ga0265340_10023153 | Ga0265340_100231532 | 50 |
| 512 | 3300031247 | Ga0265340_10031944 | Ga0265340_100319443 | 50 |
| 513 | 3300031247 | Ga0265340_10035170 | Ga0265340_100351702 | 50 |
| 514 | 3300031247 | Ga0265340_10228324 | Ga0265340_102283242 | 50 |
| 515 | 3300031247 | Ga0265340_10339852 | Ga0265340_103398521 | 50 |
| 516 | 3300031247 | Ga0265340_10491399 | Ga0265340_104913992 | 50 |
| 517 | 3300031249 | Ga0265339_10463770 | Ga0265339_104637702 | 50 |
| 518 | 3300031344 | Ga0265316_10038361 | Ga0265316_100383613 | 50 |
| 519 | 3300031344 | Ga0265316_10058161 | Ga0265316_100581613 | 50 |
| 520 | 3300031344 | Ga0265316_10242658 | Ga0265316_102426582 | 50 |
| 521 | 3300031456 | Ga0307513_10097427 | Ga0307513_100974274 | 50 |
| 522 | 3300031456 | Ga0307513_10158733 | Ga0307513_101587333 | 50 |
| 523 | 3300031548 | Ga0307408_101897712 | Ga0307408_1018977122 | 50 |
| 524 | 3300031595 | Ga0265313_10015939 | Ga0265313_100159395 | 50 |
| 525 | 3300031711 | Ga0265314_10000439 | Ga0265314_100004392 | 50 |
| 526 | 3300031711 | Ga0265314_10006193 | Ga0265314_100061938 | 50 |
| 527 | 3300031711 | Ga0265314_10549595 | Ga0265314_105495952 | 50 |
| 528 | 3300031712 | Ga0265342_10073571 | Ga0265342_100735712 | 50 |
| 529 | 3300031712 | Ga0265342_10103288 | Ga0265342_101032882 | 50 |
| 530 | 3300031731 | Ga0307405_11610809 | Ga0307405_116108091 | 50 |
| 531 | 3300031889 | Ga0326468_10004264 | Ga0326468_100042641 | 50 |
| 532 | 3300031901 | Ga0307406_11535796 | Ga0307406_115357962 | 50 |
| 533 | 3300032005 | Ga0307411_11587491 | Ga0307411_115874912 | 50 |
| 534 | 3300032005 | Ga0307411_11839705 | Ga0307411_118397052 | 50 |
| 535 | 3300034816 | Ga0373930_0001573 | Ga0373930_0001573_2413_2565 | 50 |
| 536 | 3300034816 | Ga0373930_0153446 | Ga0373930_0153446_359_517 | 50 |
| 537 | 3300034817 | Ga0373948_0007324 | Ga0373948_0007324_721_873 | 50 |
| 538 | 3300034818 | Ga0373950_0001736 | Ga0373950_0001736_1857_2009 | 50 |
| 539 | 3300034818 | Ga0373950_0011444 | Ga0373950_0011444_827_979 | 50 |
| 540 | 3300034819 | Ga0373958_0000026 | Ga0373958_0000026_3538_3690 | 50 |
| 541 | 3300034820 | Ga0373959_0000446 | Ga0373959_0000446_30_182 | 50 |
| 542 | 3300034957 | Ga0373938_0000337 | Ga0373938_0000337_875_1027 | 50 |
| 543 | 3300035083 | Ga0373926_0026336 | Ga0373926_0026336_1532_1684 | 50 |
| 544 | 3300035083 | Ga0373926_0123542 | Ga0373926_0123542_335_487 | 50 |
| 545 | 3300035083 | Ga0373926_0274714 | Ga0373926_0274714_144_296 | 50 |
| 546 | 3300035084 | Ga0373928_0000487 | Ga0373928_0000487_3675_3827 | 50 |
| 547 | 3300035084 | Ga0373928_0000532 | Ga0373928_0000532_3587_3739 | 50 |
| 548 | 3300035085 | Ga0373929_0000110 | Ga0373929_0000110_1531_1683 | 50 |
| 549 | 3300035085 | Ga0373929_0059002 | Ga0373929_0059002_278_430 | 50 |
| 550 | 3300035086 | Ga0373934_0145045 | Ga0373934_0145045_477_629 | 50 |
| 551 | 3300035088 | Ga0373940_0000116 | Ga0373940_0000116_7087_7239 | 50 |
| 552 | 3300035089 | Ga0373944_0135993 | Ga0373944_0135993_123_275 | 50 |
| 553 | 3300035089 | Ga0373944_0294123 | Ga0373944_0294123_70_222 | 50 |
| 554 | 3300035090 | Ga0373949_0001975 | Ga0373949_0001975_3352_3504 | 50 |
| 555 | 3300035091 | Ga0373951_0000638 | Ga0373951_0000638_7808_7960 | 50 |
| 556 | 3300035091 | Ga0373951_0014347 | Ga0373951_0014347_1066_1218 | 50 |
| 557 | 3300035092 | Ga0373952_0001416 | Ga0373952_0001416_3606_3758 | 50 |
| 558 | 3300035092 | Ga0373952_0029826 | Ga0373952_0029826_703_855 | 50 |
| 559 | 3300035111 | Ga0373923_0002974 | Ga0373923_0002974_456_608 | 50 |
| 560 | 3300035111 | Ga0373923_0133212 | Ga0373923_0133212_362_514 | 50 |
| 561 | 3300035112 | Ga0373932_0004843 | Ga0373932_0004843_2116_2268 | 50 |
| 562 | 3300035113 | Ga0373936_0007985 | Ga0373936_0007985_723_875 | 50 |
| 563 | 3300035113 | Ga0373936_0016239 | Ga0373936_0016239_1556_1708 | 50 |
| 564 | 3300035113 | Ga0373936_0022976 | Ga0373936_0022976_2058_2216 | 50 |
| 565 | 3300035113 | Ga0373936_0399512 | Ga0373936_0399512_256_408 | 50 |
| 566 | 3300035114 | Ga0373939_0011346 | Ga0373939_0011346_1233_1385 | 50 |
| 567 | 3300035114 | Ga0373939_0262975 | Ga0373939_0262975_313_471 | 50 |
| 568 | 3300035115 | Ga0373941_0000177 | Ga0373941_0000177_6721_6873 | 50 |
| 569 | 3300035115 | Ga0373941_0052696 | Ga0373941_0052696_990_1142 | 50 |
| 570 | 3300035115 | Ga0373941_0465608 | Ga0373941_0465608_239_394 | 50 |
| 571 | 3300035116 | Ga0373945_0013190 | Ga0373945_0013190_1337_1489 | 50 |
| 572 | 3300035116 | Ga0373945_0080896 | Ga0373945_0080896_529_681 | 50 |
| 573 | 3300035116 | Ga0373945_0112441 | Ga0373945_0112441_668_820 | 50 |
| 574 | 3300035117 | Ga0373953_0004119 | Ga0373953_0004119_3313_3465 | 50 |
| 575 | 3300035117 | Ga0373953_0035605 | Ga0373953_0035605_671_823 | 50 |
| 576 | 3300035118 | Ga0373954_0037704 | Ga0373954_0037704_1665_1817 | 50 |
| 577 | 3300035118 | Ga0373954_0074757 | Ga0373954_0074757_1071_1223 | 50 |
| 578 | 3300035118 | Ga0373954_0101210 | Ga0373954_0101210_669_821 | 50 |
| 579 | 3300035118 | Ga0373954_0207498 | Ga0373954_0207498_228_386 | 50 |
| 580 | 3300035118 | Ga0373954_0265227 | Ga0373954_0265227_163_315 | 50 |
| 581 | 3300035119 | Ga0373956_0011159 | Ga0373956_0011159_599_751 | 50 |
| 582 | 3300035119 | Ga0373956_0047253 | Ga0373956_0047253_1032_1184 | 50 |
| 583 | 3300035119 | Ga0373956_0093600 | Ga0373956_0093600_486_638 | 50 |
| 584 | 3300035119 | Ga0373956_0182312 | Ga0373956_0182312_411_563 | 50 |
| 585 | 3300035119 | Ga0373956_0298529 | Ga0373956_0298529_175_327 | 50 |
| 586 | 3300035120 | Ga0373957_0004295 | Ga0373957_0004295_4117_4269 | 50 |
| 587 | 3300035120 | Ga0373957_0018552 | Ga0373957_0018552_543_695 | 50 |
| 588 | 3300035120 | Ga0373957_0230343 | Ga0373957_0230343_24_176 | 50 |
| 589 | 3300035120 | Ga0373957_0252678 | Ga0373957_0252678_215_370 | 50 |
| 590 | 3300035121 | Ga0373960_0003980 | Ga0373960_0003980_1985_2137 | 50 |
| 591 | 3300035170 | Ga0373943_0004455 | Ga0373943_0004455_1168_1320 | 50 |
| 592 | 3300035170 | Ga0373943_0095454 | Ga0373943_0095454_1041_1193 | 50 |
| 593 | 3300035170 | Ga0373943_0496996 | Ga0373943_0496996_383_535 | 50 |
| 594 | 3300035171 | Ga0373946_0007076 | Ga0373946_0007076_2154_2306 | 50 |
| 595 | 3300035171 | Ga0373946_0012082 | Ga0373946_0012082_913_1065 | 50 |
