F491065

General Info

Members Datasets Scaffolds Average Seq Length
1165 377 1165 90

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100328484|Ga0075430_1003284843
Length 100
Sequence MAEQQQTQAEGREPAGRTRRKVRTGVVTSDKMTKTVTVSLVRRYAHPAYGKQVTRTKKVKARNVEGEGAARAGDTVRIMETRPLAKTVCWRVTEVVERAK

Samples

Sample ID Description Type Environment
1 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
199 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
219 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
223 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
228 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
229 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
233 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
236 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
237 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
301 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
302 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
329 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
330 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
331 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
332 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
333 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
334 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
335 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
336 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
337 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
338 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
339 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
340 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
341 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
342 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
343 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
349 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
350 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
351 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
352 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
357 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
358 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
359 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
360 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
361 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
364 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
365 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
368 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
369 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
372 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
373 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
374 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.38
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26145J50221_1029825 3300003371 Bacteria 554
2 Ga0058863_11744258 3300004799 Bacteria 817
3 Ga0058861_11902585 3300004800 Bacteria 912
4 Ga0058862_12815550 3300004803 Bacteria 695
5 Ga0058862_12862010 3300004803 Bacteria 1187
6 Ga0065715_10095098 3300005293 Bacteria 4166
7 Ga0065715_10308647 3300005293 Bacteria 1025
8 Ga0065715_10335955 3300005293 Bacteria 975
9 Ga0065715_10425513 3300005293 Bacteria 853
10 Ga0065707_10114865 3300005295 Bacteria 2284
11 Ga0065707_10544474 3300005295 Bacteria 725
12 Ga0070676_10001554 3300005328 Bacteria 11626
13 Ga0070676_10020381 3300005328 Bacteria 3700
14 Ga0070676_10894785 3300005328 Bacteria 661
15 Ga0070676_11543454 3300005328 Bacteria 512
16 Ga0070683_100089391 3300005329 Bacteria 2890
17 Ga0070683_100731628 3300005329 Bacteria 948
18 Ga0070683_100942413 3300005329 Bacteria 828
19 Ga0070690_100220052 3300005330 Bacteria 1330
20 Ga0070690_101392295 3300005330 Bacteria 564
21 Ga0070670_100407826 3300005331 Bacteria 1200
22 Ga0070677_10147733 3300005333 Bacteria 1091
23 Ga0068869_100170341 3300005334 Bacteria 1701
24 Ga0068869_100431635 3300005334 Bacteria 1089
25 Ga0068869_101492079 3300005334 Bacteria 600
26 Ga0068869_101612082 3300005334 Bacteria 578
27 Ga0070666_10039763 3300005335 Bacteria 3136
28 Ga0070666_10529683 3300005335 Bacteria 856
29 Ga0070680_100003421 3300005336 Bacteria 11843
30 Ga0070680_100048659 3300005336 Bacteria 3455
31 Ga0070680_100542498 3300005336 Bacteria 996
32 Ga0070680_101030501 3300005336 Bacteria 711
33 Ga0070680_101621089 3300005336 Bacteria 561
34 Ga0070682_100546693 3300005337 Bacteria 905
35 Ga0070660_100444041 3300005339 Bacteria 1076
36 Ga0070660_100630816 3300005339 Bacteria 897
37 Ga0070689_100202868 3300005340 Bacteria 1620
38 Ga0070689_101294659 3300005340 Bacteria 656
39 Ga0070691_10076548 3300005341 Bacteria 1631
40 Ga0070661_100083639 3300005344 Bacteria 2357
41 Ga0070661_100451391 3300005344 Bacteria 1023
42 Ga0070661_100818957 3300005344 Bacteria 765
43 Ga0070692_10370865 3300005345 Bacteria 895
44 Ga0070668_100011736 3300005347 Bacteria 6523
45 Ga0070668_100176017 3300005347 Bacteria 1745
46 Ga0070668_101471305 3300005347 Bacteria 622
47 Ga0070669_100299120 3300005353 Bacteria 1294
48 Ga0070669_100642291 3300005353 Bacteria 892
49 Ga0070669_101400285 3300005353 Unclassified 607
50 Ga0070669_101858838 3300005353 Bacteria 526
51 Ga0070675_100180981 3300005354 Bacteria 1823
52 Ga0070675_100653862 3300005354 Bacteria 955
53 Ga0070675_101229611 3300005354 Bacteria 690
54 Ga0070675_101270869 3300005354 Bacteria 678
55 Ga0070671_100007559 3300005355 Bacteria 8688
56 Ga0070671_100821229 3300005355 Bacteria 810
57 Ga0070674_100011786 3300005356 Bacteria 5337
58 Ga0070674_100343363 3300005356 Bacteria 1203
59 Ga0070674_101229198 3300005356 Bacteria 666
60 Ga0070673_100024204 3300005364 Bacteria 4448
61 Ga0070673_100044532 3300005364 Bacteria 3437
62 Ga0070673_100076697 3300005364 Bacteria 2700
63 Ga0070673_100198753 3300005364 Bacteria 1726
64 Ga0070673_100629188 3300005364 Bacteria 981
65 Ga0070673_101170635 3300005364 Bacteria 720
66 Ga0070688_100178790 3300005365 Bacteria 1470
67 Ga0070688_100954398 3300005365 Bacteria 679
68 Ga0070688_101413679 3300005365 Bacteria 564
69 Ga0070659_100094353 3300005366 Bacteria 2402
70 Ga0070659_100239592 3300005366 Bacteria 1501
71 Ga0070659_100543630 3300005366 Bacteria 994
72 Ga0070659_100679738 3300005366 Bacteria 889
73 Ga0070667_100387814 3300005367 Bacteria 1270
74 Ga0070667_100461332 3300005367 Bacteria 1162
75 Ga0070703_10308912 3300005406 Bacteria 662
76 Ga0070709_10180504 3300005434 Bacteria 1482
77 Ga0070701_10331438 3300005438 Bacteria 945
78 Ga0070701_10457070 3300005438 Bacteria 821
79 Ga0070711_100034546 3300005439 Bacteria 3373
80 Ga0070711_100973531 3300005439 Bacteria 727
81 Ga0070705_100020535 3300005440 Bacteria 3499
82 Ga0070705_100061139 3300005440 Bacteria 2237
83 Ga0070705_100249304 3300005440 Bacteria 1245
84 Ga0070705_100335450 3300005440 Bacteria 1097
85 Ga0070705_100423510 3300005440 Bacteria 992
86 Ga0070700_100027726 3300005441 Bacteria 3361
87 Ga0070700_100620053 3300005441 Bacteria 850
88 Ga0070700_100637552 3300005441 Bacteria 840
89 Ga0070700_101997932 3300005441 Unclassified 503
90 Ga0070694_100047914 3300005444 Bacteria 2873
91 Ga0070694_100058538 3300005444 Bacteria 2622
92 Ga0070694_100093025 3300005444 Bacteria 2119
93 Ga0070694_100177344 3300005444 Bacteria 1574
94 Ga0070694_100280246 3300005444 Bacteria 1271
95 Ga0070694_100644995 3300005444 Bacteria 857
96 Ga0070694_101652601 3300005444 Bacteria 544
97 Ga0070708_100003800 3300005445 Bacteria 11845
98 Ga0070708_100021258 3300005445 Bacteria 5484
99 Ga0070708_100034355 3300005445 Bacteria 4411
100 Ga0070708_100191282 3300005445 Bacteria 1914
101 Ga0070708_100684253 3300005445 Bacteria 966
102 Ga0070708_100996881 3300005445 Bacteria 786
103 Ga0070708_101158261 3300005445 Unclassified 724
104 Ga0070708_101543029 3300005445 Unclassified 619
105 Ga0070708_101809990 3300005445 Bacteria 567
106 Ga0070663_100075610 3300005455 Bacteria 2462
107 Ga0070663_100334387 3300005455 Bacteria 1222
108 Ga0070663_100501939 3300005455 Bacteria 1008
109 Ga0070678_100006200 3300005456 Bacteria 6992
110 Ga0070678_100928706 3300005456 Bacteria 797
111 Ga0070678_101783078 3300005456 Bacteria 580
112 Ga0070662_100000495 3300005457 Bacteria 23489
113 Ga0070662_100014308 3300005457 Bacteria 5298
114 Ga0070662_100390599 3300005457 Bacteria 1147
115 Ga0070662_100939191 3300005457 Bacteria 739
116 Ga0070662_101010479 3300005457 Unclassified 712
117 Ga0070681_10128360 3300005458 Bacteria 2468
118 Ga0070681_10206973 3300005458 Bacteria 1879
119 Ga0070681_10343864 3300005458 Bacteria 1402
120 Ga0070681_10354334 3300005458 Bacteria 1378
121 Ga0070681_11031439 3300005458 Unclassified 743
122 Ga0070681_11988419 3300005458 Bacteria 509
123 Ga0068867_100033463 3300005459 Bacteria 3723
124 Ga0068867_101697991 3300005459 Bacteria 592
125 Ga0068867_102388518 3300005459 Bacteria 503
126 Ga0070685_10285802 3300005466 Bacteria 1106
127 Ga0070685_10638714 3300005466 Bacteria 770
128 Ga0070706_100006592 3300005467 Bacteria 10949
129 Ga0070706_100568247 3300005467 Bacteria 1055
130 Ga0070706_100568256 3300005467 Bacteria 1055
131 Ga0070706_100662439 3300005467 Bacteria 969
132 Ga0070706_100813541 3300005467 Bacteria 865
133 Ga0070706_100959699 3300005467 Bacteria 789
134 Ga0070706_101017615 3300005467 Bacteria 764
135 Ga0070707_100011103 3300005468 Bacteria 8389
136 Ga0070707_100016356 3300005468 Bacteria 6962
137 Ga0070707_100143871 3300005468 Bacteria 2320
138 Ga0070707_100200331 3300005468 Bacteria 1946
139 Ga0070707_100787234 3300005468 Bacteria 915
140 Ga0070698_100005769 3300005471 Bacteria 13540
141 Ga0070698_100014490 3300005471 Bacteria 8325
142 Ga0070698_100029788 3300005471 Bacteria 5664
143 Ga0070698_100046236 3300005471 Bacteria 4451
144 Ga0070698_100070895 3300005471 Bacteria 3496
145 Ga0070698_100280886 3300005471 Bacteria 1596
146 Ga0070698_100402189 3300005471 Bacteria 1303
147 Ga0070698_100933138 3300005471 Bacteria 814
148 Ga0070699_100003912 3300005518 Bacteria 13158
149 Ga0070699_100024629 3300005518 Bacteria 5188
150 Ga0070699_100029175 3300005518 Bacteria 4757
151 Ga0070699_100063453 3300005518 Bacteria 3203
152 Ga0070699_100123141 3300005518 Bacteria 2281
153 Ga0070699_100279819 3300005518 Bacteria 1494
154 Ga0070699_100361549 3300005518 Bacteria 1309
155 Ga0070699_100791760 3300005518 Bacteria 868
156 Ga0070699_100995700 3300005518 Bacteria 768
157 Ga0070699_102188397 3300005518 Unclassified 505
158 Ga0070679_100014655 3300005530 Bacteria 7534
159 Ga0070679_100145172 3300005530 Bacteria 2351
160 Ga0070679_101294096 3300005530 Bacteria 675
161 Ga0070684_100454857 3300005535 Bacteria 1183
162 Ga0070684_100767074 3300005535 Bacteria 901
163 Ga0070697_100341629 3300005536 Bacteria 1292
164 Ga0070697_100913939 3300005536 Bacteria 779
165 Ga0070697_101164221 3300005536 Bacteria 687
166 Ga0070697_101506255 3300005536 Bacteria 601
167 Ga0068853_100468970 3300005539 Bacteria 1186
168 Ga0068853_100654070 3300005539 Bacteria 1000
169 Ga0068853_100908900 3300005539 Bacteria 846
170 Ga0068853_101596348 3300005539 Bacteria 632
171 Ga0070672_100017934 3300005543 Bacteria 5106
172 Ga0070672_100992761 3300005543 Bacteria 744
173 Ga0070672_101465907 3300005543 Bacteria 611
174 Ga0070672_102120639 3300005543 Bacteria 507
175 Ga0070686_100561210 3300005544 Bacteria 894
176 Ga0070686_100815594 3300005544 Bacteria 753
177 Ga0070695_100015722 3300005545 Bacteria 4572
178 Ga0070695_100067133 3300005545 Bacteria 2339
179 Ga0070695_100643180 3300005545 Bacteria 837
180 Ga0070695_101185225 3300005545 Bacteria 628
181 Ga0070696_100001655 3300005546 Bacteria 14605
182 Ga0070696_100005337 3300005546 Bacteria 8571
183 Ga0070696_100018217 3300005546 Bacteria 4744
184 Ga0070696_100262629 3300005546 Bacteria 1310
185 Ga0070696_100303927 3300005546 Bacteria 1223
186 Ga0070696_100385249 3300005546 Bacteria 1093
187 Ga0070696_100407520 3300005546 Bacteria 1065
188 Ga0070696_100539727 3300005546 Bacteria 933
189 Ga0070696_100680906 3300005546 Bacteria 837
190 Ga0070696_101416005 3300005546 Unclassified 593
191 Ga0070696_101775888 3300005546 Unclassified 533
192 Ga0070693_100095316 3300005547 Bacteria 1802
193 Ga0070693_100116783 3300005547 Bacteria 1650
194 Ga0070693_100136177 3300005547 Bacteria 1541
195 Ga0070693_100148892 3300005547 Bacteria 1480
196 Ga0070693_100384717 3300005547 Bacteria 969
197 Ga0070665_100026956 3300005548 Bacteria 5786
198 Ga0070704_100006202 3300005549 Bacteria 7025
199 Ga0070704_100106053 3300005549 Bacteria 2129
200 Ga0070704_100228522 3300005549 Bacteria 1516
201 Ga0070704_100352090 3300005549 Bacteria 1243
202 Ga0070704_100993763 3300005549 Bacteria 759
203 Ga0068855_101252128 3300005563 Bacteria 770
204 Ga0068855_101764356 3300005563 Unclassified 630
205 Ga0070664_100212641 3300005564 Bacteria 1728
206 Ga0070664_100333535 3300005564 Bacteria 1376
207 Ga0070664_101294866 3300005564 Bacteria 688
208 Ga0068857_100006227 3300005577 Bacteria 10201
209 Ga0068857_100347678 3300005577 Bacteria 1373
210 Ga0068857_100413384 3300005577 Bacteria 1257
211 Ga0068854_100000444 3300005578 Bacteria 25595
212 Ga0068854_100069785 3300005578 Bacteria 2567
213 Ga0068854_100602803 3300005578 Bacteria 938
214 Ga0068854_100705066 3300005578 Bacteria 871
215 Ga0068854_101018527 3300005578 Bacteria 734
216 Ga0068854_101195261 3300005578 Bacteria 681
217 Ga0068856_100453171 3300005614 Bacteria 1304
218 Ga0070702_100224648 3300005615 Bacteria 1258
219 Ga0070702_100740099 3300005615 Bacteria 754
220 Ga0070702_100784631 3300005615 Bacteria 735
221 Ga0070702_100898855 3300005615 Bacteria 693
222 Ga0068852_100300801 3300005616 Bacteria 1553
223 Ga0068852_100404440 3300005616 Bacteria 1343
224 Ga0068859_100043718 3300005617 Bacteria 4503
225 Ga0068859_100051859 3300005617 Bacteria 4124
226 Ga0068859_100224186 3300005617 Bacteria 1968
227 Ga0068859_102157460 3300005617 Bacteria 615
228 Ga0068864_100005272 3300005618 Bacteria 10592
229 Ga0068864_100347494 3300005618 Bacteria 1399
230 Ga0068864_100836106 3300005618 Bacteria 906
231 Ga0068864_100997105 3300005618 Bacteria 830
232 Ga0068864_101792466 3300005618 Bacteria 619
233 Ga0068864_102032541 3300005618 Bacteria 581
234 Ga0068864_102627985 3300005618 Bacteria 509
235 Ga0068866_10000625 3300005718 Bacteria 16073
236 Ga0068861_100176742 3300005719 Bacteria 1773
237 Ga0068861_100242529 3300005719 Bacteria 1533
238 Ga0068870_10134528 3300005840 Bacteria 1440
239 Ga0068870_10304124 3300005840 Bacteria 1008
240 Ga0068863_100236593 3300005841 Bacteria 1762
241 Ga0068863_100289181 3300005841 Bacteria 1589
242 Ga0068863_100315227 3300005841 Bacteria 1518
243 Ga0068863_100902400 3300005841 Bacteria 884
244 Ga0068863_101351026 3300005841 Bacteria 720
245 Ga0068858_100048389 3300005842 Bacteria 3940
246 Ga0068858_100282027 3300005842 Bacteria 1582
247 Ga0068858_101178818 3300005842 Bacteria 753
248 Ga0068858_102208347 3300005842 Bacteria 544
249 Ga0068858_102515552 3300005842 Bacteria 508
250 Ga0068860_100025031 3300005843 Bacteria 5761
251 Ga0068860_100200274 3300005843 Bacteria 1935
252 Ga0068860_100596670 3300005843 Bacteria 1109
253 Ga0068862_100027479 3300005844 Bacteria 4789
254 Ga0068862_100035153 3300005844 Bacteria 4242
255 Ga0068862_100494809 3300005844 Bacteria 1160
256 Ga0081455_10025196 3300005937 Bacteria 5495
257 Ga0075432_10577971 3300006058 Bacteria 511
258 Ga0070715_10096457 3300006163 Bacteria 1371
259 Ga0070715_10215555 3300006163 Bacteria 984
260 Ga0070715_11035376 3300006163 Bacteria 513
261 Ga0070716_100330172 3300006173 Bacteria 1072
262 Ga0070712_100426865 3300006175 Bacteria 1100
263 Ga0097621_100040793 3300006237 Bacteria 3733
264 Ga0075428_100061239 3300006844 Bacteria 4121
265 Ga0075428_100106239 3300006844 Bacteria 3061
266 Ga0075428_100152688 3300006844 Bacteria 2508
267 Ga0075428_100271986 3300006844 Bacteria 1823
268 Ga0075428_101952778 3300006844 Bacteria 609
269 Ga0075430_100150989 3300006846 Bacteria 1934
270 Ga0075430_100328484 3300006846 Bacteria 1264
271 Ga0075430_100429249 3300006846 Bacteria 1091
272 Ga0075431_100018917 3300006847 Bacteria 7017
273 Ga0075431_100152648 3300006847 Bacteria 2378
274 Ga0075431_101690066 3300006847 Bacteria 590
275 Ga0075433_10030828 3300006852 Bacteria 4579
276 Ga0075433_10139968 3300006852 Bacteria 2151
277 Ga0075433_10288518 3300006852 Bacteria 1453
278 Ga0075433_10925755 3300006852 Bacteria 760
279 Ga0075433_11412793 3300006852 Bacteria 602
280 Ga0075433_11839462 3300006852 Bacteria 520