| 596 | 3300035172 | Ga0373955_0000509 | Ga0373955_0000509_11352_11504 | 50 |
| 597 | 3300035172 | Ga0373955_0007958 | Ga0373955_0007958_3840_3992 | 50 |
| 598 | 3300035172 | Ga0373955_0008788 | Ga0373955_0008788_1764_1916 | 50 |
| 599 | 3300035172 | Ga0373955_0040130 | Ga0373955_0040130_1827_1979 | 50 |
| 600 | 3300035172 | Ga0373955_0295497 | Ga0373955_0295497_34_189 | 50 |
| 601 | 3300035207 | Ga0373942_0002386 | Ga0373942_0002386_738_890 | 50 |
| 602 | 3300035207 | Ga0373942_0028123 | Ga0373942_0028123_60_212 | 50 |
| 603 | 3300035207 | Ga0373942_0090969 | Ga0373942_0090969_320_472 | 50 |
| 604 | 3300035207 | Ga0373942_0197046 | Ga0373942_0197046_55_210 | 50 |
| 605 | 3300035241 | Ga0373961_0001126 | Ga0373961_0001126_3808_3960 | 50 |
| 606 | 3300035242 | Ga0373962_0009256 | Ga0373962_0009256_2065_2217 | 50 |
| 607 | 3300035242 | Ga0373962_0010843 | Ga0373962_0010843_453_605 | 50 |
| 608 | 3300035410 | Ga0373924_0010900 | Ga0373924_0010900_2808_2960 | 50 |
| 609 | 3300035410 | Ga0373924_0016524 | Ga0373924_0016524_894_1046 | 50 |
| 610 | 3300035410 | Ga0373924_0018675 | Ga0373924_0018675_1116_1274 | 50 |
| 611 | 3300035410 | Ga0373924_0163200 | Ga0373924_0163200_592_744 | 50 |
| 612 | 3300035691 | Ga0373931_0021710 | Ga0373931_0021710_2375_2527 | 50 |
| 613 | 3300035692 | Ga0373935_0024574 | Ga0373935_0024574_3341_3493 | 50 |
| 614 | 3300035692 | Ga0373935_0697246 | Ga0373935_0697246_253_405 | 50 |
| 615 | 3300035692 | Ga0373935_1178271 | Ga0373935_1178271_29_181 | 50 |
| 616 | 3300035695 | Ga0373927_0021223 | Ga0373927_0021223_3029_3181 | 50 |
| 617 | 3300035695 | Ga0373927_0196561 | Ga0373927_0196561_594_746 | 50 |
| 618 | 3300035695 | Ga0373927_0847915 | Ga0373927_0847915_422_580 | 50 |
| 619 | 3300035724 | Ga0373933_0001541 | Ga0373933_0001541_3917_4069 | 50 |
| 620 | 3300035724 | Ga0373933_0043969 | Ga0373933_0043969_675_827 | 50 |
| 621 | 3300035724 | Ga0373933_0305040 | Ga0373933_0305040_56_211 | 50 |
| 622 | 3300035724 | Ga0373933_0343979 | Ga0373933_0343979_742_894 | 50 |
| 623 | 3300035724 | Ga0373933_0983754 | Ga0373933_0983754_282_440 | 50 |
| 624 | 3300035724 | Ga0373933_1101789 | Ga0373933_1101789_162_314 | 50 |
| 625 | 3300035725 | Ga0373947_0017782 | Ga0373947_0017782_3310_3468 | 50 |
| 626 | 3300035725 | Ga0373947_0252500 | Ga0373947_0252500_581_733 | 50 |
| 627 | 3300035725 | Ga0373947_0347804 | Ga0373947_0347804_378_530 | 50 |
| 628 | 3300035725 | Ga0373947_0492468 | Ga0373947_0492468_241_393 | 50 |
| 629 | 3300036401 | Ga0373937_0006385 | Ga0373937_0006385_3537_3689 | 50 |
| 630 | 3300036401 | Ga0373937_0130085 | Ga0373937_0130085_309_461 | 50 |
| 631 | 3300036401 | Ga0373937_0158313 | Ga0373937_0158313_421_573 | 50 |
| 632 | 3300036401 | Ga0373937_0236309 | Ga0373937_0236309_423_578 | 50 |
| 633 | 3300036401 | Ga0373937_0237316 | Ga0373937_0237316_633_785 | 50 |
| 634 | 3300036401 | Ga0373937_0611734 | Ga0373937_0611734_506_664 | 50 |
| 635 | 3300036401 | Ga0373937_0642406 | Ga0373937_0642406_360_512 | 50 |
| 636 | 3300036401 | Ga0373937_0865207 | Ga0373937_0865207_440_592 | 50 |
| 637 | 3300036401 | Ga0373937_1050266 | Ga0373937_1050266_556_708 | 50 |
| 638 | 3300037068 | Ga0373925_0001273 | Ga0373925_0001273_8765_8917 | 50 |
| 639 | 3300037068 | Ga0373925_0105184 | Ga0373925_0105184_855_1007 | 50 |
| 640 | 3300037068 | Ga0373925_0242647 | Ga0373925_0242647_1147_1305 | 50 |
| 641 | 3300038698 | Ga0242419_020650 | Ga0242419_020650_298_450 | 50 |
| 642 | 3300038996 | Ga0242420_000887 | Ga0242420_000887_354_506 | 50 |
| 643 | 3300039437 | Ga0436365_0169472 | Ga0436365_0169472_1091_1255 | 50 |
| 644 | 3300039437 | Ga0436365_1076647 | Ga0436365_1076647_93_248 | 50 |
| 645 | 3300039437 | Ga0436365_1298767 | Ga0436365_1298767_98_250 | 50 |
| 646 | 3300041408 | Ga0439453_0000106 | Ga0439453_0000106_2358_2516 | 50 |
| 647 | 3300041452 | Ga0451793_0093313 | Ga0451793_0093313_13_171 | 50 |
| 648 | 3300041486 | Ga0451807_1006014 | Ga0451807_1006014_155_313 | 50 |
| 649 | 3300041501 | Ga0451845_0439394 | Ga0451845_0439394_226_384 | 50 |
| 650 | 3300041511 | Ga0451855_1205704 | Ga0451855_1205704_254_412 | 50 |
| 651 | 3300042000 | Ga0439437_055629 | Ga0439437_055629_214_366 | 50 |
| 652 | 3300042001 | Ga0439441_063145 | Ga0439441_063145_36_188 | 50 |
| 653 | 3300042001 | Ga0439441_111744 | Ga0439441_111744_311_469 | 50 |
| 654 | 3300042003 | Ga0439443_020032 | Ga0439443_020032_97_255 | 50 |
| 655 | 3300042008 | Ga0439450_023182 | Ga0439450_023182_709_861 | 50 |
| 656 | 3300042012 | Ga0439455_0082629 | Ga0439455_0082629_585_737 | 50 |
| 657 | 3300042016 | Ga0439463_122214 | Ga0439463_122214_202_354 | 50 |
| 658 | 3300042118 | Ga0450914_057810 | Ga0450914_057810_96_248 | 50 |
| 659 | 3300042145 | Ga0450906_083918 | Ga0450906_083918_182_340 | 50 |
| 660 | 3300042184 | Ga0450908_043822 | Ga0450908_043822_495_653 | 50 |
| 661 | 3300042436 | Ga0439435_0000370 | Ga0439435_0000370_4153_4311 | 50 |
| 662 | 3300042436 | Ga0439435_0232470 | Ga0439435_0232470_69_221 | 50 |
| 663 | 3300042437 | Ga0439444_0042475 | Ga0439444_0042475_567_719 | 50 |
| 664 | 3300042438 | Ga0439459_0119527 | Ga0439459_0119527_314_472 | 50 |
| 665 | 3300042439 | Ga0439464_0010042 | Ga0439464_0010042_1469_1621 | 50 |
| 666 | 3300042461 | Ga0439460_0068356 | Ga0439460_0068356_171_323 | 50 |
| 667 | 3300042461 | Ga0439460_0100815 | Ga0439460_0100815_689_847 | 50 |
| 668 | 3300042876 | Ga0451577_0042439 | Ga0451577_0042439_3559_3711 | 50 |
| 669 | 3300042993 | Ga0439440_0023527 | Ga0439440_0023527_631_789 | 50 |
| 670 | 3300042993 | Ga0439440_0079560 | Ga0439440_0079560_468_620 | 50 |
| 671 | 3300044673 | Ga0453683_0236175 | Ga0453683_0236175_699_851 | 50 |
| 672 | 3300044684 | Ga0466966_0080184 | Ga0466966_0080184_1419_1571 | 50 |
| 673 | 3300044684 | Ga0466966_0928577 | Ga0466966_0928577_79_237 | 50 |
| 674 | 3300044693 | Ga0466961_0164926 | Ga0466961_0164926_353_505 | 50 |
| 675 | 3300044694 | Ga0466963_0191670 | Ga0466963_0191670_991_1143 | 50 |
| 676 | 3300044694 | Ga0466963_0533340 | Ga0466963_0533340_635_787 | 50 |
| 677 | 3300044712 | Ga0453684_0057645 | Ga0453684_0057645_668_820 | 50 |
| 678 | 3300044712 | Ga0453684_1926619 | Ga0453684_1926619_218_373 | 50 |
| 679 | 3300044719 | Ga0466971_0141346 | Ga0466971_0141346_109_261 | 50 |
| 680 | 3300044719 | Ga0466971_0395370 | Ga0466971_0395370_319_471 | 50 |
| 681 | 3300044842 | Ga0466957_0329076 | Ga0466957_0329076_845_997 | 50 |
| 682 | 3300044842 | Ga0466957_1348258 | Ga0466957_1348258_331_483 | 50 |
| 683 | 3300044901 | Ga0466960_0544725 | Ga0466960_0544725_269_421 | 50 |
| 684 | 3300044901 | Ga0466960_0946467 | Ga0466960_0946467_285_443 | 50 |
| 685 | 3300045049 | Ga0466959_0472214 | Ga0466959_0472214_405_557 | 50 |
| 686 | 3300045051 | Ga0451576_0087001 | Ga0451576_0087001_2806_2958 | 50 |
| 687 | 3300045836 | Ga0466958_0201370 | Ga0466958_0201370_619_771 | 50 |
| 688 | 3300045836 | Ga0466958_0336726 | Ga0466958_0336726_316_468 | 50 |
| 689 | 3300045976 | Ga0466967_0149240 | Ga0466967_0149240_441_593 | 50 |
| 690 | 3300045976 | Ga0466967_0216103 | Ga0466967_0216103_272_424 | 50 |
| 691 | 3300045976 | Ga0466967_0786880 | Ga0466967_0786880_151_303 | 50 |
| 692 | 3300046454 | Ga0495592_0023347 | Ga0495592_0023347_1540_1692 | 50 |
| 693 | 3300046454 | Ga0495592_0086679 | Ga0495592_0086679_754_906 | 50 |
| 694 | 3300046454 | Ga0495592_0385201 | Ga0495592_0385201_419_571 | 50 |
| 695 | 3300046455 | Ga0495603_0018201 | Ga0495603_0018201_209_361 | 50 |
| 696 | 3300046455 | Ga0495603_0065563 | Ga0495603_0065563_1030_1182 | 50 |
| 697 | 3300046457 | Ga0495590_0153664 | Ga0495590_0153664_554_706 | 50 |
| 698 | 3300046459 | Ga0495629_0792342 | Ga0495629_0792342_161_319 | 50 |
| 699 | 3300046460 | Ga0495638_0028464 | Ga0495638_0028464_985_1143 | 50 |
| 700 | 3300046461 | Ga0495641_0014894 | Ga0495641_0014894_817_969 | 50 |
| 701 | 3300046461 | Ga0495641_0158608 | Ga0495641_0158608_152_304 | 50 |
| 702 | 3300046462 | Ga0495651_0024840 | Ga0495651_0024840_4289_4441 | 50 |
| 703 | 3300046462 | Ga0495651_0027684 | Ga0495651_0027684_1905_2057 | 50 |
| 704 | 3300046462 | Ga0495651_0028851 | Ga0495651_0028851_3064_3216 | 50 |
| 705 | 3300046462 | Ga0495651_0206341 | Ga0495651_0206341_1055_1207 | 50 |
| 706 | 3300046462 | Ga0495651_0423628 | Ga0495651_0423628_511_663 | 50 |
| 707 | 3300046462 | Ga0495651_0463609 | Ga0495651_0463609_487_645 | 50 |
| 708 | 3300046463 | Ga0495653_0118639 | Ga0495653_0118639_1235_1387 | 50 |
| 709 | 3300046463 | Ga0495653_0127576 | Ga0495653_0127576_47_199 | 50 |
| 710 | 3300046463 | Ga0495653_0194059 | Ga0495653_0194059_1120_1272 | 50 |
| 711 | 3300046463 | Ga0495653_0287572 | Ga0495653_0287572_836_994 | 50 |
| 712 | 3300046472 | Ga0495580_0983689 | Ga0495580_0983689_333_485 | 50 |
| 713 | 3300046473 | Ga0495582_0049796 | Ga0495582_0049796_1471_1623 | 50 |
| 714 | 3300046473 | Ga0495582_0076771 | Ga0495582_0076771_690_842 | 50 |
| 715 | 3300046474 | Ga0495605_0488129 | Ga0495605_0488129_284_436 | 50 |
| 716 | 3300046475 | Ga0495639_0004864 | Ga0495639_0004864_3352_3504 | 50 |
| 717 | 3300046475 | Ga0495639_0103744 | Ga0495639_0103744_815_967 | 50 |
| 718 | 3300046476 | Ga0495662_0011898 | Ga0495662_0011898_3401_3553 | 50 |
| 719 | 3300046476 | Ga0495662_0125968 | Ga0495662_0125968_634_786 | 50 |
| 720 | 3300046477 | Ga0495664_0002672 | Ga0495664_0002672_2190_2342 | 50 |
| 721 | 3300046477 | Ga0495664_0006545 | Ga0495664_0006545_5931_6083 | 50 |
| 722 | 3300046477 | Ga0495664_0035617 | Ga0495664_0035617_468_620 | 50 |
| 723 | 3300046477 | Ga0495664_0343334 | Ga0495664_0343334_424_576 | 50 |
| 724 | 3300046477 | Ga0495664_0696686 | Ga0495664_0696686_365_523 | 50 |
| 725 | 3300046499 | Ga0495594_0026904 | Ga0495594_0026904_470_622 | 50 |
| 726 | 3300046501 | Ga0495607_0010006 | Ga0495607_0010006_2633_2785 | 50 |
| 727 | 3300046511 | Ga0495608_0000557 | Ga0495608_0000557_22515_22667 | 50 |
| 728 | 3300046511 | Ga0495608_0015588 | Ga0495608_0015588_1682_1834 | 50 |
| 729 | 3300046511 | Ga0495608_0028419 | Ga0495608_0028419_2313_2465 | 50 |
| 730 | 3300046511 | Ga0495608_0164099 | Ga0495608_0164099_1107_1259 | 50 |
| 731 | 3300046513 | Ga0495616_0426090 | Ga0495616_0426090_326_484 | 50 |
| 732 | 3300046514 | Ga0495618_0393534 | Ga0495618_0393534_333_485 | 50 |
| 733 | 3300046514 | Ga0495618_0405482 | Ga0495618_0405482_144_296 | 50 |
| 734 | 3300046515 | Ga0495620_0074315 | Ga0495620_0074315_67_225 | 50 |
| 735 | 3300046516 | Ga0495628_0001465 | Ga0495628_0001465_18096_18248 | 50 |
| 736 | 3300046516 | Ga0495628_0037692 | Ga0495628_0037692_948_1100 | 50 |
| 737 | 3300046516 | Ga0495628_0928444 | Ga0495628_0928444_161_313 | 50 |
| 738 | 3300046517 | Ga0495630_0441245 | Ga0495630_0441245_209_361 | 50 |
| 739 | 3300046517 | Ga0495630_0463588 | Ga0495630_0463588_57_215 | 50 |
| 740 | 3300046522 | Ga0495643_0127748 | Ga0495643_0127748_453_611 | 50 |
| 741 | 3300046523 | Ga0495644_0380952 | Ga0495644_0380952_371_523 | 50 |
| 742 | 3300046526 | Ga0495666_0033133 | Ga0495666_0033133_2353_2505 | 50 |
| 743 | 3300046526 | Ga0495666_0033310 | Ga0495666_0033310_722_874 | 50 |
| 744 | 3300046529 | Ga0495652_0002359 | Ga0495652_0002359_16149_16301 | 50 |
| 745 | 3300046529 | Ga0495652_0053207 | Ga0495652_0053207_1393_1545 | 50 |
| 746 | 3300046529 | Ga0495652_0188561 | Ga0495652_0188561_1036_1188 | 50 |
| 747 | 3300046529 | Ga0495652_1025771 | Ga0495652_1025771_123_281 | 50 |
| 748 | 3300046531 | Ga0495665_0067398 | Ga0495665_0067398_630_782 | 50 |
| 749 | 3300046531 | Ga0495665_0069847 | Ga0495665_0069847_914_1066 | 50 |
| 750 | 3300046531 | Ga0495665_0520799 | Ga0495665_0520799_366_524 | 50 |
| 751 | 3300046533 | Ga0495640_0131267 | Ga0495640_0131267_792_944 | 50 |
| 752 | 3300046533 | Ga0495640_0201292 | Ga0495640_0201292_897_1049 | 50 |
| 753 | 3300046533 | Ga0495640_0297700 | Ga0495640_0297700_332_484 | 50 |
| 754 | 3300046533 | Ga0495640_0570189 | Ga0495640_0570189_111_269 | 50 |
| 755 | 3300046535 | Ga0495586_0034869 | Ga0495586_0034869_909_1061 | 50 |
| 756 | 3300046535 | Ga0495586_0244719 | Ga0495586_0244719_222_380 | 50 |
| 757 | 3300046536 | Ga0495587_0031834 | Ga0495587_0031834_2455_2607 | 50 |
| 758 | 3300046536 | Ga0495587_0245789 | Ga0495587_0245789_710_862 | 50 |
| 759 | 3300046536 | Ga0495587_0771954 | Ga0495587_0771954_306_458 | 50 |
| 760 | 3300046537 | Ga0495598_0004138 | Ga0495598_0004138_1849_2007 | 50 |
| 761 | 3300046538 | Ga0495609_0170486 | Ga0495609_0170486_18_170 | 50 |