281 Ga0075434_100031426 3300006871 Bacteria 5235
282 Ga0075434_100126654 3300006871 Bacteria 2571
283 Ga0075434_100154946 3300006871 Bacteria 2311
284 Ga0075434_100258550 3300006871 Bacteria 1760
285 Ga0075434_100644571 3300006871 Bacteria 1078
286 Ga0075434_100779527 3300006871 Bacteria 973
287 Ga0075434_101464534 3300006871 Unclassified 692
288 Ga0075429_100102770 3300006880 Bacteria 2495
289 Ga0068865_100045517 3300006881 Bacteria 3008
290 Ga0068865_100450966 3300006881 Bacteria 1063
291 Ga0068865_102120411 3300006881 Bacteria 511
292 Ga0075436_100005801 3300006914 Bacteria 8479
293 Ga0075436_100434782 3300006914 Bacteria 954
294 Ga0075436_100480752 3300006914 Bacteria 907
295 Ga0097620_100043718 3300006931 Bacteria 4503
296 Ga0097620_100051857 3300006931 Bacteria 4124
297 Ga0097620_100224164 3300006931 Bacteria 1968
298 Ga0097620_102156521 3300006931 Bacteria 615
299 Ga0075435_100111105 3300007076 Bacteria 2280
300 Ga0075435_100144049 3300007076 Bacteria 2000
301 Ga0075435_100166460 3300007076 Bacteria 1859
302 Ga0075435_100313249 3300007076 Bacteria 1343
303 Ga0075435_100520585 3300007076 Bacteria 1029
304 Ga0075435_100709248 3300007076 Bacteria 875
305 Ga0075435_100799775 3300007076 Bacteria 821
306 Ga0105240_10152415 3300009093 Bacteria 2752
307 Ga0111539_10475690 3300009094 Bacteria 1455
308 Ga0105245_10020560 3300009098 Bacteria 5789
309 Ga0105245_11323001 3300009098 Bacteria 770
310 Ga0105245_11902774 3300009098 Bacteria 648
311 Ga0114129_10106429 3300009147 Bacteria 3874
312 Ga0114129_10113339 3300009147 Bacteria 3739
313 Ga0114129_10238790 3300009147 Bacteria 2444
314 Ga0114129_10327586 3300009147 Bacteria 2035
315 Ga0114129_10384224 3300009147 Bacteria 1854
316 Ga0114129_11052867 3300009147 Bacteria 1021
317 Ga0114129_11139767 3300009147 Bacteria 974
318 Ga0114129_11271694 3300009147 Bacteria 913
319 Ga0114129_11691990 3300009147 Bacteria 772
320 Ga0114129_11958715 3300009147 Unclassified 709
321 Ga0105243_10286031 3300009148 Bacteria 1487
322 Ga0105243_11051471 3300009148 Bacteria 820
323 Ga0105243_11961932 3300009148 Bacteria 619
324 Ga0105241_12192956 3300009174 Bacteria 548
325 Ga0105242_10007285 3300009176 Bacteria 8528
326 Ga0105248_10090668 3300009177 Bacteria 3442
327 Ga0105248_10301689 3300009177 Bacteria 1804
328 Ga0105248_11273287 3300009177 Bacteria 832
329 Ga0105248_11862803 3300009177 Bacteria 682
330 Ga0105248_12579348 3300009177 Unclassified 579
331 Ga0105248_12805151 3300009177 Bacteria 556
332 Ga0105248_13350057 3300009177 Bacteria 509
333 Ga0105237_10487139 3300009545 Bacteria 1239
334 Ga0105238_10763200 3300009551 Bacteria 981
335 Ga0105238_10931241 3300009551 Bacteria 888
336 Ga0105249_10120380 3300009553 Bacteria 2494
337 Ga0105249_10291620 3300009553 Bacteria 1633
338 Ga0105249_12651511 3300009553 Bacteria 573
339 Ga0105239_10039556 3300010375 Bacteria 5166
340 Ga0105239_10107261 3300010375 Bacteria 3094
341 Ga0105239_10443774 3300010375 Bacteria 1472
342 Ga0105239_12799455 3300010375 Bacteria 569
343 Ga0105246_10040974 3300011119 Bacteria 3129
344 Ga0105246_10187984 3300011119 Bacteria 1596
345 Ga0105246_10564752 3300011119 Bacteria 977
346 Ga0157373_10552518 3300013100 Bacteria 835
347 Ga0157373_10824432 3300013100 Bacteria 685
348 Ga0157373_10944393 3300013100 Bacteria 641
349 Ga0157378_10018282 3300013297 Bacteria 6153
350 Ga0163162_10396518 3300013306 Bacteria 1513
351 Ga0163162_10422599 3300013306 Bacteria 1465
352 Ga0163162_12443140 3300013306 Unclassified 601
353 Ga0163162_13090401 3300013306 Bacteria 534
354 Ga0157372_10703184 3300013307 Bacteria 1176
355 Ga0157372_12789528 3300013307 Bacteria 560
356 Ga0157375_10259312 3300013308 Bacteria 1900
357 Ga0157375_10392073 3300013308 Bacteria 1555
358 Ga0157375_10980544 3300013308 Bacteria 986
359 Ga0157375_11897510 3300013308 Bacteria 707
360 Ga0157375_12377958 3300013308 Bacteria 632
361 Ga0163163_10009943 3300014325 Bacteria 8530
362 Ga0157380_10119060 3300014326 Bacteria 2233
363 Ga0157380_10475785 3300014326 Bacteria 1207
364 Ga0157380_10550087 3300014326 Bacteria 1132
365 Ga0157380_11090769 3300014326 Bacteria 837
366 Ga0157377_10169018 3300014745 Bacteria 1366
367 Ga0157377_10657126 3300014745 Bacteria 755
368 Ga0157377_10950300 3300014745 Bacteria 647
369 Ga0157377_11351813 3300014745 Bacteria 559
370 Ga0157379_10345831 3300014968 Bacteria 1361
371 Ga0157379_10654301 3300014968 Unclassified 984
372 Ga0157379_10946638 3300014968 Bacteria 819
373 Ga0157379_11004220 3300014968 Bacteria 796
374 Ga0157376_10507677 3300014969 Bacteria 1186
375 Ga0157376_11128045 3300014969 Bacteria 811
376 Ga0163161_10050412 3300017792 Bacteria 3012
377 Ga0163161_10378295 3300017792 Bacteria 1131
378 Ga0206350_10498630 3300020080 Bacteria 580
379 Ga0207697_10200592 3300025315 Bacteria 877
380 Ga0207682_10130045 3300025893 Bacteria 1123
381 Ga0207642_10000869 3300025899 Bacteria 9430
382 Ga0207688_10237312 3300025901 Bacteria 1102
383 Ga0207680_10748122 3300025903 Bacteria 701
384 Ga0207699_10623500 3300025906 Bacteria 786
385 Ga0207645_10002969 3300025907 Bacteria 13108
386 Ga0207645_10032454 3300025907 Bacteria 3356
387 Ga0207645_10378613 3300025907 Bacteria 950
388 Ga0207643_10007495 3300025908 Bacteria 5859
389 Ga0207643_10229111 3300025908 Bacteria 1139
390 Ga0207684_10022976 3300025910 Bacteria 5326
391 Ga0207684_10229689 3300025910 Bacteria 1601
392 Ga0207684_10305111 3300025910 Bacteria 1372
393 Ga0207684_10438050 3300025910 Bacteria 1122
394 Ga0207684_10882431 3300025910 Bacteria 753
395 Ga0207654_10190775 3300025911 Bacteria 1343
396 Ga0207707_10004257 3300025912 Bacteria 12664
397 Ga0207707_10098552 3300025912 Bacteria 2555
398 Ga0207707_10170477 3300025912 Bacteria 1902
399 Ga0207707_11115247 3300025912 Bacteria 642
400 Ga0207707_11201620 3300025912 Bacteria 614
401 Ga0207707_11209998 3300025912 Bacteria 611
402 Ga0207671_10895915 3300025914 Bacteria 701
403 Ga0207671_11284985 3300025914 Bacteria 570
404 Ga0207663_10079124 3300025916 Bacteria 2145
405 Ga0207663_10775699 3300025916 Bacteria 762
406 Ga0207660_10004139 3300025917 Bacteria 9438
407 Ga0207660_10253121 3300025917 Bacteria 1390
408 Ga0207660_10372014 3300025917 Bacteria 1148
409 Ga0207660_10441767 3300025917 Bacteria 1051
410 Ga0207660_10941522 3300025917 Bacteria 705
411 Ga0207660_11097629 3300025917 Bacteria 648
412 Ga0207662_10070949 3300025918 Bacteria 2108
413 Ga0207657_10511511 3300025919 Bacteria 940
414 Ga0207657_10939970 3300025919 Bacteria 665
415 Ga0207657_11151772 3300025919 Bacteria 591
416 Ga0207649_11051461 3300025920 Bacteria 641
417 Ga0207652_10011077 3300025921 Bacteria 7269
418 Ga0207652_10321015 3300025921 Bacteria 1398
419 Ga0207652_11803743 3300025921 Unclassified 517
420 Ga0207646_10036746 3300025922 Bacteria 4421
421 Ga0207646_10059053 3300025922 Bacteria 3425
422 Ga0207646_10165758 3300025922 Bacteria 1995
423 Ga0207646_10314034 3300025922 Bacteria 1416
424 Ga0207646_10452978 3300025922 Bacteria 1158
425 Ga0207681_10037063 3300025923 Bacteria 3221
426 Ga0207681_10162842 3300025923 Bacteria 1683
427 Ga0207681_10784831 3300025923 Bacteria 795
428 Ga0207694_10765988 3300025924 Bacteria 815
429 Ga0207694_11852719 3300025924 Bacteria 506
430 Ga0207650_10522056 3300025925 Bacteria 994
431 Ga0207659_10065037 3300025926 Bacteria 2642
432 Ga0207659_10076987 3300025926 Bacteria 2454
433 Ga0207659_10330415 3300025926 Bacteria 1260
434 Ga0207659_11569423 3300025926 Bacteria 562
435 Ga0207687_10361616 3300025927 Bacteria 1185
436 Ga0207644_10005299 3300025931 Bacteria 8417
437 Ga0207644_10223074 3300025931 Bacteria 1495
438 Ga0207690_10064627 3300025932 Bacteria 2499
439 Ga0207690_10477202 3300025932 Bacteria 1006
440 Ga0207690_10812354 3300025932 Bacteria 773
441 Ga0207706_10000025 3300025933 Bacteria 150958
442 Ga0207706_10103419 3300025933 Bacteria 2506
443 Ga0207706_10174699 3300025933 Bacteria 1887
444 Ga0207706_10298462 3300025933 Bacteria 1404
445 Ga0207706_10878513 3300025933 Bacteria 758
446 Ga0207686_10001115 3300025934 Bacteria 15582
447 Ga0207686_10819194 3300025934 Bacteria 747
448 Ga0207686_11160440 3300025934 Bacteria 631
449 Ga0207709_10032436 3300025935 Bacteria 3058
450 Ga0207709_10173009 3300025935 Bacteria 1517
451 Ga0207709_10693245 3300025935 Bacteria 814
452 Ga0207709_11424829 3300025935 Bacteria 574
453 Ga0207670_10501346 3300025936 Bacteria 986
454 Ga0207670_10987243 3300025936 Bacteria 708
455 Ga0207669_10000638 3300025937 Bacteria 15128
456 Ga0207669_10416317 3300025937 Bacteria 1056
457 Ga0207704_10004727 3300025938 Bacteria 6249
458 Ga0207704_10090959 3300025938 Bacteria 2004
459 Ga0207704_10861171 3300025938 Bacteria 760
460 Ga0207665_10589027 3300025939 Bacteria 867
461 Ga0207691_10016076 3300025940 Bacteria 7109
462 Ga0207691_11016400 3300025940 Bacteria 691
463 Ga0207711_10234797 3300025941 Bacteria 1680
464 Ga0207711_11288607 3300025941 Bacteria 673
465 Ga0207711_11291209 3300025941 Bacteria 672
466 Ga0207711_12085706 3300025941 Bacteria 510
467 Ga0207689_10002028 3300025942 Bacteria 19145
468 Ga0207689_10457749 3300025942 Bacteria 1067
469 Ga0207689_11522603 3300025942 Bacteria 558
470 Ga0207661_10029676 3300025944 Bacteria 4204
471 Ga0207661_10960756 3300025944 Bacteria 787
472 Ga0207679_10155209 3300025945 Bacteria 1868
473 Ga0207679_10456129 3300025945 Bacteria 1134
474 Ga0207679_11733348 3300025945 Bacteria 571
475 Ga0207679_11739576 3300025945 Unclassified 570
476 Ga0207679_12075248 3300025945 Bacteria 517
477 Ga0207667_10289436 3300025949 Bacteria 1674
478 Ga0207667_11310676 3300025949 Bacteria 700
479 Ga0207651_10022102 3300025960 Bacteria 3881
480 Ga0207651_10121492 3300025960 Bacteria 1982
481 Ga0207651_10232942 3300025960 Bacteria 1496
482 Ga0207651_10527058 3300025960 Bacteria 1024
483 Ga0207651_10539187 3300025960 Bacteria 1013
484 Ga0207712_10019662 3300025961 Bacteria 4414
485 Ga0207712_10395073 3300025961 Bacteria 1161
486 Ga0207712_10453037 3300025961 Bacteria 1088
487 Ga0207712_11211803 3300025961 Unclassified 674
488 Ga0207668_10022488 3300025972 Bacteria 4038
489 Ga0207668_10182169 3300025972 Bacteria 1658
490 Ga0207668_10756007 3300025972 Bacteria 858
491 Ga0207668_11176157 3300025972 Bacteria 689
492 Ga0207640_10066246 3300025981 Bacteria 2413
493 Ga0207640_11598659 3300025981 Bacteria 587
494 Ga0207658_10219081 3300025986 Bacteria 1600
495 Ga0207658_10602404 3300025986 Bacteria 987
496 Ga0207658_11133731 3300025986 Bacteria 715
497 Ga0207703_10159851 3300026035 Bacteria 1972
498 Ga0207703_10241518 3300026035 Bacteria 1624
499 Ga0207703_11938166 3300026035 Bacteria 565
500 Ga0207639_10270901 3300026041 Bacteria 1489
501 Ga0207639_11080565 3300026041 Bacteria 752
502 Ga0207678_10103624 3300026067 Bacteria 2429
503 Ga0207678_10128015 3300026067 Bacteria 2166
504 Ga0207678_10551442 3300026067 Bacteria 1008
505 Ga0207678_10712722 3300026067 Bacteria 883
506 Ga0207708_10012624 3300026075 Bacteria 6301
507 Ga0207708_10149443 3300026075 Bacteria 1838
508 Ga0207708_10718607 3300026075 Bacteria 855
509 Ga0207702_10487428 3300026078 Bacteria 1200
510 Ga0207641_10091448 3300026088 Bacteria 2663
511 Ga0207641_10555052 3300026088 Bacteria 1120
512 Ga0207641_10949604 3300026088 Bacteria 855
513 Ga0207648_10000138 3300026089 Bacteria 72558
514 Ga0207648_10016875 3300026089 Bacteria 6657
515 Ga0207648_10818425 3300026089 Bacteria 868
516 Ga0207648_11547059 3300026089 Bacteria 623
517 Ga0207676_10219571 3300026095 Bacteria 1692
518 Ga0207676_10240562 3300026095 Bacteria 1623
519 Ga0207676_10771069 3300026095 Bacteria 936
520 Ga0207676_11106174 3300026095 Bacteria 783
521 Ga0207676_11194171 3300026095 Bacteria 754
522 Ga0207676_12202602 3300026095 Bacteria 549
523 Ga0207674_10347999 3300026116 Bacteria 1433
524 Ga0207674_10351745 3300026116 Bacteria 1424
525 Ga0207674_10542907 3300026116 Bacteria 1123
526 Ga0207675_100006697 3300026118 Bacteria 10892
527 Ga0207675_100031110 3300026118 Bacteria 4970
528 Ga0207675_101501757 3300026118 Bacteria 694
529 Ga0207675_102030572 3300026118 Bacteria 592
530 Ga0207683_10006013 3300026121 Bacteria 10390
531 Ga0207683_10756438 3300026121 Bacteria 901
532 Ga0207683_11900586 3300026121 Bacteria 544
533 Ga0207698_10070479 3300026142 Bacteria 2770
534 Ga0209968_1009371 3300027526 Bacteria 1499
535 Ga0209968_1033503 3300027526 Bacteria 864
536 Ga0209999_1036477 3300027543 Bacteria 918
537 Ga0209970_1041124 3300027614 Bacteria 822
538 Ga0209971_1005664 3300027682 Bacteria 2963
539 Ga0209966_1007173 3300027695 Bacteria 1947
540 Ga0209998_10090134 3300027717 Bacteria 751
541 Ga0209998_10175771 3300027717 Bacteria 556
542 Ga0209974_10007380 3300027876 Bacteria 3789
543 Ga0209974_10013888 3300027876 Bacteria 2683
544 Ga0209974_10371913 3300027876 Unclassified 557
545 Ga0207428_10277396 3300027907 Bacteria 1245
546 Ga0207428_10785885 3300027907 Bacteria 677
547 Ga0268266_10077288 3300028379 Bacteria 2894
548 Ga0268265_10005281 3300028380 Bacteria 8845
549 Ga0268265_10227173 3300028380 Bacteria 1638
550 Ga0268265_10811376 3300028380 Bacteria 913
551 Ga0268264_10012146 3300028381 Bacteria 7091
552 Ga0268264_10363608 3300028381 Bacteria 1381
553 Ga0268264_10762871 3300028381 Bacteria 964
554 Ga0268264_12637842 3300028381 Unclassified 507
555 Ga0307408_100007121 3300031548 Bacteria 7404
556 Ga0307408_100140658 3300031548 Bacteria 1894
557 Ga0307408_100217429 3300031548 Bacteria 1557
558 Ga0307408_100281869 3300031548 Bacteria 1384
559 Ga0307408_100292745 3300031548 Bacteria 1360
560 Ga0307408_100731728 3300031548 Bacteria 892
561 Ga0307408_101364086 3300031548 Bacteria 666
562 Ga0307408_102430427 3300031548 Bacteria 509
563 Ga0307405_10003907 3300031731 Bacteria 6958
564 Ga0307405_10113716 3300031731 Bacteria 1838
565 Ga0307405_10163077 3300031731 Bacteria 1581
566 Ga0307405_10219766 3300031731 Bacteria 1393
567 Ga0307405_10225710 3300031731 Bacteria 1377
568 Ga0307405_10304193 3300031731 Bacteria 1211
569 Ga0307413_10001530 3300031824 Bacteria 8875
570 Ga0307413_10002665 3300031824 Bacteria 7313
571 Ga0307413_10011873 3300031824 Bacteria 4306
572 Ga0307413_10012580 3300031824 Bacteria 4216
573 Ga0307413_10031847 3300031824 Bacteria 2981
574 Ga0307413_10105379 3300031824 Bacteria 1874
575 Ga0307413_10130690 3300031824 Bacteria 1718
576 Ga0307413_10319626 3300031824 Bacteria 1185
577 Ga0307413_10346189 3300031824 Bacteria 1145
578 Ga0307413_10369452 3300031824 Bacteria 1113
579 Ga0307413_10874657 3300031824 Unclassified 761
580 Ga0307410_10000285 3300031852 Bacteria 19565
581 Ga0307410_10004966 3300031852 Bacteria 6971
582 Ga0307410_10005858 3300031852 Bacteria 6561
583 Ga0307410_10013117 3300031852 Bacteria 4822
584 Ga0307410_10027373 3300031852 Bacteria 3603
585 Ga0307410_10061436 3300031852 Bacteria 2571
586 Ga0307410_10313960 3300031852 Bacteria 1241
587 Ga0307410_10531368 3300031852 Bacteria 972
588 Ga0307410_10599876 3300031852 Bacteria 918
589 Ga0307406_10004231 3300031901 Bacteria 7805
590 Ga0307406_10009039 3300031901 Bacteria 5572
591 Ga0307406_10030175 3300031901 Bacteria 3290
592 Ga0307406_10040469 3300031901 Bacteria 2898
593 Ga0307406_10166791 3300031901 Bacteria 1589
594 Ga0307406_10206536 3300031901 Bacteria 1450
595 Ga0307407_10001057 3300031903 Bacteria 9539
596 Ga0307407_10005051 3300031903 Bacteria 5687
597 Ga0307407_10058334 3300031903 Bacteria 2243
598 Ga0307407_10094272 3300031903 Bacteria 1842
599 Ga0307407_10618099 3300031903 Bacteria 808
600 Ga0307407_10815099 3300031903 Bacteria 711
601 Ga0307407_11008750 3300031903 Bacteria 643
602 Ga0307412_10241216 3300031911 Bacteria 1398
603 Ga0307412_10249970 3300031911 Bacteria 1376
604 Ga0307412_10384216 3300031911 Bacteria 1138
605 Ga0307412_10902781 3300031911 Bacteria 774
606 Ga0307412_11491734 3300031911 Bacteria 614
607 Ga0307412_12006291 3300031911 Bacteria 536
608 Ga0307412_12241692 3300031911 Bacteria 509
609 Ga0307409_100000501 3300031995 Bacteria 16895
610 Ga0307409_100008795 3300031995 Bacteria 6156
611 Ga0307409_100028220 3300031995 Bacteria 3994
612 Ga0307409_100063049 3300031995 Bacteria 2905
613 Ga0307409_100102187 3300031995 Bacteria 2381
614 Ga0307409_100154528 3300031995 Bacteria 1997
615 Ga0307409_100154690 3300031995 Bacteria 1996
616 Ga0307409_100222092 3300031995 Bacteria 1706
617 Ga0307409_100287225 3300031995 Bacteria 1523
618 Ga0307409_100597630 3300031995 Bacteria 1090
619 Ga0307409_100698018 3300031995 Bacteria 1014
620 Ga0307409_101183516 3300031995 Bacteria 787
621 Ga0307409_101702054 3300031995 Unclassified 659
622 Ga0307416_100003682 3300032002 Bacteria 9079
623 Ga0307416_100010520 3300032002 Bacteria 6115
624 Ga0307416_100015821 3300032002 Bacteria 5223
625 Ga0307416_100016925 3300032002 Bacteria 5084
626 Ga0307416_100020437 3300032002 Bacteria 4725
627 Ga0307416_100056806 3300032002 Bacteria 3161
628 Ga0307416_100089622 3300032002 Bacteria 2634
629 Ga0307416_100217109 3300032002 Bacteria 1830
630 Ga0307416_100278279 3300032002 Bacteria 1648
631 Ga0307416_100278480 3300032002 Bacteria 1647
632 Ga0307416_100429662 3300032002 Bacteria 1368
633 Ga0307416_100538020 3300032002 Bacteria 1239
634 Ga0307416_100611026 3300032002 Bacteria 1171
635 Ga0307416_101561833 3300032002 Bacteria 765
636 Ga0307416_101748361 3300032002 Bacteria 726
637 Ga0307414_10030049 3300032004 Bacteria 3545
638 Ga0307414_10054914 3300032004 Bacteria 2786
639 Ga0307414_10219473 3300032004 Bacteria 1560
640 Ga0307414_10273173 3300032004 Bacteria 1417
641 Ga0307414_10351362 3300032004 Bacteria 1265
642 Ga0307414_10804425 3300032004 Unclassified 857
643 Ga0307414_11421427 3300032004 Bacteria 645
644 Ga0307414_12008444 3300032004 Bacteria 540
645 Ga0307414_12198084 3300032004 Bacteria 515
646 Ga0307411_10001075 3300032005 Bacteria 10594
647 Ga0307411_10022708 3300032005 Bacteria 3700
648 Ga0307411_10061799 3300032005 Bacteria 2495
649 Ga0307411_10083987 3300032005 Bacteria 2201
650 Ga0307411_10155066 3300032005 Bacteria 1707
651 Ga0307411_10158432 3300032005 Bacteria 1692
652 Ga0307411_10168662 3300032005 Bacteria 1648
653 Ga0307411_10193734 3300032005 Bacteria 1554
654 Ga0307411_10211317 3300032005 Bacteria 1498
655 Ga0307411_11040021 3300032005 Unclassified 735
656 Ga0307411_11900480 3300032005 Bacteria 554
657 Ga0307415_100004272 3300032126 Bacteria 7389
658 Ga0307415_100023019 3300032126 Bacteria 3858
659 Ga0307415_100072922 3300032126 Bacteria 2420
660 Ga0307415_100161299 3300032126 Bacteria 1738
661 Ga0307415_100240821 3300032126 Bacteria 1463
662 Ga0307415_100339846 3300032126 Bacteria 1259
663 Ga0307415_100416479 3300032126 Bacteria 1151
664 Ga0307415_100434528 3300032126 Bacteria 1130
665 Ga0307415_100846712 3300032126 Bacteria 839
666 Ga0307415_101188383 3300032126 Bacteria 718
667 Ga0307415_101305711 3300032126 Unclassified 687
668 Ga0307415_101975427 3300032126 Bacteria 568
669 Ga0307415_102296005 3300032126 Unclassified 529
670 Ga0373930_0205149 3300034816 Unclassified 514
671 Ga0373959_0015002 3300034820 Bacteria 1418
672 Ga0373959_0164898 3300034820 Bacteria 568
673 Ga0373926_0275828 3300035083 Bacteria 654
674 Ga0373928_0019246 3300035084 Bacteria 1423
675 Ga0373929_0048444 3300035085 Bacteria 965
676 Ga0373929_0141169 3300035085 Bacteria 639
677 Ga0373940_0010034 3300035088 Bacteria 2216
678 Ga0373940_0068857 3300035088 Bacteria 1026
679 Ga0373940_0199361 3300035088 Bacteria 657
680 Ga0373940_0246081 3300035088 Bacteria 601
681 Ga0373949_0025139 3300035090 Bacteria 1388
682 Ga0373949_0098380 3300035090 Bacteria 799
683 Ga0373951_0028079 3300035091 Bacteria 1317
684 Ga0373932_0032020 3300035112 Bacteria 1469
685 Ga0373932_0071714 3300035112 Bacteria 1076
686 Ga0373939_0003994 3300035114 Bacteria 3474
687 Ga0373939_0252909 3300035114 Bacteria 686
688 Ga0373939_0257797 3300035114 Bacteria 681
689 Ga0373941_0111579 3300035115 Bacteria 964
690 Ga0373956_0309398 3300035119 Bacteria 753
691 Ga0373960_0096120 3300035121 Bacteria 954
692 Ga0373942_0088012 3300035207 Bacteria 932
693 Ga0373942_0104546 3300035207 Bacteria 869
694 Ga0373961_0017856 3300035241 Bacteria 1846
695 Ga0373961_0110993 3300035241 Bacteria 898
696 Ga0373961_0163450 3300035241 Bacteria 766
697 Ga0373961_0232718 3300035241 Bacteria 661
698 Ga0373962_0081746 3300035242 Bacteria 982
699 Ga0373962_0181556 3300035242 Unclassified 704
700 Ga0373931_0113596 3300035691 Bacteria 1540
701 Ga0373931_0118715 3300035691 Bacteria 1509
702 Ga0373931_0156788 3300035691 Bacteria 1331
703 Ga0373931_0309264 3300035691 Bacteria 978
704 Ga0373931_0808296 3300035691 Bacteria 625
705 Ga0373935_0136746 3300035692 Bacteria 1652
706 Ga0373947_0824889 3300035725 Bacteria 633
707 Ga0373937_0114614 3300036401 Bacteria 2509
708 Ga0373925_0405252 3300037068 Bacteria 1113
709 Ga0395905_0552337 3300037471 Bacteria 1053
710 Ga0395905_0569350 3300037471 Bacteria 1034
711 Ga0395905_0622518 3300037471 Bacteria 981
712 Ga0395905_0763736 3300037471 Bacteria 869
713 Ga0395901_0384581 3300038443 Bacteria 1444
714 Ga0242419_003452 3300038698 Bacteria 1070
715 Ga0242420_006765 3300038996 Bacteria 1820
716 Ga0242420_036891 3300038996 Unclassified 924
717 Ga0439436_0073755 3300041404 Bacteria 951
718 Ga0439439_0020628 3300041406 Bacteria 1639
719 Ga0439439_0023621 3300041406 Bacteria 1541
720 Ga0451787_750746 3300041441 Bacteria 527
721 Ga0451804_0789277 3300041463 Bacteria 963
722 Ga0451807_0674211 3300041486 Bacteria 3051
723 Ga0451853_2411247 3300041512 Bacteria 600
724 Ga0439431_0009377 3300041997 Bacteria 2211
725 Ga0439431_0012021 3300041997 Bacteria 1985
726 Ga0439433_0080089 3300041999 Bacteria 794
727 Ga0439441_137200 3300042001 Bacteria 570
728 Ga0439445_0097230 3300042004 Bacteria 833
729 Ga0439448_0134969 3300042005 Bacteria 852
730 Ga0439448_0208916 3300042005 Bacteria 685
731 Ga0439449_0234577 3300042007 Bacteria 689
732 Ga0439457_019297 3300042014 Bacteria 1514
733 Ga0439462_0032157 3300042015 Bacteria 1390
734 Ga0439462_0116722 3300042015 Bacteria 741
735 Ga0450923_037208 3300042125 Bacteria 1012
736 Ga0450890_005210 3300042127 Bacteria 1676
737 Ga0450890_057475 3300042127 Bacteria 604
738 Ga0450898_084983 3300042134 Unclassified 647
739 Ga0450910_019874 3300042147 Bacteria 1011
740 Ga0439446_0004079 3300042156 Bacteria 3680
741 Ga0439446_0076459 3300042156 Bacteria 1031
742 Ga0439446_0239565 3300042156 Bacteria 623
743 Ga0439434_0092927 3300042435 Bacteria 966
744 Ga0439434_0196020 3300042435 Bacteria 680
745 Ga0439459_0033962 3300042438 Bacteria 1053
746 Ga0439459_0046509 3300042438 Bacteria 939
747 Ga0451577_0071213 3300042876 Bacteria 3100
748 Ga0451577_1966498 3300042876 Unclassified 511
749 Ga0453683_0027180 3300044673 Bacteria 3632
750 Ga0453683_0036857 3300044673 Bacteria 3077
751 Ga0453683_0134021 3300044673 Bacteria 1562
752 Ga0453684_1310675 3300044712 Unclassified 755
753 Ga0466960_0112845 3300044901 Bacteria 1414
754 Ga0466960_0379094 3300044901 Bacteria 811
755 Ga0451576_0043122 3300045051 Bacteria 4760
756 Ga0451576_2448933 3300045051 Unclassified 534
757 Ga0466967_1071083 3300045976 Bacteria 803
758 Ga0466967_1294393 3300045976 Bacteria 726
759 Ga0495603_0004055 3300046455 Bacteria 8717
760 Ga0495603_0058761 3300046455 Bacteria 2273
761 Ga0495603_0129979 3300046455 Bacteria 1467
762 Ga0495641_0033780 3300046461 Bacteria 2424
763 Ga0495653_0332714 3300046463 Bacteria 981
764 Ga0495580_0083378 3300046472 Bacteria 2227
765 Ga0495582_0004780 3300046473 Bacteria 7611
766 Ga0495582_0533567 3300046473 Unclassified 679
767 Ga0495639_0160034 3300046475 Bacteria 1089
768 Ga0495664_0006539 3300046477 Bacteria 6440
769 Ga0495585_0034640 3300046492 Bacteria 2855
770 Ga0495585_0447580 3300046492 Unclassified 618
771 Ga0495594_0002236 3300046499 Bacteria 10074
772 Ga0495594_0010292 3300046499 Bacteria 4849
773 Ga0495594_0036897 3300046499 Bacteria 2667
774 Ga0495596_0436381 3300046500 Bacteria 511
775 Ga0495618_0216760 3300046514 Bacteria 1208
776 Ga0495628_0074756 3300046516 Bacteria 2639
777 Ga0495628_0673212 3300046516 Bacteria 733
778 Ga0495637_0361447 3300046520 Unclassified 508
779 Ga0495666_0006653 3300046526 Bacteria 5810
780 Ga0495640_0007035 3300046533 Bacteria 8858
781 Ga0495586_0029015 3300046535 Bacteria 2961
782 Ga0495586_0193566 3300046535 Bacteria 1152
783 Ga0495586_0260586 3300046535 Bacteria 990
784 Ga0495587_0715865 3300046536 Bacteria 548
785 Ga0495598_0126788 3300046537 Bacteria 871
786 Ga0495622_0397881 3300046557 Bacteria 593
787 Ga0495633_0064996 3300046558 Bacteria 1705
788 Ga0495667_0034963 3300046559 Bacteria 3360
789 Ga0495656_0218455 3300046615 Bacteria 952
790 Ga0495634_0001123 3300046642 Bacteria 24774
791 Ga0495611_0153345 3300046648 Bacteria 1076
792 Ga0495659_0021818 3300046664 Bacteria 2161
793 Ga0495588_0046873 3300046674 Bacteria 2218
794 Ga0495657_0169181 3300046675 Bacteria 1347
795 Ga0495599_0892523 3300046678 Bacteria 504
796 Ga0495647_0038991 3300046681 Bacteria 1798
797 Ga0495647_0205031 3300046681 Bacteria 866
798 Ga0495647_0521172 3300046681 Unclassified 554
799 Ga0495658_0003330 3300046683 Bacteria 7973
800 Ga0495669_0224871 3300046684 Bacteria 900
801 Ga0495613_0025046 3300046689 Bacteria 4447
802 Ga0495670_0151670 3300046691 Bacteria 1215
803 Ga0495636_0029474 3300047318 Bacteria 2240
804 Ga0495674_0024223 3300047319 Bacteria 5581
805 Ga0495680_0012216 3300047322 Bacteria 7573
806 Ga0495684_0045726 3300047471 Bacteria 3349
807 Ga0496100_0227840 3300048903 Bacteria 1370
808 Ga0496100_0335590 3300048903 Bacteria 1139
809 Ga0496100_0688578 3300048903 Bacteria 797
810 Ga0496100_0702735 3300048903 Bacteria 789
811 Ga0496101_0047340 3300048904 Bacteria 3087
812 Ga0496101_0049962 3300048904 Bacteria 3009
813 Ga0496101_0074343 3300048904 Bacteria 2499
814 Ga0496101_0555486 3300048904 Bacteria 908
815 Ga0496101_0577224 3300048904 Bacteria 889
816 Ga0496101_0938613 3300048904 Bacteria 681
817 Ga0496101_1279510 3300048904 Bacteria 574
818 Ga0496102_0002335 3300048905 Bacteria 16187
819 Ga0496102_0088835 3300048905 Bacteria 2858
820 Ga0496102_0168993 3300048905 Bacteria 2058
821 Ga0496102_0214892 3300048905 Bacteria 1812
822 Ga0496102_0280261 3300048905 Bacteria 1571
823 Ga0496102_0870353 3300048905 Unclassified 823
824 Ga0496103_0145994 3300048906 Bacteria 1514
825 Ga0496103_0152380 3300048906 Bacteria 1481
826 Ga0496103_0217461 3300048906 Bacteria 1229
827 Ga0496103_0233696 3300048906 Bacteria 1183
828 Ga0496103_0299737 3300048906 Bacteria 1034
829 Ga0496103_0345145 3300048906 Bacteria 957
830 Ga0496103_0826536 3300048906 Bacteria 583
831 Ga0496104_0005407 3300048907 Bacteria 11175
832 Ga0496104_0065574 3300048907 Bacteria 3446
833 Ga0496104_0081866 3300048907 Bacteria 3079
834 Ga0496104_0184083 3300048907 Bacteria 1999
835 Ga0496104_0305788 3300048907 Bacteria 1502
836 Ga0496104_1015274 3300048907 Bacteria 733
837 Ga0496104_1716414 3300048907 Unclassified 530
838 Ga0496105_0104474 3300048908 Bacteria 2339
839 Ga0496105_0132121 3300048908 Bacteria 2058
840 Ga0496105_0188845 3300048908 Bacteria 1685
841 Ga0496105_0264215 3300048908 Bacteria 1391
842 Ga0496106_0003759 3300048909 Bacteria 11316
843 Ga0496106_0006627 3300048909 Bacteria 8573
844 Ga0496106_0078374 3300048909 Bacteria 2535
845 Ga0496106_0128300 3300048909 Bacteria 1987
846 Ga0496106_0311866 3300048909 Bacteria 1262
847 Ga0496106_0331505 3300048909 Bacteria 1222
848 Ga0496106_0814105 3300048909 Bacteria 740
849 Ga0496106_0887585 3300048909 Bacteria 704
850 Ga0496107_0077151 3300048910 Bacteria 2427
851 Ga0496107_0083067 3300048910 Bacteria 2336
852 Ga0496107_0121290 3300048910 Bacteria 1926
853 Ga0496107_0748661 3300048910 Bacteria 717
854 Ga0496107_0806281 3300048910 Bacteria 687
855 Ga0496107_0827155 3300048910 Bacteria 677
856 Ga0496107_1064501 3300048910 Bacteria 585
857 Ga0496108_0005766 3300048911 Bacteria 10032
858 Ga0496108_0012348 3300048911 Bacteria 6950
859 Ga0496108_0076691 3300048911 Bacteria 2825
860 Ga0496108_0167980 3300048911 Bacteria 1897
861 Ga0496109_0019764 3300048912 Bacteria 5942
862 Ga0496109_0039889 3300048912 Bacteria 4251
863 Ga0496109_0173149 3300048912 Bacteria 2025
864 Ga0496109_0434182 3300048912 Bacteria 1240
865 Ga0496109_1223699 3300048912 Bacteria 687
866 Ga0496110_0005386 3300048913 Bacteria 10029
867 Ga0496110_0007094 3300048913 Bacteria 8919
868 Ga0496110_0451480 3300048913 Bacteria 1171
869 Ga0496110_0537967 3300048913 Bacteria 1062
870 Ga0496110_1012730 3300048913 Bacteria 738
871 Ga0496111_0001415 3300048914 Bacteria 13651
872 Ga0496111_0010407 3300048914 Bacteria 6241
873 Ga0496111_0093771 3300048914 Bacteria 2201
874 Ga0496111_0190057 3300048914 Bacteria 1526
875 Ga0496111_0228735 3300048914 Bacteria 1381
876 Ga0496112_0024016 3300048915 Bacteria 5833
877 Ga0496112_0053839 3300048915 Bacteria 3953
878 Ga0496112_0216716 3300048915 Bacteria 1870
879 Ga0496112_1529824 3300048915 Bacteria 581
880 Ga0496113_0001258 3300048916 Bacteria 13982
881 Ga0496113_0063896 3300048916 Bacteria 2782
882 Ga0496113_0142208 3300048916 Bacteria 1888
883 Ga0496113_1315942 3300048916 Bacteria 562
884 Ga0496114_0047313 3300048917 Bacteria 3578
885 Ga0496114_0145538 3300048917 Bacteria 2054
886 Ga0496114_0159060 3300048917 Bacteria 1963
887 Ga0496114_0215901 3300048917 Bacteria 1683
888 Ga0496114_0269382 3300048917 Bacteria 1500
889 Ga0496115_0061354 3300048918 Bacteria 3031
890 Ga0501292_073204 3300049515 Unclassified 640
891 Ga0501298_028743 3300049521 Bacteria 1080
892 Ga0501298_126584 3300049521 Bacteria 606
893 Ga0501299_161534 3300049522 Bacteria 573
894 Ga0501031_0141051 3300049568 Bacteria 1575
895 Ga0501033_0282204 3300049570 Bacteria 1172
896 Ga0501033_0323097 3300049570 Bacteria 1084
897 Ga0501033_0579392 3300049570 Bacteria 771
898 Ga0501034_0044308 3300049571 Bacteria 4500
899 Ga0501034_0474406 3300049571 Bacteria 1167
900 Ga0501036_0358239 3300049572 Bacteria 1218
901 Ga0501036_0438580 3300049572 Bacteria 1088
902 Ga0501036_0643821 3300049572 Bacteria 878
903 Ga0501037_0072122 3300049573 Bacteria 2512
904 Ga0501037_0707889 3300049573 Bacteria 670
905 Ga0501038_0112160 3300049574 Bacteria 2258
906 Ga0501038_0321822 3300049574 Bacteria 1210
907 Ga0501038_0328376 3300049574 Bacteria 1195
908 Ga0501038_0946762 3300049574 Bacteria 634
909 Ga0501038_1086756 3300049574 Bacteria 584
910 Ga0501038_1109192 3300049574 Bacteria 577
911 Ga0501039_0112345 3300049575 Bacteria 2130
912 Ga0501039_0283824 3300049575 Bacteria 1301
913 Ga0501039_0602451 3300049575 Bacteria 861
914 Ga0501040_0080718 3300049576 Bacteria 2253
915 Ga0501040_0114192 3300049576 Bacteria 1890
916 Ga0501040_0303360 3300049576 Bacteria 1142
917 Ga0501040_0791412 3300049576 Bacteria 686
918 Ga0501040_0975250 3300049576 Bacteria 614
919 Ga0501040_1064113 3300049576 Bacteria 587
920 Ga0501041_0056716 3300049577 Bacteria 2394
921 Ga0501041_0206300 3300049577 Bacteria 1232
922 Ga0501041_0381060 3300049577 Bacteria 892
923 Ga0501041_0432310 3300049577 Bacteria 835
924 Ga0501042_0330152 3300049578 Bacteria 1102
925 Ga0501042_0905776 3300049578 Bacteria 642
926 Ga0501043_0467303 3300049579 Bacteria 946
927 Ga0501043_0608566 3300049579 Bacteria 806
928 Ga0501046_0206933 3300049580 Bacteria 1458
929 Ga0501046_0293363 3300049580 Bacteria 1189
930 Ga0501046_0784959 3300049580 Bacteria 668
931 Ga0501046_1022413 3300049580 Bacteria 573
932 Ga0501047_0851675 3300049581 Bacteria 725
933 Ga0501048_0007522 3300049582 Bacteria 8255
934 Ga0501048_0119600 3300049582 Bacteria 1861
935 Ga0501048_0307985 3300049582 Bacteria 1127
936 Ga0501048_0383996 3300049582 Bacteria 1003
937 Ga0501048_0468939 3300049582 Bacteria 902
938 Ga0501048_0916162 3300049582 Bacteria 630
939 Ga0501067_0014484 3300049583 Bacteria 4365
940 Ga0501067_0031279 3300049583 Bacteria 2953
941 Ga0501067_0047159 3300049583 Bacteria 2390
942 Ga0501067_0185227 3300049583 Bacteria 1159
943 Ga0501067_0342844 3300049583 Bacteria 833
944 Ga0501067_0354778 3300049583 Bacteria 817
945 Ga0501068_0008160 3300049584 Bacteria 5818
946 Ga0501068_0251675 3300049584 Bacteria 1126
947 Ga0501068_0402862 3300049584 Bacteria 882
948 Ga0501068_0831621 3300049584 Bacteria 606
949 Ga0501068_1161056 3300049584 Bacteria 511
950 Ga0501069_0008330 3300049585 Bacteria 5444
951 Ga0501069_0054197 3300049585 Bacteria 2234
952 Ga0501069_0095389 3300049585 Bacteria 1684
953 Ga0501069_0131449 3300049585 Bacteria 1433
954 Ga0501069_0168546 3300049585 Bacteria 1263
955 Ga0501069_0183138 3300049585 Bacteria 1211
956 Ga0501069_0238224 3300049585 Bacteria 1060
957 Ga0501069_0429712 3300049585 Bacteria 783
958 Ga0501070_0013050 3300049586 Bacteria 7001
959 Ga0501070_0032011 3300049586 Bacteria 4403
960 Ga0501070_0063385 3300049586 Bacteria 3062
961 Ga0501070_0222680 3300049586 Bacteria 1547
962 Ga0501070_0810712 3300049586 Bacteria 734
963 Ga0501070_0973915 3300049586 Bacteria 659
964 Ga0501070_1109598 3300049586 Bacteria 610
965 Ga0501071_0012801 3300049587 Bacteria 5704
966 Ga0501071_0030822 3300049587 Bacteria 3795
967 Ga0501071_0179960 3300049587 Bacteria 1584
968 Ga0501071_0207757 3300049587 Bacteria 1472
969 Ga0501071_0281338 3300049587 Bacteria 1259