| 762 | 3300046539 | Ga0495621_0048691 | Ga0495621_0048691_954_1112 | 50 |
| 763 | 3300046543 | Ga0495645_0002006 | Ga0495645_0002006_3133_3285 | 50 |
| 764 | 3300046543 | Ga0495645_0035666 | Ga0495645_0035666_2480_2632 | 50 |
| 765 | 3300046557 | Ga0495622_0169368 | Ga0495622_0169368_625_777 | 50 |
| 766 | 3300046557 | Ga0495622_0446356 | Ga0495622_0446356_157_309 | 50 |
| 767 | 3300046558 | Ga0495633_0002198 | Ga0495633_0002198_9285_9437 | 50 |
| 768 | 3300046559 | Ga0495667_0002889 | Ga0495667_0002889_3366_3518 | 50 |
| 769 | 3300046559 | Ga0495667_0015972 | Ga0495667_0015972_1055_1207 | 50 |
| 770 | 3300046559 | Ga0495667_0041062 | Ga0495667_0041062_38_190 | 50 |
| 771 | 3300046559 | Ga0495667_0415458 | Ga0495667_0415458_463_621 | 50 |
| 772 | 3300046642 | Ga0495634_0167244 | Ga0495634_0167244_950_1102 | 50 |
| 773 | 3300046642 | Ga0495634_0247000 | Ga0495634_0247000_489_647 | 50 |
| 774 | 3300046642 | Ga0495634_0334238 | Ga0495634_0334238_343_501 | 50 |
| 775 | 3300046642 | Ga0495634_0619076 | Ga0495634_0619076_298_450 | 50 |
| 776 | 3300046648 | Ga0495611_0003383 | Ga0495611_0003383_1315_1467 | 50 |
| 777 | 3300046648 | Ga0495611_0572628 | Ga0495611_0572628_24_176 | 50 |
| 778 | 3300046660 | Ga0495625_0817033 | Ga0495625_0817033_82_234 | 50 |
| 779 | 3300046663 | Ga0495635_0003603 | Ga0495635_0003603_5167_5319 | 50 |
| 780 | 3300046663 | Ga0495635_0061445 | Ga0495635_0061445_1263_1415 | 50 |
| 781 | 3300046663 | Ga0495635_0149588 | Ga0495635_0149588_240_392 | 50 |
| 782 | 3300046663 | Ga0495635_0498040 | Ga0495635_0498040_427_579 | 50 |
| 783 | 3300046665 | Ga0495661_0067702 | Ga0495661_0067702_631_783 | 50 |
| 784 | 3300046674 | Ga0495588_0009109 | Ga0495588_0009109_3668_3820 | 50 |
| 785 | 3300046674 | Ga0495588_0372213 | Ga0495588_0372213_343_495 | 50 |
| 786 | 3300046675 | Ga0495657_0020739 | Ga0495657_0020739_2215_2367 | 50 |
| 787 | 3300046675 | Ga0495657_0023491 | Ga0495657_0023491_3022_3174 | 50 |
| 788 | 3300046675 | Ga0495657_0654207 | Ga0495657_0654207_247_405 | 50 |
| 789 | 3300046678 | Ga0495599_0004135 | Ga0495599_0004135_6597_6749 | 50 |
| 790 | 3300046678 | Ga0495599_0005971 | Ga0495599_0005971_3218_3370 | 50 |
| 791 | 3300046679 | Ga0495623_0413858 | Ga0495623_0413858_499_651 | 50 |
| 792 | 3300046680 | Ga0495646_0020139 | Ga0495646_0020139_1045_1197 | 50 |
| 793 | 3300046680 | Ga0495646_0053496 | Ga0495646_0053496_2153_2305 | 50 |
| 794 | 3300046681 | Ga0495647_0003659 | Ga0495647_0003659_665_817 | 50 |
| 795 | 3300046681 | Ga0495647_0031914 | Ga0495647_0031914_1189_1341 | 50 |
| 796 | 3300046681 | Ga0495647_0507716 | Ga0495647_0507716_69_221 | 50 |
| 797 | 3300046683 | Ga0495658_0007904 | Ga0495658_0007904_4713_4865 | 50 |
| 798 | 3300046683 | Ga0495658_0012613 | Ga0495658_0012613_3413_3565 | 50 |
| 799 | 3300046683 | Ga0495658_0151377 | Ga0495658_0151377_888_1046 | 50 |
| 800 | 3300046684 | Ga0495669_0552341 | Ga0495669_0552341_137_289 | 50 |
| 801 | 3300046689 | Ga0495613_0079381 | Ga0495613_0079381_783_935 | 50 |
| 802 | 3300046689 | Ga0495613_0557627 | Ga0495613_0557627_166_324 | 50 |
| 803 | 3300046689 | Ga0495613_0677271 | Ga0495613_0677271_125_277 | 50 |
| 804 | 3300046690 | Ga0495624_0102522 | Ga0495624_0102522_1087_1239 | 50 |
| 805 | 3300046691 | Ga0495670_0000870 | Ga0495670_0000870_2743_2895 | 50 |
| 806 | 3300046691 | Ga0495670_0314893 | Ga0495670_0314893_327_485 | 50 |
| 807 | 3300046809 | Ga0495600_0002049 | Ga0495600_0002049_11109_11261 | 50 |
| 808 | 3300046809 | Ga0495600_0069850 | Ga0495600_0069850_239_391 | 50 |
| 809 | 3300046809 | Ga0495600_0260938 | Ga0495600_0260938_649_801 | 50 |
| 810 | 3300046809 | Ga0495600_0408600 | Ga0495600_0408600_622_774 | 50 |
| 811 | 3300047315 | Ga0495581_0048792 | Ga0495581_0048792_879_1031 | 50 |
| 812 | 3300047315 | Ga0495581_0058530 | Ga0495581_0058530_296_448 | 50 |
| 813 | 3300047315 | Ga0495581_0345605 | Ga0495581_0345605_629_781 | 50 |
| 814 | 3300047317 | Ga0495604_0010650 | Ga0495604_0010650_6120_6272 | 50 |
| 815 | 3300047317 | Ga0495604_0052471 | Ga0495604_0052471_2127_2279 | 50 |
| 816 | 3300047319 | Ga0495674_0011272 | Ga0495674_0011272_1837_1989 | 50 |
| 817 | 3300047319 | Ga0495674_0035712 | Ga0495674_0035712_1111_1263 | 50 |
| 818 | 3300047319 | Ga0495674_0042925 | Ga0495674_0042925_1889_2041 | 50 |
| 819 | 3300047319 | Ga0495674_0186903 | Ga0495674_0186903_304_462 | 50 |
| 820 | 3300047321 | Ga0495676_0278352 | Ga0495676_0278352_750_902 | 50 |
| 821 | 3300047321 | Ga0495676_0581090 | Ga0495676_0581090_169_321 | 50 |
| 822 | 3300047321 | Ga0495676_1106675 | Ga0495676_1106675_70_228 | 50 |
| 823 | 3300047322 | Ga0495680_0005770 | Ga0495680_0005770_5330_5482 | 50 |
| 824 | 3300047322 | Ga0495680_0014947 | Ga0495680_0014947_1098_1250 | 50 |
| 825 | 3300047322 | Ga0495680_0020201 | Ga0495680_0020201_2227_2379 | 50 |
| 826 | 3300047322 | Ga0495680_0309648 | Ga0495680_0309648_378_530 | 50 |
| 827 | 3300047322 | Ga0495680_0355282 | Ga0495680_0355282_125_277 | 50 |
| 828 | 3300047322 | Ga0495680_0956366 | Ga0495680_0956366_95_247 | 50 |
| 829 | 3300047444 | Ga0495675_0000740 | Ga0495675_0000740_19207_19359 | 50 |
| 830 | 3300047444 | Ga0495675_0082688 | Ga0495675_0082688_119_271 | 50 |
| 831 | 3300047444 | Ga0495675_0217902 | Ga0495675_0217902_580_732 | 50 |
| 832 | 3300047444 | Ga0495675_0284711 | Ga0495675_0284711_103_255 | 50 |
| 833 | 3300047445 | Ga0495677_0248898 | Ga0495677_0248898_100_258 | 50 |
| 834 | 3300047447 | Ga0495685_115550 | Ga0495685_115550_289_447 | 50 |
| 835 | 3300047447 | Ga0495685_224657 | Ga0495685_224657_292_450 | 50 |
| 836 | 3300047471 | Ga0495684_0068395 | Ga0495684_0068395_1156_1308 | 50 |
| 837 | 3300047471 | Ga0495684_0290792 | Ga0495684_0290792_655_807 | 50 |
| 838 | 3300047472 | Ga0495686_0284600 | Ga0495686_0284600_477_635 | 50 |
| 839 | 3300047673 | Ga0495593_0419159 | Ga0495593_0419159_306_458 | 50 |
| 840 | 3300048088 | Ga0495602_0002218 | Ga0495602_0002218_1727_1879 | 50 |
| 841 | 3300048088 | Ga0495602_0013696 | Ga0495602_0013696_1363_1515 | 50 |
| 842 | 3300048088 | Ga0495602_0037475 | Ga0495602_0037475_297_449 | 50 |
| 843 | 3300048088 | Ga0495602_0063070 | Ga0495602_0063070_426_584 | 50 |