970 Ga0501071_0368781 3300049587 Bacteria 1094
971 Ga0501071_0695360 3300049587 Bacteria 783
972 Ga0501071_0819882 3300049587 Bacteria 717
973 Ga0501071_1503731 3300049587 Bacteria 520
974 Ga0501071_1563448 3300049587 Bacteria 509
975 Ga0501072_0006109 3300049588 Bacteria 9187
976 Ga0501072_0032455 3300049588 Bacteria 4090
977 Ga0501072_0233391 3300049588 Bacteria 1465
978 Ga0501072_0364972 3300049588 Bacteria 1146
979 Ga0501072_0410843 3300049588 Bacteria 1073
980 Ga0501072_0420172 3300049588 Bacteria 1060
981 Ga0501072_0459184 3300049588 Bacteria 1008
982 Ga0501072_0950269 3300049588 Bacteria 671
983 Ga0501072_1341487 3300049588 Bacteria 554
984 Ga0501073_0062704 3300049589 Bacteria 2593
985 Ga0501073_0073839 3300049589 Bacteria 2374
986 Ga0501073_0438172 3300049589 Bacteria 903
987 Ga0501073_0709010 3300049589 Bacteria 694
988 Ga0501074_0064396 3300049590 Bacteria 2639
989 Ga0501074_0135782 3300049590 Bacteria 1759
990 Ga0501074_0237463 3300049590 Bacteria 1297
991 Ga0501074_0264170 3300049590 Bacteria 1223
992 Ga0501074_0463936 3300049590 Bacteria 898
993 Ga0501074_0588199 3300049590 Bacteria 787
994 Ga0501075_0006835 3300049591 Bacteria 7875
995 Ga0501075_0039029 3300049591 Bacteria 3553
996 Ga0501075_0197437 3300049591 Bacteria 1534
997 Ga0501075_0263535 3300049591 Bacteria 1313
998 Ga0501075_0567145 3300049591 Bacteria 866
999 Ga0501076_0006442 3300049592 Bacteria 8516
1000 Ga0501076_0047582 3300049592 Bacteria 3391
1001 Ga0501076_0054868 3300049592 Bacteria 3159
1002 Ga0501076_0228738 3300049592 Bacteria 1520
1003 Ga0501076_0526801 3300049592 Bacteria 974
1004 Ga0501076_1211718 3300049592 Bacteria 621
1005 Ga0501077_0002603 3300049593 Bacteria 10813
1006 Ga0501077_0009743 3300049593 Bacteria 5974
1007 Ga0501077_0015471 3300049593 Bacteria 4804
1008 Ga0501077_0048237 3300049593 Bacteria 2705
1009 Ga0501077_0095096 3300049593 Bacteria 1889
1010 Ga0501077_0572658 3300049593 Bacteria 725
1011 Ga0501077_0673513 3300049593 Bacteria 665
1012 Ga0501208_066406 3300049655 Unclassified 717
1013 Ga0501209_036721 3300049656 Bacteria 1275
1014 Ga0501209_041012 3300049656 Bacteria 1224
1015 Ga0501217_005170 3300049661 Bacteria 2717
1016 Ga0501227_157341 3300049665 Unclassified 630
1017 Ga0501230_038983 3300049667 Bacteria 914
1018 Ga0501233_129515 3300049668 Bacteria 688
1019 Ga0501235_066427 3300049669 Bacteria 849
1020 Ga0501240_072036 3300049673 Bacteria 627
1021 Ga0501243_054189 3300049675 Unclassified 730
1022 Ga0501243_125041 3300049675 Bacteria 534
1023 Ga0501247_001365 3300049677 Bacteria 2328
1024 Ga0501249_028447 3300049679 Bacteria 1239
1025 Ga0501250_009150 3300049680 Bacteria 1108
1026 Ga0501255_061117 3300049684 Unclassified 598
1027 Ga0501256_015384 3300049685 Bacteria 767
1028 Ga0501257_033911 3300049686 Bacteria 1238
1029 Ga0501259_014322 3300049688 Bacteria 1343
1030 Ga0501079_0010761 3300049741 Bacteria 6966
1031 Ga0501079_0020338 3300049741 Bacteria 5072
1032 Ga0501079_0025157 3300049741 Bacteria 4566
1033 Ga0501079_0147972 3300049741 Bacteria 1831
1034 Ga0501079_0318496 3300049741 Bacteria 1217
1035 Ga0501079_0506313 3300049741 Bacteria 949
1036 Ga0501079_0510157 3300049741 Bacteria 946
1037 Ga0501079_0513137 3300049741 Bacteria 942
1038 Ga0501079_1260629 3300049741 Bacteria 582
1039 Ga0501079_1322122 3300049741 Bacteria 567
1040 Ga0501080_0004569 3300049742 Bacteria 12338
1041 Ga0501080_0051733 3300049742 Bacteria 3823
1042 Ga0501080_0052432 3300049742 Bacteria 3796
1043 Ga0501080_0130656 3300049742 Bacteria 2325
1044 Ga0501080_0131482 3300049742 Bacteria 2317
1045 Ga0501080_0212338 3300049742 Bacteria 1773
1046 Ga0501080_0740196 3300049742 Bacteria 865
1047 Ga0501081_0011857 3300049743 Bacteria 5710
1048 Ga0501081_0049086 3300049743 Bacteria 2905
1049 Ga0501081_0164473 3300049743 Bacteria 1600
1050 Ga0501081_0432119 3300049743 Bacteria 977
1051 Ga0501081_0445598 3300049743 Bacteria 961
1052 Ga0501081_0456626 3300049743 Bacteria 949
1053 Ga0501081_0545407 3300049743 Bacteria 866
1054 Ga0501081_0613492 3300049743 Bacteria 815
1055 Ga0501081_1227714 3300049743 Bacteria 568
1056 Ga0501083_0014932 3300049744 Bacteria 5433
1057 Ga0501083_0051334 3300049744 Bacteria 2773
1058 Ga0501083_0091110 3300049744 Bacteria 2013
1059 Ga0501083_0329367 3300049744 Bacteria 993
1060 Ga0501083_0336790 3300049744 Bacteria 981
1061 Ga0501083_0523460 3300049744 Bacteria 772
1062 Ga0501083_0553865 3300049744 Bacteria 748
1063 Ga0501263_000777 3300049760 Bacteria 2683
1064 Ga0501267_013501 3300049764 Bacteria 850
1065 Ga0501272_003966 3300049769 Bacteria 1527
1066 Ga0501273_018515 3300049770 Unclassified 927
1067 Ga0501283_046396 3300049779 Bacteria 762
1068 Ga0501035_0946183 3300049822 Bacteria 680
1069 Ga0501035_1123039 3300049822 Bacteria 613
1070 Ga0501044_0891303 3300049823 Bacteria 765
1071 Ga0501044_1357639 3300049823 Bacteria 577
1072 Ga0501045_0069371 3300049824 Bacteria 2591
1073 Ga0501045_0101271 3300049824 Bacteria 2132
1074 Ga0501045_0231212 3300049824 Bacteria 1376
1075 Ga0501045_0485282 3300049824 Bacteria 918
1076 Ga0501045_0806506 3300049824 Bacteria 691
1077 Ga0501204_012112 3300049850 Bacteria 1032
1078 Ga0501226_013373 3300049853 Bacteria 906
1079 nmdc:mga05p37_1968370_c1 3300050507 Bacteria 554
1080 nmdc:mga05p37_227975_c1 3300050507 Bacteria 2246
1081 nmdc:mga05p37_4273_c1 3300050507 Bacteria 16689
1082 nmdc:mga05p37_453214_c1 3300050507 Bacteria 1484
1083 nmdc:mga05p37_553551_c1 3300050507 Bacteria 1309
1084 nmdc:mga05p37_565454_c1 3300050507 Bacteria 1291
1085 nmdc:mga05p37_719978_c1 3300050507 Bacteria 1105
1086 nmdc:mga05p37_843703_c1 3300050507 Bacteria 996
1087 nmdc:mga09592_11913_c1 3300050508 Bacteria 7074
1088 nmdc:mga09592_21260_c1 3300050508 Bacteria 5347
1089 nmdc:mga0qj67_54443_c1 3300050509 Bacteria 3168
1090 nmdc:mga0qj67_954959_c1 3300050509 Bacteria 674
1091 nmdc:mga06r32_1172073_c1 3300050510 Bacteria 715
1092 nmdc:mga06r32_347205_c1 3300050510 Bacteria 1468
1093 nmdc:mga06r32_52016_c1 3300050510 Bacteria 3922
1094 nmdc:mga06r32_809092_c1 3300050510 Bacteria 897
1095 nmdc:mga08y16_116742_c1 3300050511 Bacteria 2778
1096 nmdc:mga08y16_2039352_c1 3300050511 Bacteria 522
1097 nmdc:mga08y16_498272_c1 3300050511 Bacteria 1238
1098 nmdc:mga0n895_1028976_c1 3300050512 Bacteria 804
1099 nmdc:mga0n895_228293_c1 3300050512 Bacteria 1890
1100 nmdc:mga0n895_248304_c1 3300050512 Bacteria 1806
1101 nmdc:mga0n895_44735_c1 3300050512 Bacteria 4317
1102 nmdc:mga0n895_489365_c1 3300050512 Bacteria 1240
1103 nmdc:mga0n895_53761_c1 3300050512 Bacteria 3958
1104 nmdc:mga0rr50_1208234_c1 3300050513 Unclassified 642
1105 nmdc:mga0rr50_1295563_c1 3300050513 Bacteria 618
1106 nmdc:mga0rr50_226862_c1 3300050513 Bacteria 1544
1107 nmdc:mga0rr50_272117_c1 3300050513 Bacteria 1412
1108 nmdc:mga0rr50_299402_c1 3300050513 Bacteria 1345
1109 nmdc:mga0rr50_491500_c1 3300050513 Bacteria 1043
1110 nmdc:mga0rr50_63483_c1 3300050513 Bacteria 2789
1111 nmdc:mga0rr50_840081_c1 3300050513 Bacteria 783
1112 nmdc:mga08x19_123587_c1 3300050514 Bacteria 1737
1113 nmdc:mga08x19_512751_c1 3300050514 Bacteria 847
1114 nmdc:mga08x19_535547_c1 3300050514 Bacteria 828
1115 nmdc:mga08x19_603223_c1 3300050514 Bacteria 778
1116 nmdc:mga08x19_930801_c1 3300050514 Bacteria 617
1117 nmdc:mga0a205_11705_c1 3300050515 Bacteria 8091
1118 nmdc:mga0a205_1311424_c1 3300050515 Bacteria 572
1119 nmdc:mga0a205_135878_c1 3300050515 Bacteria 2359
1120 nmdc:mga0a205_157745_c1 3300050515 Bacteria 2167
1121 nmdc:mga0a205_471649_c1 3300050515 Bacteria 1114
1122 Ga0495612_0197095 3300053078 Unclassified 888
1123 Ga0495595_0736426 3300053084 Bacteria 506
1124 Ga0495619_0335257 3300053085 Bacteria 1047
1125 Ga0501084_0021009 3300054114 Bacteria 5445
1126 Ga0501084_0032504 3300054114 Bacteria 4364
1127 Ga0501084_0053363 3300054114 Bacteria 3381
1128 Ga0501084_0055496 3300054114 Bacteria 3314
1129 Ga0501084_0111100 3300054114 Bacteria 2303
1130 Ga0501084_0146629 3300054114 Bacteria 1988
1131 Ga0501084_0154746 3300054114 Bacteria 1933
1132 Ga0501084_0177220 3300054114 Bacteria 1799
1133 Ga0501084_0290002 3300054114 Bacteria 1382
1134 Ga0501084_0291972 3300054114 Bacteria 1377
1135 Ga0501084_0533641 3300054114 Bacteria 992
1136 Ga0501084_0817189 3300054114 Bacteria 785
1137 Ga0501084_1025346 3300054114 Unclassified 693
1138 Ga0590071_003425 3300059421 Bacteria 3897
1139 Ga0590071_064032 3300059421 Bacteria 901
1140 Ga0590071_081582 3300059421 Bacteria 804
1141 Ga0590074_004419 3300059423 Bacteria 2324
1142 Ga0590074_056058 3300059423 Bacteria 727
1143 Ga0590075_010024 3300059424 Bacteria 2276
1144 Ga0590077_023866 3300059426 Bacteria 1311
1145 Ga0590077_041201 3300059426 Bacteria 1026
1146 Ga0587071_011239 3300060344 Bacteria 1508
1147 Ga0501082_0019498 3300060353 Bacteria 5847
1148 Ga0501082_0033970 3300060353 Bacteria 4399
1149 Ga0501082_0052165 3300060353 Bacteria 3525
1150 Ga0501082_0052740 3300060353 Bacteria 3506
1151 Ga0501082_0114169 3300060353 Bacteria 2339
1152 Ga0501082_0154711 3300060353 Bacteria 1992
1153 Ga0501082_0202643 3300060353 Bacteria 1726
1154 Ga0501082_0407769 3300060353 Bacteria 1186
1155 Ga0501082_0651895 3300060353 Bacteria 921
1156 Ga0501082_0722994 3300060353 Bacteria 871
1157 Ga0501082_0961481 3300060353 Bacteria 747
1158 Ga0501082_1427867 3300060353 Bacteria 604
1159 Ga0501082_1678475 3300060353 Bacteria 554
1160 Ga0530510_0092411 3300061734 Bacteria 2208
1161 Ga0530510_0362046 3300061734 Bacteria 1090
1162 Ga0530510_0375174 3300061734 Bacteria 1070
1163 Ga0530510_0461644 3300061734 Bacteria 961
1164 Ga0530510_0522120 3300061734 Bacteria 901
1165 Ga0530510_0659022 3300061734 Bacteria 797

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005840 Ga0068870_10134528 Ga0068870_101345283 78
2 3300025926 Ga0207659_10065037 Ga0207659_100650375 78
3 3300042876 Ga0451577_0071213 Ga0451577_0071213_499_771 78
4 3300044673 Ga0453683_0134021 Ga0453683_0134021_792_1064 78
5 3300045051 Ga0451576_0043122 Ga0451576_0043122_2084_2356 78
6 3300046648 Ga0495611_0153345 Ga0495611_0153345_681_953 78
7 3300046664 Ga0495659_0021818 Ga0495659_0021818_926_1198 78
8 3300047318 Ga0495636_0029474 Ga0495636_0029474_1317_1589 78
9 3300048910 Ga0496107_0083067 Ga0496107_0083067_1816_2088 78
10 3300005329 Ga0070683_100089391 Ga0070683_1000893913 79
11 3300005336 Ga0070680_100003421 Ga0070680_10000342113 79
12 3300005530 Ga0070679_100014655 Ga0070679_10001465511 79
13 3300005547 Ga0070693_100095316 Ga0070693_1000953163 79
14 3300025912 Ga0207707_10004257 Ga0207707_1000425713 79
15 3300025917 Ga0207660_10004139 Ga0207660_1000413912 79
16 3300025921 Ga0207652_10011077 Ga0207652_100110779 79
17 3300005293 Ga0065715_10425513 Ga0065715_104255133 80
18 3300005328 Ga0070676_10020381 Ga0070676_100203813 80
19 3300005333 Ga0070677_10147733 Ga0070677_101477332 80
20 3300005334 Ga0068869_100170341 Ga0068869_1001703411 80
21 3300005335 Ga0070666_10529683 Ga0070666_105296831 80
22 3300005345 Ga0070692_10370865 Ga0070692_103708652 80
23 3300005347 Ga0070668_100011736 Ga0070668_1000117369 80
24 3300005353 Ga0070669_100299120 Ga0070669_1002991204 80
25 3300005354 Ga0070675_100653862 Ga0070675_1006538622 80
26 3300005356 Ga0070674_100011786 Ga0070674_1000117866 80
27 3300005364 Ga0070673_100024204 Ga0070673_1000242049 80
28 3300005365 Ga0070688_100178790 Ga0070688_1001787903 80
29 3300005366 Ga0070659_100679738 Ga0070659_1006797382 80
30 3300005367 Ga0070667_100461332 Ga0070667_1004613322 80
31 3300005441 Ga0070700_100637552 Ga0070700_1006375522 80
32 3300005444 Ga0070694_101652601 Ga0070694_1016526012 80
33 3300005455 Ga0070663_100334387 Ga0070663_1003343873 80
34 3300005456 Ga0070678_100928706 Ga0070678_1009287063 80
35 3300005457 Ga0070662_100014308 Ga0070662_1000143083 80
36 3300005459 Ga0068867_100033463 Ga0068867_1000334638 80
37 3300005543 Ga0070672_100017934 Ga0070672_10001793410 80
38 3300005548 Ga0070665_100026956 Ga0070665_10002695611 80
39 3300005564 Ga0070664_101294866 Ga0070664_1012948661 80
40 3300005578 Ga0068854_100602803 Ga0068854_1006028032 80
41 3300005615 Ga0070702_100898855 Ga0070702_1008988552 80
42 3300005719 Ga0068861_100242529 Ga0068861_1002425294 80
43 3300005840 Ga0068870_10304124 Ga0068870_103041242 80
44 3300005841 Ga0068863_100289181 Ga0068863_1002891813 80
45 3300005842 Ga0068858_100048389 Ga0068858_1000483893 80
46 3300005843 Ga0068860_100200274 Ga0068860_1002002743 80
47 3300005844 Ga0068862_100027479 Ga0068862_10002747910 80
48 3300006844 Ga0075428_100271986 Ga0075428_1002719863 80
49 3300006881 Ga0068865_100045517 Ga0068865_1000455173 80
50 3300013306 Ga0163162_12443140 Ga0163162_124431401 80
51 3300017792 Ga0163161_10378295 Ga0163161_103782953 80
52 3300025315 Ga0207697_10200592 Ga0207697_102005922 80
53 3300025893 Ga0207682_10130045 Ga0207682_101300453 80
54 3300025901 Ga0207688_10237312 Ga0207688_102373123 80
55 3300025903 Ga0207680_10748122 Ga0207680_107481222 80
56 3300025907 Ga0207645_10032454 Ga0207645_100324547 80
57 3300025908 Ga0207643_10229111 Ga0207643_102291112 80
58 3300025919 Ga0207657_10939970 Ga0207657_109399702 80
59 3300025923 Ga0207681_10037063 Ga0207681_100370637 80
60 3300025926 Ga0207659_10330415 Ga0207659_103304153 80
61 3300025932 Ga0207690_10477202 Ga0207690_104772023 80
62 3300025933 Ga0207706_10298462 Ga0207706_102984623 80
63 3300025937 Ga0207669_10416317 Ga0207669_104163173 80
64 3300025938 Ga0207704_10090959 Ga0207704_100909593 80
65 3300025940 Ga0207691_10016076 Ga0207691_100160764 80
66 3300025941 Ga0207711_10234797 Ga0207711_102347973 80
67 3300025944 Ga0207661_10029676 Ga0207661_100296766 80
68 3300025945 Ga0207679_12075248 Ga0207679_120752482 80
69 3300025960 Ga0207651_10527058 Ga0207651_105270582 80
70 3300025972 Ga0207668_10022488 Ga0207668_100224884 80
71 3300026067 Ga0207678_10551442 Ga0207678_105514423 80
72 3300026075 Ga0207708_10718607 Ga0207708_107186072 80
73 3300026088 Ga0207641_10555052 Ga0207641_105550522 80
74 3300026089 Ga0207648_10016875 Ga0207648_100168753 80
75 3300026118 Ga0207675_100031110 Ga0207675_1000311104 80
76 3300026121 Ga0207683_10756438 Ga0207683_107564382 80
77 3300028380 Ga0268265_10811376 Ga0268265_108113762 80
78 3300028381 Ga0268264_10762871 Ga0268264_107628713 80
79 3300042125 Ga0450923_037208 Ga0450923_037208_479_760 80
80 3300046455 Ga0495603_0004055 Ga0495603_0004055_2117_2398 80
81 3300046492 Ga0495585_0447580 Ga0495585_0447580_283_564 80
82 3300046537 Ga0495598_0126788 Ga0495598_0126788_79_360 80
83 3300046557 Ga0495622_0397881 Ga0495622_0397881_145_426 80
84 3300046558 Ga0495633_0064996 Ga0495633_0064996_1125_1406 80
85 3300046691 Ga0495670_0151670 Ga0495670_0151670_323_604 80
86 3300048913 Ga0496110_1012730 Ga0496110_1012730_244_525 80
87 3300005546 Ga0070696_101416005 Ga0070696_1014160051 81
88 3300006871 Ga0075434_101464534 Ga0075434_1014645342 81
89 3300005518 Ga0070699_100361549 Ga0070699_1003615492 82
90 3300005577 Ga0068857_100006227 Ga0068857_1000062273 82
91 3300005618 Ga0068864_100005272 Ga0068864_1000052724 82
92 3300011119 Ga0105246_10187984 Ga0105246_101879843 82
93 3300025945 Ga0207679_11733348 Ga0207679_117333481 82
94 3300026095 Ga0207676_10240562 Ga0207676_102405624 82
95 3300026116 Ga0207674_10542907 Ga0207674_105429073 82
96 3300027526 Ga0209968_1033503 Ga0209968_10335032 82
97 3300049574 Ga0501038_0321822 Ga0501038_0321822_785_1066 83
98 3300049743 Ga0501081_1227714 Ga0501081_1227714_162_443 83
99 3300054114 Ga0501084_0817189 Ga0501084_0817189_494_775 83
100 3300005466 Ga0070685_10638714 Ga0070685_106387142 84
101 3300009177 Ga0105248_10301689 Ga0105248_103016894 85
102 3300014326 Ga0157380_10550087 Ga0157380_105500873 85
103 3300035088 Ga0373940_0246081 Ga0373940_0246081_76_363 85
104 3300035090 Ga0373949_0025139 Ga0373949_0025139_658_945 85
105 3300035691 Ga0373931_0309264 Ga0373931_0309264_272_559 85
106 3300049743 Ga0501081_0613492 Ga0501081_0613492_92_349 85
107 3300060353 Ga0501082_0961481 Ga0501082_0961481_341_598 85
108 3300005293 Ga0065715_10095098 Ga0065715_100950988 86
109 3300005293 Ga0065715_10308647 Ga0065715_103086473 86
110 3300005295 Ga0065707_10544474 Ga0065707_105444741 86
111 3300005330 Ga0070690_101392295 Ga0070690_1013922951 86
112 3300005334 Ga0068869_101612082 Ga0068869_1016120822 86
113 3300005336 Ga0070680_101030501 Ga0070680_1010305012 86
114 3300005339 Ga0070660_100630816 Ga0070660_1006308163 86
115 3300005347 Ga0070668_101471305 Ga0070668_1014713052 86
116 3300005364 Ga0070673_101170635 Ga0070673_1011706353 86