| 844 | 3300048088 | Ga0495602_0150527 | Ga0495602_0150527_1475_1627 | 50 |
| 845 | 3300048089 | Ga0495614_0048355 | Ga0495614_0048355_1299_1451 | 50 |
| 846 | 3300048089 | Ga0495614_0259467 | Ga0495614_0259467_255_407 | 50 |
| 847 | 3300048090 | Ga0495615_0059894 | Ga0495615_0059894_834_992 | 50 |
| 848 | 3300048903 | Ga0496100_0189818 | Ga0496100_0189818_1194_1352 | 50 |
| 849 | 3300048904 | Ga0496101_0001349 | Ga0496101_0001349_868_1020 | 50 |
| 850 | 3300048904 | Ga0496101_0059537 | Ga0496101_0059537_1005_1157 | 50 |
| 851 | 3300048905 | Ga0496102_0002354 | Ga0496102_0002354_868_1020 | 50 |
| 852 | 3300048905 | Ga0496102_0017521 | Ga0496102_0017521_2458_2610 | 50 |
| 853 | 3300048906 | Ga0496103_0048757 | Ga0496103_0048757_63_215 | 50 |
| 854 | 3300048907 | Ga0496104_0000126 | Ga0496104_0000126_33178_33330 | 50 |
| 855 | 3300048907 | Ga0496104_0065771 | Ga0496104_0065771_2073_2225 | 50 |
| 856 | 3300048907 | Ga0496104_0253403 | Ga0496104_0253403_1430_1582 | 50 |
| 857 | 3300048908 | Ga0496105_0000117 | Ga0496105_0000117_26195_26347 | 50 |
| 858 | 3300048909 | Ga0496106_0000557 | Ga0496106_0000557_21880_22032 | 50 |
| 859 | 3300048909 | Ga0496106_0047156 | Ga0496106_0047156_767_919 | 50 |
| 860 | 3300048909 | Ga0496106_0052745 | Ga0496106_0052745_1707_1859 | 50 |
| 861 | 3300048910 | Ga0496107_0019064 | Ga0496107_0019064_19_171 | 50 |
| 862 | 3300048910 | Ga0496107_0019668 | Ga0496107_0019668_1396_1548 | 50 |
| 863 | 3300048911 | Ga0496108_0037745 | Ga0496108_0037745_2929_3081 | 50 |
| 864 | 3300048912 | Ga0496109_0004864 | Ga0496109_0004864_9562_9714 | 50 |
| 865 | 3300048912 | Ga0496109_0038200 | Ga0496109_0038200_2408_2560 | 50 |
| 866 | 3300048913 | Ga0496110_0054572 | Ga0496110_0054572_1084_1236 | 50 |
| 867 | 3300048914 | Ga0496111_0096583 | Ga0496111_0096583_1025_1177 | 50 |
| 868 | 3300048915 | Ga0496112_0086388 | Ga0496112_0086388_122_274 | 50 |
| 869 | 3300048915 | Ga0496112_0217980 | Ga0496112_0217980_388_540 | 50 |
| 870 | 3300048915 | Ga0496112_0724967 | Ga0496112_0724967_353_505 | 50 |
| 871 | 3300048915 | Ga0496112_0976941 | Ga0496112_0976941_411_569 | 50 |
| 872 | 3300048915 | Ga0496112_1646631 | Ga0496112_1646631_99_251 | 50 |
| 873 | 3300048916 | Ga0496113_0015747 | Ga0496113_0015747_1349_1501 | 50 |
| 874 | 3300048916 | Ga0496113_0252736 | Ga0496113_0252736_872_1024 | 50 |
| 875 | 3300048916 | Ga0496113_0969549 | Ga0496113_0969549_91_249 | 50 |
| 876 | 3300048917 | Ga0496114_0072327 | Ga0496114_0072327_1303_1455 | 50 |
| 877 | 3300048917 | Ga0496114_0345346 | Ga0496114_0345346_450_602 | 50 |
| 878 | 3300048918 | Ga0496115_0018679 | Ga0496115_0018679_928_1086 | 50 |
| 879 | 3300048918 | Ga0496115_0036386 | Ga0496115_0036386_382_534 | 50 |
| 880 | 3300048918 | Ga0496115_0245055 | Ga0496115_0245055_771_923 | 50 |
| 881 | 3300048918 | Ga0496115_0508590 | Ga0496115_0508590_755_907 | 50 |
| 882 | 3300048918 | Ga0496115_0543685 | Ga0496115_0543685_554_706 | 50 |
| 883 | 3300048924 | Ga0496121_0751335 | Ga0496121_0751335_160_312 | 50 |
| 884 | 3300048929 | Ga0496126_0131972 | Ga0496126_0131972_1370_1522 | 50 |
| 885 | 3300048929 | Ga0496126_0647370 | Ga0496126_0647370_272_424 | 50 |
| 886 | 3300049568 | Ga0501031_0006160 | Ga0501031_0006160_4478_4636 | 50 |
| 887 | 3300049568 | Ga0501031_0113961 | Ga0501031_0113961_957_1109 | 50 |
| 888 | 3300049568 | Ga0501031_0913327 | Ga0501031_0913327_253_411 | 50 |
| 889 | 3300049568 | Ga0501031_0929218 | Ga0501031_0929218_209_364 | 50 |
| 890 | 3300049569 | Ga0501032_0002502 | Ga0501032_0002502_5118_5276 | 50 |
| 891 | 3300049570 | Ga0501033_0026683 | Ga0501033_0026683_1291_1449 | 50 |
| 892 | 3300049570 | Ga0501033_0228381 | Ga0501033_0228381_506_658 | 50 |
| 893 | 3300049570 | Ga0501033_0276787 | Ga0501033_0276787_286_441 | 50 |
| 894 | 3300049571 | Ga0501034_0023206 | Ga0501034_0023206_2897_3055 | 50 |
| 895 | 3300049571 | Ga0501034_0046159 | Ga0501034_0046159_2684_2836 | 50 |
| 896 | 3300049571 | Ga0501034_0088744 | Ga0501034_0088744_283_438 | 50 |
| 897 | 3300049571 | Ga0501034_0163432 | Ga0501034_0163432_189_353 | 50 |
| 898 | 3300049571 | Ga0501034_0192227 | Ga0501034_0192227_439_594 | 50 |
| 899 | 3300049571 | Ga0501034_0293709 | Ga0501034_0293709_836_994 | 50 |
| 900 | 3300049571 | Ga0501034_0600209 | Ga0501034_0600209_267_422 | 50 |
| 901 | 3300049571 | Ga0501034_0616819 | Ga0501034_0616819_605_757 | 50 |
| 902 | 3300049571 | Ga0501034_0627646 | Ga0501034_0627646_728_886 | 50 |
| 903 | 3300049571 | Ga0501034_0919986 | Ga0501034_0919986_590_742 | 50 |
| 904 | 3300049571 | Ga0501034_1214588 | Ga0501034_1214588_195_353 | 50 |
| 905 | 3300049571 | Ga0501034_1357579 | Ga0501034_1357579_241_396 | 50 |
| 906 | 3300049572 | Ga0501036_0012785 | Ga0501036_0012785_3466_3624 | 50 |
| 907 | 3300049572 | Ga0501036_0119528 | Ga0501036_0119528_1108_1263 | 50 |
| 908 | 3300049572 | Ga0501036_0273997 | Ga0501036_0273997_58_213 | 50 |
| 909 | 3300049572 | Ga0501036_0334881 | Ga0501036_0334881_527_685 | 50 |
| 910 | 3300049573 | Ga0501037_0007235 | Ga0501037_0007235_6533_6691 | 50 |
| 911 | 3300049573 | Ga0501037_0010967 | Ga0501037_0010967_5667_5822 | 50 |
| 912 | 3300049573 | Ga0501037_0131872 | Ga0501037_0131872_308_463 | 50 |
| 913 | 3300049573 | Ga0501037_0856328 | Ga0501037_0856328_91_243 | 50 |
| 914 | 3300049574 | Ga0501038_0004064 | Ga0501038_0004064_2897_3055 | 50 |
| 915 | 3300049574 | Ga0501038_0082157 | Ga0501038_0082157_2148_2303 | 50 |
| 916 | 3300049574 | Ga0501038_0085007 | Ga0501038_0085007_188_343 | 50 |
| 917 | 3300049574 | Ga0501038_0125210 | Ga0501038_0125210_1521_1679 | 50 |
| 918 | 3300049575 | Ga0501039_0015100 | Ga0501039_0015100_5039_5197 | 50 |
| 919 | 3300049575 | Ga0501039_0238558 | Ga0501039_0238558_756_914 | 50 |
| 920 | 3300049575 | Ga0501039_0388010 | Ga0501039_0388010_526_678 | 50 |
| 921 | 3300049575 | Ga0501039_1434623 | Ga0501039_1434623_61_216 | 50 |
| 922 | 3300049575 | Ga0501039_1516249 | Ga0501039_1516249_18_173 | 50 |
| 923 | 3300049576 | Ga0501040_0317674 | Ga0501040_0317674_226_384 | 50 |
| 924 | 3300049576 | Ga0501040_1275635 | Ga0501040_1275635_201_359 | 50 |
| 925 | 3300049577 | Ga0501041_0220912 | Ga0501041_0220912_879_1037 | 50 |
| 926 | 3300049578 | Ga0501042_0032536 | Ga0501042_0032536_2260_2418 | 50 |
| 927 | 3300049578 | Ga0501042_0222621 | Ga0501042_0222621_369_527 | 50 |
| 928 | 3300049578 | Ga0501042_1217403 | Ga0501042_1217403_382_537 | 50 |
| 929 | 3300049579 | Ga0501043_0031616 | Ga0501043_0031616_3028_3186 | 50 |
| 930 | 3300049580 | Ga0501046_0004620 | Ga0501046_0004620_10059_10217 | 50 |
| 931 | 3300049580 | Ga0501046_0124968 | Ga0501046_0124968_444_602 | 50 |
| 932 | 3300049581 | Ga0501047_0014677 | Ga0501047_0014677_975_1133 | 50 |
| 933 | 3300049581 | Ga0501047_0082757 | Ga0501047_0082757_2219_2383 | 50 |
| 934 | 3300049581 | Ga0501047_0100323 | Ga0501047_0100323_56_208 | 50 |
| 935 | 3300049581 | Ga0501047_1204133 | Ga0501047_1204133_328_486 | 50 |
| 936 | 3300049582 | Ga0501048_0019145 | Ga0501048_0019145_3894_4052 | 50 |
| 937 | 3300049582 | Ga0501048_0260560 | Ga0501048_0260560_594_749 | 50 |
| 938 | 3300049582 | Ga0501048_0379929 | Ga0501048_0379929_222_380 | 50 |
| 939 | 3300049583 | Ga0501067_0003146 | Ga0501067_0003146_4170_4328 | 50 |
| 940 | 3300049584 | Ga0501068_0093062 | Ga0501068_0093062_689_847 | 50 |
| 941 | 3300049584 | Ga0501068_0395056 | Ga0501068_0395056_395_550 | 50 |
| 942 | 3300049584 | Ga0501068_0578833 | Ga0501068_0578833_68_223 | 50 |
| 943 | 3300049585 | Ga0501069_0003163 | Ga0501069_0003163_5014_5172 | 50 |
| 944 | 3300049585 | Ga0501069_0068986 | Ga0501069_0068986_118_273 | 50 |
| 945 | 3300049585 | Ga0501069_0286906 | Ga0501069_0286906_779_931 | 50 |
| 946 | 3300049585 | Ga0501069_0360288 | Ga0501069_0360288_92_244 | 50 |
| 947 | 3300049585 | Ga0501069_0696963 | Ga0501069_0696963_394_558 | 50 |
| 948 | 3300049585 | Ga0501069_1037381 | Ga0501069_1037381_29_181 | 50 |
| 949 | 3300049586 | Ga0501070_0021944 | Ga0501070_0021944_4874_5029 | 50 |
| 950 | 3300049586 | Ga0501070_0059924 | Ga0501070_0059924_2931_3086 | 50 |
| 951 | 3300049586 | Ga0501070_0068845 | Ga0501070_0068845_1291_1443 | 50 |
| 952 | 3300049586 | Ga0501070_0125154 | Ga0501070_0125154_1489_1644 | 50 |
| 953 | 3300049586 | Ga0501070_0136867 | Ga0501070_0136867_1431_1586 | 50 |
| 954 | 3300049586 | Ga0501070_0138228 | Ga0501070_0138228_975_1133 | 50 |
| 955 | 3300049586 | Ga0501070_0160373 | Ga0501070_0160373_640_795 | 50 |
| 956 | 3300049586 | Ga0501070_0380165 | Ga0501070_0380165_750_905 | 50 |
| 957 | 3300049586 | Ga0501070_0519677 | Ga0501070_0519677_194_352 | 50 |
| 958 | 3300049586 | Ga0501070_0529665 | Ga0501070_0529665_431_586 | 50 |
| 959 | 3300049587 | Ga0501071_0019296 | Ga0501071_0019296_491_646 | 50 |
| 960 | 3300049587 | Ga0501071_0031082 | Ga0501071_0031082_514_672 | 50 |
| 961 | 3300049587 | Ga0501071_1321645 | Ga0501071_1321645_138_293 | 50 |
| 962 | 3300049587 | Ga0501071_1379481 | Ga0501071_1379481_232_390 | 50 |
| 963 | 3300049588 | Ga0501072_0136759 | Ga0501072_0136759_1640_1798 | 50 |
| 964 | 3300049588 | Ga0501072_0206092 | Ga0501072_0206092_1373_1531 | 50 |
| 965 | 3300049588 | Ga0501072_0283321 | Ga0501072_0283321_195_350 | 50 |
| 966 | 3300049588 | Ga0501072_0352471 | Ga0501072_0352471_250_405 | 50 |
| 967 | 3300049588 | Ga0501072_0746599 | Ga0501072_0746599_366_524 | 50 |
| 968 | 3300049588 | Ga0501072_1010253 | Ga0501072_1010253_147_305 | 50 |
| 969 | 3300049588 | Ga0501072_1126436 | Ga0501072_1126436_349_504 | 50 |
| 970 | 3300049589 | Ga0501073_0001123 | Ga0501073_0001123_10144_10302 | 50 |
| 971 | 3300049589 | Ga0501073_0260130 | Ga0501073_0260130_540_698 | 50 |
| 972 | 3300049589 | Ga0501073_0272271 | Ga0501073_0272271_811_975 | 50 |
| 973 | 3300049589 | Ga0501073_0877677 | Ga0501073_0877677_144_296 | 50 |
| 974 | 3300049589 | Ga0501073_1034504 | Ga0501073_1034504_69_224 | 50 |
| 975 | 3300049590 | Ga0501074_0004631 | Ga0501074_0004631_4797_4955 | 50 |
| 976 | 3300049590 | Ga0501074_0322129 | Ga0501074_0322129_790_942 | 50 |
| 977 | 3300049590 | Ga0501074_0500393 | Ga0501074_0500393_128_286 | 50 |
| 978 | 3300049590 | Ga0501074_0634529 | Ga0501074_0634529_404_559 | 50 |
| 979 | 3300049590 | Ga0501074_0855275 | Ga0501074_0855275_35_190 | 50 |
| 980 | 3300049591 | Ga0501075_0153437 | Ga0501075_0153437_812_970 | 50 |
| 981 | 3300049591 | Ga0501075_0334557 | Ga0501075_0334557_348_503 | 50 |
| 982 | 3300049591 | Ga0501075_1215610 | Ga0501075_1215610_238_393 | 50 |
| 983 | 3300049591 | Ga0501075_1242020 | Ga0501075_1242020_309_461 | 50 |
| 984 | 3300049592 | Ga0501076_0165934 | Ga0501076_0165934_1114_1269 | 50 |
| 985 | 3300049593 | Ga0501077_0310518 | Ga0501077_0310518_308_466 | 50 |
| 986 | 3300049593 | Ga0501077_0372447 | Ga0501077_0372447_200_358 | 50 |
| 987 | 3300049593 | Ga0501077_0386885 | Ga0501077_0386885_724_882 | 50 |
| 988 | 3300049741 | Ga0501079_0045066 | Ga0501079_0045066_2903_3061 | 50 |
| 989 | 3300049741 | Ga0501079_0108919 | Ga0501079_0108919_1741_1899 | 50 |
| 990 | 3300049741 | Ga0501079_0811133 | Ga0501079_0811133_127_282 | 50 |
| 991 | 3300049741 | Ga0501079_0937301 | Ga0501079_0937301_429_587 | 50 |
| 992 | 3300049741 | Ga0501079_1624177 | Ga0501079_1624177_190_345 | 50 |
| 993 | 3300049742 | Ga0501080_0005918 | Ga0501080_0005918_9804_9962 | 50 |
| 994 | 3300049742 | Ga0501080_0025350 | Ga0501080_0025350_3784_3939 | 50 |
| 995 | 3300049742 | Ga0501080_0049111 | Ga0501080_0049111_2654_2818 | 50 |
| 996 | 3300049742 | Ga0501080_0385101 | Ga0501080_0385101_165_320 | 50 |
| 997 | 3300049742 | Ga0501080_0436636 | Ga0501080_0436636_515_673 | 50 |
| 998 | 3300049742 | Ga0501080_0951813 | Ga0501080_0951813_39_191 | 50 |
| 999 | 3300049742 | Ga0501080_1056169 | Ga0501080_1056169_418_573 | 50 |
| 1000 | 3300049742 | Ga0501080_1217666 | Ga0501080_1217666_300_452 | 50 |
| 1001 | 3300049743 | Ga0501081_0298704 | Ga0501081_0298704_299_457 | 50 |
| 1002 | 3300049743 | Ga0501081_0674666 | Ga0501081_0674666_197_352 | 50 |
| 1003 | 3300049743 | Ga0501081_1289507 | Ga0501081_1289507_180_338 | 50 |
| 1004 | 3300049743 | Ga0501081_1460913 | Ga0501081_1460913_128_286 | 50 |
| 1005 | 3300049744 | Ga0501083_0003568 | Ga0501083_0003568_10644_10796 | 50 |
| 1006 | 3300049744 | Ga0501083_0027818 | Ga0501083_0027818_1306_1464 | 50 |
| 1007 | 3300049744 | Ga0501083_0030644 | Ga0501083_0030644_2549_2707 | 50 |
| 1008 | 3300049744 | Ga0501083_0045461 | Ga0501083_0045461_435_587 | 50 |
| 1009 | 3300049744 | Ga0501083_0142892 | Ga0501083_0142892_351_509 | 50 |