117 3300005366 Ga0070659_100543630 Ga0070659_1005436301 86
118 3300005406 Ga0070703_10308912 Ga0070703_103089122 86
119 3300005439 Ga0070711_100973531 Ga0070711_1009735312 86
120 3300005440 Ga0070705_100020535 Ga0070705_1000205354 86
121 3300005440 Ga0070705_100423510 Ga0070705_1004235103 86
122 3300005441 Ga0070700_100620053 Ga0070700_1006200532 86
123 3300005444 Ga0070694_100058538 Ga0070694_1000585384 86
124 3300005445 Ga0070708_100003800 Ga0070708_1000038007 86
125 3300005445 Ga0070708_100191282 Ga0070708_1001912823 86
126 3300005445 Ga0070708_101809990 Ga0070708_1018099902 86
127 3300005457 Ga0070662_100939191 Ga0070662_1009391911 86
128 3300005467 Ga0070706_100006592 Ga0070706_10000659213 86
129 3300005468 Ga0070707_100016356 Ga0070707_1000163569 86
130 3300005471 Ga0070698_100933138 Ga0070698_1009331383 86
131 3300005518 Ga0070699_100003912 Ga0070699_10000391217 86
132 3300005536 Ga0070697_100341629 Ga0070697_1003416293 86
133 3300005536 Ga0070697_100913939 Ga0070697_1009139392 86
134 3300005543 Ga0070672_101465907 Ga0070672_1014659072 86
135 3300005545 Ga0070695_100067133 Ga0070695_1000671334 86
136 3300005546 Ga0070696_100018217 Ga0070696_1000182177 86
137 3300005546 Ga0070696_100303927 Ga0070696_1003039272 86
138 3300005546 Ga0070696_100539727 Ga0070696_1005397273 86
139 3300005547 Ga0070693_100384717 Ga0070693_1003847173 86
140 3300005549 Ga0070704_100006202 Ga0070704_10000620214 86
141 3300005578 Ga0068854_101195261 Ga0068854_1011952612 86
142 3300005614 Ga0068856_100453171 Ga0068856_1004531712 86
143 3300005615 Ga0070702_100740099 Ga0070702_1007400993 86
144 3300005617 Ga0068859_100224186 Ga0068859_1002241863 86
145 3300005618 Ga0068864_100347494 Ga0068864_1003474944 86
146 3300005842 Ga0068858_102208347 Ga0068858_1022083472 86
147 3300006163 Ga0070715_10215555 Ga0070715_102155552 86
148 3300006173 Ga0070716_100330172 Ga0070716_1003301722 86
149 3300006852 Ga0075433_10139968 Ga0075433_101399684 86
150 3300006852 Ga0075433_11839462 Ga0075433_118394621 86
151 3300006871 Ga0075434_100031426 Ga0075434_1000314265 86
152 3300006871 Ga0075434_100154946 Ga0075434_1001549463 86
153 3300006871 Ga0075434_100779527 Ga0075434_1007795273 86
154 3300006914 Ga0075436_100005801 Ga0075436_1000058018 86
155 3300006931 Ga0097620_100224164 Ga0097620_1002241643 86
156 3300007076 Ga0075435_100144049 Ga0075435_1001440494 86
157 3300007076 Ga0075435_100166460 Ga0075435_1001664604 86
158 3300007076 Ga0075435_100709248 Ga0075435_1007092483 86
159 3300009147 Ga0114129_10106429 Ga0114129_101064297 86
160 3300009147 Ga0114129_11052867 Ga0114129_110528672 86
161 3300009147 Ga0114129_11691990 Ga0114129_116919901 86
162 3300009177 Ga0105248_12805151 Ga0105248_128051512 86
163 3300009545 Ga0105237_10487139 Ga0105237_104871392 86
164 3300009553 Ga0105249_10291620 Ga0105249_102916204 86
165 3300010375 Ga0105239_10107261 Ga0105239_101072614 86
166 3300013306 Ga0163162_13090401 Ga0163162_130904012 86
167 3300014745 Ga0157377_10950300 Ga0157377_109503001 86
168 3300025910 Ga0207684_10022976 Ga0207684_100229767 86
169 3300025914 Ga0207671_10895915 Ga0207671_108959152 86
170 3300025916 Ga0207663_10775699 Ga0207663_107756993 86
171 3300025917 Ga0207660_11097629 Ga0207660_110976292 86
172 3300025921 Ga0207652_11803743 Ga0207652_118037432 86
173 3300025922 Ga0207646_10314034 Ga0207646_103140341 86
174 3300025933 Ga0207706_10103419 Ga0207706_101034195 86
175 3300025935 Ga0207709_11424829 Ga0207709_114248292 86
176 3300025940 Ga0207691_11016400 Ga0207691_110164002 86
177 3300025941 Ga0207711_11288607 Ga0207711_112886072 86
178 3300025942 Ga0207689_11522603 Ga0207689_115226032 86
179 3300025961 Ga0207712_10395073 Ga0207712_103950734 86
180 3300025972 Ga0207668_10756007 Ga0207668_107560073 86
181 3300025986 Ga0207658_11133731 Ga0207658_111337311 86
182 3300026035 Ga0207703_11938166 Ga0207703_119381662 86
183 3300026075 Ga0207708_10149443 Ga0207708_101494433 86
184 3300026078 Ga0207702_10487428 Ga0207702_104874282 86
185 3300026089 Ga0207648_11547059 Ga0207648_115470592 86
186 3300026095 Ga0207676_11106174 Ga0207676_111061743 86
187 3300035088 Ga0373940_0199361 Ga0373940_0199361_245_508 86
188 3300035242 Ga0373962_0181556 Ga0373962_0181556_117_380 86
189 3300035691 Ga0373931_0808296 Ga0373931_0808296_332_595 86
190 3300042005 Ga0439448_0134969 Ga0439448_0134969_400_663 86
191 3300044673 Ga0453683_0027180 Ga0453683_0027180_191_454 86
192 3300044673 Ga0453683_0036857 Ga0453683_0036857_1632_1895 86
193 3300046674 Ga0495588_0046873 Ga0495588_0046873_563_826 86
194 3300048903 Ga0496100_0688578 Ga0496100_0688578_382_645 86
195 3300048904 Ga0496101_0074343 Ga0496101_0074343_1345_1608 86
196 3300048905 Ga0496102_0002335 Ga0496102_0002335_15223_15486 86
197 3300048905 Ga0496102_0088835 Ga0496102_0088835_2464_2727 86
198 3300048906 Ga0496103_0145994 Ga0496103_0145994_374_637 86
199 3300048906 Ga0496103_0345145 Ga0496103_0345145_171_434 86
200 3300048907 Ga0496104_0005407 Ga0496104_0005407_6004_6267 86
201 3300048907 Ga0496104_1015274 Ga0496104_1015274_78_341 86
202 3300048908 Ga0496105_0188845 Ga0496105_0188845_1368_1631 86
203 3300048909 Ga0496106_0006627 Ga0496106_0006627_884_1147 86
204 3300048910 Ga0496107_0121290 Ga0496107_0121290_1097_1360 86
205 3300048911 Ga0496108_0005766 Ga0496108_0005766_4330_4593 86
206 3300048912 Ga0496109_0019764 Ga0496109_0019764_3120_3383 86
207 3300048913 Ga0496110_0005386 Ga0496110_0005386_1465_1728 86
208 3300048914 Ga0496111_0010407 Ga0496111_0010407_4893_5156 86
209 3300048916 Ga0496113_0001258 Ga0496113_0001258_1932_2195 86
210 3300048917 Ga0496114_0159060 Ga0496114_0159060_1080_1343 86
211 3300050507 nmdc:mga05p37_4273_c1 nmdc:mga05p37_4273_c1_13522_13785 86
212 3300050507 nmdc:mga05p37_453214_c1 nmdc:mga05p37_453214_c1_544_807 86
213 3300050508 nmdc:mga09592_21260_c1 nmdc:mga09592_21260_c1_2084_2347 86
214 3300050510 nmdc:mga06r32_809092_c1 nmdc:mga06r32_809092_c1_123_386 86
215 3300050512 nmdc:mga0n895_1028976_c1 nmdc:mga0n895_1028976_c1_67_330 86
216 3300050512 nmdc:mga0n895_228293_c1 nmdc:mga0n895_228293_c1_966_1229 86
217 3300050512 nmdc:mga0n895_248304_c1 nmdc:mga0n895_248304_c1_273_536 86
218 3300050512 nmdc:mga0n895_53761_c1 nmdc:mga0n895_53761_c1_2213_2476 86
219 3300050513 nmdc:mga0rr50_299402_c1 nmdc:mga0rr50_299402_c1_38_301 86
220 3300050513 nmdc:mga0rr50_63483_c1 nmdc:mga0rr50_63483_c1_2390_2653 86
221 3300050514 nmdc:mga08x19_123587_c1 nmdc:mga08x19_123587_c1_904_1167 86
222 3300050514 nmdc:mga08x19_512751_c1 nmdc:mga08x19_512751_c1_496_759 86
223 3300050514 nmdc:mga08x19_930801_c1 nmdc:mga08x19_930801_c1_210_473 86
224 3300050515 nmdc:mga0a205_135878_c1 nmdc:mga0a205_135878_c1_965_1228 86
225 3300050515 nmdc:mga0a205_157745_c1 nmdc:mga0a205_157745_c1_445_708 86
226 3300014968 Ga0157379_10345831 Ga0157379_103458312 87
227 3300031731 Ga0307405_10003907 Ga0307405_1000390712 87
228 3300031824 Ga0307413_10001530 Ga0307413_1000153012 87
229 3300031852 Ga0307410_10004966 Ga0307410_1000496613 87
230 3300031901 Ga0307406_10004231 Ga0307406_100042318 87
231 3300031903 Ga0307407_10001057 Ga0307407_1000105714 87
232 3300031995 Ga0307409_100000501 Ga0307409_10000050119 87
233 3300032002 Ga0307416_100056806 Ga0307416_1000568067 87
234 3300032004 Ga0307414_10804425 Ga0307414_108044251 87
235 3300032005 Ga0307411_10001075 Ga0307411_100010757 87
236 3300032126 Ga0307415_100004272 Ga0307415_10000427213 87
237 3300049571 Ga0501034_0044308 Ga0501034_0044308_3773_4039 87
238 3300049571 Ga0501034_0474406 Ga0501034_0474406_859_1125 87
239 3300049578 Ga0501042_0905776 Ga0501042_0905776_268_534 87
240 3300049579 Ga0501043_0467303 Ga0501043_0467303_522_788 87
241 3300049581 Ga0501047_0851675 Ga0501047_0851675_171_437 87
242 3300049582 Ga0501048_0383996 Ga0501048_0383996_213_479 87
243 3300049583 Ga0501067_0014484 Ga0501067_0014484_224_490 87
244 3300049583 Ga0501067_0047159 Ga0501067_0047159_462_728 87
245 3300049584 Ga0501068_0008160 Ga0501068_0008160_5091_5357 87
246 3300049584 Ga0501068_0402862 Ga0501068_0402862_254_520 87
247 3300049585 Ga0501069_0008330 Ga0501069_0008330_2709_2975 87
248 3300049585 Ga0501069_0095389 Ga0501069_0095389_209_475 87
249 3300049585 Ga0501069_0183138 Ga0501069_0183138_676_942 87
250 3300049586 Ga0501070_0013050 Ga0501070_0013050_2676_2942 87
251 3300049586 Ga0501070_0032011 Ga0501070_0032011_2221_2487 87
252 3300049586 Ga0501070_0810712 Ga0501070_0810712_228_494 87
253 3300049587 Ga0501071_0012801 Ga0501071_0012801_4977_5243 87
254 3300049587 Ga0501071_0179960 Ga0501071_0179960_345_611 87
255 3300049587 Ga0501071_0207757 Ga0501071_0207757_501_764 87
256 3300049587 Ga0501071_1563448 Ga0501071_1563448_138_404 87
257 3300049588 Ga0501072_0006109 Ga0501072_0006109_3818_4084 87
258 3300049588 Ga0501072_0032455 Ga0501072_0032455_3730_3996 87
259 3300049589 Ga0501073_0073839 Ga0501073_0073839_286_552 87
260 3300049589 Ga0501073_0709010 Ga0501073_0709010_172_438 87
261 3300049590 Ga0501074_0135782 Ga0501074_0135782_97_363 87
262 3300049591 Ga0501075_0263535 Ga0501075_0263535_609_872 87
263 3300049592 Ga0501076_0054868 Ga0501076_0054868_625_891 87
264 3300049593 Ga0501077_0095096 Ga0501077_0095096_968_1231 87
265 3300049656 Ga0501209_041012 Ga0501209_041012_229_495 87
266 3300049665 Ga0501227_157341 Ga0501227_157341_186_452 87
267 3300049679 Ga0501249_028447 Ga0501249_028447_402_668 87
268 3300049741 Ga0501079_0318496 Ga0501079_0318496_97_363 87
269 3300049741 Ga0501079_0510157 Ga0501079_0510157_177_440 87
270 3300049741 Ga0501079_1322122 Ga0501079_1322122_132_398 87
271 3300049742 Ga0501080_0004569 Ga0501080_0004569_4924_5190 87
272 3300049742 Ga0501080_0051733 Ga0501080_0051733_1895_2158 87
273 3300049742 Ga0501080_0052432 Ga0501080_0052432_1878_2144 87
274 3300049742 Ga0501080_0131482 Ga0501080_0131482_1822_2088 87
275 3300049743 Ga0501081_0545407 Ga0501081_0545407_475_738 87
276 3300049744 Ga0501083_0014932 Ga0501083_0014932_96_362 87
277 3300049744 Ga0501083_0051334 Ga0501083_0051334_742_1008 87
278 3300049744 Ga0501083_0329367 Ga0501083_0329367_609_872 87
279 3300049744 Ga0501083_0523460 Ga0501083_0523460_346_612 87
280 3300049770 Ga0501273_018515 Ga0501273_018515_512_778 87
281 3300054114 Ga0501084_0032504 Ga0501084_0032504_4002_4268 87
282 3300054114 Ga0501084_0053363 Ga0501084_0053363_487_753 87
283 3300054114 Ga0501084_0111100 Ga0501084_0111100_1907_2173 87
284 3300054114 Ga0501084_0146629 Ga0501084_0146629_51_314 87
285 3300060353 Ga0501082_0019498 Ga0501082_0019498_286_552 87
286 3300060353 Ga0501082_0033970 Ga0501082_0033970_1556_1822 87
287 3300060353 Ga0501082_0407769 Ga0501082_0407769_709_975 87
288 3300060353 Ga0501082_0722994 Ga0501082_0722994_551_814 87
289 3300061734 Ga0530510_0522120 Ga0530510_0522120_111_377 87
290 3300061734 Ga0530510_0659022 Ga0530510_0659022_226_489 87
291 3300004803 Ga0058862_12815550 Ga0058862_128155501 88
292 3300005295 Ga0065707_10114865 Ga0065707_101148654 88
293 3300005336 Ga0070680_101621089 Ga0070680_1016210892 88
294 3300005340 Ga0070689_100202868 Ga0070689_1002028683 88
295 3300005353 Ga0070669_100642291 Ga0070669_1006422912 88
296 3300005355 Ga0070671_100007559 Ga0070671_1000075593 88
297 3300005356 Ga0070674_101229198 Ga0070674_1012291982 88
298 3300005364 Ga0070673_100076697 Ga0070673_1000766976 88
299 3300005440 Ga0070705_100249304 Ga0070705_1002493043 88
300 3300005441 Ga0070700_101997932 Ga0070700_1019979322 88
301 3300005444 Ga0070694_100093025 Ga0070694_1000930251 88
302 3300005444 Ga0070694_100177344 Ga0070694_1001773444 88
303 3300005445 Ga0070708_101158261 Ga0070708_1011582611 88
304 3300005457 Ga0070662_101010479 Ga0070662_1010104792 88
305 3300005458 Ga0070681_11031439 Ga0070681_110314392 88
306 3300005459 Ga0068867_101697991 Ga0068867_1016979912 88
307 3300005468 Ga0070707_100011103 Ga0070707_10001110312 88
308 3300005468 Ga0070707_100200331 Ga0070707_1002003313 88
309 3300005471 Ga0070698_100014490 Ga0070698_1000144908 88
310 3300005471 Ga0070698_100029788 Ga0070698_1000297883 88
311 3300005471 Ga0070698_100046236 Ga0070698_1000462369 88
312 3300005471 Ga0070698_100070895 Ga0070698_1000708957 88
313 3300005471 Ga0070698_100402189 Ga0070698_1004021894 88
314 3300005518 Ga0070699_100024629 Ga0070699_1000246299 88
315 3300005518 Ga0070699_100063453 Ga0070699_1000634533 88
316 3300005518 Ga0070699_100123141 Ga0070699_1001231414 88
317 3300005518 Ga0070699_100995700 Ga0070699_1009957001 88
318 3300005535 Ga0070684_100767074 Ga0070684_1007670742 88
319 3300005536 Ga0070697_101506255 Ga0070697_1015062552 88
320 3300005546 Ga0070696_100262629 Ga0070696_1002626291 88
321 3300005549 Ga0070704_100106053 Ga0070704_1001060534 88
322 3300005549 Ga0070704_100993763 Ga0070704_1009937631 88
323 3300005564 Ga0070664_100212641 Ga0070664_1002126414 88
324 3300005578 Ga0068854_101018527 Ga0068854_1010185272 88
325 3300005617 Ga0068859_100043718 Ga0068859_1000437189 88
326 3300005618 Ga0068864_102627985 Ga0068864_1026279852 88
327 3300005841 Ga0068863_100315227 Ga0068863_1003152272 88
328 3300005841 Ga0068863_100902400 Ga0068863_1009024002 88
329 3300005842 Ga0068858_100282027 Ga0068858_1002820273 88
330 3300005843 Ga0068860_100596670 Ga0068860_1005966703 88
331 3300005844 Ga0068862_100035153 Ga0068862_1000351539 88
332 3300005937 Ga0081455_10025196 Ga0081455_100251964 88
333 3300006163 Ga0070715_11035376 Ga0070715_110353761 88
334 3300006844 Ga0075428_100061239 Ga0075428_1000612398 88
335 3300006844 Ga0075428_100106239 Ga0075428_1001062394 88
336 3300006847 Ga0075431_100152648 Ga0075431_1001526484 88
337 3300006852 Ga0075433_10925755 Ga0075433_109257552 88
338 3300006852 Ga0075433_11412793 Ga0075433_114127932 88
339 3300006871 Ga0075434_100258550 Ga0075434_1002585504 88
340 3300006880 Ga0075429_100102770 Ga0075429_1001027704 88
341 3300006931 Ga0097620_100043718 Ga0097620_1000437189 88
342 3300007076 Ga0075435_100111105 Ga0075435_1001111054 88
343 3300007076 Ga0075435_100799775 Ga0075435_1007997752 88
344 3300009098 Ga0105245_11902774 Ga0105245_119027741 88
345 3300009147 Ga0114129_10113339 Ga0114129_101133393 88
346 3300009147 Ga0114129_10238790 Ga0114129_102387903 88
347 3300009147 Ga0114129_11271694 Ga0114129_112716943 88
348 3300009147 Ga0114129_11958715 Ga0114129_119587153 88
349 3300009148 Ga0105243_11051471 Ga0105243_110514712 88
350 3300009177 Ga0105248_11273287 Ga0105248_112732873 88
351 3300009177 Ga0105248_13350057 Ga0105248_133500571 88
352 3300009553 Ga0105249_10120380 Ga0105249_101203804 88
353 3300013100 Ga0157373_10944393 Ga0157373_109443932 88
354 3300013308 Ga0157375_10259312 Ga0157375_102593124 88
355 3300013308 Ga0157375_12377958 Ga0157375_123779582 88
356 3300014325 Ga0163163_10009943 Ga0163163_1000994312 88
357 3300025910 Ga0207684_10882431 Ga0207684_108824311 88
358 3300025917 Ga0207660_10372014 Ga0207660_103720143 88
359 3300025920 Ga0207649_11051461 Ga0207649_110514613 88
360 3300025922 Ga0207646_10059053 Ga0207646_100590532 88
361 3300025922 Ga0207646_10165758 Ga0207646_101657584 88
362 3300025923 Ga0207681_10784831 Ga0207681_107848312 88
363 3300025931 Ga0207644_10005299 Ga0207644_100052993 88
364 3300025933 Ga0207706_10878513 Ga0207706_108785132 88
365 3300025934 Ga0207686_10819194 Ga0207686_108191942 88
366 3300025935 Ga0207709_10173009 Ga0207709_101730092 88
367 3300025936 Ga0207670_10501346 Ga0207670_105013463 88
368 3300025941 Ga0207711_12085706 Ga0207711_120857062 88
369 3300025945 Ga0207679_10155209 Ga0207679_101552093 88
370 3300025960 Ga0207651_10022102 Ga0207651_100221023 88
371 3300025960 Ga0207651_10121492 Ga0207651_101214924 88
372 3300025986 Ga0207658_10602404 Ga0207658_106024041 88
373 3300026035 Ga0207703_10241518 Ga0207703_102415183 88
374 3300026088 Ga0207641_10949604 Ga0207641_109496042 88
375 3300026089 Ga0207648_10818425 Ga0207648_108184252 88
376 3300026095 Ga0207676_12202602 Ga0207676_122026022 88
377 3300027526 Ga0209968_1009371 Ga0209968_10093712 88
378 3300027695 Ga0209966_1007173 Ga0209966_10071734 88
379 3300027876 Ga0209974_10371913 Ga0209974_103719131 88
380 3300028380 Ga0268265_10005281 Ga0268265_100052819 88
381 3300028381 Ga0268264_10363608 Ga0268264_103636083 88
382 3300031548 Ga0307408_100140658 Ga0307408_1001406584 88
383 3300031548 Ga0307408_100217429 Ga0307408_1002174293 88
384 3300031548 Ga0307408_100292745 Ga0307408_1002927453 88
385 3300031548 Ga0307408_100731728 Ga0307408_1007317282 88
386 3300031731 Ga0307405_10113716 Ga0307405_101137163 88
387 3300031731 Ga0307405_10219766 Ga0307405_102197663 88
388 3300031731 Ga0307405_10225710 Ga0307405_102257101 88
389 3300031824 Ga0307413_10002665 Ga0307413_100026653 88
390 3300031824 Ga0307413_10031847 Ga0307413_100318474 88
391 3300031824 Ga0307413_10105379 Ga0307413_101053793 88
392 3300031824 Ga0307413_10369452 Ga0307413_103694524 88
393 3300031824 Ga0307413_10874657 Ga0307413_108746572 88
394 3300031852 Ga0307410_10000285 Ga0307410_1000028511 88
395 3300031852 Ga0307410_10005858 Ga0307410_100058588 88
396 3300031852 Ga0307410_10027373 Ga0307410_100273734 88
397 3300031852 Ga0307410_10061436 Ga0307410_100614364 88
398 3300031901 Ga0307406_10009039 Ga0307406_100090396 88
399 3300031901 Ga0307406_10030175 Ga0307406_100301754 88
400 3300031901 Ga0307406_10166791 Ga0307406_101667913 88
401 3300031903 Ga0307407_10005051 Ga0307407_100050519 88
402 3300031903 Ga0307407_10058334 Ga0307407_100583345 88
403 3300031903 Ga0307407_10618099 Ga0307407_106180992 88
404 3300031903 Ga0307407_10815099 Ga0307407_108150993 88
405 3300031903 Ga0307407_11008750 Ga0307407_110087502 88
406 3300031911 Ga0307412_10241216 Ga0307412_102412163 88
407 3300031911 Ga0307412_10902781 Ga0307412_109027813 88
408 3300031911 Ga0307412_11491734 Ga0307412_114917341 88
409 3300031995 Ga0307409_100008795 Ga0307409_1000087959 88
410 3300031995 Ga0307409_100063049 Ga0307409_1000630494 88
411 3300031995 Ga0307409_100154528 Ga0307409_1001545284 88
412 3300031995 Ga0307409_100154690 Ga0307409_1001546904 88
413 3300031995 Ga0307409_100222092 Ga0307409_1002220923 88
414 3300031995 Ga0307409_100287225 Ga0307409_1002872254 88
415 3300031995 Ga0307409_101702054 Ga0307409_1017020542 88
416 3300032002 Ga0307416_100003682 Ga0307416_1000036829 88
417 3300032002 Ga0307416_100010520 Ga0307416_10001052010 88
418 3300032002 Ga0307416_100015821 Ga0307416_10001582112 88
419 3300032002 Ga0307416_100020437 Ga0307416_1000204374 88
420 3300032002 Ga0307416_100217109 Ga0307416_1002171092 88
421 3300032002 Ga0307416_100278480 Ga0307416_1002784804 88
422 3300032002 Ga0307416_100611026 Ga0307416_1006110262 88
423 3300032004 Ga0307414_10219473 Ga0307414_102194732 88
424 3300032004 Ga0307414_10351362 Ga0307414_103513623 88
425 3300032004 Ga0307414_11421427 Ga0307414_114214271 88
426 3300032005 Ga0307411_10022708 Ga0307411_100227084 88
427 3300032005 Ga0307411_10155066 Ga0307411_101550662 88
428 3300032005 Ga0307411_10211317 Ga0307411_102113173 88
429 3300032005 Ga0307411_11040021 Ga0307411_110400212 88
430 3300032126 Ga0307415_100023019 Ga0307415_1000230196 88
431 3300032126 Ga0307415_100072922 Ga0307415_1000729224 88
432 3300032126 Ga0307415_100240821 Ga0307415_1002408213 88
433 3300032126 Ga0307415_100339846 Ga0307415_1003398463 88
434 3300032126 Ga0307415_101305711 Ga0307415_1013057111 88
435 3300032126 Ga0307415_102296005 Ga0307415_1022960051 88
436 3300034820 Ga0373959_0164898 Ga0373959_0164898_54_338 88
437 3300035119 Ga0373956_0309398 Ga0373956_0309398_85_354 88
438 3300035725 Ga0373947_0824889 Ga0373947_0824889_148_417 88
439 3300036401 Ga0373937_0114614 Ga0373937_0114614_1611_1880 88
440 3300037471 Ga0395905_0569350 Ga0395905_0569350_509_787 88
441 3300041404 Ga0439436_0073755 Ga0439436_0073755_511_798 88
442 3300041406 Ga0439439_0023621 Ga0439439_0023621_805_1092 88
443 3300041463 Ga0451804_0789277 Ga0451804_0789277_609_884 88
444 3300041486 Ga0451807_0674211 Ga0451807_0674211_195_470 88
445 3300041512 Ga0451853_2411247 Ga0451853_2411247_74_349 88
446 3300041999 Ga0439433_0080089 Ga0439433_0080089_230_496 88
447 3300042015 Ga0439462_0116722 Ga0439462_0116722_13_300 88
448 3300042156 Ga0439446_0239565 Ga0439446_0239565_261_527 88
449 3300042435 Ga0439434_0092927 Ga0439434_0092927_102_389 88
450 3300046455 Ga0495603_0058761 Ga0495603_0058761_742_1011 88
451 3300046461 Ga0495641_0033780 Ga0495641_0033780_2129_2398 88
452 3300046463 Ga0495653_0332714 Ga0495653_0332714_211_495 88
453 3300046472 Ga0495580_0083378 Ga0495580_0083378_913_1182 88
454 3300046473 Ga0495582_0004780 Ga0495582_0004780_880_1149 88
455 3300046475 Ga0495639_0160034 Ga0495639_0160034_637_906 88
456 3300046477 Ga0495664_0006539 Ga0495664_0006539_5765_6034 88
457 3300046499 Ga0495594_0002236 Ga0495594_0002236_6287_6556 88
458 3300046514 Ga0495618_0216760 Ga0495618_0216760_774_1043 88
459 3300046516 Ga0495628_0074756 Ga0495628_0074756_1423_1692 88
460 3300046516 Ga0495628_0673212 Ga0495628_0673212_178_462 88
461 3300046526 Ga0495666_0006653 Ga0495666_0006653_1518_1787 88
462 3300046533 Ga0495640_0007035 Ga0495640_0007035_7480_7749 88
463 3300046535 Ga0495586_0029015 Ga0495586_0029015_2358_2627 88
464 3300046535 Ga0495586_0193566 Ga0495586_0193566_830_1105 88
465 3300046535 Ga0495586_0260586 Ga0495586_0260586_177_461 88
466 3300046536 Ga0495587_0715865 Ga0495587_0715865_59_343 88
467 3300046559 Ga0495667_0034963 Ga0495667_0034963_1502_1771 88
468 3300046642 Ga0495634_0001123 Ga0495634_0001123_5072_5341 88
469 3300046675 Ga0495657_0169181 Ga0495657_0169181_411_695 88
470 3300046678 Ga0495599_0892523 Ga0495599_0892523_64_333 88
471 3300046681 Ga0495647_0038991 Ga0495647_0038991_796_1065 88
472 3300046683 Ga0495658_0003330 Ga0495658_0003330_2775_3044 88
473 3300046689 Ga0495613_0025046 Ga0495613_0025046_174_443 88
474 3300047319 Ga0495674_0024223 Ga0495674_0024223_353_622 88
475 3300047322 Ga0495680_0012216 Ga0495680_0012216_6644_6913 88
476 3300047471 Ga0495684_0045726 Ga0495684_0045726_2446_2715 88
477 3300049515 Ga0501292_073204 Ga0501292_073204_86_355 88
478 3300049521 Ga0501298_028743 Ga0501298_028743_333_602 88
479 3300049521 Ga0501298_126584 Ga0501298_126584_75_344 88
480 3300049580 Ga0501046_1022413 Ga0501046_1022413_262_528 88
481 3300049583 Ga0501067_0342844 Ga0501067_0342844_382_651 88
482 3300049584 Ga0501068_0251675 Ga0501068_0251675_669_938 88
483 3300049585 Ga0501069_0238224 Ga0501069_0238224_405_674 88
484 3300049587 Ga0501071_0368781 Ga0501071_0368781_627_899 88
485 3300049588 Ga0501072_1341487 Ga0501072_1341487_273_539 88
486 3300049589 Ga0501073_0062704 Ga0501073_0062704_1534_1803 88
487 3300049592 Ga0501076_0526801 Ga0501076_0526801_62_328 88
488 3300049593 Ga0501077_0009743 Ga0501077_0009743_5110_5379 88
489 3300049593 Ga0501077_0673513 Ga0501077_0673513_92_364 88
490 3300049655 Ga0501208_066406 Ga0501208_066406_299_568 88
491 3300049656 Ga0501209_036721 Ga0501209_036721_483_752 88
492 3300049661 Ga0501217_005170 Ga0501217_005170_2297_2566 88
493 3300049667 Ga0501230_038983 Ga0501230_038983_77_346 88
494 3300049668 Ga0501233_129515 Ga0501233_129515_290_559 88
495 3300049669 Ga0501235_066427 Ga0501235_066427_371_640 88
496 3300049673 Ga0501240_072036 Ga0501240_072036_294_563 88
497 3300049675 Ga0501243_054189 Ga0501243_054189_236_505 88
498 3300049675 Ga0501243_125041 Ga0501243_125041_164_433 88
499 3300049677 Ga0501247_001365 Ga0501247_001365_1614_1883 88
500 3300049680 Ga0501250_009150 Ga0501250_009150_211_480 88
501 3300049684 Ga0501255_061117 Ga0501255_061117_163_432 88
502 3300049685 Ga0501256_015384 Ga0501256_015384_290_559 88
503 3300049686 Ga0501257_033911 Ga0501257_033911_75_344 88
504 3300049688 Ga0501259_014322 Ga0501259_014322_102_371 88
505 3300049741 Ga0501079_0010761 Ga0501079_0010761_4601_4873 88
506 3300049741 Ga0501079_0147972 Ga0501079_0147972_1473_1742 88
507 3300049743 Ga0501081_0011857 Ga0501081_0011857_2488_2760 88
508 3300049743 Ga0501081_0432119 Ga0501081_0432119_208_477 88
509 3300049744 Ga0501083_0091110 Ga0501083_0091110_483_752 88
510 3300049760 Ga0501263_000777 Ga0501263_000777_2264_2533 88
511 3300049764 Ga0501267_013501 Ga0501267_013501_418_687 88
512 3300049769 Ga0501272_003966 Ga0501272_003966_753_1022 88
513 3300049824 Ga0501045_0806506 Ga0501045_0806506_84_350 88
514 3300049850 Ga0501204_012112 Ga0501204_012112_155_424 88
515 3300049853 Ga0501226_013373 Ga0501226_013373_599_868 88
516 3300050507 nmdc:mga05p37_553551_c1 nmdc:mga05p37_553551_c1_195_461 88
517 3300050507 nmdc:mga05p37_719978_c1 nmdc:mga05p37_719978_c1_433_708 88
518 3300050508 nmdc:mga09592_11913_c1 nmdc:mga09592_11913_c1_1399_1665 88
519 3300050510 nmdc:mga06r32_347205_c1 nmdc:mga06r32_347205_c1_1013_1282 88
520 3300050512 nmdc:mga0n895_489365_c1 nmdc:mga0n895_489365_c1_349_618 88
521 3300050513 nmdc:mga0rr50_1295563_c1 nmdc:mga0rr50_1295563_c1_39_305 88
522 3300050513 nmdc:mga0rr50_272117_c1 nmdc:mga0rr50_272117_c1_822_1091 88
523 3300053084 Ga0495595_0736426 Ga0495595_0736426_19_288 88
524 3300053085 Ga0495619_0335257 Ga0495619_0335257_619_888 88
525 3300054114 Ga0501084_0154746 Ga0501084_0154746_436_705 88
526 3300054114 Ga0501084_1025346 Ga0501084_1025346_77_349 88
527 3300060353 Ga0501082_0052740 Ga0501082_0052740_558_830 88
528 3300060353 Ga0501082_0651895 Ga0501082_0651895_438_704 88
529 3300060353 Ga0501082_1427867 Ga0501082_1427867_81_350 88
530 3300005293 Ga0065715_10335955 Ga0065715_103359552 89
531 3300005328 Ga0070676_10001554 Ga0070676_1000155413 89
532 3300005328 Ga0070676_11543454 Ga0070676_115434541 89
533 3300005329 Ga0070683_100731628 Ga0070683_1007316283 89
534 3300005330 Ga0070690_100220052 Ga0070690_1002200522 89
535 3300005334 Ga0068869_100431635 Ga0068869_1004316353 89
536 3300005335 Ga0070666_10039763 Ga0070666_100397633 89
537 3300005336 Ga0070680_100542498 Ga0070680_1005424983 89
538 3300005340 Ga0070689_101294659 Ga0070689_1012946592 89
539 3300005341 Ga0070691_10076548 Ga0070691_100765483 89
540 3300005344 Ga0070661_100451391 Ga0070661_1004513912 89
541 3300005344 Ga0070661_100818957 Ga0070661_1008189571 89
542 3300005347 Ga0070668_100176017 Ga0070668_1001760174 89
543 3300005354 Ga0070675_100180981 Ga0070675_1001809811 89
544 3300005354 Ga0070675_101229611 Ga0070675_1012296112 89
545 3300005355 Ga0070671_100821229 Ga0070671_1008212291 89
546 3300005356 Ga0070674_100343363 Ga0070674_1003433634 89
547 3300005364 Ga0070673_100044532 Ga0070673_1000445324 89
548 3300005364 Ga0070673_100198753 Ga0070673_1001987534 89
549 3300005364 Ga0070673_100629188 Ga0070673_1006291881 89
550 3300005365 Ga0070688_101413679 Ga0070688_1014136791 89
551 3300005366 Ga0070659_100239592 Ga0070659_1002395923 89
552 3300005367 Ga0070667_100387814 Ga0070667_1003878143 89
553 3300005438 Ga0070701_10331438 Ga0070701_103314382 89
554 3300005438 Ga0070701_10457070 Ga0070701_104570701 89
555 3300005440 Ga0070705_100061139 Ga0070705_1000611395 89
556 3300005440 Ga0070705_100335450 Ga0070705_1003354503 89
557 3300005441 Ga0070700_100027726 Ga0070700_1000277267 89
558 3300005444 Ga0070694_100047914 Ga0070694_1000479147 89
559 3300005445 Ga0070708_100021258 Ga0070708_1000212584 89
560 3300005445 Ga0070708_100684253 Ga0070708_1006842533 89
561 3300005445 Ga0070708_100996881 Ga0070708_1009968811 89
562 3300005455 Ga0070663_100501939 Ga0070663_1005019393 89
563 3300005456 Ga0070678_100006200 Ga0070678_10000620010 89
564 3300005456 Ga0070678_101783078 Ga0070678_1017830782 89
565 3300005457 Ga0070662_100000495 Ga0070662_1000004951 89
566 3300005457 Ga0070662_100390599 Ga0070662_1003905993 89
567 3300005458 Ga0070681_10343864 Ga0070681_103438641 89
568 3300005458 Ga0070681_10354334 Ga0070681_103543344 89
569 3300005458 Ga0070681_11988419 Ga0070681_119884192 89
570 3300005459 Ga0068867_102388518 Ga0068867_1023885181 89
571 3300005466 Ga0070685_10285802 Ga0070685_102858023 89
572 3300005467 Ga0070706_100813541 Ga0070706_1008135411 89
573 3300005467 Ga0070706_100959699 Ga0070706_1009596992 89
574 3300005467 Ga0070706_101017615 Ga0070706_1010176151 89
575 3300005471 Ga0070698_100005769 Ga0070698_10000576917 89
576 3300005518 Ga0070699_100029175 Ga0070699_1000291756 89
577 3300005530 Ga0070679_101294096 Ga0070679_1012940962 89
578 3300005536 Ga0070697_101164221 Ga0070697_1011642211 89
579 3300005539 Ga0068853_100468970 Ga0068853_1004689702 89
580 3300005539 Ga0068853_100654070 Ga0068853_1006540702 89
581 3300005539 Ga0068853_101596348 Ga0068853_1015963482 89
582 3300005543 Ga0070672_102120639 Ga0070672_1021206391 89
583 3300005544 Ga0070686_100561210 Ga0070686_1005612102 89
584 3300005544 Ga0070686_100815594 Ga0070686_1008155942 89
585 3300005545 Ga0070695_100015722 Ga0070695_1000157224 89
586 3300005545 Ga0070695_100643180 Ga0070695_1006431801 89
587 3300005546 Ga0070696_100001655 Ga0070696_10000165510 89
588 3300005546 Ga0070696_100005337 Ga0070696_1000053374 89
589 3300005546 Ga0070696_100385249 Ga0070696_1003852493 89
590 3300005546 Ga0070696_100407520 Ga0070696_1004075201 89
591 3300005547 Ga0070693_100116783 Ga0070693_1001167833 89
592 3300005547 Ga0070693_100148892 Ga0070693_1001488924 89
593 3300005549 Ga0070704_100228522 Ga0070704_1002285223 89
594 3300005549 Ga0070704_100352090 Ga0070704_1003520903 89
595 3300005563 Ga0068855_101764356 Ga0068855_1017643562 89
596 3300005577 Ga0068857_100413384 Ga0068857_1004133844 89
597 3300005578 Ga0068854_100000444 Ga0068854_10000044412 89
598 3300005578 Ga0068854_100069785 Ga0068854_1000697857 89
599 3300005615 Ga0070702_100224648 Ga0070702_1002246481 89
600 3300005616 Ga0068852_100300801 Ga0068852_1003008011 89
601 3300005617 Ga0068859_102157460 Ga0068859_1021574601 89
602 3300005618 Ga0068864_101792466 Ga0068864_1017924662 89
603 3300005718 Ga0068866_10000625 Ga0068866_1000062515 89
604 3300005719 Ga0068861_100176742 Ga0068861_1001767423 89
605 3300005841 Ga0068863_101351026 Ga0068863_1013510261 89
606 3300005842 Ga0068858_102515552 Ga0068858_1025155521 89
607 3300005843 Ga0068860_100025031 Ga0068860_10002503110 89
608 3300005844 Ga0068862_100494809 Ga0068862_1004948093 89
609 3300006058 Ga0075432_10577971 Ga0075432_105779711 89
610 3300006163 Ga0070715_10096457 Ga0070715_100964571 89
611 3300006237 Ga0097621_100040793 Ga0097621_1000407931 89
612 3300006844 Ga0075428_101952778 Ga0075428_1019527782 89
613 3300006846 Ga0075430_100150989 Ga0075430_1001509895 89
614 3300006847 Ga0075431_100018917 Ga0075431_1000189174 89
615 3300006852 Ga0075433_10030828 Ga0075433_100308287 89
616 3300006871 Ga0075434_100126654 Ga0075434_1001266544 89
617 3300006881 Ga0068865_100450966 Ga0068865_1004509662 89
618 3300006881 Ga0068865_102120411 Ga0068865_1021204111 89
619 3300006914 Ga0075436_100434782 Ga0075436_1004347823 89
620 3300006931 Ga0097620_102156521 Ga0097620_1021565212 89
621 3300007076 Ga0075435_100313249 Ga0075435_1003132493 89
622 3300009093 Ga0105240_10152415 Ga0105240_101524154 89
623 3300009094 Ga0111539_10475690 Ga0111539_104756903 89
624 3300009098 Ga0105245_10020560 Ga0105245_100205609 89
625 3300009098 Ga0105245_11323001 Ga0105245_113230011 89
626 3300009147 Ga0114129_10384224 Ga0114129_103842242 89
627 3300009148 Ga0105243_10286031 Ga0105243_102860313 89
628 3300009148 Ga0105243_11961932 Ga0105243_119619321 89
629 3300009174 Ga0105241_12192956 Ga0105241_121929562 89
630 3300009176 Ga0105242_10007285 Ga0105242_1000728513 89
631 3300009177 Ga0105248_10090668 Ga0105248_100906683 89
632 3300009177 Ga0105248_11862803 Ga0105248_118628032 89
633 3300009177 Ga0105248_12579348 Ga0105248_125793481 89
634 3300009551 Ga0105238_10763200 Ga0105238_107632002 89
635 3300009551 Ga0105238_10931241 Ga0105238_109312413 89
636 3300009553 Ga0105249_12651511 Ga0105249_126515111 89
637 3300010375 Ga0105239_10039556 Ga0105239_100395565 89
638 3300010375 Ga0105239_10443774 Ga0105239_104437744 89
639 3300011119 Ga0105246_10040974 Ga0105246_100409743 89
640 3300013100 Ga0157373_10824432 Ga0157373_108244321 89
641 3300013297 Ga0157378_10018282 Ga0157378_100182829 89
642 3300013306 Ga0163162_10396518 Ga0163162_103965183 89
643 3300013306 Ga0163162_10422599 Ga0163162_104225994 89
644 3300013307 Ga0157372_10703184 Ga0157372_107031843 89
645 3300013307 Ga0157372_12789528 Ga0157372_127895282 89
646 3300013308 Ga0157375_10392073 Ga0157375_103920734 89
647 3300013308 Ga0157375_10980544 Ga0157375_109805443 89
648 3300014326 Ga0157380_10119060 Ga0157380_101190605 89
649 3300014326 Ga0157380_10475785 Ga0157380_104757853 89
650 3300014326 Ga0157380_11090769 Ga0157380_110907692 89
651 3300014745 Ga0157377_10169018 Ga0157377_101690181 89
652 3300014745 Ga0157377_10657126 Ga0157377_106571262 89
653 3300014968 Ga0157379_10654301 Ga0157379_106543012 89
654 3300014969 Ga0157376_10507677 Ga0157376_105076772 89
655 3300017792 Ga0163161_10050412 Ga0163161_100504121 89
656 3300025899 Ga0207642_10000869 Ga0207642_100008694 89
657 3300025907 Ga0207645_10002969 Ga0207645_1000296914 89
658 3300025908 Ga0207643_10007495 Ga0207643_1000749511 89
659 3300025911 Ga0207654_10190775 Ga0207654_101907754 89
660 3300025912 Ga0207707_11115247 Ga0207707_111152472 89
661 3300025912 Ga0207707_11209998 Ga0207707_112099981 89
662 3300025914 Ga0207671_11284985 Ga0207671_112849851 89
663 3300025917 Ga0207660_10253121 Ga0207660_102531214 89
664 3300025917 Ga0207660_10441767 Ga0207660_104417673 89
665 3300025918 Ga0207662_10070949 Ga0207662_100709495 89
666 3300025919 Ga0207657_11151772 Ga0207657_111517722 89
667 3300025923 Ga0207681_10162842 Ga0207681_101628421 89
668 3300025924 Ga0207694_10765988 Ga0207694_107659883 89
669 3300025924 Ga0207694_11852719 Ga0207694_118527191 89
670 3300025926 Ga0207659_10076987 Ga0207659_100769873 89
671 3300025926 Ga0207659_11569423 Ga0207659_115694232 89
672 3300025927 Ga0207687_10361616 Ga0207687_103616161 89
673 3300025931 Ga0207644_10223074 Ga0207644_102230743 89
674 3300025932 Ga0207690_10812354 Ga0207690_108123541 89
675 3300025933 Ga0207706_10000025 Ga0207706_1000002569 89
676 3300025933 Ga0207706_10174699 Ga0207706_101746993 89
677 3300025934 Ga0207686_10001115 Ga0207686_1000111513 89
678 3300025935 Ga0207709_10032436 Ga0207709_100324361 89
679 3300025935 Ga0207709_10693245 Ga0207709_106932452 89
680 3300025936 Ga0207670_10987243 Ga0207670_109872433 89
681 3300025937 Ga0207669_10000638 Ga0207669_1000063813 89
682 3300025938 Ga0207704_10004727 Ga0207704_100047279 89
683 3300025938 Ga0207704_10861171 Ga0207704_108611712 89
684 3300025941 Ga0207711_11291209 Ga0207711_112912092 89
685 3300025942 Ga0207689_10002028 Ga0207689_1000202823 89
686 3300025949 Ga0207667_10289436 Ga0207667_102894361 89
687 3300025960 Ga0207651_10232942 Ga0207651_102329424 89
688 3300025960 Ga0207651_10539187 Ga0207651_105391872 89
689 3300025961 Ga0207712_10019662 Ga0207712_100196629 89
690 3300025961 Ga0207712_10453037 Ga0207712_104530372 89
691 3300025961 Ga0207712_11211803 Ga0207712_112118031 89
692 3300025972 Ga0207668_10182169 Ga0207668_101821693 89
693 3300025972 Ga0207668_11176157 Ga0207668_111761571 89
694 3300025981 Ga0207640_10066246 Ga0207640_100662464 89
695 3300025986 Ga0207658_10219081 Ga0207658_102190813 89
696 3300026035 Ga0207703_10159851 Ga0207703_101598511 89
697 3300026041 Ga0207639_11080565 Ga0207639_110805652 89
698 3300026067 Ga0207678_10103624 Ga0207678_101036244 89
699 3300026075 Ga0207708_10012624 Ga0207708_100126246 89
700 3300026088 Ga0207641_10091448 Ga0207641_100914486 89
701 3300026089 Ga0207648_10000138 Ga0207648_1000013865 89
702 3300026095 Ga0207676_11194171 Ga0207676_111941712 89
703 3300026118 Ga0207675_100006697 Ga0207675_10000669716 89
704 3300026118 Ga0207675_101501757 Ga0207675_1015017572 89
705 3300026118 Ga0207675_102030572 Ga0207675_1020305722 89
706 3300026121 Ga0207683_10006013 Ga0207683_100060136 89
707 3300026121 Ga0207683_11900586 Ga0207683_119005862 89
708 3300026142 Ga0207698_10070479 Ga0207698_100704792 89
709 3300027717 Ga0209998_10175771 Ga0209998_101757711 89
710 3300027876 Ga0209974_10013888 Ga0209974_100138886 89
711 3300027907 Ga0207428_10785885 Ga0207428_107858852 89
712 3300028379 Ga0268266_10077288 Ga0268266_100772886 89
713 3300028380 Ga0268265_10227173 Ga0268265_102271733 89
714 3300028381 Ga0268264_10012146 Ga0268264_100121463 89
715 3300031548 Ga0307408_100007121 Ga0307408_1000071219 89
716 3300031548 Ga0307408_102430427 Ga0307408_1024304271 89
717 3300031731 Ga0307405_10304193 Ga0307405_103041933 89
718 3300031824 Ga0307413_10346189 Ga0307413_103461894 89
719 3300031852 Ga0307410_10531368 Ga0307410_105313683 89
720 3300031901 Ga0307406_10206536 Ga0307406_102065364 89
721 3300031911 Ga0307412_10384216 Ga0307412_103842163 89
722 3300031911 Ga0307412_12241692 Ga0307412_122416921 89
723 3300031995 Ga0307409_100102187 Ga0307409_1001021874 89
724 3300031995 Ga0307409_100597630 Ga0307409_1005976303 89
725 3300032002 Ga0307416_100016925 Ga0307416_1000169259 89
726 3300032002 Ga0307416_100429662 Ga0307416_1004296622 89
727 3300032004 Ga0307414_10273173 Ga0307414_102731732 89
728 3300032004 Ga0307414_12198084 Ga0307414_121980841 89
729 3300032005 Ga0307411_10193734 Ga0307411_101937342 89
730 3300032005 Ga0307411_11900480 Ga0307411_119004802 89
731 3300032126 Ga0307415_100434528 Ga0307415_1004345282 89
732 3300035241 Ga0373961_0163450 Ga0373961_0163450_268_540 89
733 3300038996 Ga0242420_036891 Ga0242420_036891_445_723 89
734 3300041406 Ga0439439_0020628 Ga0439439_0020628_412_702 89
735 3300041997 Ga0439431_0009377 Ga0439431_0009377_1296_1586 89
736 3300042004 Ga0439445_0097230 Ga0439445_0097230_364_633 89
737 3300042014 Ga0439457_019297 Ga0439457_019297_961_1251 89
738 3300042015 Ga0439462_0032157 Ga0439462_0032157_446_736 89
739 3300042127 Ga0450890_057475 Ga0450890_057475_14_283 89
740 3300042134 Ga0450898_084983 Ga0450898_084983_100_390 89
741 3300042147 Ga0450910_019874 Ga0450910_019874_694_966 89
742 3300042156 Ga0439446_0004079 Ga0439446_0004079_1603_1893 89
743 3300042156 Ga0439446_0076459 Ga0439446_0076459_610_924 89
744 3300042435 Ga0439434_0196020 Ga0439434_0196020_309_578 89
745 3300044901 Ga0466960_0112845 Ga0466960_0112845_165_446 89
746 3300044901 Ga0466960_0379094 Ga0466960_0379094_376_654 89
747 3300046455 Ga0495603_0129979 Ga0495603_0129979_1070_1342 89
748 3300046492 Ga0495585_0034640 Ga0495585_0034640_149_421 89
749 3300046499 Ga0495594_0010292 Ga0495594_0010292_618_890 89
750 3300046499 Ga0495594_0036897 Ga0495594_0036897_2289_2561 89
751 3300046615 Ga0495656_0218455 Ga0495656_0218455_283_567 89
752 3300046681 Ga0495647_0521172 Ga0495647_0521172_203_484 89
753 3300046684 Ga0495669_0224871 Ga0495669_0224871_26_298 89
754 3300048903 Ga0496100_0227840 Ga0496100_0227840_287_559 89
755 3300048904 Ga0496101_0047340 Ga0496101_0047340_324_617 89
756 3300048904 Ga0496101_0555486 Ga0496101_0555486_43_315 89
757 3300048904 Ga0496101_0577224 Ga0496101_0577224_35_307 89
758 3300048904 Ga0496101_0938613 Ga0496101_0938613_321_590 89
759 3300048905 Ga0496102_0280261 Ga0496102_0280261_1246_1515 89
760 3300048905 Ga0496102_0870353 Ga0496102_0870353_397_675 89
761 3300048906 Ga0496103_0233696 Ga0496103_0233696_118_390 89
762 3300048906 Ga0496103_0826536 Ga0496103_0826536_181_453 89
763 3300048907 Ga0496104_0184083 Ga0496104_0184083_29_322 89
764 3300048908 Ga0496105_0264215 Ga0496105_0264215_302_595 89
765 3300048909 Ga0496106_0003759 Ga0496106_0003759_6034_6306 89
766 3300048909 Ga0496106_0078374 Ga0496106_0078374_1682_1975 89
767 3300048909 Ga0496106_0311866 Ga0496106_0311866_403_681 89
768 3300048909 Ga0496106_0331505 Ga0496106_0331505_73_345 89
769 3300048909 Ga0496106_0887585 Ga0496106_0887585_240_509 89
770 3300048910 Ga0496107_0077151 Ga0496107_0077151_1772_2065 89
771 3300048910 Ga0496107_0806281 Ga0496107_0806281_217_495 89
772 3300048912 Ga0496109_0039889 Ga0496109_0039889_1199_1492 89
773 3300048913 Ga0496110_0007094 Ga0496110_0007094_3505_3798 89
774 3300048914 Ga0496111_0001415 Ga0496111_0001415_8252_8545 89
775 3300048915 Ga0496112_0216716 Ga0496112_0216716_1546_1839 89
776 3300048915 Ga0496112_1529824 Ga0496112_1529824_253_531 89
777 3300048917 Ga0496114_0145538 Ga0496114_0145538_180_473 89
778 3300048917 Ga0496114_0269382 Ga0496114_0269382_1117_1389 89
779 3300049522 Ga0501299_161534 Ga0501299_161534_180_449 89
780 3300049572 Ga0501036_0643821 Ga0501036_0643821_573_842 89
781 3300049576 Ga0501040_1064113 Ga0501040_1064113_165_434 89
782 3300049580 Ga0501046_0784959 Ga0501046_0784959_88_357 89
783 3300049584 Ga0501068_1161056 Ga0501068_1161056_206_478 89
784 3300049585 Ga0501069_0131449 Ga0501069_0131449_690_962 89
785 3300049586 Ga0501070_0063385 Ga0501070_0063385_575_847 89
786 3300049587 Ga0501071_0281338 Ga0501071_0281338_956_1231 89
787 3300049587 Ga0501071_1503731 Ga0501071_1503731_113_382 89
788 3300049588 Ga0501072_0420172 Ga0501072_0420172_232_507 89
789 3300049588 Ga0501072_0950269 Ga0501072_0950269_311_580 89
790 3300049590 Ga0501074_0463936 Ga0501074_0463936_296_565 89
791 3300049593 Ga0501077_0572658 Ga0501077_0572658_363_635 89
792 3300049741 Ga0501079_1260629 Ga0501079_1260629_100_375 89
793 3300049743 Ga0501081_0164473 Ga0501081_0164473_1215_1484 89
794 3300049824 Ga0501045_0485282 Ga0501045_0485282_52_321 89
795 3300050507 nmdc:mga05p37_565454_c1 nmdc:mga05p37_565454_c1_103_372 89
796 3300050509 nmdc:mga0qj67_54443_c1 nmdc:mga0qj67_54443_c1_2855_3127 89
797 3300050510 nmdc:mga06r32_52016_c1 nmdc:mga06r32_52016_c1_623_895 89
798 3300050511 nmdc:mga08y16_498272_c1 nmdc:mga08y16_498272_c1_485_757 89
799 3300050512 nmdc:mga0n895_44735_c1 nmdc:mga0n895_44735_c1_1052_1321 89
800 3300050513 nmdc:mga0rr50_226862_c1 nmdc:mga0rr50_226862_c1_558_827 89
801 3300050514 nmdc:mga08x19_603223_c1 nmdc:mga08x19_603223_c1_452_736 89
802 3300050515 nmdc:mga0a205_11705_c1 nmdc:mga0a205_11705_c1_3735_4004 89
803 3300054114 Ga0501084_0533641 Ga0501084_0533641_417_692 89
804 3300059421 Ga0590071_064032 Ga0590071_064032_271_543 89
805 3300059424 Ga0590075_010024 Ga0590075_010024_1443_1715 89
806 3300059426 Ga0590077_041201 Ga0590077_041201_361_633 89
807 3300060344 Ga0587071_011239 Ga0587071_011239_420_698 89
808 3300061734 Ga0530510_0461644 Ga0530510_0461644_12_284 89
809 3300031824 Ga0307413_10011873 Ga0307413_100118739 90
810 3300031852 Ga0307410_10313960 Ga0307410_103139602 90
811 3300031901 Ga0307406_10040469 Ga0307406_100404694 90
812 3300032002 Ga0307416_100538020 Ga0307416_1005380204 90
813 3300032004 Ga0307414_10054914 Ga0307414_100549143 90
814 3300032005 Ga0307411_10158432 Ga0307411_101584324 90
815 3300032126 Ga0307415_100846712 Ga0307415_1008467123 90
816 3300041997 Ga0439431_0012021 Ga0439431_0012021_960_1274 90
817 3300005444 Ga0070694_100644995 Ga0070694_1006449952 91
818 3300005445 Ga0070708_101543029 Ga0070708_1015430292 91
819 3300005467 Ga0070706_100568247 Ga0070706_1005682473 91
820 3300005518 Ga0070699_102188397 Ga0070699_1021883972 91
821 3300045976 Ga0466967_1071083 Ga0466967_1071083_282_563 91
822 3300003371 JGI26145J50221_1029825 JGI26145J50221_10298251 92
823 3300004799 Ga0058863_11744258 Ga0058863_117442582 92
824 3300004800 Ga0058861_11902585 Ga0058861_119025852 92
825 3300004803 Ga0058862_12862010 Ga0058862_128620101 92
826 3300005328 Ga0070676_10894785 Ga0070676_108947851 92
827 3300005329 Ga0070683_100942413 Ga0070683_1009424133 92
828 3300005331 Ga0070670_100407826 Ga0070670_1004078263 92
829 3300005334 Ga0068869_101492079 Ga0068869_1014920791 92
830 3300005336 Ga0070680_100048659 Ga0070680_1000486596 92
831 3300005337 Ga0070682_100546693 Ga0070682_1005466932 92
832 3300005339 Ga0070660_100444041 Ga0070660_1004440413 92
833 3300005344 Ga0070661_100083639 Ga0070661_1000836395 92
834 3300005353 Ga0070669_101400285 Ga0070669_1014002852 92
835 3300005353 Ga0070669_101858838 Ga0070669_1018588381 92
836 3300005354 Ga0070675_101270869 Ga0070675_1012708692 92
837 3300005365 Ga0070688_100954398 Ga0070688_1009543981 92
838 3300005366 Ga0070659_100094353 Ga0070659_1000943535 92
839 3300005434 Ga0070709_10180504 Ga0070709_101805044 92
840 3300005439 Ga0070711_100034546 Ga0070711_1000345464 92
841 3300005444 Ga0070694_100280246 Ga0070694_1002802461 92
842 3300005445 Ga0070708_100034355 Ga0070708_1000343557 92
843 3300005455 Ga0070663_100075610 Ga0070663_1000756104 92
844 3300005458 Ga0070681_10128360 Ga0070681_101283603 92
845 3300005458 Ga0070681_10206973 Ga0070681_102069734 92
846 3300005467 Ga0070706_100568256 Ga0070706_1005682561 92
847 3300005467 Ga0070706_100662439 Ga0070706_1006624393 92
848 3300005468 Ga0070707_100143871 Ga0070707_1001438716 92
849 3300005468 Ga0070707_100787234 Ga0070707_1007872342 92
850 3300005471 Ga0070698_100280886 Ga0070698_1002808864 92
851 3300005518 Ga0070699_100279819 Ga0070699_1002798193 92
852 3300005518 Ga0070699_100791760 Ga0070699_1007917603 92
853 3300005530 Ga0070679_100145172 Ga0070679_1001451725 92
854 3300005535 Ga0070684_100454857 Ga0070684_1004548573 92
855 3300005539 Ga0068853_100908900 Ga0068853_1009089003 92
856 3300005543 Ga0070672_100992761 Ga0070672_1009927611 92
857 3300005545 Ga0070695_101185225 Ga0070695_1011852251 92
858 3300005546 Ga0070696_100680906 Ga0070696_1006809062 92
859 3300005546 Ga0070696_101775888 Ga0070696_1017758882 92
860 3300005547 Ga0070693_100136177 Ga0070693_1001361773 92
861 3300005563 Ga0068855_101252128 Ga0068855_1012521282 92
862 3300005564 Ga0070664_100333535 Ga0070664_1003335353 92
863 3300005577 Ga0068857_100347678 Ga0068857_1003476783 92
864 3300005578 Ga0068854_100705066 Ga0068854_1007050662 92
865 3300005615 Ga0070702_100784631 Ga0070702_1007846311 92
866 3300005616 Ga0068852_100404440 Ga0068852_1004044402 92
867 3300005617 Ga0068859_100051859 Ga0068859_1000518594 92
868 3300005618 Ga0068864_100836106 Ga0068864_1008361062 92
869 3300005618 Ga0068864_100997105 Ga0068864_1009971053 92
870 3300005618 Ga0068864_102032541 Ga0068864_1020325412 92
871 3300005841 Ga0068863_100236593 Ga0068863_1002365933 92
872 3300005842 Ga0068858_101178818 Ga0068858_1011788181 92
873 3300006175 Ga0070712_100426865 Ga0070712_1004268653 92
874 3300006844 Ga0075428_100152688 Ga0075428_1001526883 92
875 3300006846 Ga0075430_100328484 Ga0075430_1003284843 92
876 3300006846 Ga0075430_100429249 Ga0075430_1004292493 92
877 3300006847 Ga0075431_101690066 Ga0075431_1016900662 92
878 3300006852 Ga0075433_10288518 Ga0075433_102885184 92
879 3300006871 Ga0075434_100644571 Ga0075434_1006445712 92
880 3300006914 Ga0075436_100480752 Ga0075436_1004807522 92
881 3300006931 Ga0097620_100051857 Ga0097620_1000518579 92
882 3300007076 Ga0075435_100520585 Ga0075435_1005205852 92
883 3300009147 Ga0114129_10327586 Ga0114129_103275863 92
884 3300009147 Ga0114129_11139767 Ga0114129_111397673 92
885 3300010375 Ga0105239_12799455 Ga0105239_127994552 92
886 3300011119 Ga0105246_10564752 Ga0105246_105647522 92
887 3300013100 Ga0157373_10552518 Ga0157373_105525182 92
888 3300013308 Ga0157375_11897510 Ga0157375_118975101 92
889 3300014745 Ga0157377_11351813 Ga0157377_113518131 92
890 3300014968 Ga0157379_10946638 Ga0157379_109466382 92
891 3300014968 Ga0157379_11004220 Ga0157379_110042202 92
892 3300014969 Ga0157376_11128045 Ga0157376_111280452 92
893 3300020080 Ga0206350_10498630 Ga0206350_104986302 92
894 3300025906 Ga0207699_10623500 Ga0207699_106235002 92
895 3300025907 Ga0207645_10378613 Ga0207645_103786132 92
896 3300025910 Ga0207684_10229689 Ga0207684_102296893 92
897 3300025910 Ga0207684_10305111 Ga0207684_103051112 92
898 3300025910 Ga0207684_10438050 Ga0207684_104380502 92
899 3300025912 Ga0207707_10098552 Ga0207707_100985525 92
900 3300025912 Ga0207707_10170477 Ga0207707_101704774 92
901 3300025912 Ga0207707_11201620 Ga0207707_112016202 92
902 3300025916 Ga0207663_10079124 Ga0207663_100791244 92
903 3300025917 Ga0207660_10941522 Ga0207660_109415222 92
904 3300025919 Ga0207657_10511511 Ga0207657_105115112 92
905 3300025921 Ga0207652_10321015 Ga0207652_103210154 92
906 3300025922 Ga0207646_10036746 Ga0207646_100367467 92
907 3300025922 Ga0207646_10452978 Ga0207646_104529783 92
908 3300025925 Ga0207650_10522056 Ga0207650_105220562 92
909 3300025932 Ga0207690_10064627 Ga0207690_100646273 92
910 3300025934 Ga0207686_11160440 Ga0207686_111604402 92
911 3300025939 Ga0207665_10589027 Ga0207665_105890272 92
912 3300025942 Ga0207689_10457749 Ga0207689_104577491 92
913 3300025944 Ga0207661_10960756 Ga0207661_109607563 92
914 3300025945 Ga0207679_10456129 Ga0207679_104561292 92
915 3300025945 Ga0207679_11739576 Ga0207679_117395762 92
916 3300025949 Ga0207667_11310676 Ga0207667_113106762 92
917 3300025981 Ga0207640_11598659 Ga0207640_115986592 92
918 3300026041 Ga0207639_10270901 Ga0207639_102709012 92
919 3300026067 Ga0207678_10128015 Ga0207678_101280154 92
920 3300026067 Ga0207678_10712722 Ga0207678_107127223 92
921 3300026095 Ga0207676_10219571 Ga0207676_102195712 92
922 3300026095 Ga0207676_10771069 Ga0207676_107710692 92
923 3300026116 Ga0207674_10347999 Ga0207674_103479993 92
924 3300026116 Ga0207674_10351745 Ga0207674_103517453 92
925 3300027543 Ga0209999_1036477 Ga0209999_10364772 92
926 3300027614 Ga0209970_1041124 Ga0209970_10411242 92
927 3300027682 Ga0209971_1005664 Ga0209971_10056643 92
928 3300027717 Ga0209998_10090134 Ga0209998_100901341 92
929 3300027876 Ga0209974_10007380 Ga0209974_100073808 92
930 3300027907 Ga0207428_10277396 Ga0207428_102773964 92
931 3300028381 Ga0268264_12637842 Ga0268264_126378421 92
932 3300031548 Ga0307408_100281869 Ga0307408_1002818692 92
933 3300031548 Ga0307408_101364086 Ga0307408_1013640862 92
934 3300031731 Ga0307405_10163077 Ga0307405_101630773 92
935 3300031824 Ga0307413_10012580 Ga0307413_100125802 92
936 3300031824 Ga0307413_10130690 Ga0307413_101306901 92
937 3300031824 Ga0307413_10319626 Ga0307413_103196262 92
938 3300031852 Ga0307410_10013117 Ga0307410_100131174 92
939 3300031852 Ga0307410_10599876 Ga0307410_105998762 92
940 3300031903 Ga0307407_10094272 Ga0307407_100942722 92
941 3300031911 Ga0307412_10249970 Ga0307412_102499702 92
942 3300031911 Ga0307412_12006291 Ga0307412_120062912 92
943 3300031995 Ga0307409_100028220 Ga0307409_1000282209 92
944 3300031995 Ga0307409_100698018 Ga0307409_1006980183 92
945 3300031995 Ga0307409_101183516 Ga0307409_1011835162 92
946 3300032002 Ga0307416_100089622 Ga0307416_1000896225 92
947 3300032002 Ga0307416_100278279 Ga0307416_1002782791 92
948 3300032002 Ga0307416_101561833 Ga0307416_1015618332 92
949 3300032002 Ga0307416_101748361 Ga0307416_1017483613 92
950 3300032004 Ga0307414_10030049 Ga0307414_100300492 92
951 3300032004 Ga0307414_12008444 Ga0307414_120084441 92
952 3300032005 Ga0307411_10061799 Ga0307411_100617995 92
953 3300032005 Ga0307411_10083987 Ga0307411_100839875 92
954 3300032005 Ga0307411_10168662 Ga0307411_101686623 92
955 3300032126 Ga0307415_100161299 Ga0307415_1001612993 92
956 3300032126 Ga0307415_100416479 Ga0307415_1004164793 92
957 3300032126 Ga0307415_101188383 Ga0307415_1011883833 92
958 3300032126 Ga0307415_101975427 Ga0307415_1019754272 92
959 3300034816 Ga0373930_0205149 Ga0373930_0205149_123_410 92
960 3300034820 Ga0373959_0015002 Ga0373959_0015002_958_1242 92
961 3300035083 Ga0373926_0275828 Ga0373926_0275828_299_583 92
962 3300035084 Ga0373928_0019246 Ga0373928_0019246_404_691 92
963 3300035085 Ga0373929_0048444 Ga0373929_0048444_111_398 92
964 3300035085 Ga0373929_0141169 Ga0373929_0141169_309_596 92
965 3300035088 Ga0373940_0010034 Ga0373940_0010034_661_948 92
966 3300035088 Ga0373940_0068857 Ga0373940_0068857_100_384 92
967 3300035090 Ga0373949_0098380 Ga0373949_0098380_75_359 92
968 3300035091 Ga0373951_0028079 Ga0373951_0028079_341_628 92
969 3300035112 Ga0373932_0032020 Ga0373932_0032020_632_910 92
970 3300035112 Ga0373932_0071714 Ga0373932_0071714_267_554 92
971 3300035114 Ga0373939_0003994 Ga0373939_0003994_1258_1542 92
972 3300035114 Ga0373939_0252909 Ga0373939_0252909_20_307 92
973 3300035114 Ga0373939_0257797 Ga0373939_0257797_218_496 92
974 3300035115 Ga0373941_0111579 Ga0373941_0111579_309_596 92
975 3300035121 Ga0373960_0096120 Ga0373960_0096120_387_674 92
976 3300035207 Ga0373942_0088012 Ga0373942_0088012_429_716 92
977 3300035207 Ga0373942_0104546 Ga0373942_0104546_113_397 92
978 3300035241 Ga0373961_0017856 Ga0373961_0017856_44_328 92
979 3300035241 Ga0373961_0110993 Ga0373961_0110993_399_686 92
980 3300035241 Ga0373961_0232718 Ga0373961_0232718_39_317 92
981 3300035242 Ga0373962_0081746 Ga0373962_0081746_288_575 92
982 3300035691 Ga0373931_0113596 Ga0373931_0113596_105_383 92
983 3300035691 Ga0373931_0118715 Ga0373931_0118715_838_1122 92
984 3300035691 Ga0373931_0156788 Ga0373931_0156788_1015_1302 92
985 3300035692 Ga0373935_0136746 Ga0373935_0136746_374_658 92
986 3300037068 Ga0373925_0405252 Ga0373925_0405252_625_912 92
987 3300037471 Ga0395905_0552337 Ga0395905_0552337_272_550 92
988 3300037471 Ga0395905_0622518 Ga0395905_0622518_608_895 92
989 3300037471 Ga0395905_0763736 Ga0395905_0763736_108_395 92
990 3300038443 Ga0395901_0384581 Ga0395901_0384581_465_752 92
991 3300038698 Ga0242419_003452 Ga0242419_003452_748_1035 92
992 3300038996 Ga0242420_006765 Ga0242420_006765_1071_1358 92
993 3300041441 Ga0451787_750746 Ga0451787_750746_235_513 92
994 3300042001 Ga0439441_137200 Ga0439441_137200_108_386 92
995 3300042005 Ga0439448_0208916 Ga0439448_0208916_57_344 92
996 3300042007 Ga0439449_0234577 Ga0439449_0234577_367_645 92
997 3300042127 Ga0450890_005210 Ga0450890_005210_754_1038 92
998 3300042438 Ga0439459_0033962 Ga0439459_0033962_240_524 92
999 3300042438 Ga0439459_0046509 Ga0439459_0046509_70_357 92
1000 3300042876 Ga0451577_1966498 Ga0451577_1966498_155_457 92
1001 3300044712 Ga0453684_1310675 Ga0453684_1310675_275_556 92
1002 3300045051 Ga0451576_2448933 Ga0451576_2448933_120_398 92
1003 3300045976 Ga0466967_1294393 Ga0466967_1294393_13_291 92
1004 3300046473 Ga0495582_0533567 Ga0495582_0533567_210_497 92
1005 3300046500 Ga0495596_0436381 Ga0495596_0436381_13_291 92
1006 3300046520 Ga0495637_0361447 Ga0495637_0361447_197_475 92
1007 3300046681 Ga0495647_0205031 Ga0495647_0205031_213_500 92
1008 3300048903 Ga0496100_0335590 Ga0496100_0335590_380_658 92
1009 3300048903 Ga0496100_0702735 Ga0496100_0702735_32_319 92
1010 3300048904 Ga0496101_0049962 Ga0496101_0049962_2090_2377 92
1011 3300048904 Ga0496101_1279510 Ga0496101_1279510_245_523 92
1012 3300048905 Ga0496102_0168993 Ga0496102_0168993_1751_2035 92
1013 3300048905 Ga0496102_0214892 Ga0496102_0214892_617_904 92
1014 3300048906 Ga0496103_0152380 Ga0496103_0152380_456_743 92
1015 3300048906 Ga0496103_0217461 Ga0496103_0217461_137_424 92
1016 3300048906 Ga0496103_0299737 Ga0496103_0299737_453_731 92
1017 3300048907 Ga0496104_0065574 Ga0496104_0065574_252_539 92
1018 3300048907 Ga0496104_0081866 Ga0496104_0081866_329_616 92
1019 3300048907 Ga0496104_0305788 Ga0496104_0305788_552_830 92
1020 3300048907 Ga0496104_1716414 Ga0496104_1716414_223_510 92
1021 3300048908 Ga0496105_0104474 Ga0496105_0104474_1038_1325 92
1022 3300048908 Ga0496105_0132121 Ga0496105_0132121_618_896 92
1023 3300048909 Ga0496106_0128300 Ga0496106_0128300_351_638 92
1024 3300048909 Ga0496106_0814105 Ga0496106_0814105_74_361 92
1025 3300048910 Ga0496107_0748661 Ga0496107_0748661_383_670 92
1026 3300048910 Ga0496107_0827155 Ga0496107_0827155_35_322 92
1027 3300048910 Ga0496107_1064501 Ga0496107_1064501_18_296 92
1028 3300048911 Ga0496108_0012348 Ga0496108_0012348_4780_5067 92
1029 3300048911 Ga0496108_0076691 Ga0496108_0076691_890_1177 92
1030 3300048911 Ga0496108_0167980 Ga0496108_0167980_1246_1524 92
1031 3300048912 Ga0496109_0173149 Ga0496109_0173149_634_921 92
1032 3300048912 Ga0496109_0434182 Ga0496109_0434182_320_607 92
1033 3300048912 Ga0496109_1223699 Ga0496109_1223699_382_660 92
1034 3300048913 Ga0496110_0451480 Ga0496110_0451480_497_784 92
1035 3300048913 Ga0496110_0537967 Ga0496110_0537967_512_790 92
1036 3300048914 Ga0496111_0093771 Ga0496111_0093771_989_1267 92
1037 3300048914 Ga0496111_0190057 Ga0496111_0190057_634_921 92
1038 3300048914 Ga0496111_0228735 Ga0496111_0228735_192_479 92
1039 3300048915 Ga0496112_0024016 Ga0496112_0024016_326_613 92
1040 3300048915 Ga0496112_0053839 Ga0496112_0053839_1914_2201 92
1041 3300048916 Ga0496113_0063896 Ga0496113_0063896_1889_2176 92
1042 3300048916 Ga0496113_0142208 Ga0496113_0142208_110_397 92
1043 3300048916 Ga0496113_1315942 Ga0496113_1315942_55_333 92
1044 3300048917 Ga0496114_0047313 Ga0496114_0047313_964_1251 92
1045 3300048917 Ga0496114_0215901 Ga0496114_0215901_1349_1627 92
1046 3300048918 Ga0496115_0061354 Ga0496115_0061354_861_1148 92
1047 3300049568 Ga0501031_0141051 Ga0501031_0141051_750_1028 92
1048 3300049570 Ga0501033_0282204 Ga0501033_0282204_767_1057 92
1049 3300049570 Ga0501033_0323097 Ga0501033_0323097_606_884 92
1050 3300049570 Ga0501033_0579392 Ga0501033_0579392_435_713 92
1051 3300049572 Ga0501036_0358239 Ga0501036_0358239_66_344 92
1052 3300049572 Ga0501036_0438580 Ga0501036_0438580_343_621 92
1053 3300049573 Ga0501037_0072122 Ga0501037_0072122_291_569 92
1054 3300049573 Ga0501037_0707889 Ga0501037_0707889_153_443 92
1055 3300049574 Ga0501038_0112160 Ga0501038_0112160_1880_2158 92
1056 3300049574 Ga0501038_0328376 Ga0501038_0328376_673_963 92
1057 3300049574 Ga0501038_0946762 Ga0501038_0946762_204_494 92
1058 3300049574 Ga0501038_1086756 Ga0501038_1086756_244_522 92
1059 3300049574 Ga0501038_1109192 Ga0501038_1109192_271_549 92
1060 3300049575 Ga0501039_0112345 Ga0501039_0112345_118_396 92
1061 3300049575 Ga0501039_0283824 Ga0501039_0283824_451_729 92
1062 3300049575 Ga0501039_0602451 Ga0501039_0602451_370_660 92
1063 3300049576 Ga0501040_0080718 Ga0501040_0080718_1736_2014 92
1064 3300049576 Ga0501040_0114192 Ga0501040_0114192_712_1002 92
1065 3300049576 Ga0501040_0303360 Ga0501040_0303360_461_739 92
1066 3300049576 Ga0501040_0791412 Ga0501040_0791412_174_464 92
1067 3300049576 Ga0501040_0975250 Ga0501040_0975250_108_386 92
1068 3300049577 Ga0501041_0056716 Ga0501041_0056716_1298_1576 92
1069 3300049577 Ga0501041_0206300 Ga0501041_0206300_177_467 92
1070 3300049577 Ga0501041_0381060 Ga0501041_0381060_505_783 92
1071 3300049577 Ga0501041_0432310 Ga0501041_0432310_385_675 92
1072 3300049578 Ga0501042_0330152 Ga0501042_0330152_643_921 92
1073 3300049579 Ga0501043_0608566 Ga0501043_0608566_70_348 92
1074 3300049580 Ga0501046_0206933 Ga0501046_0206933_1071_1349 92
1075 3300049580 Ga0501046_0293363 Ga0501046_0293363_732_1022 92
1076 3300049582 Ga0501048_0007522 Ga0501048_0007522_1505_1783 92
1077 3300049582 Ga0501048_0119600 Ga0501048_0119600_713_991 92
1078 3300049582 Ga0501048_0307985 Ga0501048_0307985_709_999 92
1079 3300049582 Ga0501048_0468939 Ga0501048_0468939_415_705 92
1080 3300049582 Ga0501048_0916162 Ga0501048_0916162_283_561 92
1081 3300049583 Ga0501067_0031279 Ga0501067_0031279_168_446 92
1082 3300049583 Ga0501067_0185227 Ga0501067_0185227_787_1065 92
1083 3300049583 Ga0501067_0354778 Ga0501067_0354778_71_358 92
1084 3300049584 Ga0501068_0831621 Ga0501068_0831621_280_570 92
1085 3300049585 Ga0501069_0054197 Ga0501069_0054197_1653_1940 92
1086 3300049585 Ga0501069_0168546 Ga0501069_0168546_692_970 92
1087 3300049585 Ga0501069_0429712 Ga0501069_0429712_387_665 92
1088 3300049586 Ga0501070_0222680 Ga0501070_0222680_638_928 92
1089 3300049586 Ga0501070_0973915 Ga0501070_0973915_19_306 92
1090 3300049586 Ga0501070_1109598 Ga0501070_1109598_13_291 92
1091 3300049587 Ga0501071_0030822 Ga0501071_0030822_857_1135 92
1092 3300049587 Ga0501071_0695360 Ga0501071_0695360_437_715 92
1093 3300049587 Ga0501071_0819882 Ga0501071_0819882_120_398 92
1094 3300049588 Ga0501072_0233391 Ga0501072_0233391_620_898 92
1095 3300049588 Ga0501072_0364972 Ga0501072_0364972_477_755 92
1096 3300049588 Ga0501072_0410843 Ga0501072_0410843_488_766 92
1097 3300049588 Ga0501072_0459184 Ga0501072_0459184_526_816 92
1098 3300049589 Ga0501073_0438172 Ga0501073_0438172_345_623 92
1099 3300049590 Ga0501074_0064396 Ga0501074_0064396_1116_1394 92
1100 3300049590 Ga0501074_0237463 Ga0501074_0237463_602_880 92
1101 3300049590 Ga0501074_0264170 Ga0501074_0264170_553_843 92
1102 3300049590 Ga0501074_0588199 Ga0501074_0588199_152_442 92
1103 3300049591 Ga0501075_0006835 Ga0501075_0006835_6945_7223 92
1104 3300049591 Ga0501075_0039029 Ga0501075_0039029_12_302 92
1105 3300049591 Ga0501075_0197437 Ga0501075_0197437_1169_1447 92
1106 3300049591 Ga0501075_0567145 Ga0501075_0567145_175_465 92
1107 3300049592 Ga0501076_0006442 Ga0501076_0006442_5891_6181 92
1108 3300049592 Ga0501076_0047582 Ga0501076_0047582_1172_1450 92
1109 3300049592 Ga0501076_0228738 Ga0501076_0228738_30_308 92
1110 3300049592 Ga0501076_1211718 Ga0501076_1211718_194_484 92
1111 3300049593 Ga0501077_0002603 Ga0501077_0002603_4614_4904 92
1112 3300049593 Ga0501077_0015471 Ga0501077_0015471_3030_3308 92
1113 3300049593 Ga0501077_0048237 Ga0501077_0048237_2037_2315 92
1114 3300049741 Ga0501079_0020338 Ga0501079_0020338_480_770 92
1115 3300049741 Ga0501079_0025157 Ga0501079_0025157_87_365 92
1116 3300049741 Ga0501079_0506313 Ga0501079_0506313_22_312 92
1117 3300049741 Ga0501079_0513137 Ga0501079_0513137_398_676 92
1118 3300049742 Ga0501080_0130656 Ga0501080_0130656_1107_1385 92
1119 3300049742 Ga0501080_0212338 Ga0501080_0212338_655_945 92
1120 3300049742 Ga0501080_0740196 Ga0501080_0740196_519_797 92
1121 3300049743 Ga0501081_0049086 Ga0501081_0049086_1127_1405 92
1122 3300049743 Ga0501081_0445598 Ga0501081_0445598_580_870 92
1123 3300049743 Ga0501081_0456626 Ga0501081_0456626_95_373 92
1124 3300049744 Ga0501083_0336790 Ga0501083_0336790_83_361 92
1125 3300049744 Ga0501083_0553865 Ga0501083_0553865_282_572 92
1126 3300049779 Ga0501283_046396 Ga0501283_046396_45_329 92
1127 3300049822 Ga0501035_0946183 Ga0501035_0946183_119_397 92
1128 3300049822 Ga0501035_1123039 Ga0501035_1123039_81_371 92
1129 3300049823 Ga0501044_0891303 Ga0501044_0891303_224_502 92
1130 3300049823 Ga0501044_1357639 Ga0501044_1357639_207_497 92
1131 3300049824 Ga0501045_0069371 Ga0501045_0069371_1722_2000 92
1132 3300049824 Ga0501045_0101271 Ga0501045_0101271_504_794 92
1133 3300049824 Ga0501045_0231212 Ga0501045_0231212_1004_1282 92
1134 3300050507 nmdc:mga05p37_1968370_c1 nmdc:mga05p37_1968370_c1_11_313 92
1135 3300050507 nmdc:mga05p37_227975_c1 nmdc:mga05p37_227975_c1_299_577 92
1136 3300050507 nmdc:mga05p37_843703_c1 nmdc:mga05p37_843703_c1_479_757 92
1137 3300050509 nmdc:mga0qj67_954959_c1 nmdc:mga0qj67_954959_c1_240_542 92
1138 3300050510 nmdc:mga06r32_1172073_c1 nmdc:mga06r32_1172073_c1_67_345 92
1139 3300050511 nmdc:mga08y16_116742_c1 nmdc:mga08y16_116742_c1_2471_2749 92
1140 3300050511 nmdc:mga08y16_2039352_c1 nmdc:mga08y16_2039352_c1_231_509 92
1141 3300050513 nmdc:mga0rr50_1208234_c1 nmdc:mga0rr50_1208234_c1_213_500 92
1142 3300050513 nmdc:mga0rr50_491500_c1 nmdc:mga0rr50_491500_c1_363_647 92
1143 3300050513 nmdc:mga0rr50_840081_c1 nmdc:mga0rr50_840081_c1_188_475 92
1144 3300050514 nmdc:mga08x19_535547_c1 nmdc:mga08x19_535547_c1_404_688 92
1145 3300050515 nmdc:mga0a205_1311424_c1 nmdc:mga0a205_1311424_c1_187_474 92
1146 3300050515 nmdc:mga0a205_471649_c1 nmdc:mga0a205_471649_c1_434_721 92
1147 3300053078 Ga0495612_0197095 Ga0495612_0197095_329_613 92
1148 3300054114 Ga0501084_0021009 Ga0501084_0021009_1783_2061 92
1149 3300054114 Ga0501084_0055496 Ga0501084_0055496_22_312 92
1150 3300054114 Ga0501084_0177220 Ga0501084_0177220_1077_1355 92
1151 3300054114 Ga0501084_0290002 Ga0501084_0290002_1028_1318 92
1152 3300054114 Ga0501084_0291972 Ga0501084_0291972_1048_1326 92
1153 3300059421 Ga0590071_003425 Ga0590071_003425_1220_1498 92
1154 3300059421 Ga0590071_081582 Ga0590071_081582_185_469 92
1155 3300059423 Ga0590074_004419 Ga0590074_004419_1691_1969 92
1156 3300059423 Ga0590074_056058 Ga0590074_056058_195_473 92
1157 3300059426 Ga0590077_023866 Ga0590077_023866_667_945 92
1158 3300060353 Ga0501082_0052165 Ga0501082_0052165_346_624 92
1159 3300060353 Ga0501082_0114169 Ga0501082_0114169_1397_1687 92
1160 3300060353 Ga0501082_0154711 Ga0501082_0154711_1307_1585 92
1161 3300060353 Ga0501082_0202643 Ga0501082_0202643_761_1051 92
1162 3300060353 Ga0501082_1678475 Ga0501082_1678475_186_464 92
1163 3300061734 Ga0530510_0092411 Ga0530510_0092411_332_610 92
1164 3300061734 Ga0530510_0362046 Ga0530510_0362046_179_457 92
1165 3300061734 Ga0530510_0375174 Ga0530510_0375174_405_683 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

25

94

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4d-assembly2.cif.gz_ED e. coli release factor 1 bound to the 70s ribosome in response to a pseudouridylated stop codon 0.9601 12 90
1i96-assembly1.cif.gz_Q crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) 0.9557 12 92
4v8c-assembly1.cif.gz_CT crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). 0.9551 12 92
4v9k-assembly2.cif.gz_CQ 70s ribosome translocation intermediate gdpnp-i containing elongation factor efg/gdpnp, mrna, and trna bound in the pe*/e state. 0.9482 12 89
8qpp-assembly1.cif.gz_Q bacillus subtilis muts2-collided disome complex (stalled 70s) 0.9474 12 92
ID Description Score Start End Superfamily
af_P54036_1_116_2.40.50.1000 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.952 13 90 2.40.50.1000
3ms0Q00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9513 12 89 2.40.50.140
af_Q2FW15_6_86_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9442 12 92 2.40.50.140
af_Q9LHN1_1_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9424 13 92 2.40.50.140
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9401 13 92 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7V5WNC0-F1-model_v4 Small ribosomal subunit protein uS17 0.9784 12 92 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-B4X581-F1-model_v4 Small ribosomal subunit protein uS17 0.972 12 92 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A353QXD6-F1-model_v4 Small ribosomal subunit protein uS17 0.9707 12 92 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A7R6VYH1-F1-model_v4 Small ribosomal subunit protein uS17 0.9701 12 88 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A3B0PD33-F1-model_v4 30S ribosomal protein S17 0.9697 9 82 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
87.68 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map