| 1010 | 3300049744 | Ga0501083_0248523 | Ga0501083_0248523_329_481 | 50 |
| 1011 | 3300049744 | Ga0501083_0260533 | Ga0501083_0260533_953_1105 | 50 |
| 1012 | 3300049744 | Ga0501083_0484894 | Ga0501083_0484894_573_731 | 50 |
| 1013 | 3300049744 | Ga0501083_0773588 | Ga0501083_0773588_369_521 | 50 |
| 1014 | 3300049744 | Ga0501083_0845226 | Ga0501083_0845226_14_178 | 50 |
| 1015 | 3300049744 | Ga0501083_1010162 | Ga0501083_1010162_367_522 | 50 |
| 1016 | 3300049822 | Ga0501035_0001398 | Ga0501035_0001398_7986_8141 | 50 |
| 1017 | 3300049822 | Ga0501035_0006244 | Ga0501035_0006244_5836_5994 | 50 |
| 1018 | 3300049822 | Ga0501035_0217381 | Ga0501035_0217381_1284_1439 | 50 |
| 1019 | 3300049822 | Ga0501035_0282585 | Ga0501035_0282585_530_685 | 50 |
| 1020 | 3300049822 | Ga0501035_0945237 | Ga0501035_0945237_377_535 | 50 |
| 1021 | 3300049823 | Ga0501044_0000144 | Ga0501044_0000144_28586_28744 | 50 |
| 1022 | 3300049823 | Ga0501044_0039381 | Ga0501044_0039381_975_1133 | 50 |
| 1023 | 3300049823 | Ga0501044_0053820 | Ga0501044_0053820_1976_2131 | 50 |
| 1024 | 3300049823 | Ga0501044_0142628 | Ga0501044_0142628_1205_1360 | 50 |
| 1025 | 3300049823 | Ga0501044_0143647 | Ga0501044_0143647_1449_1601 | 50 |
| 1026 | 3300049823 | Ga0501044_0427071 | Ga0501044_0427071_957_1118 | 50 |
| 1027 | 3300049823 | Ga0501044_0728509 | Ga0501044_0728509_150_305 | 50 |
| 1028 | 3300049823 | Ga0501044_0734446 | Ga0501044_0734446_203_361 | 50 |
| 1029 | 3300049823 | Ga0501044_1337423 | Ga0501044_1337423_79_231 | 50 |
| 1030 | 3300049824 | Ga0501045_0014266 | Ga0501045_0014266_2038_2196 | 50 |
| 1031 | 3300049824 | Ga0501045_0191157 | Ga0501045_0191157_1164_1322 | 50 |
| 1032 | 3300050489 | nmdc:mga03683_113970_c1 | nmdc:mga03683_113970_c1_90_248 | 50 |
| 1033 | 3300050489 | nmdc:mga03683_136052_c1 | nmdc:mga03683_136052_c1_344_496 | 50 |
| 1034 | 3300050490 | nmdc:mga03n38_21471_c1 | nmdc:mga03n38_21471_c1_1923_2081 | 50 |
| 1035 | 3300050490 | nmdc:mga03n38_74265_c1 | nmdc:mga03n38_74265_c1_769_927 | 50 |
| 1036 | 3300050490 | nmdc:mga03n38_912634_c1 | nmdc:mga03n38_912634_c1_119_277 | 50 |
| 1037 | 3300050491 | nmdc:mga00v17_119937_c1 | nmdc:mga00v17_119937_c1_470_628 | 50 |
| 1038 | 3300050491 | nmdc:mga00v17_212083_c1 | nmdc:mga00v17_212083_c1_928_1080 | 50 |
| 1039 | 3300050491 | nmdc:mga00v17_62461_c1 | nmdc:mga00v17_62461_c1_1911_2063 | 50 |
| 1040 | 3300050491 | nmdc:mga00v17_862119_c1 | nmdc:mga00v17_862119_c1_273_431 | 50 |
| 1041 | 3300050492 | nmdc:mga0yw44_22649_c1 | nmdc:mga0yw44_22649_c1_1310_1462 | 50 |
| 1042 | 3300050492 | nmdc:mga0yw44_329362_c1 | nmdc:mga0yw44_329362_c1_221_373 | 50 |
| 1043 | 3300050492 | nmdc:mga0yw44_419147_c1 | nmdc:mga0yw44_419147_c1_339_497 | 50 |
| 1044 | 3300050492 | nmdc:mga0yw44_642101_c1 | nmdc:mga0yw44_642101_c1_378_536 | 50 |
| 1045 | 3300050493 | nmdc:mga0k408_18358_c1 | nmdc:mga0k408_18358_c1_2406_2564 | 50 |
| 1046 | 3300050493 | nmdc:mga0k408_272184_c1 | nmdc:mga0k408_272184_c1_340_492 | 50 |
| 1047 | 3300050493 | nmdc:mga0k408_294496_c1 | nmdc:mga0k408_294496_c1_801_953 | 50 |
| 1048 | 3300050493 | nmdc:mga0k408_33376_c1 | nmdc:mga0k408_33376_c1_472_630 | 50 |
| 1049 | 3300050493 | nmdc:mga0k408_39346_c2 | nmdc:mga0k408_39346_c2_542_700 | 50 |
| 1050 | 3300050494 | nmdc:mga06z11_115359_c1 | nmdc:mga06z11_115359_c1_594_752 | 50 |
| 1051 | 3300050494 | nmdc:mga06z11_15335_c1 | nmdc:mga06z11_15335_c1_1456_1608 | 50 |
| 1052 | 3300050494 | nmdc:mga06z11_336974_c1 | nmdc:mga06z11_336974_c1_734_886 | 50 |
| 1053 | 3300050494 | nmdc:mga06z11_356368_c1 | nmdc:mga06z11_356368_c1_150_302 | 50 |
| 1054 | 3300050495 | nmdc:mga04h51_146652_c1 | nmdc:mga04h51_146652_c1_176_334 | 50 |
| 1055 | 3300050496 | nmdc:mga07m45_166500_c1 | nmdc:mga07m45_166500_c1_11_163 | 50 |
| 1056 | 3300050496 | nmdc:mga07m45_804514_c1 | nmdc:mga07m45_804514_c1_270_428 | 50 |
| 1057 | 3300050507 | nmdc:mga05p37_11125_c1 | nmdc:mga05p37_11125_c1_6823_6975 | 50 |
| 1058 | 3300050507 | nmdc:mga05p37_1385311_c1 | nmdc:mga05p37_1385311_c1_510_668 | 50 |
| 1059 | 3300050507 | nmdc:mga05p37_947858_c1 | nmdc:mga05p37_947858_c1_641_796 | 50 |
| 1060 | 3300050508 | nmdc:mga09592_34712_c1 | nmdc:mga09592_34712_c1_2085_2237 | 50 |
| 1061 | 3300050508 | nmdc:mga09592_441356_c1 | nmdc:mga09592_441356_c1_306_461 | 50 |
| 1062 | 3300050509 | nmdc:mga0qj67_179390_c1 | nmdc:mga0qj67_179390_c1_374_529 | 50 |
| 1063 | 3300050509 | nmdc:mga0qj67_276_c1 | nmdc:mga0qj67_276_c1_25419_25571 | 50 |
| 1064 | 3300050509 | nmdc:mga0qj67_591110_c1 | nmdc:mga0qj67_591110_c1_343_498 | 50 |
| 1065 | 3300050510 | nmdc:mga06r32_1575399_c1 | nmdc:mga06r32_1575399_c1_388_543 | 50 |
| 1066 | 3300050510 | nmdc:mga06r32_7663_c1 | nmdc:mga06r32_7663_c1_2840_2992 | 50 |
| 1067 | 3300050510 | nmdc:mga06r32_783718_c1 | nmdc:mga06r32_783718_c1_649_804 | 50 |
| 1068 | 3300050511 | nmdc:mga08y16_373765_c1 | nmdc:mga08y16_373765_c1_388_540 | 50 |
| 1069 | 3300050511 | nmdc:mga08y16_3857_c1 | nmdc:mga08y16_3857_c1_7775_7927 | 50 |
| 1070 | 3300050511 | nmdc:mga08y16_3921_c1 | nmdc:mga08y16_3921_c1_5799_5951 | 50 |
| 1071 | 3300050511 | nmdc:mga08y16_4944_c1 | nmdc:mga08y16_4944_c1_7058_7210 | 50 |
| 1072 | 3300050511 | nmdc:mga08y16_601643_c1 | nmdc:mga08y16_601643_c1_461_619 | 50 |
| 1073 | 3300050512 | nmdc:mga0n895_1246330_c1 | nmdc:mga0n895_1246330_c1_240_398 | 50 |
| 1074 | 3300050512 | nmdc:mga0n895_150292_c1 | nmdc:mga0n895_150292_c1_198_356 | 50 |
| 1075 | 3300050512 | nmdc:mga0n895_183619_c1 | nmdc:mga0n895_183619_c1_701_853 | 50 |
| 1076 | 3300050512 | nmdc:mga0n895_36674_c1 | nmdc:mga0n895_36674_c1_3717_3869 | 50 |
| 1077 | 3300050512 | nmdc:mga0n895_43874_c1 | nmdc:mga0n895_43874_c1_2099_2251 | 50 |
| 1078 | 3300050513 | nmdc:mga0rr50_3124_c1 | nmdc:mga0rr50_3124_c1_316_468 | 50 |
| 1079 | 3300050514 | nmdc:mga08x19_1121739_c1 | nmdc:mga08x19_1121739_c1_192_344 | 50 |
| 1080 | 3300050514 | nmdc:mga08x19_38060_c1 | nmdc:mga08x19_38060_c1_1808_1960 | 50 |
| 1081 | 3300050514 | nmdc:mga08x19_504912_c1 | nmdc:mga08x19_504912_c1_76_228 | 50 |
| 1082 | 3300050514 | nmdc:mga08x19_924325_c1 | nmdc:mga08x19_924325_c1_47_205 | 50 |
| 1083 | 3300050515 | nmdc:mga0a205_1633_c1 | nmdc:mga0a205_1633_c1_4563_4715 | 50 |
| 1084 | 3300050515 | nmdc:mga0a205_6204_c1 | nmdc:mga0a205_6204_c1_2329_2481 | 50 |
| 1085 | 3300050515 | nmdc:mga0a205_750252_c1 | nmdc:mga0a205_750252_c1_96_248 | 50 |
| 1086 | 3300050516 | nmdc:mga0sz30_51691_c1 | nmdc:mga0sz30_51691_c1_102_254 | 50 |
| 1087 | 3300050516 | nmdc:mga0sz30_66522_c1 | nmdc:mga0sz30_66522_c1_247_405 | 50 |
| 1088 | 3300050516 | nmdc:mga0sz30_77064_c1 | nmdc:mga0sz30_77064_c1_767_925 | 50 |
| 1089 | 3300053077 | Ga0495601_0000128 | Ga0495601_0000128_28908_29060 | 50 |
| 1090 | 3300053077 | Ga0495601_0004569 | Ga0495601_0004569_2821_2973 | 50 |
| 1091 | 3300053077 | Ga0495601_0021624 | Ga0495601_0021624_1913_2065 | 50 |
| 1092 | 3300053077 | Ga0495601_0324568 | Ga0495601_0324568_726_878 | 50 |
| 1093 | 3300053078 | Ga0495612_0002324 | Ga0495612_0002324_763_915 | 50 |
| 1094 | 3300053078 | Ga0495612_0026565 | Ga0495612_0026565_148_300 | 50 |
| 1095 | 3300053078 | Ga0495612_0040582 | Ga0495612_0040582_496_648 | 50 |
| 1096 | 3300053078 | Ga0495612_0056227 | Ga0495612_0056227_1234_1386 | 50 |
| 1097 | 3300053079 | Ga0500610_0076252 | Ga0500610_0076252_1470_1628 | 50 |
| 1098 | 3300053080 | Ga0500635_0085652 | Ga0500635_0085652_68_226 | 50 |
| 1099 | 3300053084 | Ga0495595_0000754 | Ga0495595_0000754_6494_6646 | 50 |
| 1100 | 3300053084 | Ga0495595_0022079 | Ga0495595_0022079_2564_2716 | 50 |
| 1101 | 3300053084 | Ga0495595_0042886 | Ga0495595_0042886_1876_2028 | 50 |
| 1102 | 3300053084 | Ga0495595_0284564 | Ga0495595_0284564_137_289 | 50 |
| 1103 | 3300053084 | Ga0495595_0443666 | Ga0495595_0443666_369_521 | 50 |
| 1104 | 3300053085 | Ga0495619_0000252 | Ga0495619_0000252_27262_27414 | 50 |
| 1105 | 3300053085 | Ga0495619_0014409 | Ga0495619_0014409_2149_2301 | 50 |
| 1106 | 3300053085 | Ga0495619_0058073 | Ga0495619_0058073_836_988 | 50 |
| 1107 | 3300053085 | Ga0495619_0209561 | Ga0495619_0209561_309_461 | 50 |
| 1108 | 3300053085 | Ga0495619_0257904 | Ga0495619_0257904_288_440 | 50 |
| 1109 | 3300053085 | Ga0495619_0288798 | Ga0495619_0288798_952_1104 | 50 |
| 1110 | 3300053085 | Ga0495619_0517880 | Ga0495619_0517880_351_503 | 50 |
| 1111 | 3300053085 | Ga0495619_0721079 | Ga0495619_0721079_74_232 | 50 |
| 1112 | 3300053087 | Ga0500643_003892 | Ga0500643_003892_6409_6561 | 50 |
| 1113 | 3300053088 | Ga0500644_0170246 | Ga0500644_0170246_701_853 | 50 |
| 1114 | 3300053090 | Ga0500646_0019777 | Ga0500646_0019777_1233_1391 | 50 |
| 1115 | 3300053092 | Ga0500583_0173540 | Ga0500583_0173540_581_739 | 50 |
| 1116 | 3300053093 | Ga0500651_0034932 | Ga0500651_0034932_1419_1571 | 50 |
| 1117 | 3300053093 | Ga0500651_0266704 | Ga0500651_0266704_519_671 | 50 |
| 1118 | 3300053094 | Ga0500566_0050359 | Ga0500566_0050359_1360_1512 | 50 |
| 1119 | 3300053094 | Ga0500566_0196625 | Ga0500566_0196625_400_552 | 50 |
| 1120 | 3300053096 | Ga0500641_0037364 | Ga0500641_0037364_1118_1276 | 50 |
| 1121 | 3300053096 | Ga0500641_0083814 | Ga0500641_0083814_562_714 | 50 |
| 1122 | 3300053098 | Ga0500650_0012656 | Ga0500650_0012656_1650_1808 | 50 |
| 1123 | 3300053108 | Ga0500562_164288 | Ga0500562_164288_229_387 | 50 |
| 1124 | 3300053117 | Ga0500593_003271 | Ga0500593_003271_5190_5348 | 50 |
| 1125 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_227416_227568 | 50 |
| 1126 | 3300053119 | Ga0500595_003306 | Ga0500595_003306_2322_2474 | 50 |
| 1127 | 3300053119 | Ga0500595_148931 | Ga0500595_148931_126_284 | 50 |
| 1128 | 3300053119 | Ga0500595_170807 | Ga0500595_170807_155_307 | 50 |
| 1129 | 3300053131 | Ga0500652_000068 | Ga0500652_000068_3172_3324 | 50 |
| 1130 | 3300053131 | Ga0500652_144470 | Ga0500652_144470_220_378 | 50 |
| 1131 | 3300053131 | Ga0500652_163002 | Ga0500652_163002_366_518 | 50 |
| 1132 | 3300053134 | Ga0500658_0264437 | Ga0500658_0264437_134_292 | 50 |
| 1133 | 3300053134 | Ga0500658_0285502 | Ga0500658_0285502_374_532 | 50 |
| 1134 | 3300053134 | Ga0500658_0384893 | Ga0500658_0384893_100_258 | 50 |
| 1135 | 3300053140 | Ga0500573_0267100 | Ga0500573_0267100_35_187 | 50 |
| 1136 | 3300053142 | Ga0500577_0069654 | Ga0500577_0069654_726_884 | 50 |
| 1137 | 3300053151 | Ga0500604_0259502 | Ga0500604_0259502_223_378 | 50 |
| 1138 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_600321_600473 | 50 |
| 1139 | 3300053153 | Ga0500616_0197263 | Ga0500616_0197263_175_333 | 50 |
| 1140 | 3300053160 | Ga0500633_0176670 | Ga0500633_0176670_494_649 | 50 |
| 1141 | 3300053163 | Ga0500639_255786 | Ga0500639_255786_90_248 | 50 |
| 1142 | 3300053177 | Ga0500636_0017818 | Ga0500636_0017818_982_1134 | 50 |
| 1143 | 3300053730 | Ga0500645_001000 | Ga0500645_001000_12081_12233 | 50 |
| 1144 | 3300053730 | Ga0500645_024140 | Ga0500645_024140_733_885 | 50 |
| 1145 | 3300054114 | Ga0501084_0131328 | Ga0501084_0131328_1505_1663 | 50 |
| 1146 | 3300054114 | Ga0501084_0324286 | Ga0501084_0324286_771_929 | 50 |
| 1147 | 3300054114 | Ga0501084_0337528 | Ga0501084_0337528_519_677 | 50 |
| 1148 | 3300054114 | Ga0501084_0438027 | Ga0501084_0438027_401_559 | 50 |
| 1149 | 3300054114 | Ga0501084_0516132 | Ga0501084_0516132_393_548 | 50 |
| 1150 | 3300054114 | Ga0501084_0523625 | Ga0501084_0523625_101_259 | 50 |
| 1151 | 3300054114 | Ga0501084_0691150 | Ga0501084_0691150_243_401 | 50 |
| 1152 | 3300054114 | Ga0501084_1008997 | Ga0501084_1008997_237_395 | 50 |
| 1153 | 3300059421 | Ga0590071_129695 | Ga0590071_129695_77_232 | 50 |
| 1154 | 3300060353 | Ga0501082_0000002 | Ga0501082_0000002_79474_79632 | 50 |
| 1155 | 3300060353 | Ga0501082_0036242 | Ga0501082_0036242_1554_1706 | 50 |
| 1156 | 3300060353 | Ga0501082_0204626 | Ga0501082_0204626_598_756 | 50 |
| 1157 | 3300060353 | Ga0501082_0208295 | Ga0501082_0208295_873_1025 | 50 |
| 1158 | 3300060353 | Ga0501082_1731668 | Ga0501082_1731668_322_486 | 50 |
| 1159 | 3300061719 | Ga0466962_0234228 | Ga0466962_0234228_356_508 | 50 |
| 1160 | 3300061734 | Ga0530510_0186955 | Ga0530510_0186955_24_194 | 50 |
| 1161 | 3300061734 | Ga0530510_0194378 | Ga0530510_0194378_645_803 | 50 |
| 1162 | 3300061734 | Ga0530510_0740144 | Ga0530510_0740144_529_687 | 50 |
| 1163 | 3300061734 | Ga0530510_1129293 | Ga0530510_1129293_62_220 | 50 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar