F491065
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1165 | 377 | 1165 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100328484|Ga0075430_1003284843 |
| Length | 100 |
| Sequence | MAEQQQTQAEGREPAGRTRRKVRTGVVTSDKMTKTVTVSLVRRYAHPAYGKQVTRTKKVKARNVEGEGAARAGDTVRIMETRPLAKTVCWRVTEVVERAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 219 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 228 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 229 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 230 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 231 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 232 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 233 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 234 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 235 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 236 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 237 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 238 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 301 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 302 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 331 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 333 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 337 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 338 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 341 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 342 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 343 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 344 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 349 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 350 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 351 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 352 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 357 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 358 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 372 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 373 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 374 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 375 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.48 |
| Metatranscriptomes | 0.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.38 |
| Rhizosphere | 92.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI26145J50221_1029825 | 3300003371 | Bacteria | 554 |
| 2 | Ga0058863_11744258 | 3300004799 | Bacteria | 817 |
| 3 | Ga0058861_11902585 | 3300004800 | Bacteria | 912 |
| 4 | Ga0058862_12815550 | 3300004803 | Bacteria | 695 |
| 5 | Ga0058862_12862010 | 3300004803 | Bacteria | 1187 |
| 6 | Ga0065715_10095098 | 3300005293 | Bacteria | 4166 |
| 7 | Ga0065715_10308647 | 3300005293 | Bacteria | 1025 |
| 8 | Ga0065715_10335955 | 3300005293 | Bacteria | 975 |
| 9 | Ga0065715_10425513 | 3300005293 | Bacteria | 853 |
| 10 | Ga0065707_10114865 | 3300005295 | Bacteria | 2284 |
| 11 | Ga0065707_10544474 | 3300005295 | Bacteria | 725 |
| 12 | Ga0070676_10001554 | 3300005328 | Bacteria | 11626 |
| 13 | Ga0070676_10020381 | 3300005328 | Bacteria | 3700 |
| 14 | Ga0070676_10894785 | 3300005328 | Bacteria | 661 |
| 15 | Ga0070676_11543454 | 3300005328 | Bacteria | 512 |
| 16 | Ga0070683_100089391 | 3300005329 | Bacteria | 2890 |
| 17 | Ga0070683_100731628 | 3300005329 | Bacteria | 948 |
| 18 | Ga0070683_100942413 | 3300005329 | Bacteria | 828 |
| 19 | Ga0070690_100220052 | 3300005330 | Bacteria | 1330 |
| 20 | Ga0070690_101392295 | 3300005330 | Bacteria | 564 |
| 21 | Ga0070670_100407826 | 3300005331 | Bacteria | 1200 |
| 22 | Ga0070677_10147733 | 3300005333 | Bacteria | 1091 |
| 23 | Ga0068869_100170341 | 3300005334 | Bacteria | 1701 |
| 24 | Ga0068869_100431635 | 3300005334 | Bacteria | 1089 |
| 25 | Ga0068869_101492079 | 3300005334 | Bacteria | 600 |
| 26 | Ga0068869_101612082 | 3300005334 | Bacteria | 578 |
| 27 | Ga0070666_10039763 | 3300005335 | Bacteria | 3136 |
| 28 | Ga0070666_10529683 | 3300005335 | Bacteria | 856 |
| 29 | Ga0070680_100003421 | 3300005336 | Bacteria | 11843 |
| 30 | Ga0070680_100048659 | 3300005336 | Bacteria | 3455 |
| 31 | Ga0070680_100542498 | 3300005336 | Bacteria | 996 |
| 32 | Ga0070680_101030501 | 3300005336 | Bacteria | 711 |
| 33 | Ga0070680_101621089 | 3300005336 | Bacteria | 561 |
| 34 | Ga0070682_100546693 | 3300005337 | Bacteria | 905 |
| 35 | Ga0070660_100444041 | 3300005339 | Bacteria | 1076 |
| 36 | Ga0070660_100630816 | 3300005339 | Bacteria | 897 |
| 37 | Ga0070689_100202868 | 3300005340 | Bacteria | 1620 |
| 38 | Ga0070689_101294659 | 3300005340 | Bacteria | 656 |
| 39 | Ga0070691_10076548 | 3300005341 | Bacteria | 1631 |
| 40 | Ga0070661_100083639 | 3300005344 | Bacteria | 2357 |
| 41 | Ga0070661_100451391 | 3300005344 | Bacteria | 1023 |
| 42 | Ga0070661_100818957 | 3300005344 | Bacteria | 765 |
| 43 | Ga0070692_10370865 | 3300005345 | Bacteria | 895 |
| 44 | Ga0070668_100011736 | 3300005347 | Bacteria | 6523 |
| 45 | Ga0070668_100176017 | 3300005347 | Bacteria | 1745 |
| 46 | Ga0070668_101471305 | 3300005347 | Bacteria | 622 |
| 47 | Ga0070669_100299120 | 3300005353 | Bacteria | 1294 |
| 48 | Ga0070669_100642291 | 3300005353 | Bacteria | 892 |
| 49 | Ga0070669_101400285 | 3300005353 | Unclassified | 607 |
| 50 | Ga0070669_101858838 | 3300005353 | Bacteria | 526 |
| 51 | Ga0070675_100180981 | 3300005354 | Bacteria | 1823 |
| 52 | Ga0070675_100653862 | 3300005354 | Bacteria | 955 |
| 53 | Ga0070675_101229611 | 3300005354 | Bacteria | 690 |
| 54 | Ga0070675_101270869 | 3300005354 | Bacteria | 678 |
| 55 | Ga0070671_100007559 | 3300005355 | Bacteria | 8688 |
| 56 | Ga0070671_100821229 | 3300005355 | Bacteria | 810 |
| 57 | Ga0070674_100011786 | 3300005356 | Bacteria | 5337 |
| 58 | Ga0070674_100343363 | 3300005356 | Bacteria | 1203 |
| 59 | Ga0070674_101229198 | 3300005356 | Bacteria | 666 |
| 60 | Ga0070673_100024204 | 3300005364 | Bacteria | 4448 |
| 61 | Ga0070673_100044532 | 3300005364 | Bacteria | 3437 |
| 62 | Ga0070673_100076697 | 3300005364 | Bacteria | 2700 |
| 63 | Ga0070673_100198753 | 3300005364 | Bacteria | 1726 |
| 64 | Ga0070673_100629188 | 3300005364 | Bacteria | 981 |
| 65 | Ga0070673_101170635 | 3300005364 | Bacteria | 720 |
| 66 | Ga0070688_100178790 | 3300005365 | Bacteria | 1470 |
| 67 | Ga0070688_100954398 | 3300005365 | Bacteria | 679 |
| 68 | Ga0070688_101413679 | 3300005365 | Bacteria | 564 |
| 69 | Ga0070659_100094353 | 3300005366 | Bacteria | 2402 |
| 70 | Ga0070659_100239592 | 3300005366 | Bacteria | 1501 |
| 71 | Ga0070659_100543630 | 3300005366 | Bacteria | 994 |
| 72 | Ga0070659_100679738 | 3300005366 | Bacteria | 889 |
| 73 | Ga0070667_100387814 | 3300005367 | Bacteria | 1270 |
| 74 | Ga0070667_100461332 | 3300005367 | Bacteria | 1162 |
| 75 | Ga0070703_10308912 | 3300005406 | Bacteria | 662 |
| 76 | Ga0070709_10180504 | 3300005434 | Bacteria | 1482 |
| 77 | Ga0070701_10331438 | 3300005438 | Bacteria | 945 |
| 78 | Ga0070701_10457070 | 3300005438 | Bacteria | 821 |
| 79 | Ga0070711_100034546 | 3300005439 | Bacteria | 3373 |
| 80 | Ga0070711_100973531 | 3300005439 | Bacteria | 727 |
| 81 | Ga0070705_100020535 | 3300005440 | Bacteria | 3499 |
| 82 | Ga0070705_100061139 | 3300005440 | Bacteria | 2237 |
| 83 | Ga0070705_100249304 | 3300005440 | Bacteria | 1245 |
| 84 | Ga0070705_100335450 | 3300005440 | Bacteria | 1097 |
| 85 | Ga0070705_100423510 | 3300005440 | Bacteria | 992 |
| 86 | Ga0070700_100027726 | 3300005441 | Bacteria | 3361 |
| 87 | Ga0070700_100620053 | 3300005441 | Bacteria | 850 |
| 88 | Ga0070700_100637552 | 3300005441 | Bacteria | 840 |
| 89 | Ga0070700_101997932 | 3300005441 | Unclassified | 503 |
| 90 | Ga0070694_100047914 | 3300005444 | Bacteria | 2873 |
| 91 | Ga0070694_100058538 | 3300005444 | Bacteria | 2622 |
| 92 | Ga0070694_100093025 | 3300005444 | Bacteria | 2119 |
| 93 | Ga0070694_100177344 | 3300005444 | Bacteria | 1574 |
| 94 | Ga0070694_100280246 | 3300005444 | Bacteria | 1271 |
| 95 | Ga0070694_100644995 | 3300005444 | Bacteria | 857 |
| 96 | Ga0070694_101652601 | 3300005444 | Bacteria | 544 |
| 97 | Ga0070708_100003800 | 3300005445 | Bacteria | 11845 |
| 98 | Ga0070708_100021258 | 3300005445 | Bacteria | 5484 |
| 99 | Ga0070708_100034355 | 3300005445 | Bacteria | 4411 |
| 100 | Ga0070708_100191282 | 3300005445 | Bacteria | 1914 |
| 101 | Ga0070708_100684253 | 3300005445 | Bacteria | 966 |
| 102 | Ga0070708_100996881 | 3300005445 | Bacteria | 786 |
| 103 | Ga0070708_101158261 | 3300005445 | Unclassified | 724 |
| 104 | Ga0070708_101543029 | 3300005445 | Unclassified | 619 |
| 105 | Ga0070708_101809990 | 3300005445 | Bacteria | 567 |
| 106 | Ga0070663_100075610 | 3300005455 | Bacteria | 2462 |
| 107 | Ga0070663_100334387 | 3300005455 | Bacteria | 1222 |
| 108 | Ga0070663_100501939 | 3300005455 | Bacteria | 1008 |
| 109 | Ga0070678_100006200 | 3300005456 | Bacteria | 6992 |
| 110 | Ga0070678_100928706 | 3300005456 | Bacteria | 797 |
| 111 | Ga0070678_101783078 | 3300005456 | Bacteria | 580 |
| 112 | Ga0070662_100000495 | 3300005457 | Bacteria | 23489 |
| 113 | Ga0070662_100014308 | 3300005457 | Bacteria | 5298 |
| 114 | Ga0070662_100390599 | 3300005457 | Bacteria | 1147 |
| 115 | Ga0070662_100939191 | 3300005457 | Bacteria | 739 |
| 116 | Ga0070662_101010479 | 3300005457 | Unclassified | 712 |
| 117 | Ga0070681_10128360 | 3300005458 | Bacteria | 2468 |
| 118 | Ga0070681_10206973 | 3300005458 | Bacteria | 1879 |
| 119 | Ga0070681_10343864 | 3300005458 | Bacteria | 1402 |
| 120 | Ga0070681_10354334 | 3300005458 | Bacteria | 1378 |
| 121 | Ga0070681_11031439 | 3300005458 | Unclassified | 743 |
| 122 | Ga0070681_11988419 | 3300005458 | Bacteria | 509 |
| 123 | Ga0068867_100033463 | 3300005459 | Bacteria | 3723 |
| 124 | Ga0068867_101697991 | 3300005459 | Bacteria | 592 |
| 125 | Ga0068867_102388518 | 3300005459 | Bacteria | 503 |
| 126 | Ga0070685_10285802 | 3300005466 | Bacteria | 1106 |
| 127 | Ga0070685_10638714 | 3300005466 | Bacteria | 770 |
| 128 | Ga0070706_100006592 | 3300005467 | Bacteria | 10949 |
| 129 | Ga0070706_100568247 | 3300005467 | Bacteria | 1055 |
| 130 | Ga0070706_100568256 | 3300005467 | Bacteria | 1055 |
| 131 | Ga0070706_100662439 | 3300005467 | Bacteria | 969 |
| 132 | Ga0070706_100813541 | 3300005467 | Bacteria | 865 |
| 133 | Ga0070706_100959699 | 3300005467 | Bacteria | 789 |
| 134 | Ga0070706_101017615 | 3300005467 | Bacteria | 764 |
| 135 | Ga0070707_100011103 | 3300005468 | Bacteria | 8389 |
| 136 | Ga0070707_100016356 | 3300005468 | Bacteria | 6962 |
| 137 | Ga0070707_100143871 | 3300005468 | Bacteria | 2320 |
| 138 | Ga0070707_100200331 | 3300005468 | Bacteria | 1946 |
| 139 | Ga0070707_100787234 | 3300005468 | Bacteria | 915 |
| 140 | Ga0070698_100005769 | 3300005471 | Bacteria | 13540 |
| 141 | Ga0070698_100014490 | 3300005471 | Bacteria | 8325 |
| 142 | Ga0070698_100029788 | 3300005471 | Bacteria | 5664 |
| 143 | Ga0070698_100046236 | 3300005471 | Bacteria | 4451 |
| 144 | Ga0070698_100070895 | 3300005471 | Bacteria | 3496 |
| 145 | Ga0070698_100280886 | 3300005471 | Bacteria | 1596 |
| 146 | Ga0070698_100402189 | 3300005471 | Bacteria | 1303 |
| 147 | Ga0070698_100933138 | 3300005471 | Bacteria | 814 |
| 148 | Ga0070699_100003912 | 3300005518 | Bacteria | 13158 |
| 149 | Ga0070699_100024629 | 3300005518 | Bacteria | 5188 |
| 150 | Ga0070699_100029175 | 3300005518 | Bacteria | 4757 |
| 151 | Ga0070699_100063453 | 3300005518 | Bacteria | 3203 |
| 152 | Ga0070699_100123141 | 3300005518 | Bacteria | 2281 |
| 153 | Ga0070699_100279819 | 3300005518 | Bacteria | 1494 |
| 154 | Ga0070699_100361549 | 3300005518 | Bacteria | 1309 |
| 155 | Ga0070699_100791760 | 3300005518 | Bacteria | 868 |
| 156 | Ga0070699_100995700 | 3300005518 | Bacteria | 768 |
| 157 | Ga0070699_102188397 | 3300005518 | Unclassified | 505 |
| 158 | Ga0070679_100014655 | 3300005530 | Bacteria | 7534 |
| 159 | Ga0070679_100145172 | 3300005530 | Bacteria | 2351 |
| 160 | Ga0070679_101294096 | 3300005530 | Bacteria | 675 |
| 161 | Ga0070684_100454857 | 3300005535 | Bacteria | 1183 |
| 162 | Ga0070684_100767074 | 3300005535 | Bacteria | 901 |
| 163 | Ga0070697_100341629 | 3300005536 | Bacteria | 1292 |
| 164 | Ga0070697_100913939 | 3300005536 | Bacteria | 779 |
| 165 | Ga0070697_101164221 | 3300005536 | Bacteria | 687 |
| 166 | Ga0070697_101506255 | 3300005536 | Bacteria | 601 |
| 167 | Ga0068853_100468970 | 3300005539 | Bacteria | 1186 |
| 168 | Ga0068853_100654070 | 3300005539 | Bacteria | 1000 |
| 169 | Ga0068853_100908900 | 3300005539 | Bacteria | 846 |
| 170 | Ga0068853_101596348 | 3300005539 | Bacteria | 632 |
| 171 | Ga0070672_100017934 | 3300005543 | Bacteria | 5106 |
| 172 | Ga0070672_100992761 | 3300005543 | Bacteria | 744 |
| 173 | Ga0070672_101465907 | 3300005543 | Bacteria | 611 |
| 174 | Ga0070672_102120639 | 3300005543 | Bacteria | 507 |
| 175 | Ga0070686_100561210 | 3300005544 | Bacteria | 894 |
| 176 | Ga0070686_100815594 | 3300005544 | Bacteria | 753 |
| 177 | Ga0070695_100015722 | 3300005545 | Bacteria | 4572 |
| 178 | Ga0070695_100067133 | 3300005545 | Bacteria | 2339 |
| 179 | Ga0070695_100643180 | 3300005545 | Bacteria | 837 |
| 180 | Ga0070695_101185225 | 3300005545 | Bacteria | 628 |
| 181 | Ga0070696_100001655 | 3300005546 | Bacteria | 14605 |
| 182 | Ga0070696_100005337 | 3300005546 | Bacteria | 8571 |
| 183 | Ga0070696_100018217 | 3300005546 | Bacteria | 4744 |
| 184 | Ga0070696_100262629 | 3300005546 | Bacteria | 1310 |
| 185 | Ga0070696_100303927 | 3300005546 | Bacteria | 1223 |
| 186 | Ga0070696_100385249 | 3300005546 | Bacteria | 1093 |
| 187 | Ga0070696_100407520 | 3300005546 | Bacteria | 1065 |
| 188 | Ga0070696_100539727 | 3300005546 | Bacteria | 933 |
| 189 | Ga0070696_100680906 | 3300005546 | Bacteria | 837 |
| 190 | Ga0070696_101416005 | 3300005546 | Unclassified | 593 |
| 191 | Ga0070696_101775888 | 3300005546 | Unclassified | 533 |
| 192 | Ga0070693_100095316 | 3300005547 | Bacteria | 1802 |
| 193 | Ga0070693_100116783 | 3300005547 | Bacteria | 1650 |
| 194 | Ga0070693_100136177 | 3300005547 | Bacteria | 1541 |
| 195 | Ga0070693_100148892 | 3300005547 | Bacteria | 1480 |
| 196 | Ga0070693_100384717 | 3300005547 | Bacteria | 969 |
| 197 | Ga0070665_100026956 | 3300005548 | Bacteria | 5786 |
| 198 | Ga0070704_100006202 | 3300005549 | Bacteria | 7025 |
| 199 | Ga0070704_100106053 | 3300005549 | Bacteria | 2129 |
| 200 | Ga0070704_100228522 | 3300005549 | Bacteria | 1516 |
| 201 | Ga0070704_100352090 | 3300005549 | Bacteria | 1243 |
| 202 | Ga0070704_100993763 | 3300005549 | Bacteria | 759 |
| 203 | Ga0068855_101252128 | 3300005563 | Bacteria | 770 |
| 204 | Ga0068855_101764356 | 3300005563 | Unclassified | 630 |
| 205 | Ga0070664_100212641 | 3300005564 | Bacteria | 1728 |
| 206 | Ga0070664_100333535 | 3300005564 | Bacteria | 1376 |
| 207 | Ga0070664_101294866 | 3300005564 | Bacteria | 688 |
| 208 | Ga0068857_100006227 | 3300005577 | Bacteria | 10201 |
| 209 | Ga0068857_100347678 | 3300005577 | Bacteria | 1373 |
| 210 | Ga0068857_100413384 | 3300005577 | Bacteria | 1257 |
| 211 | Ga0068854_100000444 | 3300005578 | Bacteria | 25595 |
| 212 | Ga0068854_100069785 | 3300005578 | Bacteria | 2567 |
| 213 | Ga0068854_100602803 | 3300005578 | Bacteria | 938 |
| 214 | Ga0068854_100705066 | 3300005578 | Bacteria | 871 |
| 215 | Ga0068854_101018527 | 3300005578 | Bacteria | 734 |
| 216 | Ga0068854_101195261 | 3300005578 | Bacteria | 681 |
| 217 | Ga0068856_100453171 | 3300005614 | Bacteria | 1304 |
| 218 | Ga0070702_100224648 | 3300005615 | Bacteria | 1258 |
| 219 | Ga0070702_100740099 | 3300005615 | Bacteria | 754 |
| 220 | Ga0070702_100784631 | 3300005615 | Bacteria | 735 |
| 221 | Ga0070702_100898855 | 3300005615 | Bacteria | 693 |
| 222 | Ga0068852_100300801 | 3300005616 | Bacteria | 1553 |
| 223 | Ga0068852_100404440 | 3300005616 | Bacteria | 1343 |
| 224 | Ga0068859_100043718 | 3300005617 | Bacteria | 4503 |
| 225 | Ga0068859_100051859 | 3300005617 | Bacteria | 4124 |
| 226 | Ga0068859_100224186 | 3300005617 | Bacteria | 1968 |
| 227 | Ga0068859_102157460 | 3300005617 | Bacteria | 615 |
| 228 | Ga0068864_100005272 | 3300005618 | Bacteria | 10592 |
| 229 | Ga0068864_100347494 | 3300005618 | Bacteria | 1399 |
| 230 | Ga0068864_100836106 | 3300005618 | Bacteria | 906 |
| 231 | Ga0068864_100997105 | 3300005618 | Bacteria | 830 |
| 232 | Ga0068864_101792466 | 3300005618 | Bacteria | 619 |
| 233 | Ga0068864_102032541 | 3300005618 | Bacteria | 581 |
| 234 | Ga0068864_102627985 | 3300005618 | Bacteria | 509 |
| 235 | Ga0068866_10000625 | 3300005718 | Bacteria | 16073 |
| 236 | Ga0068861_100176742 | 3300005719 | Bacteria | 1773 |
| 237 | Ga0068861_100242529 | 3300005719 | Bacteria | 1533 |
| 238 | Ga0068870_10134528 | 3300005840 | Bacteria | 1440 |
| 239 | Ga0068870_10304124 | 3300005840 | Bacteria | 1008 |
| 240 | Ga0068863_100236593 | 3300005841 | Bacteria | 1762 |
| 241 | Ga0068863_100289181 | 3300005841 | Bacteria | 1589 |
| 242 | Ga0068863_100315227 | 3300005841 | Bacteria | 1518 |
| 243 | Ga0068863_100902400 | 3300005841 | Bacteria | 884 |
| 244 | Ga0068863_101351026 | 3300005841 | Bacteria | 720 |
| 245 | Ga0068858_100048389 | 3300005842 | Bacteria | 3940 |
| 246 | Ga0068858_100282027 | 3300005842 | Bacteria | 1582 |
| 247 | Ga0068858_101178818 | 3300005842 | Bacteria | 753 |
| 248 | Ga0068858_102208347 | 3300005842 | Bacteria | 544 |
| 249 | Ga0068858_102515552 | 3300005842 | Bacteria | 508 |
| 250 | Ga0068860_100025031 | 3300005843 | Bacteria | 5761 |
| 251 | Ga0068860_100200274 | 3300005843 | Bacteria | 1935 |
| 252 | Ga0068860_100596670 | 3300005843 | Bacteria | 1109 |
| 253 | Ga0068862_100027479 | 3300005844 | Bacteria | 4789 |
| 254 | Ga0068862_100035153 | 3300005844 | Bacteria | 4242 |
| 255 | Ga0068862_100494809 | 3300005844 | Bacteria | 1160 |
| 256 | Ga0081455_10025196 | 3300005937 | Bacteria | 5495 |
| 257 | Ga0075432_10577971 | 3300006058 | Bacteria | 511 |
| 258 | Ga0070715_10096457 | 3300006163 | Bacteria | 1371 |
| 259 | Ga0070715_10215555 | 3300006163 | Bacteria | 984 |
| 260 | Ga0070715_11035376 | 3300006163 | Bacteria | 513 |
| 261 | Ga0070716_100330172 | 3300006173 | Bacteria | 1072 |
| 262 | Ga0070712_100426865 | 3300006175 | Bacteria | 1100 |
| 263 | Ga0097621_100040793 | 3300006237 | Bacteria | 3733 |
| 264 | Ga0075428_100061239 | 3300006844 | Bacteria | 4121 |
| 265 | Ga0075428_100106239 | 3300006844 | Bacteria | 3061 |
| 266 | Ga0075428_100152688 | 3300006844 | Bacteria | 2508 |
| 267 | Ga0075428_100271986 | 3300006844 | Bacteria | 1823 |
| 268 | Ga0075428_101952778 | 3300006844 | Bacteria | 609 |
| 269 | Ga0075430_100150989 | 3300006846 | Bacteria | 1934 |
| 270 | Ga0075430_100328484 | 3300006846 | Bacteria | 1264 |
| 271 | Ga0075430_100429249 | 3300006846 | Bacteria | 1091 |
| 272 | Ga0075431_100018917 | 3300006847 | Bacteria | 7017 |
| 273 | Ga0075431_100152648 | 3300006847 | Bacteria | 2378 |
| 274 | Ga0075431_101690066 | 3300006847 | Bacteria | 590 |
| 275 | Ga0075433_10030828 | 3300006852 | Bacteria | 4579 |
| 276 | Ga0075433_10139968 | 3300006852 | Bacteria | 2151 |
| 277 | Ga0075433_10288518 | 3300006852 | Bacteria | 1453 |
| 278 | Ga0075433_10925755 | 3300006852 | Bacteria | 760 |
| 279 | Ga0075433_11412793 | 3300006852 | Bacteria | 602 |
| 280 | Ga0075433_11839462 | 3300006852 | Bacteria | 520 |
| 281 | Ga0075434_100031426 | 3300006871 | Bacteria | 5235 |
| 282 | Ga0075434_100126654 | 3300006871 | Bacteria | 2571 |
| 283 | Ga0075434_100154946 | 3300006871 | Bacteria | 2311 |
| 284 | Ga0075434_100258550 | 3300006871 | Bacteria | 1760 |
| 285 | Ga0075434_100644571 | 3300006871 | Bacteria | 1078 |
| 286 | Ga0075434_100779527 | 3300006871 | Bacteria | 973 |
| 287 | Ga0075434_101464534 | 3300006871 | Unclassified | 692 |
| 288 | Ga0075429_100102770 | 3300006880 | Bacteria | 2495 |
| 289 | Ga0068865_100045517 | 3300006881 | Bacteria | 3008 |
| 290 | Ga0068865_100450966 | 3300006881 | Bacteria | 1063 |
| 291 | Ga0068865_102120411 | 3300006881 | Bacteria | 511 |
| 292 | Ga0075436_100005801 | 3300006914 | Bacteria | 8479 |
| 293 | Ga0075436_100434782 | 3300006914 | Bacteria | 954 |
| 294 | Ga0075436_100480752 | 3300006914 | Bacteria | 907 |
| 295 | Ga0097620_100043718 | 3300006931 | Bacteria | 4503 |
| 296 | Ga0097620_100051857 | 3300006931 | Bacteria | 4124 |
| 297 | Ga0097620_100224164 | 3300006931 | Bacteria | 1968 |
| 298 | Ga0097620_102156521 | 3300006931 | Bacteria | 615 |
| 299 | Ga0075435_100111105 | 3300007076 | Bacteria | 2280 |
| 300 | Ga0075435_100144049 | 3300007076 | Bacteria | 2000 |
| 301 | Ga0075435_100166460 | 3300007076 | Bacteria | 1859 |
| 302 | Ga0075435_100313249 | 3300007076 | Bacteria | 1343 |
| 303 | Ga0075435_100520585 | 3300007076 | Bacteria | 1029 |
| 304 | Ga0075435_100709248 | 3300007076 | Bacteria | 875 |
| 305 | Ga0075435_100799775 | 3300007076 | Bacteria | 821 |
| 306 | Ga0105240_10152415 | 3300009093 | Bacteria | 2752 |
| 307 | Ga0111539_10475690 | 3300009094 | Bacteria | 1455 |
| 308 | Ga0105245_10020560 | 3300009098 | Bacteria | 5789 |
| 309 | Ga0105245_11323001 | 3300009098 | Bacteria | 770 |
| 310 | Ga0105245_11902774 | 3300009098 | Bacteria | 648 |
| 311 | Ga0114129_10106429 | 3300009147 | Bacteria | 3874 |
| 312 | Ga0114129_10113339 | 3300009147 | Bacteria | 3739 |
| 313 | Ga0114129_10238790 | 3300009147 | Bacteria | 2444 |
| 314 | Ga0114129_10327586 | 3300009147 | Bacteria | 2035 |
| 315 | Ga0114129_10384224 | 3300009147 | Bacteria | 1854 |
| 316 | Ga0114129_11052867 | 3300009147 | Bacteria | 1021 |
| 317 | Ga0114129_11139767 | 3300009147 | Bacteria | 974 |
| 318 | Ga0114129_11271694 | 3300009147 | Bacteria | 913 |
| 319 | Ga0114129_11691990 | 3300009147 | Bacteria | 772 |
| 320 | Ga0114129_11958715 | 3300009147 | Unclassified | 709 |
| 321 | Ga0105243_10286031 | 3300009148 | Bacteria | 1487 |
| 322 | Ga0105243_11051471 | 3300009148 | Bacteria | 820 |
| 323 | Ga0105243_11961932 | 3300009148 | Bacteria | 619 |
| 324 | Ga0105241_12192956 | 3300009174 | Bacteria | 548 |
| 325 | Ga0105242_10007285 | 3300009176 | Bacteria | 8528 |
| 326 | Ga0105248_10090668 | 3300009177 | Bacteria | 3442 |
| 327 | Ga0105248_10301689 | 3300009177 | Bacteria | 1804 |
| 328 | Ga0105248_11273287 | 3300009177 | Bacteria | 832 |
| 329 | Ga0105248_11862803 | 3300009177 | Bacteria | 682 |
| 330 | Ga0105248_12579348 | 3300009177 | Unclassified | 579 |
| 331 | Ga0105248_12805151 | 3300009177 | Bacteria | 556 |
| 332 | Ga0105248_13350057 | 3300009177 | Bacteria | 509 |
| 333 | Ga0105237_10487139 | 3300009545 | Bacteria | 1239 |
| 334 | Ga0105238_10763200 | 3300009551 | Bacteria | 981 |
| 335 | Ga0105238_10931241 | 3300009551 | Bacteria | 888 |
| 336 | Ga0105249_10120380 | 3300009553 | Bacteria | 2494 |
| 337 | Ga0105249_10291620 | 3300009553 | Bacteria | 1633 |
| 338 | Ga0105249_12651511 | 3300009553 | Bacteria | 573 |
| 339 | Ga0105239_10039556 | 3300010375 | Bacteria | 5166 |
| 340 | Ga0105239_10107261 | 3300010375 | Bacteria | 3094 |
| 341 | Ga0105239_10443774 | 3300010375 | Bacteria | 1472 |
| 342 | Ga0105239_12799455 | 3300010375 | Bacteria | 569 |
| 343 | Ga0105246_10040974 | 3300011119 | Bacteria | 3129 |
| 344 | Ga0105246_10187984 | 3300011119 | Bacteria | 1596 |
| 345 | Ga0105246_10564752 | 3300011119 | Bacteria | 977 |
| 346 | Ga0157373_10552518 | 3300013100 | Bacteria | 835 |
| 347 | Ga0157373_10824432 | 3300013100 | Bacteria | 685 |
| 348 | Ga0157373_10944393 | 3300013100 | Bacteria | 641 |
| 349 | Ga0157378_10018282 | 3300013297 | Bacteria | 6153 |
| 350 | Ga0163162_10396518 | 3300013306 | Bacteria | 1513 |
| 351 | Ga0163162_10422599 | 3300013306 | Bacteria | 1465 |
| 352 | Ga0163162_12443140 | 3300013306 | Unclassified | 601 |
| 353 | Ga0163162_13090401 | 3300013306 | Bacteria | 534 |
| 354 | Ga0157372_10703184 | 3300013307 | Bacteria | 1176 |
| 355 | Ga0157372_12789528 | 3300013307 | Bacteria | 560 |
| 356 | Ga0157375_10259312 | 3300013308 | Bacteria | 1900 |
| 357 | Ga0157375_10392073 | 3300013308 | Bacteria | 1555 |
| 358 | Ga0157375_10980544 | 3300013308 | Bacteria | 986 |
| 359 | Ga0157375_11897510 | 3300013308 | Bacteria | 707 |
| 360 | Ga0157375_12377958 | 3300013308 | Bacteria | 632 |
| 361 | Ga0163163_10009943 | 3300014325 | Bacteria | 8530 |
| 362 | Ga0157380_10119060 | 3300014326 | Bacteria | 2233 |
| 363 | Ga0157380_10475785 | 3300014326 | Bacteria | 1207 |
| 364 | Ga0157380_10550087 | 3300014326 | Bacteria | 1132 |
| 365 | Ga0157380_11090769 | 3300014326 | Bacteria | 837 |
| 366 | Ga0157377_10169018 | 3300014745 | Bacteria | 1366 |
| 367 | Ga0157377_10657126 | 3300014745 | Bacteria | 755 |
| 368 | Ga0157377_10950300 | 3300014745 | Bacteria | 647 |
| 369 | Ga0157377_11351813 | 3300014745 | Bacteria | 559 |
| 370 | Ga0157379_10345831 | 3300014968 | Bacteria | 1361 |
| 371 | Ga0157379_10654301 | 3300014968 | Unclassified | 984 |
| 372 | Ga0157379_10946638 | 3300014968 | Bacteria | 819 |
| 373 | Ga0157379_11004220 | 3300014968 | Bacteria | 796 |
| 374 | Ga0157376_10507677 | 3300014969 | Bacteria | 1186 |
| 375 | Ga0157376_11128045 | 3300014969 | Bacteria | 811 |
| 376 | Ga0163161_10050412 | 3300017792 | Bacteria | 3012 |
| 377 | Ga0163161_10378295 | 3300017792 | Bacteria | 1131 |
| 378 | Ga0206350_10498630 | 3300020080 | Bacteria | 580 |
| 379 | Ga0207697_10200592 | 3300025315 | Bacteria | 877 |
| 380 | Ga0207682_10130045 | 3300025893 | Bacteria | 1123 |
| 381 | Ga0207642_10000869 | 3300025899 | Bacteria | 9430 |
| 382 | Ga0207688_10237312 | 3300025901 | Bacteria | 1102 |
| 383 | Ga0207680_10748122 | 3300025903 | Bacteria | 701 |
| 384 | Ga0207699_10623500 | 3300025906 | Bacteria | 786 |
| 385 | Ga0207645_10002969 | 3300025907 | Bacteria | 13108 |
| 386 | Ga0207645_10032454 | 3300025907 | Bacteria | 3356 |
| 387 | Ga0207645_10378613 | 3300025907 | Bacteria | 950 |
| 388 | Ga0207643_10007495 | 3300025908 | Bacteria | 5859 |
| 389 | Ga0207643_10229111 | 3300025908 | Bacteria | 1139 |
| 390 | Ga0207684_10022976 | 3300025910 | Bacteria | 5326 |
| 391 | Ga0207684_10229689 | 3300025910 | Bacteria | 1601 |
| 392 | Ga0207684_10305111 | 3300025910 | Bacteria | 1372 |
| 393 | Ga0207684_10438050 | 3300025910 | Bacteria | 1122 |
| 394 | Ga0207684_10882431 | 3300025910 | Bacteria | 753 |
| 395 | Ga0207654_10190775 | 3300025911 | Bacteria | 1343 |
| 396 | Ga0207707_10004257 | 3300025912 | Bacteria | 12664 |
| 397 | Ga0207707_10098552 | 3300025912 | Bacteria | 2555 |
| 398 | Ga0207707_10170477 | 3300025912 | Bacteria | 1902 |
| 399 | Ga0207707_11115247 | 3300025912 | Bacteria | 642 |
| 400 | Ga0207707_11201620 | 3300025912 | Bacteria | 614 |
| 401 | Ga0207707_11209998 | 3300025912 | Bacteria | 611 |
| 402 | Ga0207671_10895915 | 3300025914 | Bacteria | 701 |
| 403 | Ga0207671_11284985 | 3300025914 | Bacteria | 570 |
| 404 | Ga0207663_10079124 | 3300025916 | Bacteria | 2145 |
| 405 | Ga0207663_10775699 | 3300025916 | Bacteria | 762 |
| 406 | Ga0207660_10004139 | 3300025917 | Bacteria | 9438 |
| 407 | Ga0207660_10253121 | 3300025917 | Bacteria | 1390 |
| 408 | Ga0207660_10372014 | 3300025917 | Bacteria | 1148 |
| 409 | Ga0207660_10441767 | 3300025917 | Bacteria | 1051 |
| 410 | Ga0207660_10941522 | 3300025917 | Bacteria | 705 |
| 411 | Ga0207660_11097629 | 3300025917 | Bacteria | 648 |
| 412 | Ga0207662_10070949 | 3300025918 | Bacteria | 2108 |
| 413 | Ga0207657_10511511 | 3300025919 | Bacteria | 940 |
| 414 | Ga0207657_10939970 | 3300025919 | Bacteria | 665 |
| 415 | Ga0207657_11151772 | 3300025919 | Bacteria | 591 |
| 416 | Ga0207649_11051461 | 3300025920 | Bacteria | 641 |
| 417 | Ga0207652_10011077 | 3300025921 | Bacteria | 7269 |
| 418 | Ga0207652_10321015 | 3300025921 | Bacteria | 1398 |
| 419 | Ga0207652_11803743 | 3300025921 | Unclassified | 517 |
| 420 | Ga0207646_10036746 | 3300025922 | Bacteria | 4421 |
| 421 | Ga0207646_10059053 | 3300025922 | Bacteria | 3425 |
| 422 | Ga0207646_10165758 | 3300025922 | Bacteria | 1995 |
| 423 | Ga0207646_10314034 | 3300025922 | Bacteria | 1416 |
| 424 | Ga0207646_10452978 | 3300025922 | Bacteria | 1158 |
| 425 | Ga0207681_10037063 | 3300025923 | Bacteria | 3221 |
| 426 | Ga0207681_10162842 | 3300025923 | Bacteria | 1683 |
| 427 | Ga0207681_10784831 | 3300025923 | Bacteria | 795 |
| 428 | Ga0207694_10765988 | 3300025924 | Bacteria | 815 |
| 429 | Ga0207694_11852719 | 3300025924 | Bacteria | 506 |
| 430 | Ga0207650_10522056 | 3300025925 | Bacteria | 994 |
| 431 | Ga0207659_10065037 | 3300025926 | Bacteria | 2642 |
| 432 | Ga0207659_10076987 | 3300025926 | Bacteria | 2454 |
| 433 | Ga0207659_10330415 | 3300025926 | Bacteria | 1260 |
| 434 | Ga0207659_11569423 | 3300025926 | Bacteria | 562 |
| 435 | Ga0207687_10361616 | 3300025927 | Bacteria | 1185 |
| 436 | Ga0207644_10005299 | 3300025931 | Bacteria | 8417 |
| 437 | Ga0207644_10223074 | 3300025931 | Bacteria | 1495 |
| 438 | Ga0207690_10064627 | 3300025932 | Bacteria | 2499 |
| 439 | Ga0207690_10477202 | 3300025932 | Bacteria | 1006 |
| 440 | Ga0207690_10812354 | 3300025932 | Bacteria | 773 |
| 441 | Ga0207706_10000025 | 3300025933 | Bacteria | 150958 |
| 442 | Ga0207706_10103419 | 3300025933 | Bacteria | 2506 |
| 443 | Ga0207706_10174699 | 3300025933 | Bacteria | 1887 |
| 444 | Ga0207706_10298462 | 3300025933 | Bacteria | 1404 |
| 445 | Ga0207706_10878513 | 3300025933 | Bacteria | 758 |
| 446 | Ga0207686_10001115 | 3300025934 | Bacteria | 15582 |
| 447 | Ga0207686_10819194 | 3300025934 | Bacteria | 747 |
| 448 | Ga0207686_11160440 | 3300025934 | Bacteria | 631 |
| 449 | Ga0207709_10032436 | 3300025935 | Bacteria | 3058 |
| 450 | Ga0207709_10173009 | 3300025935 | Bacteria | 1517 |
| 451 | Ga0207709_10693245 | 3300025935 | Bacteria | 814 |
| 452 | Ga0207709_11424829 | 3300025935 | Bacteria | 574 |
| 453 | Ga0207670_10501346 | 3300025936 | Bacteria | 986 |
| 454 | Ga0207670_10987243 | 3300025936 | Bacteria | 708 |
| 455 | Ga0207669_10000638 | 3300025937 | Bacteria | 15128 |
| 456 | Ga0207669_10416317 | 3300025937 | Bacteria | 1056 |
| 457 | Ga0207704_10004727 | 3300025938 | Bacteria | 6249 |
| 458 | Ga0207704_10090959 | 3300025938 | Bacteria | 2004 |
| 459 | Ga0207704_10861171 | 3300025938 | Bacteria | 760 |
| 460 | Ga0207665_10589027 | 3300025939 | Bacteria | 867 |
| 461 | Ga0207691_10016076 | 3300025940 | Bacteria | 7109 |
| 462 | Ga0207691_11016400 | 3300025940 | Bacteria | 691 |
| 463 | Ga0207711_10234797 | 3300025941 | Bacteria | 1680 |
| 464 | Ga0207711_11288607 | 3300025941 | Bacteria | 673 |
| 465 | Ga0207711_11291209 | 3300025941 | Bacteria | 672 |
| 466 | Ga0207711_12085706 | 3300025941 | Bacteria | 510 |
| 467 | Ga0207689_10002028 | 3300025942 | Bacteria | 19145 |
| 468 | Ga0207689_10457749 | 3300025942 | Bacteria | 1067 |
| 469 | Ga0207689_11522603 | 3300025942 | Bacteria | 558 |
| 470 | Ga0207661_10029676 | 3300025944 | Bacteria | 4204 |
| 471 | Ga0207661_10960756 | 3300025944 | Bacteria | 787 |
| 472 | Ga0207679_10155209 | 3300025945 | Bacteria | 1868 |
| 473 | Ga0207679_10456129 | 3300025945 | Bacteria | 1134 |
| 474 | Ga0207679_11733348 | 3300025945 | Bacteria | 571 |
| 475 | Ga0207679_11739576 | 3300025945 | Unclassified | 570 |
| 476 | Ga0207679_12075248 | 3300025945 | Bacteria | 517 |
| 477 | Ga0207667_10289436 | 3300025949 | Bacteria | 1674 |
| 478 | Ga0207667_11310676 | 3300025949 | Bacteria | 700 |
| 479 | Ga0207651_10022102 | 3300025960 | Bacteria | 3881 |
| 480 | Ga0207651_10121492 | 3300025960 | Bacteria | 1982 |
| 481 | Ga0207651_10232942 | 3300025960 | Bacteria | 1496 |
| 482 | Ga0207651_10527058 | 3300025960 | Bacteria | 1024 |
| 483 | Ga0207651_10539187 | 3300025960 | Bacteria | 1013 |
| 484 | Ga0207712_10019662 | 3300025961 | Bacteria | 4414 |
| 485 | Ga0207712_10395073 | 3300025961 | Bacteria | 1161 |
| 486 | Ga0207712_10453037 | 3300025961 | Bacteria | 1088 |
| 487 | Ga0207712_11211803 | 3300025961 | Unclassified | 674 |
| 488 | Ga0207668_10022488 | 3300025972 | Bacteria | 4038 |
| 489 | Ga0207668_10182169 | 3300025972 | Bacteria | 1658 |
| 490 | Ga0207668_10756007 | 3300025972 | Bacteria | 858 |
| 491 | Ga0207668_11176157 | 3300025972 | Bacteria | 689 |
| 492 | Ga0207640_10066246 | 3300025981 | Bacteria | 2413 |
| 493 | Ga0207640_11598659 | 3300025981 | Bacteria | 587 |
| 494 | Ga0207658_10219081 | 3300025986 | Bacteria | 1600 |
| 495 | Ga0207658_10602404 | 3300025986 | Bacteria | 987 |
| 496 | Ga0207658_11133731 | 3300025986 | Bacteria | 715 |
| 497 | Ga0207703_10159851 | 3300026035 | Bacteria | 1972 |
| 498 | Ga0207703_10241518 | 3300026035 | Bacteria | 1624 |
| 499 | Ga0207703_11938166 | 3300026035 | Bacteria | 565 |
| 500 | Ga0207639_10270901 | 3300026041 | Bacteria | 1489 |
| 501 | Ga0207639_11080565 | 3300026041 | Bacteria | 752 |
| 502 | Ga0207678_10103624 | 3300026067 | Bacteria | 2429 |
| 503 | Ga0207678_10128015 | 3300026067 | Bacteria | 2166 |
| 504 | Ga0207678_10551442 | 3300026067 | Bacteria | 1008 |
| 505 | Ga0207678_10712722 | 3300026067 | Bacteria | 883 |
| 506 | Ga0207708_10012624 | 3300026075 | Bacteria | 6301 |
| 507 | Ga0207708_10149443 | 3300026075 | Bacteria | 1838 |
| 508 | Ga0207708_10718607 | 3300026075 | Bacteria | 855 |
| 509 | Ga0207702_10487428 | 3300026078 | Bacteria | 1200 |
| 510 | Ga0207641_10091448 | 3300026088 | Bacteria | 2663 |
| 511 | Ga0207641_10555052 | 3300026088 | Bacteria | 1120 |
| 512 | Ga0207641_10949604 | 3300026088 | Bacteria | 855 |
| 513 | Ga0207648_10000138 | 3300026089 | Bacteria | 72558 |
| 514 | Ga0207648_10016875 | 3300026089 | Bacteria | 6657 |
| 515 | Ga0207648_10818425 | 3300026089 | Bacteria | 868 |
| 516 | Ga0207648_11547059 | 3300026089 | Bacteria | 623 |
| 517 | Ga0207676_10219571 | 3300026095 | Bacteria | 1692 |
| 518 | Ga0207676_10240562 | 3300026095 | Bacteria | 1623 |
| 519 | Ga0207676_10771069 | 3300026095 | Bacteria | 936 |
| 520 | Ga0207676_11106174 | 3300026095 | Bacteria | 783 |
| 521 | Ga0207676_11194171 | 3300026095 | Bacteria | 754 |
| 522 | Ga0207676_12202602 | 3300026095 | Bacteria | 549 |
| 523 | Ga0207674_10347999 | 3300026116 | Bacteria | 1433 |
| 524 | Ga0207674_10351745 | 3300026116 | Bacteria | 1424 |
| 525 | Ga0207674_10542907 | 3300026116 | Bacteria | 1123 |
| 526 | Ga0207675_100006697 | 3300026118 | Bacteria | 10892 |
| 527 | Ga0207675_100031110 | 3300026118 | Bacteria | 4970 |
| 528 | Ga0207675_101501757 | 3300026118 | Bacteria | 694 |
| 529 | Ga0207675_102030572 | 3300026118 | Bacteria | 592 |
| 530 | Ga0207683_10006013 | 3300026121 | Bacteria | 10390 |
| 531 | Ga0207683_10756438 | 3300026121 | Bacteria | 901 |
| 532 | Ga0207683_11900586 | 3300026121 | Bacteria | 544 |
| 533 | Ga0207698_10070479 | 3300026142 | Bacteria | 2770 |
| 534 | Ga0209968_1009371 | 3300027526 | Bacteria | 1499 |
| 535 | Ga0209968_1033503 | 3300027526 | Bacteria | 864 |
| 536 | Ga0209999_1036477 | 3300027543 | Bacteria | 918 |
| 537 | Ga0209970_1041124 | 3300027614 | Bacteria | 822 |
| 538 | Ga0209971_1005664 | 3300027682 | Bacteria | 2963 |
| 539 | Ga0209966_1007173 | 3300027695 | Bacteria | 1947 |
| 540 | Ga0209998_10090134 | 3300027717 | Bacteria | 751 |
| 541 | Ga0209998_10175771 | 3300027717 | Bacteria | 556 |
| 542 | Ga0209974_10007380 | 3300027876 | Bacteria | 3789 |
| 543 | Ga0209974_10013888 | 3300027876 | Bacteria | 2683 |
| 544 | Ga0209974_10371913 | 3300027876 | Unclassified | 557 |
| 545 | Ga0207428_10277396 | 3300027907 | Bacteria | 1245 |
| 546 | Ga0207428_10785885 | 3300027907 | Bacteria | 677 |
| 547 | Ga0268266_10077288 | 3300028379 | Bacteria | 2894 |
| 548 | Ga0268265_10005281 | 3300028380 | Bacteria | 8845 |
| 549 | Ga0268265_10227173 | 3300028380 | Bacteria | 1638 |
| 550 | Ga0268265_10811376 | 3300028380 | Bacteria | 913 |
| 551 | Ga0268264_10012146 | 3300028381 | Bacteria | 7091 |
| 552 | Ga0268264_10363608 | 3300028381 | Bacteria | 1381 |
| 553 | Ga0268264_10762871 | 3300028381 | Bacteria | 964 |
| 554 | Ga0268264_12637842 | 3300028381 | Unclassified | 507 |
| 555 | Ga0307408_100007121 | 3300031548 | Bacteria | 7404 |
| 556 | Ga0307408_100140658 | 3300031548 | Bacteria | 1894 |
| 557 | Ga0307408_100217429 | 3300031548 | Bacteria | 1557 |
| 558 | Ga0307408_100281869 | 3300031548 | Bacteria | 1384 |
| 559 | Ga0307408_100292745 | 3300031548 | Bacteria | 1360 |
| 560 | Ga0307408_100731728 | 3300031548 | Bacteria | 892 |
| 561 | Ga0307408_101364086 | 3300031548 | Bacteria | 666 |
| 562 | Ga0307408_102430427 | 3300031548 | Bacteria | 509 |
| 563 | Ga0307405_10003907 | 3300031731 | Bacteria | 6958 |
| 564 | Ga0307405_10113716 | 3300031731 | Bacteria | 1838 |
| 565 | Ga0307405_10163077 | 3300031731 | Bacteria | 1581 |
| 566 | Ga0307405_10219766 | 3300031731 | Bacteria | 1393 |
| 567 | Ga0307405_10225710 | 3300031731 | Bacteria | 1377 |
| 568 | Ga0307405_10304193 | 3300031731 | Bacteria | 1211 |
| 569 | Ga0307413_10001530 | 3300031824 | Bacteria | 8875 |
| 570 | Ga0307413_10002665 | 3300031824 | Bacteria | 7313 |
| 571 | Ga0307413_10011873 | 3300031824 | Bacteria | 4306 |
| 572 | Ga0307413_10012580 | 3300031824 | Bacteria | 4216 |
| 573 | Ga0307413_10031847 | 3300031824 | Bacteria | 2981 |
| 574 | Ga0307413_10105379 | 3300031824 | Bacteria | 1874 |
| 575 | Ga0307413_10130690 | 3300031824 | Bacteria | 1718 |
| 576 | Ga0307413_10319626 | 3300031824 | Bacteria | 1185 |
| 577 | Ga0307413_10346189 | 3300031824 | Bacteria | 1145 |
| 578 | Ga0307413_10369452 | 3300031824 | Bacteria | 1113 |
| 579 | Ga0307413_10874657 | 3300031824 | Unclassified | 761 |
| 580 | Ga0307410_10000285 | 3300031852 | Bacteria | 19565 |
| 581 | Ga0307410_10004966 | 3300031852 | Bacteria | 6971 |
| 582 | Ga0307410_10005858 | 3300031852 | Bacteria | 6561 |
| 583 | Ga0307410_10013117 | 3300031852 | Bacteria | 4822 |
| 584 | Ga0307410_10027373 | 3300031852 | Bacteria | 3603 |
| 585 | Ga0307410_10061436 | 3300031852 | Bacteria | 2571 |
| 586 | Ga0307410_10313960 | 3300031852 | Bacteria | 1241 |
| 587 | Ga0307410_10531368 | 3300031852 | Bacteria | 972 |
| 588 | Ga0307410_10599876 | 3300031852 | Bacteria | 918 |
| 589 | Ga0307406_10004231 | 3300031901 | Bacteria | 7805 |
| 590 | Ga0307406_10009039 | 3300031901 | Bacteria | 5572 |
| 591 | Ga0307406_10030175 | 3300031901 | Bacteria | 3290 |
| 592 | Ga0307406_10040469 | 3300031901 | Bacteria | 2898 |
| 593 | Ga0307406_10166791 | 3300031901 | Bacteria | 1589 |
| 594 | Ga0307406_10206536 | 3300031901 | Bacteria | 1450 |
| 595 | Ga0307407_10001057 | 3300031903 | Bacteria | 9539 |
| 596 | Ga0307407_10005051 | 3300031903 | Bacteria | 5687 |
| 597 | Ga0307407_10058334 | 3300031903 | Bacteria | 2243 |
| 598 | Ga0307407_10094272 | 3300031903 | Bacteria | 1842 |
| 599 | Ga0307407_10618099 | 3300031903 | Bacteria | 808 |
| 600 | Ga0307407_10815099 | 3300031903 | Bacteria | 711 |
| 601 | Ga0307407_11008750 | 3300031903 | Bacteria | 643 |
| 602 | Ga0307412_10241216 | 3300031911 | Bacteria | 1398 |
| 603 | Ga0307412_10249970 | 3300031911 | Bacteria | 1376 |
| 604 | Ga0307412_10384216 | 3300031911 | Bacteria | 1138 |
| 605 | Ga0307412_10902781 | 3300031911 | Bacteria | 774 |
| 606 | Ga0307412_11491734 | 3300031911 | Bacteria | 614 |
| 607 | Ga0307412_12006291 | 3300031911 | Bacteria | 536 |
| 608 | Ga0307412_12241692 | 3300031911 | Bacteria | 509 |
| 609 | Ga0307409_100000501 | 3300031995 | Bacteria | 16895 |
| 610 | Ga0307409_100008795 | 3300031995 | Bacteria | 6156 |
| 611 | Ga0307409_100028220 | 3300031995 | Bacteria | 3994 |
| 612 | Ga0307409_100063049 | 3300031995 | Bacteria | 2905 |
| 613 | Ga0307409_100102187 | 3300031995 | Bacteria | 2381 |
| 614 | Ga0307409_100154528 | 3300031995 | Bacteria | 1997 |
| 615 | Ga0307409_100154690 | 3300031995 | Bacteria | 1996 |
| 616 | Ga0307409_100222092 | 3300031995 | Bacteria | 1706 |
| 617 | Ga0307409_100287225 | 3300031995 | Bacteria | 1523 |
| 618 | Ga0307409_100597630 | 3300031995 | Bacteria | 1090 |
| 619 | Ga0307409_100698018 | 3300031995 | Bacteria | 1014 |
| 620 | Ga0307409_101183516 | 3300031995 | Bacteria | 787 |
| 621 | Ga0307409_101702054 | 3300031995 | Unclassified | 659 |
| 622 | Ga0307416_100003682 | 3300032002 | Bacteria | 9079 |
| 623 | Ga0307416_100010520 | 3300032002 | Bacteria | 6115 |
| 624 | Ga0307416_100015821 | 3300032002 | Bacteria | 5223 |
| 625 | Ga0307416_100016925 | 3300032002 | Bacteria | 5084 |
| 626 | Ga0307416_100020437 | 3300032002 | Bacteria | 4725 |
| 627 | Ga0307416_100056806 | 3300032002 | Bacteria | 3161 |
| 628 | Ga0307416_100089622 | 3300032002 | Bacteria | 2634 |
| 629 | Ga0307416_100217109 | 3300032002 | Bacteria | 1830 |
| 630 | Ga0307416_100278279 | 3300032002 | Bacteria | 1648 |
| 631 | Ga0307416_100278480 | 3300032002 | Bacteria | 1647 |
| 632 | Ga0307416_100429662 | 3300032002 | Bacteria | 1368 |
| 633 | Ga0307416_100538020 | 3300032002 | Bacteria | 1239 |
| 634 | Ga0307416_100611026 | 3300032002 | Bacteria | 1171 |
| 635 | Ga0307416_101561833 | 3300032002 | Bacteria | 765 |
| 636 | Ga0307416_101748361 | 3300032002 | Bacteria | 726 |
| 637 | Ga0307414_10030049 | 3300032004 | Bacteria | 3545 |
| 638 | Ga0307414_10054914 | 3300032004 | Bacteria | 2786 |
| 639 | Ga0307414_10219473 | 3300032004 | Bacteria | 1560 |
| 640 | Ga0307414_10273173 | 3300032004 | Bacteria | 1417 |
| 641 | Ga0307414_10351362 | 3300032004 | Bacteria | 1265 |
| 642 | Ga0307414_10804425 | 3300032004 | Unclassified | 857 |
| 643 | Ga0307414_11421427 | 3300032004 | Bacteria | 645 |
| 644 | Ga0307414_12008444 | 3300032004 | Bacteria | 540 |
| 645 | Ga0307414_12198084 | 3300032004 | Bacteria | 515 |
| 646 | Ga0307411_10001075 | 3300032005 | Bacteria | 10594 |
| 647 | Ga0307411_10022708 | 3300032005 | Bacteria | 3700 |
| 648 | Ga0307411_10061799 | 3300032005 | Bacteria | 2495 |
| 649 | Ga0307411_10083987 | 3300032005 | Bacteria | 2201 |
| 650 | Ga0307411_10155066 | 3300032005 | Bacteria | 1707 |
| 651 | Ga0307411_10158432 | 3300032005 | Bacteria | 1692 |
| 652 | Ga0307411_10168662 | 3300032005 | Bacteria | 1648 |
| 653 | Ga0307411_10193734 | 3300032005 | Bacteria | 1554 |
| 654 | Ga0307411_10211317 | 3300032005 | Bacteria | 1498 |
| 655 | Ga0307411_11040021 | 3300032005 | Unclassified | 735 |
| 656 | Ga0307411_11900480 | 3300032005 | Bacteria | 554 |
| 657 | Ga0307415_100004272 | 3300032126 | Bacteria | 7389 |
| 658 | Ga0307415_100023019 | 3300032126 | Bacteria | 3858 |
| 659 | Ga0307415_100072922 | 3300032126 | Bacteria | 2420 |
| 660 | Ga0307415_100161299 | 3300032126 | Bacteria | 1738 |
| 661 | Ga0307415_100240821 | 3300032126 | Bacteria | 1463 |
| 662 | Ga0307415_100339846 | 3300032126 | Bacteria | 1259 |
| 663 | Ga0307415_100416479 | 3300032126 | Bacteria | 1151 |
| 664 | Ga0307415_100434528 | 3300032126 | Bacteria | 1130 |
| 665 | Ga0307415_100846712 | 3300032126 | Bacteria | 839 |
| 666 | Ga0307415_101188383 | 3300032126 | Bacteria | 718 |
| 667 | Ga0307415_101305711 | 3300032126 | Unclassified | 687 |
| 668 | Ga0307415_101975427 | 3300032126 | Bacteria | 568 |
| 669 | Ga0307415_102296005 | 3300032126 | Unclassified | 529 |
| 670 | Ga0373930_0205149 | 3300034816 | Unclassified | 514 |
| 671 | Ga0373959_0015002 | 3300034820 | Bacteria | 1418 |
| 672 | Ga0373959_0164898 | 3300034820 | Bacteria | 568 |
| 673 | Ga0373926_0275828 | 3300035083 | Bacteria | 654 |
| 674 | Ga0373928_0019246 | 3300035084 | Bacteria | 1423 |
| 675 | Ga0373929_0048444 | 3300035085 | Bacteria | 965 |
| 676 | Ga0373929_0141169 | 3300035085 | Bacteria | 639 |
| 677 | Ga0373940_0010034 | 3300035088 | Bacteria | 2216 |
| 678 | Ga0373940_0068857 | 3300035088 | Bacteria | 1026 |
| 679 | Ga0373940_0199361 | 3300035088 | Bacteria | 657 |
| 680 | Ga0373940_0246081 | 3300035088 | Bacteria | 601 |
| 681 | Ga0373949_0025139 | 3300035090 | Bacteria | 1388 |
| 682 | Ga0373949_0098380 | 3300035090 | Bacteria | 799 |
| 683 | Ga0373951_0028079 | 3300035091 | Bacteria | 1317 |
| 684 | Ga0373932_0032020 | 3300035112 | Bacteria | 1469 |
| 685 | Ga0373932_0071714 | 3300035112 | Bacteria | 1076 |
| 686 | Ga0373939_0003994 | 3300035114 | Bacteria | 3474 |
| 687 | Ga0373939_0252909 | 3300035114 | Bacteria | 686 |
| 688 | Ga0373939_0257797 | 3300035114 | Bacteria | 681 |
| 689 | Ga0373941_0111579 | 3300035115 | Bacteria | 964 |
| 690 | Ga0373956_0309398 | 3300035119 | Bacteria | 753 |
| 691 | Ga0373960_0096120 | 3300035121 | Bacteria | 954 |
| 692 | Ga0373942_0088012 | 3300035207 | Bacteria | 932 |
| 693 | Ga0373942_0104546 | 3300035207 | Bacteria | 869 |
| 694 | Ga0373961_0017856 | 3300035241 | Bacteria | 1846 |
| 695 | Ga0373961_0110993 | 3300035241 | Bacteria | 898 |
| 696 | Ga0373961_0163450 | 3300035241 | Bacteria | 766 |
| 697 | Ga0373961_0232718 | 3300035241 | Bacteria | 661 |
| 698 | Ga0373962_0081746 | 3300035242 | Bacteria | 982 |
| 699 | Ga0373962_0181556 | 3300035242 | Unclassified | 704 |
| 700 | Ga0373931_0113596 | 3300035691 | Bacteria | 1540 |
| 701 | Ga0373931_0118715 | 3300035691 | Bacteria | 1509 |
| 702 | Ga0373931_0156788 | 3300035691 | Bacteria | 1331 |
| 703 | Ga0373931_0309264 | 3300035691 | Bacteria | 978 |
| 704 | Ga0373931_0808296 | 3300035691 | Bacteria | 625 |
| 705 | Ga0373935_0136746 | 3300035692 | Bacteria | 1652 |
| 706 | Ga0373947_0824889 | 3300035725 | Bacteria | 633 |
| 707 | Ga0373937_0114614 | 3300036401 | Bacteria | 2509 |
| 708 | Ga0373925_0405252 | 3300037068 | Bacteria | 1113 |
| 709 | Ga0395905_0552337 | 3300037471 | Bacteria | 1053 |
| 710 | Ga0395905_0569350 | 3300037471 | Bacteria | 1034 |
| 711 | Ga0395905_0622518 | 3300037471 | Bacteria | 981 |
| 712 | Ga0395905_0763736 | 3300037471 | Bacteria | 869 |
| 713 | Ga0395901_0384581 | 3300038443 | Bacteria | 1444 |
| 714 | Ga0242419_003452 | 3300038698 | Bacteria | 1070 |
| 715 | Ga0242420_006765 | 3300038996 | Bacteria | 1820 |
| 716 | Ga0242420_036891 | 3300038996 | Unclassified | 924 |
| 717 | Ga0439436_0073755 | 3300041404 | Bacteria | 951 |
| 718 | Ga0439439_0020628 | 3300041406 | Bacteria | 1639 |
| 719 | Ga0439439_0023621 | 3300041406 | Bacteria | 1541 |
| 720 | Ga0451787_750746 | 3300041441 | Bacteria | 527 |
| 721 | Ga0451804_0789277 | 3300041463 | Bacteria | 963 |
| 722 | Ga0451807_0674211 | 3300041486 | Bacteria | 3051 |
| 723 | Ga0451853_2411247 | 3300041512 | Bacteria | 600 |
| 724 | Ga0439431_0009377 | 3300041997 | Bacteria | 2211 |
| 725 | Ga0439431_0012021 | 3300041997 | Bacteria | 1985 |
| 726 | Ga0439433_0080089 | 3300041999 | Bacteria | 794 |
| 727 | Ga0439441_137200 | 3300042001 | Bacteria | 570 |
| 728 | Ga0439445_0097230 | 3300042004 | Bacteria | 833 |
| 729 | Ga0439448_0134969 | 3300042005 | Bacteria | 852 |
| 730 | Ga0439448_0208916 | 3300042005 | Bacteria | 685 |
| 731 | Ga0439449_0234577 | 3300042007 | Bacteria | 689 |
| 732 | Ga0439457_019297 | 3300042014 | Bacteria | 1514 |
| 733 | Ga0439462_0032157 | 3300042015 | Bacteria | 1390 |
| 734 | Ga0439462_0116722 | 3300042015 | Bacteria | 741 |
| 735 | Ga0450923_037208 | 3300042125 | Bacteria | 1012 |
| 736 | Ga0450890_005210 | 3300042127 | Bacteria | 1676 |
| 737 | Ga0450890_057475 | 3300042127 | Bacteria | 604 |
| 738 | Ga0450898_084983 | 3300042134 | Unclassified | 647 |
| 739 | Ga0450910_019874 | 3300042147 | Bacteria | 1011 |
| 740 | Ga0439446_0004079 | 3300042156 | Bacteria | 3680 |
| 741 | Ga0439446_0076459 | 3300042156 | Bacteria | 1031 |
| 742 | Ga0439446_0239565 | 3300042156 | Bacteria | 623 |
| 743 | Ga0439434_0092927 | 3300042435 | Bacteria | 966 |
| 744 | Ga0439434_0196020 | 3300042435 | Bacteria | 680 |
| 745 | Ga0439459_0033962 | 3300042438 | Bacteria | 1053 |
| 746 | Ga0439459_0046509 | 3300042438 | Bacteria | 939 |
| 747 | Ga0451577_0071213 | 3300042876 | Bacteria | 3100 |
| 748 | Ga0451577_1966498 | 3300042876 | Unclassified | 511 |
| 749 | Ga0453683_0027180 | 3300044673 | Bacteria | 3632 |
| 750 | Ga0453683_0036857 | 3300044673 | Bacteria | 3077 |
| 751 | Ga0453683_0134021 | 3300044673 | Bacteria | 1562 |
| 752 | Ga0453684_1310675 | 3300044712 | Unclassified | 755 |
| 753 | Ga0466960_0112845 | 3300044901 | Bacteria | 1414 |
| 754 | Ga0466960_0379094 | 3300044901 | Bacteria | 811 |
| 755 | Ga0451576_0043122 | 3300045051 | Bacteria | 4760 |
| 756 | Ga0451576_2448933 | 3300045051 | Unclassified | 534 |
| 757 | Ga0466967_1071083 | 3300045976 | Bacteria | 803 |
| 758 | Ga0466967_1294393 | 3300045976 | Bacteria | 726 |
| 759 | Ga0495603_0004055 | 3300046455 | Bacteria | 8717 |
| 760 | Ga0495603_0058761 | 3300046455 | Bacteria | 2273 |
| 761 | Ga0495603_0129979 | 3300046455 | Bacteria | 1467 |
| 762 | Ga0495641_0033780 | 3300046461 | Bacteria | 2424 |
| 763 | Ga0495653_0332714 | 3300046463 | Bacteria | 981 |
| 764 | Ga0495580_0083378 | 3300046472 | Bacteria | 2227 |
| 765 | Ga0495582_0004780 | 3300046473 | Bacteria | 7611 |
| 766 | Ga0495582_0533567 | 3300046473 | Unclassified | 679 |
| 767 | Ga0495639_0160034 | 3300046475 | Bacteria | 1089 |
| 768 | Ga0495664_0006539 | 3300046477 | Bacteria | 6440 |
| 769 | Ga0495585_0034640 | 3300046492 | Bacteria | 2855 |
| 770 | Ga0495585_0447580 | 3300046492 | Unclassified | 618 |
| 771 | Ga0495594_0002236 | 3300046499 | Bacteria | 10074 |
| 772 | Ga0495594_0010292 | 3300046499 | Bacteria | 4849 |
| 773 | Ga0495594_0036897 | 3300046499 | Bacteria | 2667 |
| 774 | Ga0495596_0436381 | 3300046500 | Bacteria | 511 |
| 775 | Ga0495618_0216760 | 3300046514 | Bacteria | 1208 |
| 776 | Ga0495628_0074756 | 3300046516 | Bacteria | 2639 |
| 777 | Ga0495628_0673212 | 3300046516 | Bacteria | 733 |
| 778 | Ga0495637_0361447 | 3300046520 | Unclassified | 508 |
| 779 | Ga0495666_0006653 | 3300046526 | Bacteria | 5810 |
| 780 | Ga0495640_0007035 | 3300046533 | Bacteria | 8858 |
| 781 | Ga0495586_0029015 | 3300046535 | Bacteria | 2961 |
| 782 | Ga0495586_0193566 | 3300046535 | Bacteria | 1152 |
| 783 | Ga0495586_0260586 | 3300046535 | Bacteria | 990 |
| 784 | Ga0495587_0715865 | 3300046536 | Bacteria | 548 |
| 785 | Ga0495598_0126788 | 3300046537 | Bacteria | 871 |
| 786 | Ga0495622_0397881 | 3300046557 | Bacteria | 593 |
| 787 | Ga0495633_0064996 | 3300046558 | Bacteria | 1705 |
| 788 | Ga0495667_0034963 | 3300046559 | Bacteria | 3360 |
| 789 | Ga0495656_0218455 | 3300046615 | Bacteria | 952 |
| 790 | Ga0495634_0001123 | 3300046642 | Bacteria | 24774 |
| 791 | Ga0495611_0153345 | 3300046648 | Bacteria | 1076 |
| 792 | Ga0495659_0021818 | 3300046664 | Bacteria | 2161 |
| 793 | Ga0495588_0046873 | 3300046674 | Bacteria | 2218 |
| 794 | Ga0495657_0169181 | 3300046675 | Bacteria | 1347 |
| 795 | Ga0495599_0892523 | 3300046678 | Bacteria | 504 |
| 796 | Ga0495647_0038991 | 3300046681 | Bacteria | 1798 |
| 797 | Ga0495647_0205031 | 3300046681 | Bacteria | 866 |
| 798 | Ga0495647_0521172 | 3300046681 | Unclassified | 554 |
| 799 | Ga0495658_0003330 | 3300046683 | Bacteria | 7973 |
| 800 | Ga0495669_0224871 | 3300046684 | Bacteria | 900 |
| 801 | Ga0495613_0025046 | 3300046689 | Bacteria | 4447 |
| 802 | Ga0495670_0151670 | 3300046691 | Bacteria | 1215 |
| 803 | Ga0495636_0029474 | 3300047318 | Bacteria | 2240 |
| 804 | Ga0495674_0024223 | 3300047319 | Bacteria | 5581 |
| 805 | Ga0495680_0012216 | 3300047322 | Bacteria | 7573 |
| 806 | Ga0495684_0045726 | 3300047471 | Bacteria | 3349 |
| 807 | Ga0496100_0227840 | 3300048903 | Bacteria | 1370 |
| 808 | Ga0496100_0335590 | 3300048903 | Bacteria | 1139 |
| 809 | Ga0496100_0688578 | 3300048903 | Bacteria | 797 |
| 810 | Ga0496100_0702735 | 3300048903 | Bacteria | 789 |
| 811 | Ga0496101_0047340 | 3300048904 | Bacteria | 3087 |
| 812 | Ga0496101_0049962 | 3300048904 | Bacteria | 3009 |
| 813 | Ga0496101_0074343 | 3300048904 | Bacteria | 2499 |
| 814 | Ga0496101_0555486 | 3300048904 | Bacteria | 908 |
| 815 | Ga0496101_0577224 | 3300048904 | Bacteria | 889 |
| 816 | Ga0496101_0938613 | 3300048904 | Bacteria | 681 |
| 817 | Ga0496101_1279510 | 3300048904 | Bacteria | 574 |
| 818 | Ga0496102_0002335 | 3300048905 | Bacteria | 16187 |
| 819 | Ga0496102_0088835 | 3300048905 | Bacteria | 2858 |
| 820 | Ga0496102_0168993 | 3300048905 | Bacteria | 2058 |
| 821 | Ga0496102_0214892 | 3300048905 | Bacteria | 1812 |
| 822 | Ga0496102_0280261 | 3300048905 | Bacteria | 1571 |
| 823 | Ga0496102_0870353 | 3300048905 | Unclassified | 823 |
| 824 | Ga0496103_0145994 | 3300048906 | Bacteria | 1514 |
| 825 | Ga0496103_0152380 | 3300048906 | Bacteria | 1481 |
| 826 | Ga0496103_0217461 | 3300048906 | Bacteria | 1229 |
| 827 | Ga0496103_0233696 | 3300048906 | Bacteria | 1183 |
| 828 | Ga0496103_0299737 | 3300048906 | Bacteria | 1034 |
| 829 | Ga0496103_0345145 | 3300048906 | Bacteria | 957 |
| 830 | Ga0496103_0826536 | 3300048906 | Bacteria | 583 |
| 831 | Ga0496104_0005407 | 3300048907 | Bacteria | 11175 |
| 832 | Ga0496104_0065574 | 3300048907 | Bacteria | 3446 |
| 833 | Ga0496104_0081866 | 3300048907 | Bacteria | 3079 |
| 834 | Ga0496104_0184083 | 3300048907 | Bacteria | 1999 |
| 835 | Ga0496104_0305788 | 3300048907 | Bacteria | 1502 |
| 836 | Ga0496104_1015274 | 3300048907 | Bacteria | 733 |
| 837 | Ga0496104_1716414 | 3300048907 | Unclassified | 530 |
| 838 | Ga0496105_0104474 | 3300048908 | Bacteria | 2339 |
| 839 | Ga0496105_0132121 | 3300048908 | Bacteria | 2058 |
| 840 | Ga0496105_0188845 | 3300048908 | Bacteria | 1685 |
| 841 | Ga0496105_0264215 | 3300048908 | Bacteria | 1391 |
| 842 | Ga0496106_0003759 | 3300048909 | Bacteria | 11316 |
| 843 | Ga0496106_0006627 | 3300048909 | Bacteria | 8573 |
| 844 | Ga0496106_0078374 | 3300048909 | Bacteria | 2535 |
| 845 | Ga0496106_0128300 | 3300048909 | Bacteria | 1987 |
| 846 | Ga0496106_0311866 | 3300048909 | Bacteria | 1262 |
| 847 | Ga0496106_0331505 | 3300048909 | Bacteria | 1222 |
| 848 | Ga0496106_0814105 | 3300048909 | Bacteria | 740 |
| 849 | Ga0496106_0887585 | 3300048909 | Bacteria | 704 |
| 850 | Ga0496107_0077151 | 3300048910 | Bacteria | 2427 |
| 851 | Ga0496107_0083067 | 3300048910 | Bacteria | 2336 |
| 852 | Ga0496107_0121290 | 3300048910 | Bacteria | 1926 |
| 853 | Ga0496107_0748661 | 3300048910 | Bacteria | 717 |
| 854 | Ga0496107_0806281 | 3300048910 | Bacteria | 687 |
| 855 | Ga0496107_0827155 | 3300048910 | Bacteria | 677 |
| 856 | Ga0496107_1064501 | 3300048910 | Bacteria | 585 |
| 857 | Ga0496108_0005766 | 3300048911 | Bacteria | 10032 |
| 858 | Ga0496108_0012348 | 3300048911 | Bacteria | 6950 |
| 859 | Ga0496108_0076691 | 3300048911 | Bacteria | 2825 |
| 860 | Ga0496108_0167980 | 3300048911 | Bacteria | 1897 |
| 861 | Ga0496109_0019764 | 3300048912 | Bacteria | 5942 |
| 862 | Ga0496109_0039889 | 3300048912 | Bacteria | 4251 |
| 863 | Ga0496109_0173149 | 3300048912 | Bacteria | 2025 |
| 864 | Ga0496109_0434182 | 3300048912 | Bacteria | 1240 |
| 865 | Ga0496109_1223699 | 3300048912 | Bacteria | 687 |
| 866 | Ga0496110_0005386 | 3300048913 | Bacteria | 10029 |
| 867 | Ga0496110_0007094 | 3300048913 | Bacteria | 8919 |
| 868 | Ga0496110_0451480 | 3300048913 | Bacteria | 1171 |
| 869 | Ga0496110_0537967 | 3300048913 | Bacteria | 1062 |
| 870 | Ga0496110_1012730 | 3300048913 | Bacteria | 738 |
| 871 | Ga0496111_0001415 | 3300048914 | Bacteria | 13651 |
| 872 | Ga0496111_0010407 | 3300048914 | Bacteria | 6241 |
| 873 | Ga0496111_0093771 | 3300048914 | Bacteria | 2201 |
| 874 | Ga0496111_0190057 | 3300048914 | Bacteria | 1526 |
| 875 | Ga0496111_0228735 | 3300048914 | Bacteria | 1381 |
| 876 | Ga0496112_0024016 | 3300048915 | Bacteria | 5833 |
| 877 | Ga0496112_0053839 | 3300048915 | Bacteria | 3953 |
| 878 | Ga0496112_0216716 | 3300048915 | Bacteria | 1870 |
| 879 | Ga0496112_1529824 | 3300048915 | Bacteria | 581 |
| 880 | Ga0496113_0001258 | 3300048916 | Bacteria | 13982 |
| 881 | Ga0496113_0063896 | 3300048916 | Bacteria | 2782 |
| 882 | Ga0496113_0142208 | 3300048916 | Bacteria | 1888 |
| 883 | Ga0496113_1315942 | 3300048916 | Bacteria | 562 |
| 884 | Ga0496114_0047313 | 3300048917 | Bacteria | 3578 |
| 885 | Ga0496114_0145538 | 3300048917 | Bacteria | 2054 |
| 886 | Ga0496114_0159060 | 3300048917 | Bacteria | 1963 |
| 887 | Ga0496114_0215901 | 3300048917 | Bacteria | 1683 |
| 888 | Ga0496114_0269382 | 3300048917 | Bacteria | 1500 |
| 889 | Ga0496115_0061354 | 3300048918 | Bacteria | 3031 |
| 890 | Ga0501292_073204 | 3300049515 | Unclassified | 640 |
| 891 | Ga0501298_028743 | 3300049521 | Bacteria | 1080 |
| 892 | Ga0501298_126584 | 3300049521 | Bacteria | 606 |
| 893 | Ga0501299_161534 | 3300049522 | Bacteria | 573 |
| 894 | Ga0501031_0141051 | 3300049568 | Bacteria | 1575 |
| 895 | Ga0501033_0282204 | 3300049570 | Bacteria | 1172 |
| 896 | Ga0501033_0323097 | 3300049570 | Bacteria | 1084 |
| 897 | Ga0501033_0579392 | 3300049570 | Bacteria | 771 |
| 898 | Ga0501034_0044308 | 3300049571 | Bacteria | 4500 |
| 899 | Ga0501034_0474406 | 3300049571 | Bacteria | 1167 |
| 900 | Ga0501036_0358239 | 3300049572 | Bacteria | 1218 |
| 901 | Ga0501036_0438580 | 3300049572 | Bacteria | 1088 |
| 902 | Ga0501036_0643821 | 3300049572 | Bacteria | 878 |
| 903 | Ga0501037_0072122 | 3300049573 | Bacteria | 2512 |
| 904 | Ga0501037_0707889 | 3300049573 | Bacteria | 670 |
| 905 | Ga0501038_0112160 | 3300049574 | Bacteria | 2258 |
| 906 | Ga0501038_0321822 | 3300049574 | Bacteria | 1210 |
| 907 | Ga0501038_0328376 | 3300049574 | Bacteria | 1195 |
| 908 | Ga0501038_0946762 | 3300049574 | Bacteria | 634 |
| 909 | Ga0501038_1086756 | 3300049574 | Bacteria | 584 |
| 910 | Ga0501038_1109192 | 3300049574 | Bacteria | 577 |
| 911 | Ga0501039_0112345 | 3300049575 | Bacteria | 2130 |
| 912 | Ga0501039_0283824 | 3300049575 | Bacteria | 1301 |
| 913 | Ga0501039_0602451 | 3300049575 | Bacteria | 861 |
| 914 | Ga0501040_0080718 | 3300049576 | Bacteria | 2253 |
| 915 | Ga0501040_0114192 | 3300049576 | Bacteria | 1890 |
| 916 | Ga0501040_0303360 | 3300049576 | Bacteria | 1142 |
| 917 | Ga0501040_0791412 | 3300049576 | Bacteria | 686 |
| 918 | Ga0501040_0975250 | 3300049576 | Bacteria | 614 |
| 919 | Ga0501040_1064113 | 3300049576 | Bacteria | 587 |
| 920 | Ga0501041_0056716 | 3300049577 | Bacteria | 2394 |
| 921 | Ga0501041_0206300 | 3300049577 | Bacteria | 1232 |
| 922 | Ga0501041_0381060 | 3300049577 | Bacteria | 892 |
| 923 | Ga0501041_0432310 | 3300049577 | Bacteria | 835 |
| 924 | Ga0501042_0330152 | 3300049578 | Bacteria | 1102 |
| 925 | Ga0501042_0905776 | 3300049578 | Bacteria | 642 |
| 926 | Ga0501043_0467303 | 3300049579 | Bacteria | 946 |
| 927 | Ga0501043_0608566 | 3300049579 | Bacteria | 806 |
| 928 | Ga0501046_0206933 | 3300049580 | Bacteria | 1458 |
| 929 | Ga0501046_0293363 | 3300049580 | Bacteria | 1189 |
| 930 | Ga0501046_0784959 | 3300049580 | Bacteria | 668 |
| 931 | Ga0501046_1022413 | 3300049580 | Bacteria | 573 |
| 932 | Ga0501047_0851675 | 3300049581 | Bacteria | 725 |
| 933 | Ga0501048_0007522 | 3300049582 | Bacteria | 8255 |
| 934 | Ga0501048_0119600 | 3300049582 | Bacteria | 1861 |
| 935 | Ga0501048_0307985 | 3300049582 | Bacteria | 1127 |
| 936 | Ga0501048_0383996 | 3300049582 | Bacteria | 1003 |
| 937 | Ga0501048_0468939 | 3300049582 | Bacteria | 902 |
| 938 | Ga0501048_0916162 | 3300049582 | Bacteria | 630 |
| 939 | Ga0501067_0014484 | 3300049583 | Bacteria | 4365 |
| 940 | Ga0501067_0031279 | 3300049583 | Bacteria | 2953 |
| 941 | Ga0501067_0047159 | 3300049583 | Bacteria | 2390 |
| 942 | Ga0501067_0185227 | 3300049583 | Bacteria | 1159 |
| 943 | Ga0501067_0342844 | 3300049583 | Bacteria | 833 |
| 944 | Ga0501067_0354778 | 3300049583 | Bacteria | 817 |
| 945 | Ga0501068_0008160 | 3300049584 | Bacteria | 5818 |
| 946 | Ga0501068_0251675 | 3300049584 | Bacteria | 1126 |
| 947 | Ga0501068_0402862 | 3300049584 | Bacteria | 882 |
| 948 | Ga0501068_0831621 | 3300049584 | Bacteria | 606 |
| 949 | Ga0501068_1161056 | 3300049584 | Bacteria | 511 |
| 950 | Ga0501069_0008330 | 3300049585 | Bacteria | 5444 |
| 951 | Ga0501069_0054197 | 3300049585 | Bacteria | 2234 |
| 952 | Ga0501069_0095389 | 3300049585 | Bacteria | 1684 |
| 953 | Ga0501069_0131449 | 3300049585 | Bacteria | 1433 |
| 954 | Ga0501069_0168546 | 3300049585 | Bacteria | 1263 |
| 955 | Ga0501069_0183138 | 3300049585 | Bacteria | 1211 |
| 956 | Ga0501069_0238224 | 3300049585 | Bacteria | 1060 |
| 957 | Ga0501069_0429712 | 3300049585 | Bacteria | 783 |
| 958 | Ga0501070_0013050 | 3300049586 | Bacteria | 7001 |
| 959 | Ga0501070_0032011 | 3300049586 | Bacteria | 4403 |
| 960 | Ga0501070_0063385 | 3300049586 | Bacteria | 3062 |
| 961 | Ga0501070_0222680 | 3300049586 | Bacteria | 1547 |
| 962 | Ga0501070_0810712 | 3300049586 | Bacteria | 734 |
| 963 | Ga0501070_0973915 | 3300049586 | Bacteria | 659 |
| 964 | Ga0501070_1109598 | 3300049586 | Bacteria | 610 |
| 965 | Ga0501071_0012801 | 3300049587 | Bacteria | 5704 |
| 966 | Ga0501071_0030822 | 3300049587 | Bacteria | 3795 |
| 967 | Ga0501071_0179960 | 3300049587 | Bacteria | 1584 |
| 968 | Ga0501071_0207757 | 3300049587 | Bacteria | 1472 |
| 969 | Ga0501071_0281338 | 3300049587 | Bacteria | 1259 |
| 970 | Ga0501071_0368781 | 3300049587 | Bacteria | 1094 |
| 971 | Ga0501071_0695360 | 3300049587 | Bacteria | 783 |
| 972 | Ga0501071_0819882 | 3300049587 | Bacteria | 717 |
| 973 | Ga0501071_1503731 | 3300049587 | Bacteria | 520 |
| 974 | Ga0501071_1563448 | 3300049587 | Bacteria | 509 |
| 975 | Ga0501072_0006109 | 3300049588 | Bacteria | 9187 |
| 976 | Ga0501072_0032455 | 3300049588 | Bacteria | 4090 |
| 977 | Ga0501072_0233391 | 3300049588 | Bacteria | 1465 |
| 978 | Ga0501072_0364972 | 3300049588 | Bacteria | 1146 |
| 979 | Ga0501072_0410843 | 3300049588 | Bacteria | 1073 |
| 980 | Ga0501072_0420172 | 3300049588 | Bacteria | 1060 |
| 981 | Ga0501072_0459184 | 3300049588 | Bacteria | 1008 |
| 982 | Ga0501072_0950269 | 3300049588 | Bacteria | 671 |
| 983 | Ga0501072_1341487 | 3300049588 | Bacteria | 554 |
| 984 | Ga0501073_0062704 | 3300049589 | Bacteria | 2593 |
| 985 | Ga0501073_0073839 | 3300049589 | Bacteria | 2374 |
| 986 | Ga0501073_0438172 | 3300049589 | Bacteria | 903 |
| 987 | Ga0501073_0709010 | 3300049589 | Bacteria | 694 |
| 988 | Ga0501074_0064396 | 3300049590 | Bacteria | 2639 |
| 989 | Ga0501074_0135782 | 3300049590 | Bacteria | 1759 |
| 990 | Ga0501074_0237463 | 3300049590 | Bacteria | 1297 |
| 991 | Ga0501074_0264170 | 3300049590 | Bacteria | 1223 |
| 992 | Ga0501074_0463936 | 3300049590 | Bacteria | 898 |
| 993 | Ga0501074_0588199 | 3300049590 | Bacteria | 787 |
| 994 | Ga0501075_0006835 | 3300049591 | Bacteria | 7875 |
| 995 | Ga0501075_0039029 | 3300049591 | Bacteria | 3553 |
| 996 | Ga0501075_0197437 | 3300049591 | Bacteria | 1534 |
| 997 | Ga0501075_0263535 | 3300049591 | Bacteria | 1313 |
| 998 | Ga0501075_0567145 | 3300049591 | Bacteria | 866 |
| 999 | Ga0501076_0006442 | 3300049592 | Bacteria | 8516 |
| 1000 | Ga0501076_0047582 | 3300049592 | Bacteria | 3391 |
| 1001 | Ga0501076_0054868 | 3300049592 | Bacteria | 3159 |
| 1002 | Ga0501076_0228738 | 3300049592 | Bacteria | 1520 |
| 1003 | Ga0501076_0526801 | 3300049592 | Bacteria | 974 |
| 1004 | Ga0501076_1211718 | 3300049592 | Bacteria | 621 |
| 1005 | Ga0501077_0002603 | 3300049593 | Bacteria | 10813 |
| 1006 | Ga0501077_0009743 | 3300049593 | Bacteria | 5974 |
| 1007 | Ga0501077_0015471 | 3300049593 | Bacteria | 4804 |
| 1008 | Ga0501077_0048237 | 3300049593 | Bacteria | 2705 |
| 1009 | Ga0501077_0095096 | 3300049593 | Bacteria | 1889 |
| 1010 | Ga0501077_0572658 | 3300049593 | Bacteria | 725 |
| 1011 | Ga0501077_0673513 | 3300049593 | Bacteria | 665 |
| 1012 | Ga0501208_066406 | 3300049655 | Unclassified | 717 |
| 1013 | Ga0501209_036721 | 3300049656 | Bacteria | 1275 |
| 1014 | Ga0501209_041012 | 3300049656 | Bacteria | 1224 |
| 1015 | Ga0501217_005170 | 3300049661 | Bacteria | 2717 |
| 1016 | Ga0501227_157341 | 3300049665 | Unclassified | 630 |
| 1017 | Ga0501230_038983 | 3300049667 | Bacteria | 914 |
| 1018 | Ga0501233_129515 | 3300049668 | Bacteria | 688 |
| 1019 | Ga0501235_066427 | 3300049669 | Bacteria | 849 |
| 1020 | Ga0501240_072036 | 3300049673 | Bacteria | 627 |
| 1021 | Ga0501243_054189 | 3300049675 | Unclassified | 730 |
| 1022 | Ga0501243_125041 | 3300049675 | Bacteria | 534 |
| 1023 | Ga0501247_001365 | 3300049677 | Bacteria | 2328 |
| 1024 | Ga0501249_028447 | 3300049679 | Bacteria | 1239 |
| 1025 | Ga0501250_009150 | 3300049680 | Bacteria | 1108 |
| 1026 | Ga0501255_061117 | 3300049684 | Unclassified | 598 |
| 1027 | Ga0501256_015384 | 3300049685 | Bacteria | 767 |
| 1028 | Ga0501257_033911 | 3300049686 | Bacteria | 1238 |
| 1029 | Ga0501259_014322 | 3300049688 | Bacteria | 1343 |
| 1030 | Ga0501079_0010761 | 3300049741 | Bacteria | 6966 |
| 1031 | Ga0501079_0020338 | 3300049741 | Bacteria | 5072 |
| 1032 | Ga0501079_0025157 | 3300049741 | Bacteria | 4566 |
| 1033 | Ga0501079_0147972 | 3300049741 | Bacteria | 1831 |
| 1034 | Ga0501079_0318496 | 3300049741 | Bacteria | 1217 |
| 1035 | Ga0501079_0506313 | 3300049741 | Bacteria | 949 |
| 1036 | Ga0501079_0510157 | 3300049741 | Bacteria | 946 |
| 1037 | Ga0501079_0513137 | 3300049741 | Bacteria | 942 |
| 1038 | Ga0501079_1260629 | 3300049741 | Bacteria | 582 |
| 1039 | Ga0501079_1322122 | 3300049741 | Bacteria | 567 |
| 1040 | Ga0501080_0004569 | 3300049742 | Bacteria | 12338 |
| 1041 | Ga0501080_0051733 | 3300049742 | Bacteria | 3823 |
| 1042 | Ga0501080_0052432 | 3300049742 | Bacteria | 3796 |
| 1043 | Ga0501080_0130656 | 3300049742 | Bacteria | 2325 |
| 1044 | Ga0501080_0131482 | 3300049742 | Bacteria | 2317 |
| 1045 | Ga0501080_0212338 | 3300049742 | Bacteria | 1773 |
| 1046 | Ga0501080_0740196 | 3300049742 | Bacteria | 865 |
| 1047 | Ga0501081_0011857 | 3300049743 | Bacteria | 5710 |
| 1048 | Ga0501081_0049086 | 3300049743 | Bacteria | 2905 |
| 1049 | Ga0501081_0164473 | 3300049743 | Bacteria | 1600 |
| 1050 | Ga0501081_0432119 | 3300049743 | Bacteria | 977 |
| 1051 | Ga0501081_0445598 | 3300049743 | Bacteria | 961 |
| 1052 | Ga0501081_0456626 | 3300049743 | Bacteria | 949 |
| 1053 | Ga0501081_0545407 | 3300049743 | Bacteria | 866 |
| 1054 | Ga0501081_0613492 | 3300049743 | Bacteria | 815 |
| 1055 | Ga0501081_1227714 | 3300049743 | Bacteria | 568 |
| 1056 | Ga0501083_0014932 | 3300049744 | Bacteria | 5433 |
| 1057 | Ga0501083_0051334 | 3300049744 | Bacteria | 2773 |
| 1058 | Ga0501083_0091110 | 3300049744 | Bacteria | 2013 |
| 1059 | Ga0501083_0329367 | 3300049744 | Bacteria | 993 |
| 1060 | Ga0501083_0336790 | 3300049744 | Bacteria | 981 |
| 1061 | Ga0501083_0523460 | 3300049744 | Bacteria | 772 |
| 1062 | Ga0501083_0553865 | 3300049744 | Bacteria | 748 |
| 1063 | Ga0501263_000777 | 3300049760 | Bacteria | 2683 |
| 1064 | Ga0501267_013501 | 3300049764 | Bacteria | 850 |
| 1065 | Ga0501272_003966 | 3300049769 | Bacteria | 1527 |
| 1066 | Ga0501273_018515 | 3300049770 | Unclassified | 927 |
| 1067 | Ga0501283_046396 | 3300049779 | Bacteria | 762 |
| 1068 | Ga0501035_0946183 | 3300049822 | Bacteria | 680 |
| 1069 | Ga0501035_1123039 | 3300049822 | Bacteria | 613 |
| 1070 | Ga0501044_0891303 | 3300049823 | Bacteria | 765 |
| 1071 | Ga0501044_1357639 | 3300049823 | Bacteria | 577 |
| 1072 | Ga0501045_0069371 | 3300049824 | Bacteria | 2591 |
| 1073 | Ga0501045_0101271 | 3300049824 | Bacteria | 2132 |
| 1074 | Ga0501045_0231212 | 3300049824 | Bacteria | 1376 |
| 1075 | Ga0501045_0485282 | 3300049824 | Bacteria | 918 |
| 1076 | Ga0501045_0806506 | 3300049824 | Bacteria | 691 |
| 1077 | Ga0501204_012112 | 3300049850 | Bacteria | 1032 |
| 1078 | Ga0501226_013373 | 3300049853 | Bacteria | 906 |
| 1079 | nmdc:mga05p37_1968370_c1 | 3300050507 | Bacteria | 554 |
| 1080 | nmdc:mga05p37_227975_c1 | 3300050507 | Bacteria | 2246 |
| 1081 | nmdc:mga05p37_4273_c1 | 3300050507 | Bacteria | 16689 |
| 1082 | nmdc:mga05p37_453214_c1 | 3300050507 | Bacteria | 1484 |
| 1083 | nmdc:mga05p37_553551_c1 | 3300050507 | Bacteria | 1309 |
| 1084 | nmdc:mga05p37_565454_c1 | 3300050507 | Bacteria | 1291 |
| 1085 | nmdc:mga05p37_719978_c1 | 3300050507 | Bacteria | 1105 |
| 1086 | nmdc:mga05p37_843703_c1 | 3300050507 | Bacteria | 996 |
| 1087 | nmdc:mga09592_11913_c1 | 3300050508 | Bacteria | 7074 |
| 1088 | nmdc:mga09592_21260_c1 | 3300050508 | Bacteria | 5347 |
| 1089 | nmdc:mga0qj67_54443_c1 | 3300050509 | Bacteria | 3168 |
| 1090 | nmdc:mga0qj67_954959_c1 | 3300050509 | Bacteria | 674 |
| 1091 | nmdc:mga06r32_1172073_c1 | 3300050510 | Bacteria | 715 |
| 1092 | nmdc:mga06r32_347205_c1 | 3300050510 | Bacteria | 1468 |
| 1093 | nmdc:mga06r32_52016_c1 | 3300050510 | Bacteria | 3922 |
| 1094 | nmdc:mga06r32_809092_c1 | 3300050510 | Bacteria | 897 |
| 1095 | nmdc:mga08y16_116742_c1 | 3300050511 | Bacteria | 2778 |
| 1096 | nmdc:mga08y16_2039352_c1 | 3300050511 | Bacteria | 522 |
| 1097 | nmdc:mga08y16_498272_c1 | 3300050511 | Bacteria | 1238 |
| 1098 | nmdc:mga0n895_1028976_c1 | 3300050512 | Bacteria | 804 |
| 1099 | nmdc:mga0n895_228293_c1 | 3300050512 | Bacteria | 1890 |
| 1100 | nmdc:mga0n895_248304_c1 | 3300050512 | Bacteria | 1806 |
| 1101 | nmdc:mga0n895_44735_c1 | 3300050512 | Bacteria | 4317 |
| 1102 | nmdc:mga0n895_489365_c1 | 3300050512 | Bacteria | 1240 |
| 1103 | nmdc:mga0n895_53761_c1 | 3300050512 | Bacteria | 3958 |
| 1104 | nmdc:mga0rr50_1208234_c1 | 3300050513 | Unclassified | 642 |
| 1105 | nmdc:mga0rr50_1295563_c1 | 3300050513 | Bacteria | 618 |
| 1106 | nmdc:mga0rr50_226862_c1 | 3300050513 | Bacteria | 1544 |
| 1107 | nmdc:mga0rr50_272117_c1 | 3300050513 | Bacteria | 1412 |
| 1108 | nmdc:mga0rr50_299402_c1 | 3300050513 | Bacteria | 1345 |
| 1109 | nmdc:mga0rr50_491500_c1 | 3300050513 | Bacteria | 1043 |
| 1110 | nmdc:mga0rr50_63483_c1 | 3300050513 | Bacteria | 2789 |
| 1111 | nmdc:mga0rr50_840081_c1 | 3300050513 | Bacteria | 783 |
| 1112 | nmdc:mga08x19_123587_c1 | 3300050514 | Bacteria | 1737 |
| 1113 | nmdc:mga08x19_512751_c1 | 3300050514 | Bacteria | 847 |
| 1114 | nmdc:mga08x19_535547_c1 | 3300050514 | Bacteria | 828 |
| 1115 | nmdc:mga08x19_603223_c1 | 3300050514 | Bacteria | 778 |
| 1116 | nmdc:mga08x19_930801_c1 | 3300050514 | Bacteria | 617 |
| 1117 | nmdc:mga0a205_11705_c1 | 3300050515 | Bacteria | 8091 |
| 1118 | nmdc:mga0a205_1311424_c1 | 3300050515 | Bacteria | 572 |
| 1119 | nmdc:mga0a205_135878_c1 | 3300050515 | Bacteria | 2359 |
| 1120 | nmdc:mga0a205_157745_c1 | 3300050515 | Bacteria | 2167 |
| 1121 | nmdc:mga0a205_471649_c1 | 3300050515 | Bacteria | 1114 |
| 1122 | Ga0495612_0197095 | 3300053078 | Unclassified | 888 |
| 1123 | Ga0495595_0736426 | 3300053084 | Bacteria | 506 |
| 1124 | Ga0495619_0335257 | 3300053085 | Bacteria | 1047 |
| 1125 | Ga0501084_0021009 | 3300054114 | Bacteria | 5445 |
| 1126 | Ga0501084_0032504 | 3300054114 | Bacteria | 4364 |
| 1127 | Ga0501084_0053363 | 3300054114 | Bacteria | 3381 |
| 1128 | Ga0501084_0055496 | 3300054114 | Bacteria | 3314 |
| 1129 | Ga0501084_0111100 | 3300054114 | Bacteria | 2303 |
| 1130 | Ga0501084_0146629 | 3300054114 | Bacteria | 1988 |
| 1131 | Ga0501084_0154746 | 3300054114 | Bacteria | 1933 |
| 1132 | Ga0501084_0177220 | 3300054114 | Bacteria | 1799 |
| 1133 | Ga0501084_0290002 | 3300054114 | Bacteria | 1382 |
| 1134 | Ga0501084_0291972 | 3300054114 | Bacteria | 1377 |
| 1135 | Ga0501084_0533641 | 3300054114 | Bacteria | 992 |
| 1136 | Ga0501084_0817189 | 3300054114 | Bacteria | 785 |
| 1137 | Ga0501084_1025346 | 3300054114 | Unclassified | 693 |
| 1138 | Ga0590071_003425 | 3300059421 | Bacteria | 3897 |
| 1139 | Ga0590071_064032 | 3300059421 | Bacteria | 901 |
| 1140 | Ga0590071_081582 | 3300059421 | Bacteria | 804 |
| 1141 | Ga0590074_004419 | 3300059423 | Bacteria | 2324 |
| 1142 | Ga0590074_056058 | 3300059423 | Bacteria | 727 |
| 1143 | Ga0590075_010024 | 3300059424 | Bacteria | 2276 |
| 1144 | Ga0590077_023866 | 3300059426 | Bacteria | 1311 |
| 1145 | Ga0590077_041201 | 3300059426 | Bacteria | 1026 |
| 1146 | Ga0587071_011239 | 3300060344 | Bacteria | 1508 |
| 1147 | Ga0501082_0019498 | 3300060353 | Bacteria | 5847 |
| 1148 | Ga0501082_0033970 | 3300060353 | Bacteria | 4399 |
| 1149 | Ga0501082_0052165 | 3300060353 | Bacteria | 3525 |
| 1150 | Ga0501082_0052740 | 3300060353 | Bacteria | 3506 |
| 1151 | Ga0501082_0114169 | 3300060353 | Bacteria | 2339 |
| 1152 | Ga0501082_0154711 | 3300060353 | Bacteria | 1992 |
| 1153 | Ga0501082_0202643 | 3300060353 | Bacteria | 1726 |
| 1154 | Ga0501082_0407769 | 3300060353 | Bacteria | 1186 |
| 1155 | Ga0501082_0651895 | 3300060353 | Bacteria | 921 |
| 1156 | Ga0501082_0722994 | 3300060353 | Bacteria | 871 |
| 1157 | Ga0501082_0961481 | 3300060353 | Bacteria | 747 |
| 1158 | Ga0501082_1427867 | 3300060353 | Bacteria | 604 |
| 1159 | Ga0501082_1678475 | 3300060353 | Bacteria | 554 |
| 1160 | Ga0530510_0092411 | 3300061734 | Bacteria | 2208 |
| 1161 | Ga0530510_0362046 | 3300061734 | Bacteria | 1090 |
| 1162 | Ga0530510_0375174 | 3300061734 | Bacteria | 1070 |
| 1163 | Ga0530510_0461644 | 3300061734 | Bacteria | 961 |
| 1164 | Ga0530510_0522120 | 3300061734 | Bacteria | 901 |
| 1165 | Ga0530510_0659022 | 3300061734 | Bacteria | 797 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005840 | Ga0068870_10134528 | Ga0068870_101345283 | 78 |
| 2 | 3300025926 | Ga0207659_10065037 | Ga0207659_100650375 | 78 |
| 3 | 3300042876 | Ga0451577_0071213 | Ga0451577_0071213_499_771 | 78 |
| 4 | 3300044673 | Ga0453683_0134021 | Ga0453683_0134021_792_1064 | 78 |
| 5 | 3300045051 | Ga0451576_0043122 | Ga0451576_0043122_2084_2356 | 78 |
| 6 | 3300046648 | Ga0495611_0153345 | Ga0495611_0153345_681_953 | 78 |
| 7 | 3300046664 | Ga0495659_0021818 | Ga0495659_0021818_926_1198 | 78 |
| 8 | 3300047318 | Ga0495636_0029474 | Ga0495636_0029474_1317_1589 | 78 |
| 9 | 3300048910 | Ga0496107_0083067 | Ga0496107_0083067_1816_2088 | 78 |
| 10 | 3300005329 | Ga0070683_100089391 | Ga0070683_1000893913 | 79 |
| 11 | 3300005336 | Ga0070680_100003421 | Ga0070680_10000342113 | 79 |
| 12 | 3300005530 | Ga0070679_100014655 | Ga0070679_10001465511 | 79 |
| 13 | 3300005547 | Ga0070693_100095316 | Ga0070693_1000953163 | 79 |
| 14 | 3300025912 | Ga0207707_10004257 | Ga0207707_1000425713 | 79 |
| 15 | 3300025917 | Ga0207660_10004139 | Ga0207660_1000413912 | 79 |
| 16 | 3300025921 | Ga0207652_10011077 | Ga0207652_100110779 | 79 |
| 17 | 3300005293 | Ga0065715_10425513 | Ga0065715_104255133 | 80 |
| 18 | 3300005328 | Ga0070676_10020381 | Ga0070676_100203813 | 80 |
| 19 | 3300005333 | Ga0070677_10147733 | Ga0070677_101477332 | 80 |
| 20 | 3300005334 | Ga0068869_100170341 | Ga0068869_1001703411 | 80 |
| 21 | 3300005335 | Ga0070666_10529683 | Ga0070666_105296831 | 80 |
| 22 | 3300005345 | Ga0070692_10370865 | Ga0070692_103708652 | 80 |
| 23 | 3300005347 | Ga0070668_100011736 | Ga0070668_1000117369 | 80 |
| 24 | 3300005353 | Ga0070669_100299120 | Ga0070669_1002991204 | 80 |
| 25 | 3300005354 | Ga0070675_100653862 | Ga0070675_1006538622 | 80 |
| 26 | 3300005356 | Ga0070674_100011786 | Ga0070674_1000117866 | 80 |
| 27 | 3300005364 | Ga0070673_100024204 | Ga0070673_1000242049 | 80 |
| 28 | 3300005365 | Ga0070688_100178790 | Ga0070688_1001787903 | 80 |
| 29 | 3300005366 | Ga0070659_100679738 | Ga0070659_1006797382 | 80 |
| 30 | 3300005367 | Ga0070667_100461332 | Ga0070667_1004613322 | 80 |
| 31 | 3300005441 | Ga0070700_100637552 | Ga0070700_1006375522 | 80 |
| 32 | 3300005444 | Ga0070694_101652601 | Ga0070694_1016526012 | 80 |
| 33 | 3300005455 | Ga0070663_100334387 | Ga0070663_1003343873 | 80 |
| 34 | 3300005456 | Ga0070678_100928706 | Ga0070678_1009287063 | 80 |
| 35 | 3300005457 | Ga0070662_100014308 | Ga0070662_1000143083 | 80 |
| 36 | 3300005459 | Ga0068867_100033463 | Ga0068867_1000334638 | 80 |
| 37 | 3300005543 | Ga0070672_100017934 | Ga0070672_10001793410 | 80 |
| 38 | 3300005548 | Ga0070665_100026956 | Ga0070665_10002695611 | 80 |
| 39 | 3300005564 | Ga0070664_101294866 | Ga0070664_1012948661 | 80 |
| 40 | 3300005578 | Ga0068854_100602803 | Ga0068854_1006028032 | 80 |
| 41 | 3300005615 | Ga0070702_100898855 | Ga0070702_1008988552 | 80 |
| 42 | 3300005719 | Ga0068861_100242529 | Ga0068861_1002425294 | 80 |
| 43 | 3300005840 | Ga0068870_10304124 | Ga0068870_103041242 | 80 |
| 44 | 3300005841 | Ga0068863_100289181 | Ga0068863_1002891813 | 80 |
| 45 | 3300005842 | Ga0068858_100048389 | Ga0068858_1000483893 | 80 |
| 46 | 3300005843 | Ga0068860_100200274 | Ga0068860_1002002743 | 80 |
| 47 | 3300005844 | Ga0068862_100027479 | Ga0068862_10002747910 | 80 |
| 48 | 3300006844 | Ga0075428_100271986 | Ga0075428_1002719863 | 80 |
| 49 | 3300006881 | Ga0068865_100045517 | Ga0068865_1000455173 | 80 |
| 50 | 3300013306 | Ga0163162_12443140 | Ga0163162_124431401 | 80 |
| 51 | 3300017792 | Ga0163161_10378295 | Ga0163161_103782953 | 80 |
| 52 | 3300025315 | Ga0207697_10200592 | Ga0207697_102005922 | 80 |
| 53 | 3300025893 | Ga0207682_10130045 | Ga0207682_101300453 | 80 |
| 54 | 3300025901 | Ga0207688_10237312 | Ga0207688_102373123 | 80 |
| 55 | 3300025903 | Ga0207680_10748122 | Ga0207680_107481222 | 80 |
| 56 | 3300025907 | Ga0207645_10032454 | Ga0207645_100324547 | 80 |
| 57 | 3300025908 | Ga0207643_10229111 | Ga0207643_102291112 | 80 |
| 58 | 3300025919 | Ga0207657_10939970 | Ga0207657_109399702 | 80 |
| 59 | 3300025923 | Ga0207681_10037063 | Ga0207681_100370637 | 80 |
| 60 | 3300025926 | Ga0207659_10330415 | Ga0207659_103304153 | 80 |
| 61 | 3300025932 | Ga0207690_10477202 | Ga0207690_104772023 | 80 |
| 62 | 3300025933 | Ga0207706_10298462 | Ga0207706_102984623 | 80 |
| 63 | 3300025937 | Ga0207669_10416317 | Ga0207669_104163173 | 80 |
| 64 | 3300025938 | Ga0207704_10090959 | Ga0207704_100909593 | 80 |
| 65 | 3300025940 | Ga0207691_10016076 | Ga0207691_100160764 | 80 |
| 66 | 3300025941 | Ga0207711_10234797 | Ga0207711_102347973 | 80 |
| 67 | 3300025944 | Ga0207661_10029676 | Ga0207661_100296766 | 80 |
| 68 | 3300025945 | Ga0207679_12075248 | Ga0207679_120752482 | 80 |
| 69 | 3300025960 | Ga0207651_10527058 | Ga0207651_105270582 | 80 |
| 70 | 3300025972 | Ga0207668_10022488 | Ga0207668_100224884 | 80 |
| 71 | 3300026067 | Ga0207678_10551442 | Ga0207678_105514423 | 80 |
| 72 | 3300026075 | Ga0207708_10718607 | Ga0207708_107186072 | 80 |
| 73 | 3300026088 | Ga0207641_10555052 | Ga0207641_105550522 | 80 |
| 74 | 3300026089 | Ga0207648_10016875 | Ga0207648_100168753 | 80 |
| 75 | 3300026118 | Ga0207675_100031110 | Ga0207675_1000311104 | 80 |
| 76 | 3300026121 | Ga0207683_10756438 | Ga0207683_107564382 | 80 |
| 77 | 3300028380 | Ga0268265_10811376 | Ga0268265_108113762 | 80 |
| 78 | 3300028381 | Ga0268264_10762871 | Ga0268264_107628713 | 80 |
| 79 | 3300042125 | Ga0450923_037208 | Ga0450923_037208_479_760 | 80 |
| 80 | 3300046455 | Ga0495603_0004055 | Ga0495603_0004055_2117_2398 | 80 |
| 81 | 3300046492 | Ga0495585_0447580 | Ga0495585_0447580_283_564 | 80 |
| 82 | 3300046537 | Ga0495598_0126788 | Ga0495598_0126788_79_360 | 80 |
| 83 | 3300046557 | Ga0495622_0397881 | Ga0495622_0397881_145_426 | 80 |
| 84 | 3300046558 | Ga0495633_0064996 | Ga0495633_0064996_1125_1406 | 80 |
| 85 | 3300046691 | Ga0495670_0151670 | Ga0495670_0151670_323_604 | 80 |
| 86 | 3300048913 | Ga0496110_1012730 | Ga0496110_1012730_244_525 | 80 |
| 87 | 3300005546 | Ga0070696_101416005 | Ga0070696_1014160051 | 81 |
| 88 | 3300006871 | Ga0075434_101464534 | Ga0075434_1014645342 | 81 |
| 89 | 3300005518 | Ga0070699_100361549 | Ga0070699_1003615492 | 82 |
| 90 | 3300005577 | Ga0068857_100006227 | Ga0068857_1000062273 | 82 |
| 91 | 3300005618 | Ga0068864_100005272 | Ga0068864_1000052724 | 82 |
| 92 | 3300011119 | Ga0105246_10187984 | Ga0105246_101879843 | 82 |
| 93 | 3300025945 | Ga0207679_11733348 | Ga0207679_117333481 | 82 |
| 94 | 3300026095 | Ga0207676_10240562 | Ga0207676_102405624 | 82 |
| 95 | 3300026116 | Ga0207674_10542907 | Ga0207674_105429073 | 82 |
| 96 | 3300027526 | Ga0209968_1033503 | Ga0209968_10335032 | 82 |
| 97 | 3300049574 | Ga0501038_0321822 | Ga0501038_0321822_785_1066 | 83 |
| 98 | 3300049743 | Ga0501081_1227714 | Ga0501081_1227714_162_443 | 83 |
| 99 | 3300054114 | Ga0501084_0817189 | Ga0501084_0817189_494_775 | 83 |
| 100 | 3300005466 | Ga0070685_10638714 | Ga0070685_106387142 | 84 |
| 101 | 3300009177 | Ga0105248_10301689 | Ga0105248_103016894 | 85 |
| 102 | 3300014326 | Ga0157380_10550087 | Ga0157380_105500873 | 85 |
| 103 | 3300035088 | Ga0373940_0246081 | Ga0373940_0246081_76_363 | 85 |
| 104 | 3300035090 | Ga0373949_0025139 | Ga0373949_0025139_658_945 | 85 |
| 105 | 3300035691 | Ga0373931_0309264 | Ga0373931_0309264_272_559 | 85 |
| 106 | 3300049743 | Ga0501081_0613492 | Ga0501081_0613492_92_349 | 85 |
| 107 | 3300060353 | Ga0501082_0961481 | Ga0501082_0961481_341_598 | 85 |
| 108 | 3300005293 | Ga0065715_10095098 | Ga0065715_100950988 | 86 |
| 109 | 3300005293 | Ga0065715_10308647 | Ga0065715_103086473 | 86 |
| 110 | 3300005295 | Ga0065707_10544474 | Ga0065707_105444741 | 86 |
| 111 | 3300005330 | Ga0070690_101392295 | Ga0070690_1013922951 | 86 |
| 112 | 3300005334 | Ga0068869_101612082 | Ga0068869_1016120822 | 86 |
| 113 | 3300005336 | Ga0070680_101030501 | Ga0070680_1010305012 | 86 |
| 114 | 3300005339 | Ga0070660_100630816 | Ga0070660_1006308163 | 86 |
| 115 | 3300005347 | Ga0070668_101471305 | Ga0070668_1014713052 | 86 |
| 116 | 3300005364 | Ga0070673_101170635 | Ga0070673_1011706353 | 86 |
| 117 | 3300005366 | Ga0070659_100543630 | Ga0070659_1005436301 | 86 |
| 118 | 3300005406 | Ga0070703_10308912 | Ga0070703_103089122 | 86 |
| 119 | 3300005439 | Ga0070711_100973531 | Ga0070711_1009735312 | 86 |
| 120 | 3300005440 | Ga0070705_100020535 | Ga0070705_1000205354 | 86 |
| 121 | 3300005440 | Ga0070705_100423510 | Ga0070705_1004235103 | 86 |
| 122 | 3300005441 | Ga0070700_100620053 | Ga0070700_1006200532 | 86 |
| 123 | 3300005444 | Ga0070694_100058538 | Ga0070694_1000585384 | 86 |
| 124 | 3300005445 | Ga0070708_100003800 | Ga0070708_1000038007 | 86 |
| 125 | 3300005445 | Ga0070708_100191282 | Ga0070708_1001912823 | 86 |
| 126 | 3300005445 | Ga0070708_101809990 | Ga0070708_1018099902 | 86 |
| 127 | 3300005457 | Ga0070662_100939191 | Ga0070662_1009391911 | 86 |
| 128 | 3300005467 | Ga0070706_100006592 | Ga0070706_10000659213 | 86 |
| 129 | 3300005468 | Ga0070707_100016356 | Ga0070707_1000163569 | 86 |
| 130 | 3300005471 | Ga0070698_100933138 | Ga0070698_1009331383 | 86 |
| 131 | 3300005518 | Ga0070699_100003912 | Ga0070699_10000391217 | 86 |
| 132 | 3300005536 | Ga0070697_100341629 | Ga0070697_1003416293 | 86 |
| 133 | 3300005536 | Ga0070697_100913939 | Ga0070697_1009139392 | 86 |
| 134 | 3300005543 | Ga0070672_101465907 | Ga0070672_1014659072 | 86 |
| 135 | 3300005545 | Ga0070695_100067133 | Ga0070695_1000671334 | 86 |
| 136 | 3300005546 | Ga0070696_100018217 | Ga0070696_1000182177 | 86 |
| 137 | 3300005546 | Ga0070696_100303927 | Ga0070696_1003039272 | 86 |
| 138 | 3300005546 | Ga0070696_100539727 | Ga0070696_1005397273 | 86 |
| 139 | 3300005547 | Ga0070693_100384717 | Ga0070693_1003847173 | 86 |
| 140 | 3300005549 | Ga0070704_100006202 | Ga0070704_10000620214 | 86 |
| 141 | 3300005578 | Ga0068854_101195261 | Ga0068854_1011952612 | 86 |
| 142 | 3300005614 | Ga0068856_100453171 | Ga0068856_1004531712 | 86 |
| 143 | 3300005615 | Ga0070702_100740099 | Ga0070702_1007400993 | 86 |
| 144 | 3300005617 | Ga0068859_100224186 | Ga0068859_1002241863 | 86 |
| 145 | 3300005618 | Ga0068864_100347494 | Ga0068864_1003474944 | 86 |
| 146 | 3300005842 | Ga0068858_102208347 | Ga0068858_1022083472 | 86 |
| 147 | 3300006163 | Ga0070715_10215555 | Ga0070715_102155552 | 86 |
| 148 | 3300006173 | Ga0070716_100330172 | Ga0070716_1003301722 | 86 |
| 149 | 3300006852 | Ga0075433_10139968 | Ga0075433_101399684 | 86 |
| 150 | 3300006852 | Ga0075433_11839462 | Ga0075433_118394621 | 86 |
| 151 | 3300006871 | Ga0075434_100031426 | Ga0075434_1000314265 | 86 |
| 152 | 3300006871 | Ga0075434_100154946 | Ga0075434_1001549463 | 86 |
| 153 | 3300006871 | Ga0075434_100779527 | Ga0075434_1007795273 | 86 |
| 154 | 3300006914 | Ga0075436_100005801 | Ga0075436_1000058018 | 86 |
| 155 | 3300006931 | Ga0097620_100224164 | Ga0097620_1002241643 | 86 |
| 156 | 3300007076 | Ga0075435_100144049 | Ga0075435_1001440494 | 86 |
| 157 | 3300007076 | Ga0075435_100166460 | Ga0075435_1001664604 | 86 |
| 158 | 3300007076 | Ga0075435_100709248 | Ga0075435_1007092483 | 86 |
| 159 | 3300009147 | Ga0114129_10106429 | Ga0114129_101064297 | 86 |
| 160 | 3300009147 | Ga0114129_11052867 | Ga0114129_110528672 | 86 |
| 161 | 3300009147 | Ga0114129_11691990 | Ga0114129_116919901 | 86 |
| 162 | 3300009177 | Ga0105248_12805151 | Ga0105248_128051512 | 86 |
| 163 | 3300009545 | Ga0105237_10487139 | Ga0105237_104871392 | 86 |
| 164 | 3300009553 | Ga0105249_10291620 | Ga0105249_102916204 | 86 |
| 165 | 3300010375 | Ga0105239_10107261 | Ga0105239_101072614 | 86 |
| 166 | 3300013306 | Ga0163162_13090401 | Ga0163162_130904012 | 86 |
| 167 | 3300014745 | Ga0157377_10950300 | Ga0157377_109503001 | 86 |
| 168 | 3300025910 | Ga0207684_10022976 | Ga0207684_100229767 | 86 |
| 169 | 3300025914 | Ga0207671_10895915 | Ga0207671_108959152 | 86 |
| 170 | 3300025916 | Ga0207663_10775699 | Ga0207663_107756993 | 86 |
| 171 | 3300025917 | Ga0207660_11097629 | Ga0207660_110976292 | 86 |
| 172 | 3300025921 | Ga0207652_11803743 | Ga0207652_118037432 | 86 |
| 173 | 3300025922 | Ga0207646_10314034 | Ga0207646_103140341 | 86 |
| 174 | 3300025933 | Ga0207706_10103419 | Ga0207706_101034195 | 86 |
| 175 | 3300025935 | Ga0207709_11424829 | Ga0207709_114248292 | 86 |
| 176 | 3300025940 | Ga0207691_11016400 | Ga0207691_110164002 | 86 |
| 177 | 3300025941 | Ga0207711_11288607 | Ga0207711_112886072 | 86 |
| 178 | 3300025942 | Ga0207689_11522603 | Ga0207689_115226032 | 86 |
| 179 | 3300025961 | Ga0207712_10395073 | Ga0207712_103950734 | 86 |
| 180 | 3300025972 | Ga0207668_10756007 | Ga0207668_107560073 | 86 |
| 181 | 3300025986 | Ga0207658_11133731 | Ga0207658_111337311 | 86 |
| 182 | 3300026035 | Ga0207703_11938166 | Ga0207703_119381662 | 86 |
| 183 | 3300026075 | Ga0207708_10149443 | Ga0207708_101494433 | 86 |
| 184 | 3300026078 | Ga0207702_10487428 | Ga0207702_104874282 | 86 |
| 185 | 3300026089 | Ga0207648_11547059 | Ga0207648_115470592 | 86 |
| 186 | 3300026095 | Ga0207676_11106174 | Ga0207676_111061743 | 86 |
| 187 | 3300035088 | Ga0373940_0199361 | Ga0373940_0199361_245_508 | 86 |
| 188 | 3300035242 | Ga0373962_0181556 | Ga0373962_0181556_117_380 | 86 |
| 189 | 3300035691 | Ga0373931_0808296 | Ga0373931_0808296_332_595 | 86 |
| 190 | 3300042005 | Ga0439448_0134969 | Ga0439448_0134969_400_663 | 86 |
| 191 | 3300044673 | Ga0453683_0027180 | Ga0453683_0027180_191_454 | 86 |
| 192 | 3300044673 | Ga0453683_0036857 | Ga0453683_0036857_1632_1895 | 86 |
| 193 | 3300046674 | Ga0495588_0046873 | Ga0495588_0046873_563_826 | 86 |
| 194 | 3300048903 | Ga0496100_0688578 | Ga0496100_0688578_382_645 | 86 |
| 195 | 3300048904 | Ga0496101_0074343 | Ga0496101_0074343_1345_1608 | 86 |
| 196 | 3300048905 | Ga0496102_0002335 | Ga0496102_0002335_15223_15486 | 86 |
| 197 | 3300048905 | Ga0496102_0088835 | Ga0496102_0088835_2464_2727 | 86 |
| 198 | 3300048906 | Ga0496103_0145994 | Ga0496103_0145994_374_637 | 86 |
| 199 | 3300048906 | Ga0496103_0345145 | Ga0496103_0345145_171_434 | 86 |
| 200 | 3300048907 | Ga0496104_0005407 | Ga0496104_0005407_6004_6267 | 86 |
| 201 | 3300048907 | Ga0496104_1015274 | Ga0496104_1015274_78_341 | 86 |
| 202 | 3300048908 | Ga0496105_0188845 | Ga0496105_0188845_1368_1631 | 86 |
| 203 | 3300048909 | Ga0496106_0006627 | Ga0496106_0006627_884_1147 | 86 |
| 204 | 3300048910 | Ga0496107_0121290 | Ga0496107_0121290_1097_1360 | 86 |
| 205 | 3300048911 | Ga0496108_0005766 | Ga0496108_0005766_4330_4593 | 86 |
| 206 | 3300048912 | Ga0496109_0019764 | Ga0496109_0019764_3120_3383 | 86 |
| 207 | 3300048913 | Ga0496110_0005386 | Ga0496110_0005386_1465_1728 | 86 |
| 208 | 3300048914 | Ga0496111_0010407 | Ga0496111_0010407_4893_5156 | 86 |
| 209 | 3300048916 | Ga0496113_0001258 | Ga0496113_0001258_1932_2195 | 86 |
| 210 | 3300048917 | Ga0496114_0159060 | Ga0496114_0159060_1080_1343 | 86 |
| 211 | 3300050507 | nmdc:mga05p37_4273_c1 | nmdc:mga05p37_4273_c1_13522_13785 | 86 |
| 212 | 3300050507 | nmdc:mga05p37_453214_c1 | nmdc:mga05p37_453214_c1_544_807 | 86 |
| 213 | 3300050508 | nmdc:mga09592_21260_c1 | nmdc:mga09592_21260_c1_2084_2347 | 86 |
| 214 | 3300050510 | nmdc:mga06r32_809092_c1 | nmdc:mga06r32_809092_c1_123_386 | 86 |
| 215 | 3300050512 | nmdc:mga0n895_1028976_c1 | nmdc:mga0n895_1028976_c1_67_330 | 86 |
| 216 | 3300050512 | nmdc:mga0n895_228293_c1 | nmdc:mga0n895_228293_c1_966_1229 | 86 |
| 217 | 3300050512 | nmdc:mga0n895_248304_c1 | nmdc:mga0n895_248304_c1_273_536 | 86 |
| 218 | 3300050512 | nmdc:mga0n895_53761_c1 | nmdc:mga0n895_53761_c1_2213_2476 | 86 |
| 219 | 3300050513 | nmdc:mga0rr50_299402_c1 | nmdc:mga0rr50_299402_c1_38_301 | 86 |
| 220 | 3300050513 | nmdc:mga0rr50_63483_c1 | nmdc:mga0rr50_63483_c1_2390_2653 | 86 |
| 221 | 3300050514 | nmdc:mga08x19_123587_c1 | nmdc:mga08x19_123587_c1_904_1167 | 86 |
| 222 | 3300050514 | nmdc:mga08x19_512751_c1 | nmdc:mga08x19_512751_c1_496_759 | 86 |
| 223 | 3300050514 | nmdc:mga08x19_930801_c1 | nmdc:mga08x19_930801_c1_210_473 | 86 |
| 224 | 3300050515 | nmdc:mga0a205_135878_c1 | nmdc:mga0a205_135878_c1_965_1228 | 86 |
| 225 | 3300050515 | nmdc:mga0a205_157745_c1 | nmdc:mga0a205_157745_c1_445_708 | 86 |
| 226 | 3300014968 | Ga0157379_10345831 | Ga0157379_103458312 | 87 |
| 227 | 3300031731 | Ga0307405_10003907 | Ga0307405_1000390712 | 87 |
| 228 | 3300031824 | Ga0307413_10001530 | Ga0307413_1000153012 | 87 |
| 229 | 3300031852 | Ga0307410_10004966 | Ga0307410_1000496613 | 87 |
| 230 | 3300031901 | Ga0307406_10004231 | Ga0307406_100042318 | 87 |
| 231 | 3300031903 | Ga0307407_10001057 | Ga0307407_1000105714 | 87 |
| 232 | 3300031995 | Ga0307409_100000501 | Ga0307409_10000050119 | 87 |
| 233 | 3300032002 | Ga0307416_100056806 | Ga0307416_1000568067 | 87 |
| 234 | 3300032004 | Ga0307414_10804425 | Ga0307414_108044251 | 87 |
| 235 | 3300032005 | Ga0307411_10001075 | Ga0307411_100010757 | 87 |
| 236 | 3300032126 | Ga0307415_100004272 | Ga0307415_10000427213 | 87 |
| 237 | 3300049571 | Ga0501034_0044308 | Ga0501034_0044308_3773_4039 | 87 |
| 238 | 3300049571 | Ga0501034_0474406 | Ga0501034_0474406_859_1125 | 87 |
| 239 | 3300049578 | Ga0501042_0905776 | Ga0501042_0905776_268_534 | 87 |
| 240 | 3300049579 | Ga0501043_0467303 | Ga0501043_0467303_522_788 | 87 |
| 241 | 3300049581 | Ga0501047_0851675 | Ga0501047_0851675_171_437 | 87 |
| 242 | 3300049582 | Ga0501048_0383996 | Ga0501048_0383996_213_479 | 87 |
| 243 | 3300049583 | Ga0501067_0014484 | Ga0501067_0014484_224_490 | 87 |
| 244 | 3300049583 | Ga0501067_0047159 | Ga0501067_0047159_462_728 | 87 |
| 245 | 3300049584 | Ga0501068_0008160 | Ga0501068_0008160_5091_5357 | 87 |
| 246 | 3300049584 | Ga0501068_0402862 | Ga0501068_0402862_254_520 | 87 |
| 247 | 3300049585 | Ga0501069_0008330 | Ga0501069_0008330_2709_2975 | 87 |
| 248 | 3300049585 | Ga0501069_0095389 | Ga0501069_0095389_209_475 | 87 |
| 249 | 3300049585 | Ga0501069_0183138 | Ga0501069_0183138_676_942 | 87 |
| 250 | 3300049586 | Ga0501070_0013050 | Ga0501070_0013050_2676_2942 | 87 |
| 251 | 3300049586 | Ga0501070_0032011 | Ga0501070_0032011_2221_2487 | 87 |
| 252 | 3300049586 | Ga0501070_0810712 | Ga0501070_0810712_228_494 | 87 |
| 253 | 3300049587 | Ga0501071_0012801 | Ga0501071_0012801_4977_5243 | 87 |
| 254 | 3300049587 | Ga0501071_0179960 | Ga0501071_0179960_345_611 | 87 |
| 255 | 3300049587 | Ga0501071_0207757 | Ga0501071_0207757_501_764 | 87 |
| 256 | 3300049587 | Ga0501071_1563448 | Ga0501071_1563448_138_404 | 87 |
| 257 | 3300049588 | Ga0501072_0006109 | Ga0501072_0006109_3818_4084 | 87 |
| 258 | 3300049588 | Ga0501072_0032455 | Ga0501072_0032455_3730_3996 | 87 |
| 259 | 3300049589 | Ga0501073_0073839 | Ga0501073_0073839_286_552 | 87 |
| 260 | 3300049589 | Ga0501073_0709010 | Ga0501073_0709010_172_438 | 87 |
| 261 | 3300049590 | Ga0501074_0135782 | Ga0501074_0135782_97_363 | 87 |
| 262 | 3300049591 | Ga0501075_0263535 | Ga0501075_0263535_609_872 | 87 |
| 263 | 3300049592 | Ga0501076_0054868 | Ga0501076_0054868_625_891 | 87 |
| 264 | 3300049593 | Ga0501077_0095096 | Ga0501077_0095096_968_1231 | 87 |
| 265 | 3300049656 | Ga0501209_041012 | Ga0501209_041012_229_495 | 87 |
| 266 | 3300049665 | Ga0501227_157341 | Ga0501227_157341_186_452 | 87 |
| 267 | 3300049679 | Ga0501249_028447 | Ga0501249_028447_402_668 | 87 |
| 268 | 3300049741 | Ga0501079_0318496 | Ga0501079_0318496_97_363 | 87 |
| 269 | 3300049741 | Ga0501079_0510157 | Ga0501079_0510157_177_440 | 87 |
| 270 | 3300049741 | Ga0501079_1322122 | Ga0501079_1322122_132_398 | 87 |
| 271 | 3300049742 | Ga0501080_0004569 | Ga0501080_0004569_4924_5190 | 87 |
| 272 | 3300049742 | Ga0501080_0051733 | Ga0501080_0051733_1895_2158 | 87 |
| 273 | 3300049742 | Ga0501080_0052432 | Ga0501080_0052432_1878_2144 | 87 |
| 274 | 3300049742 | Ga0501080_0131482 | Ga0501080_0131482_1822_2088 | 87 |
| 275 | 3300049743 | Ga0501081_0545407 | Ga0501081_0545407_475_738 | 87 |
| 276 | 3300049744 | Ga0501083_0014932 | Ga0501083_0014932_96_362 | 87 |
| 277 | 3300049744 | Ga0501083_0051334 | Ga0501083_0051334_742_1008 | 87 |
| 278 | 3300049744 | Ga0501083_0329367 | Ga0501083_0329367_609_872 | 87 |
| 279 | 3300049744 | Ga0501083_0523460 | Ga0501083_0523460_346_612 | 87 |
| 280 | 3300049770 | Ga0501273_018515 | Ga0501273_018515_512_778 | 87 |
| 281 | 3300054114 | Ga0501084_0032504 | Ga0501084_0032504_4002_4268 | 87 |
| 282 | 3300054114 | Ga0501084_0053363 | Ga0501084_0053363_487_753 | 87 |
| 283 | 3300054114 | Ga0501084_0111100 | Ga0501084_0111100_1907_2173 | 87 |
| 284 | 3300054114 | Ga0501084_0146629 | Ga0501084_0146629_51_314 | 87 |
| 285 | 3300060353 | Ga0501082_0019498 | Ga0501082_0019498_286_552 | 87 |
| 286 | 3300060353 | Ga0501082_0033970 | Ga0501082_0033970_1556_1822 | 87 |
| 287 | 3300060353 | Ga0501082_0407769 | Ga0501082_0407769_709_975 | 87 |
| 288 | 3300060353 | Ga0501082_0722994 | Ga0501082_0722994_551_814 | 87 |
| 289 | 3300061734 | Ga0530510_0522120 | Ga0530510_0522120_111_377 | 87 |
| 290 | 3300061734 | Ga0530510_0659022 | Ga0530510_0659022_226_489 | 87 |
| 291 | 3300004803 | Ga0058862_12815550 | Ga0058862_128155501 | 88 |
| 292 | 3300005295 | Ga0065707_10114865 | Ga0065707_101148654 | 88 |
| 293 | 3300005336 | Ga0070680_101621089 | Ga0070680_1016210892 | 88 |
| 294 | 3300005340 | Ga0070689_100202868 | Ga0070689_1002028683 | 88 |
| 295 | 3300005353 | Ga0070669_100642291 | Ga0070669_1006422912 | 88 |
| 296 | 3300005355 | Ga0070671_100007559 | Ga0070671_1000075593 | 88 |
| 297 | 3300005356 | Ga0070674_101229198 | Ga0070674_1012291982 | 88 |
| 298 | 3300005364 | Ga0070673_100076697 | Ga0070673_1000766976 | 88 |
| 299 | 3300005440 | Ga0070705_100249304 | Ga0070705_1002493043 | 88 |
| 300 | 3300005441 | Ga0070700_101997932 | Ga0070700_1019979322 | 88 |
| 301 | 3300005444 | Ga0070694_100093025 | Ga0070694_1000930251 | 88 |
| 302 | 3300005444 | Ga0070694_100177344 | Ga0070694_1001773444 | 88 |
| 303 | 3300005445 | Ga0070708_101158261 | Ga0070708_1011582611 | 88 |
| 304 | 3300005457 | Ga0070662_101010479 | Ga0070662_1010104792 | 88 |
| 305 | 3300005458 | Ga0070681_11031439 | Ga0070681_110314392 | 88 |
| 306 | 3300005459 | Ga0068867_101697991 | Ga0068867_1016979912 | 88 |
| 307 | 3300005468 | Ga0070707_100011103 | Ga0070707_10001110312 | 88 |
| 308 | 3300005468 | Ga0070707_100200331 | Ga0070707_1002003313 | 88 |
| 309 | 3300005471 | Ga0070698_100014490 | Ga0070698_1000144908 | 88 |
| 310 | 3300005471 | Ga0070698_100029788 | Ga0070698_1000297883 | 88 |
| 311 | 3300005471 | Ga0070698_100046236 | Ga0070698_1000462369 | 88 |
| 312 | 3300005471 | Ga0070698_100070895 | Ga0070698_1000708957 | 88 |
| 313 | 3300005471 | Ga0070698_100402189 | Ga0070698_1004021894 | 88 |
| 314 | 3300005518 | Ga0070699_100024629 | Ga0070699_1000246299 | 88 |
| 315 | 3300005518 | Ga0070699_100063453 | Ga0070699_1000634533 | 88 |
| 316 | 3300005518 | Ga0070699_100123141 | Ga0070699_1001231414 | 88 |
| 317 | 3300005518 | Ga0070699_100995700 | Ga0070699_1009957001 | 88 |
| 318 | 3300005535 | Ga0070684_100767074 | Ga0070684_1007670742 | 88 |
| 319 | 3300005536 | Ga0070697_101506255 | Ga0070697_1015062552 | 88 |
| 320 | 3300005546 | Ga0070696_100262629 | Ga0070696_1002626291 | 88 |
| 321 | 3300005549 | Ga0070704_100106053 | Ga0070704_1001060534 | 88 |
| 322 | 3300005549 | Ga0070704_100993763 | Ga0070704_1009937631 | 88 |
| 323 | 3300005564 | Ga0070664_100212641 | Ga0070664_1002126414 | 88 |
| 324 | 3300005578 | Ga0068854_101018527 | Ga0068854_1010185272 | 88 |
| 325 | 3300005617 | Ga0068859_100043718 | Ga0068859_1000437189 | 88 |
| 326 | 3300005618 | Ga0068864_102627985 | Ga0068864_1026279852 | 88 |
| 327 | 3300005841 | Ga0068863_100315227 | Ga0068863_1003152272 | 88 |
| 328 | 3300005841 | Ga0068863_100902400 | Ga0068863_1009024002 | 88 |
| 329 | 3300005842 | Ga0068858_100282027 | Ga0068858_1002820273 | 88 |
| 330 | 3300005843 | Ga0068860_100596670 | Ga0068860_1005966703 | 88 |
| 331 | 3300005844 | Ga0068862_100035153 | Ga0068862_1000351539 | 88 |
| 332 | 3300005937 | Ga0081455_10025196 | Ga0081455_100251964 | 88 |
| 333 | 3300006163 | Ga0070715_11035376 | Ga0070715_110353761 | 88 |
| 334 | 3300006844 | Ga0075428_100061239 | Ga0075428_1000612398 | 88 |
| 335 | 3300006844 | Ga0075428_100106239 | Ga0075428_1001062394 | 88 |
| 336 | 3300006847 | Ga0075431_100152648 | Ga0075431_1001526484 | 88 |
| 337 | 3300006852 | Ga0075433_10925755 | Ga0075433_109257552 | 88 |
| 338 | 3300006852 | Ga0075433_11412793 | Ga0075433_114127932 | 88 |
| 339 | 3300006871 | Ga0075434_100258550 | Ga0075434_1002585504 | 88 |
| 340 | 3300006880 | Ga0075429_100102770 | Ga0075429_1001027704 | 88 |
| 341 | 3300006931 | Ga0097620_100043718 | Ga0097620_1000437189 | 88 |
| 342 | 3300007076 | Ga0075435_100111105 | Ga0075435_1001111054 | 88 |
| 343 | 3300007076 | Ga0075435_100799775 | Ga0075435_1007997752 | 88 |
| 344 | 3300009098 | Ga0105245_11902774 | Ga0105245_119027741 | 88 |
| 345 | 3300009147 | Ga0114129_10113339 | Ga0114129_101133393 | 88 |
| 346 | 3300009147 | Ga0114129_10238790 | Ga0114129_102387903 | 88 |
| 347 | 3300009147 | Ga0114129_11271694 | Ga0114129_112716943 | 88 |
| 348 | 3300009147 | Ga0114129_11958715 | Ga0114129_119587153 | 88 |
| 349 | 3300009148 | Ga0105243_11051471 | Ga0105243_110514712 | 88 |
| 350 | 3300009177 | Ga0105248_11273287 | Ga0105248_112732873 | 88 |
| 351 | 3300009177 | Ga0105248_13350057 | Ga0105248_133500571 | 88 |
| 352 | 3300009553 | Ga0105249_10120380 | Ga0105249_101203804 | 88 |
| 353 | 3300013100 | Ga0157373_10944393 | Ga0157373_109443932 | 88 |
| 354 | 3300013308 | Ga0157375_10259312 | Ga0157375_102593124 | 88 |
| 355 | 3300013308 | Ga0157375_12377958 | Ga0157375_123779582 | 88 |
| 356 | 3300014325 | Ga0163163_10009943 | Ga0163163_1000994312 | 88 |
| 357 | 3300025910 | Ga0207684_10882431 | Ga0207684_108824311 | 88 |
| 358 | 3300025917 | Ga0207660_10372014 | Ga0207660_103720143 | 88 |
| 359 | 3300025920 | Ga0207649_11051461 | Ga0207649_110514613 | 88 |
| 360 | 3300025922 | Ga0207646_10059053 | Ga0207646_100590532 | 88 |
| 361 | 3300025922 | Ga0207646_10165758 | Ga0207646_101657584 | 88 |
| 362 | 3300025923 | Ga0207681_10784831 | Ga0207681_107848312 | 88 |
| 363 | 3300025931 | Ga0207644_10005299 | Ga0207644_100052993 | 88 |
| 364 | 3300025933 | Ga0207706_10878513 | Ga0207706_108785132 | 88 |
| 365 | 3300025934 | Ga0207686_10819194 | Ga0207686_108191942 | 88 |
| 366 | 3300025935 | Ga0207709_10173009 | Ga0207709_101730092 | 88 |
| 367 | 3300025936 | Ga0207670_10501346 | Ga0207670_105013463 | 88 |
| 368 | 3300025941 | Ga0207711_12085706 | Ga0207711_120857062 | 88 |
| 369 | 3300025945 | Ga0207679_10155209 | Ga0207679_101552093 | 88 |
| 370 | 3300025960 | Ga0207651_10022102 | Ga0207651_100221023 | 88 |
| 371 | 3300025960 | Ga0207651_10121492 | Ga0207651_101214924 | 88 |
| 372 | 3300025986 | Ga0207658_10602404 | Ga0207658_106024041 | 88 |
| 373 | 3300026035 | Ga0207703_10241518 | Ga0207703_102415183 | 88 |
| 374 | 3300026088 | Ga0207641_10949604 | Ga0207641_109496042 | 88 |
| 375 | 3300026089 | Ga0207648_10818425 | Ga0207648_108184252 | 88 |
| 376 | 3300026095 | Ga0207676_12202602 | Ga0207676_122026022 | 88 |
| 377 | 3300027526 | Ga0209968_1009371 | Ga0209968_10093712 | 88 |
| 378 | 3300027695 | Ga0209966_1007173 | Ga0209966_10071734 | 88 |
| 379 | 3300027876 | Ga0209974_10371913 | Ga0209974_103719131 | 88 |
| 380 | 3300028380 | Ga0268265_10005281 | Ga0268265_100052819 | 88 |
| 381 | 3300028381 | Ga0268264_10363608 | Ga0268264_103636083 | 88 |
| 382 | 3300031548 | Ga0307408_100140658 | Ga0307408_1001406584 | 88 |
| 383 | 3300031548 | Ga0307408_100217429 | Ga0307408_1002174293 | 88 |
| 384 | 3300031548 | Ga0307408_100292745 | Ga0307408_1002927453 | 88 |
| 385 | 3300031548 | Ga0307408_100731728 | Ga0307408_1007317282 | 88 |
| 386 | 3300031731 | Ga0307405_10113716 | Ga0307405_101137163 | 88 |
| 387 | 3300031731 | Ga0307405_10219766 | Ga0307405_102197663 | 88 |
| 388 | 3300031731 | Ga0307405_10225710 | Ga0307405_102257101 | 88 |
| 389 | 3300031824 | Ga0307413_10002665 | Ga0307413_100026653 | 88 |
| 390 | 3300031824 | Ga0307413_10031847 | Ga0307413_100318474 | 88 |
| 391 | 3300031824 | Ga0307413_10105379 | Ga0307413_101053793 | 88 |
| 392 | 3300031824 | Ga0307413_10369452 | Ga0307413_103694524 | 88 |
| 393 | 3300031824 | Ga0307413_10874657 | Ga0307413_108746572 | 88 |
| 394 | 3300031852 | Ga0307410_10000285 | Ga0307410_1000028511 | 88 |
| 395 | 3300031852 | Ga0307410_10005858 | Ga0307410_100058588 | 88 |
| 396 | 3300031852 | Ga0307410_10027373 | Ga0307410_100273734 | 88 |
| 397 | 3300031852 | Ga0307410_10061436 | Ga0307410_100614364 | 88 |
| 398 | 3300031901 | Ga0307406_10009039 | Ga0307406_100090396 | 88 |
| 399 | 3300031901 | Ga0307406_10030175 | Ga0307406_100301754 | 88 |
| 400 | 3300031901 | Ga0307406_10166791 | Ga0307406_101667913 | 88 |
| 401 | 3300031903 | Ga0307407_10005051 | Ga0307407_100050519 | 88 |
| 402 | 3300031903 | Ga0307407_10058334 | Ga0307407_100583345 | 88 |
| 403 | 3300031903 | Ga0307407_10618099 | Ga0307407_106180992 | 88 |
| 404 | 3300031903 | Ga0307407_10815099 | Ga0307407_108150993 | 88 |
| 405 | 3300031903 | Ga0307407_11008750 | Ga0307407_110087502 | 88 |
| 406 | 3300031911 | Ga0307412_10241216 | Ga0307412_102412163 | 88 |
| 407 | 3300031911 | Ga0307412_10902781 | Ga0307412_109027813 | 88 |
| 408 | 3300031911 | Ga0307412_11491734 | Ga0307412_114917341 | 88 |
| 409 | 3300031995 | Ga0307409_100008795 | Ga0307409_1000087959 | 88 |
| 410 | 3300031995 | Ga0307409_100063049 | Ga0307409_1000630494 | 88 |
| 411 | 3300031995 | Ga0307409_100154528 | Ga0307409_1001545284 | 88 |
| 412 | 3300031995 | Ga0307409_100154690 | Ga0307409_1001546904 | 88 |
| 413 | 3300031995 | Ga0307409_100222092 | Ga0307409_1002220923 | 88 |
| 414 | 3300031995 | Ga0307409_100287225 | Ga0307409_1002872254 | 88 |
| 415 | 3300031995 | Ga0307409_101702054 | Ga0307409_1017020542 | 88 |
| 416 | 3300032002 | Ga0307416_100003682 | Ga0307416_1000036829 | 88 |
| 417 | 3300032002 | Ga0307416_100010520 | Ga0307416_10001052010 | 88 |
| 418 | 3300032002 | Ga0307416_100015821 | Ga0307416_10001582112 | 88 |
| 419 | 3300032002 | Ga0307416_100020437 | Ga0307416_1000204374 | 88 |
| 420 | 3300032002 | Ga0307416_100217109 | Ga0307416_1002171092 | 88 |
| 421 | 3300032002 | Ga0307416_100278480 | Ga0307416_1002784804 | 88 |
| 422 | 3300032002 | Ga0307416_100611026 | Ga0307416_1006110262 | 88 |
| 423 | 3300032004 | Ga0307414_10219473 | Ga0307414_102194732 | 88 |
| 424 | 3300032004 | Ga0307414_10351362 | Ga0307414_103513623 | 88 |
| 425 | 3300032004 | Ga0307414_11421427 | Ga0307414_114214271 | 88 |
| 426 | 3300032005 | Ga0307411_10022708 | Ga0307411_100227084 | 88 |
| 427 | 3300032005 | Ga0307411_10155066 | Ga0307411_101550662 | 88 |
| 428 | 3300032005 | Ga0307411_10211317 | Ga0307411_102113173 | 88 |
| 429 | 3300032005 | Ga0307411_11040021 | Ga0307411_110400212 | 88 |
| 430 | 3300032126 | Ga0307415_100023019 | Ga0307415_1000230196 | 88 |
| 431 | 3300032126 | Ga0307415_100072922 | Ga0307415_1000729224 | 88 |
| 432 | 3300032126 | Ga0307415_100240821 | Ga0307415_1002408213 | 88 |
| 433 | 3300032126 | Ga0307415_100339846 | Ga0307415_1003398463 | 88 |
| 434 | 3300032126 | Ga0307415_101305711 | Ga0307415_1013057111 | 88 |
| 435 | 3300032126 | Ga0307415_102296005 | Ga0307415_1022960051 | 88 |
| 436 | 3300034820 | Ga0373959_0164898 | Ga0373959_0164898_54_338 | 88 |
| 437 | 3300035119 | Ga0373956_0309398 | Ga0373956_0309398_85_354 | 88 |
| 438 | 3300035725 | Ga0373947_0824889 | Ga0373947_0824889_148_417 | 88 |
| 439 | 3300036401 | Ga0373937_0114614 | Ga0373937_0114614_1611_1880 | 88 |
| 440 | 3300037471 | Ga0395905_0569350 | Ga0395905_0569350_509_787 | 88 |
| 441 | 3300041404 | Ga0439436_0073755 | Ga0439436_0073755_511_798 | 88 |
| 442 | 3300041406 | Ga0439439_0023621 | Ga0439439_0023621_805_1092 | 88 |
| 443 | 3300041463 | Ga0451804_0789277 | Ga0451804_0789277_609_884 | 88 |
| 444 | 3300041486 | Ga0451807_0674211 | Ga0451807_0674211_195_470 | 88 |
| 445 | 3300041512 | Ga0451853_2411247 | Ga0451853_2411247_74_349 | 88 |
| 446 | 3300041999 | Ga0439433_0080089 | Ga0439433_0080089_230_496 | 88 |
| 447 | 3300042015 | Ga0439462_0116722 | Ga0439462_0116722_13_300 | 88 |
| 448 | 3300042156 | Ga0439446_0239565 | Ga0439446_0239565_261_527 | 88 |
| 449 | 3300042435 | Ga0439434_0092927 | Ga0439434_0092927_102_389 | 88 |
| 450 | 3300046455 | Ga0495603_0058761 | Ga0495603_0058761_742_1011 | 88 |
| 451 | 3300046461 | Ga0495641_0033780 | Ga0495641_0033780_2129_2398 | 88 |
| 452 | 3300046463 | Ga0495653_0332714 | Ga0495653_0332714_211_495 | 88 |
| 453 | 3300046472 | Ga0495580_0083378 | Ga0495580_0083378_913_1182 | 88 |
| 454 | 3300046473 | Ga0495582_0004780 | Ga0495582_0004780_880_1149 | 88 |
| 455 | 3300046475 | Ga0495639_0160034 | Ga0495639_0160034_637_906 | 88 |
| 456 | 3300046477 | Ga0495664_0006539 | Ga0495664_0006539_5765_6034 | 88 |
| 457 | 3300046499 | Ga0495594_0002236 | Ga0495594_0002236_6287_6556 | 88 |
| 458 | 3300046514 | Ga0495618_0216760 | Ga0495618_0216760_774_1043 | 88 |
| 459 | 3300046516 | Ga0495628_0074756 | Ga0495628_0074756_1423_1692 | 88 |
| 460 | 3300046516 | Ga0495628_0673212 | Ga0495628_0673212_178_462 | 88 |
| 461 | 3300046526 | Ga0495666_0006653 | Ga0495666_0006653_1518_1787 | 88 |
| 462 | 3300046533 | Ga0495640_0007035 | Ga0495640_0007035_7480_7749 | 88 |
| 463 | 3300046535 | Ga0495586_0029015 | Ga0495586_0029015_2358_2627 | 88 |
| 464 | 3300046535 | Ga0495586_0193566 | Ga0495586_0193566_830_1105 | 88 |
| 465 | 3300046535 | Ga0495586_0260586 | Ga0495586_0260586_177_461 | 88 |
| 466 | 3300046536 | Ga0495587_0715865 | Ga0495587_0715865_59_343 | 88 |
| 467 | 3300046559 | Ga0495667_0034963 | Ga0495667_0034963_1502_1771 | 88 |
| 468 | 3300046642 | Ga0495634_0001123 | Ga0495634_0001123_5072_5341 | 88 |
| 469 | 3300046675 | Ga0495657_0169181 | Ga0495657_0169181_411_695 | 88 |
| 470 | 3300046678 | Ga0495599_0892523 | Ga0495599_0892523_64_333 | 88 |
| 471 | 3300046681 | Ga0495647_0038991 | Ga0495647_0038991_796_1065 | 88 |
| 472 | 3300046683 | Ga0495658_0003330 | Ga0495658_0003330_2775_3044 | 88 |
| 473 | 3300046689 | Ga0495613_0025046 | Ga0495613_0025046_174_443 | 88 |
| 474 | 3300047319 | Ga0495674_0024223 | Ga0495674_0024223_353_622 | 88 |
| 475 | 3300047322 | Ga0495680_0012216 | Ga0495680_0012216_6644_6913 | 88 |
| 476 | 3300047471 | Ga0495684_0045726 | Ga0495684_0045726_2446_2715 | 88 |
| 477 | 3300049515 | Ga0501292_073204 | Ga0501292_073204_86_355 | 88 |
| 478 | 3300049521 | Ga0501298_028743 | Ga0501298_028743_333_602 | 88 |
| 479 | 3300049521 | Ga0501298_126584 | Ga0501298_126584_75_344 | 88 |
| 480 | 3300049580 | Ga0501046_1022413 | Ga0501046_1022413_262_528 | 88 |
| 481 | 3300049583 | Ga0501067_0342844 | Ga0501067_0342844_382_651 | 88 |
| 482 | 3300049584 | Ga0501068_0251675 | Ga0501068_0251675_669_938 | 88 |
| 483 | 3300049585 | Ga0501069_0238224 | Ga0501069_0238224_405_674 | 88 |
| 484 | 3300049587 | Ga0501071_0368781 | Ga0501071_0368781_627_899 | 88 |
| 485 | 3300049588 | Ga0501072_1341487 | Ga0501072_1341487_273_539 | 88 |
| 486 | 3300049589 | Ga0501073_0062704 | Ga0501073_0062704_1534_1803 | 88 |
| 487 | 3300049592 | Ga0501076_0526801 | Ga0501076_0526801_62_328 | 88 |
| 488 | 3300049593 | Ga0501077_0009743 | Ga0501077_0009743_5110_5379 | 88 |
| 489 | 3300049593 | Ga0501077_0673513 | Ga0501077_0673513_92_364 | 88 |
| 490 | 3300049655 | Ga0501208_066406 | Ga0501208_066406_299_568 | 88 |
| 491 | 3300049656 | Ga0501209_036721 | Ga0501209_036721_483_752 | 88 |
| 492 | 3300049661 | Ga0501217_005170 | Ga0501217_005170_2297_2566 | 88 |
| 493 | 3300049667 | Ga0501230_038983 | Ga0501230_038983_77_346 | 88 |
| 494 | 3300049668 | Ga0501233_129515 | Ga0501233_129515_290_559 | 88 |
| 495 | 3300049669 | Ga0501235_066427 | Ga0501235_066427_371_640 | 88 |
| 496 | 3300049673 | Ga0501240_072036 | Ga0501240_072036_294_563 | 88 |
| 497 | 3300049675 | Ga0501243_054189 | Ga0501243_054189_236_505 | 88 |
| 498 | 3300049675 | Ga0501243_125041 | Ga0501243_125041_164_433 | 88 |
| 499 | 3300049677 | Ga0501247_001365 | Ga0501247_001365_1614_1883 | 88 |
| 500 | 3300049680 | Ga0501250_009150 | Ga0501250_009150_211_480 | 88 |
| 501 | 3300049684 | Ga0501255_061117 | Ga0501255_061117_163_432 | 88 |
| 502 | 3300049685 | Ga0501256_015384 | Ga0501256_015384_290_559 | 88 |
| 503 | 3300049686 | Ga0501257_033911 | Ga0501257_033911_75_344 | 88 |
| 504 | 3300049688 | Ga0501259_014322 | Ga0501259_014322_102_371 | 88 |
| 505 | 3300049741 | Ga0501079_0010761 | Ga0501079_0010761_4601_4873 | 88 |
| 506 | 3300049741 | Ga0501079_0147972 | Ga0501079_0147972_1473_1742 | 88 |
| 507 | 3300049743 | Ga0501081_0011857 | Ga0501081_0011857_2488_2760 | 88 |
| 508 | 3300049743 | Ga0501081_0432119 | Ga0501081_0432119_208_477 | 88 |
| 509 | 3300049744 | Ga0501083_0091110 | Ga0501083_0091110_483_752 | 88 |
| 510 | 3300049760 | Ga0501263_000777 | Ga0501263_000777_2264_2533 | 88 |
| 511 | 3300049764 | Ga0501267_013501 | Ga0501267_013501_418_687 | 88 |
| 512 | 3300049769 | Ga0501272_003966 | Ga0501272_003966_753_1022 | 88 |
| 513 | 3300049824 | Ga0501045_0806506 | Ga0501045_0806506_84_350 | 88 |
| 514 | 3300049850 | Ga0501204_012112 | Ga0501204_012112_155_424 | 88 |
| 515 | 3300049853 | Ga0501226_013373 | Ga0501226_013373_599_868 | 88 |
| 516 | 3300050507 | nmdc:mga05p37_553551_c1 | nmdc:mga05p37_553551_c1_195_461 | 88 |
| 517 | 3300050507 | nmdc:mga05p37_719978_c1 | nmdc:mga05p37_719978_c1_433_708 | 88 |
| 518 | 3300050508 | nmdc:mga09592_11913_c1 | nmdc:mga09592_11913_c1_1399_1665 | 88 |
| 519 | 3300050510 | nmdc:mga06r32_347205_c1 | nmdc:mga06r32_347205_c1_1013_1282 | 88 |
| 520 | 3300050512 | nmdc:mga0n895_489365_c1 | nmdc:mga0n895_489365_c1_349_618 | 88 |
| 521 | 3300050513 | nmdc:mga0rr50_1295563_c1 | nmdc:mga0rr50_1295563_c1_39_305 | 88 |
| 522 | 3300050513 | nmdc:mga0rr50_272117_c1 | nmdc:mga0rr50_272117_c1_822_1091 | 88 |
| 523 | 3300053084 | Ga0495595_0736426 | Ga0495595_0736426_19_288 | 88 |
| 524 | 3300053085 | Ga0495619_0335257 | Ga0495619_0335257_619_888 | 88 |
| 525 | 3300054114 | Ga0501084_0154746 | Ga0501084_0154746_436_705 | 88 |
| 526 | 3300054114 | Ga0501084_1025346 | Ga0501084_1025346_77_349 | 88 |
| 527 | 3300060353 | Ga0501082_0052740 | Ga0501082_0052740_558_830 | 88 |
| 528 | 3300060353 | Ga0501082_0651895 | Ga0501082_0651895_438_704 | 88 |
| 529 | 3300060353 | Ga0501082_1427867 | Ga0501082_1427867_81_350 | 88 |
| 530 | 3300005293 | Ga0065715_10335955 | Ga0065715_103359552 | 89 |
| 531 | 3300005328 | Ga0070676_10001554 | Ga0070676_1000155413 | 89 |
| 532 | 3300005328 | Ga0070676_11543454 | Ga0070676_115434541 | 89 |
| 533 | 3300005329 | Ga0070683_100731628 | Ga0070683_1007316283 | 89 |
| 534 | 3300005330 | Ga0070690_100220052 | Ga0070690_1002200522 | 89 |
| 535 | 3300005334 | Ga0068869_100431635 | Ga0068869_1004316353 | 89 |
| 536 | 3300005335 | Ga0070666_10039763 | Ga0070666_100397633 | 89 |
| 537 | 3300005336 | Ga0070680_100542498 | Ga0070680_1005424983 | 89 |
| 538 | 3300005340 | Ga0070689_101294659 | Ga0070689_1012946592 | 89 |
| 539 | 3300005341 | Ga0070691_10076548 | Ga0070691_100765483 | 89 |
| 540 | 3300005344 | Ga0070661_100451391 | Ga0070661_1004513912 | 89 |
| 541 | 3300005344 | Ga0070661_100818957 | Ga0070661_1008189571 | 89 |
| 542 | 3300005347 | Ga0070668_100176017 | Ga0070668_1001760174 | 89 |
| 543 | 3300005354 | Ga0070675_100180981 | Ga0070675_1001809811 | 89 |
| 544 | 3300005354 | Ga0070675_101229611 | Ga0070675_1012296112 | 89 |
| 545 | 3300005355 | Ga0070671_100821229 | Ga0070671_1008212291 | 89 |
| 546 | 3300005356 | Ga0070674_100343363 | Ga0070674_1003433634 | 89 |
| 547 | 3300005364 | Ga0070673_100044532 | Ga0070673_1000445324 | 89 |
| 548 | 3300005364 | Ga0070673_100198753 | Ga0070673_1001987534 | 89 |
| 549 | 3300005364 | Ga0070673_100629188 | Ga0070673_1006291881 | 89 |
| 550 | 3300005365 | Ga0070688_101413679 | Ga0070688_1014136791 | 89 |
| 551 | 3300005366 | Ga0070659_100239592 | Ga0070659_1002395923 | 89 |
| 552 | 3300005367 | Ga0070667_100387814 | Ga0070667_1003878143 | 89 |
| 553 | 3300005438 | Ga0070701_10331438 | Ga0070701_103314382 | 89 |
| 554 | 3300005438 | Ga0070701_10457070 | Ga0070701_104570701 | 89 |
| 555 | 3300005440 | Ga0070705_100061139 | Ga0070705_1000611395 | 89 |
| 556 | 3300005440 | Ga0070705_100335450 | Ga0070705_1003354503 | 89 |
| 557 | 3300005441 | Ga0070700_100027726 | Ga0070700_1000277267 | 89 |
| 558 | 3300005444 | Ga0070694_100047914 | Ga0070694_1000479147 | 89 |
| 559 | 3300005445 | Ga0070708_100021258 | Ga0070708_1000212584 | 89 |
| 560 | 3300005445 | Ga0070708_100684253 | Ga0070708_1006842533 | 89 |
| 561 | 3300005445 | Ga0070708_100996881 | Ga0070708_1009968811 | 89 |
| 562 | 3300005455 | Ga0070663_100501939 | Ga0070663_1005019393 | 89 |
| 563 | 3300005456 | Ga0070678_100006200 | Ga0070678_10000620010 | 89 |
| 564 | 3300005456 | Ga0070678_101783078 | Ga0070678_1017830782 | 89 |
| 565 | 3300005457 | Ga0070662_100000495 | Ga0070662_1000004951 | 89 |
| 566 | 3300005457 | Ga0070662_100390599 | Ga0070662_1003905993 | 89 |
| 567 | 3300005458 | Ga0070681_10343864 | Ga0070681_103438641 | 89 |
| 568 | 3300005458 | Ga0070681_10354334 | Ga0070681_103543344 | 89 |
| 569 | 3300005458 | Ga0070681_11988419 | Ga0070681_119884192 | 89 |
| 570 | 3300005459 | Ga0068867_102388518 | Ga0068867_1023885181 | 89 |
| 571 | 3300005466 | Ga0070685_10285802 | Ga0070685_102858023 | 89 |
| 572 | 3300005467 | Ga0070706_100813541 | Ga0070706_1008135411 | 89 |
| 573 | 3300005467 | Ga0070706_100959699 | Ga0070706_1009596992 | 89 |
| 574 | 3300005467 | Ga0070706_101017615 | Ga0070706_1010176151 | 89 |
| 575 | 3300005471 | Ga0070698_100005769 | Ga0070698_10000576917 | 89 |
| 576 | 3300005518 | Ga0070699_100029175 | Ga0070699_1000291756 | 89 |
| 577 | 3300005530 | Ga0070679_101294096 | Ga0070679_1012940962 | 89 |
| 578 | 3300005536 | Ga0070697_101164221 | Ga0070697_1011642211 | 89 |
| 579 | 3300005539 | Ga0068853_100468970 | Ga0068853_1004689702 | 89 |
| 580 | 3300005539 | Ga0068853_100654070 | Ga0068853_1006540702 | 89 |
| 581 | 3300005539 | Ga0068853_101596348 | Ga0068853_1015963482 | 89 |
| 582 | 3300005543 | Ga0070672_102120639 | Ga0070672_1021206391 | 89 |
| 583 | 3300005544 | Ga0070686_100561210 | Ga0070686_1005612102 | 89 |
| 584 | 3300005544 | Ga0070686_100815594 | Ga0070686_1008155942 | 89 |
| 585 | 3300005545 | Ga0070695_100015722 | Ga0070695_1000157224 | 89 |
| 586 | 3300005545 | Ga0070695_100643180 | Ga0070695_1006431801 | 89 |
| 587 | 3300005546 | Ga0070696_100001655 | Ga0070696_10000165510 | 89 |
| 588 | 3300005546 | Ga0070696_100005337 | Ga0070696_1000053374 | 89 |
| 589 | 3300005546 | Ga0070696_100385249 | Ga0070696_1003852493 | 89 |
| 590 | 3300005546 | Ga0070696_100407520 | Ga0070696_1004075201 | 89 |
| 591 | 3300005547 | Ga0070693_100116783 | Ga0070693_1001167833 | 89 |
| 592 | 3300005547 | Ga0070693_100148892 | Ga0070693_1001488924 | 89 |
| 593 | 3300005549 | Ga0070704_100228522 | Ga0070704_1002285223 | 89 |
| 594 | 3300005549 | Ga0070704_100352090 | Ga0070704_1003520903 | 89 |
| 595 | 3300005563 | Ga0068855_101764356 | Ga0068855_1017643562 | 89 |
| 596 | 3300005577 | Ga0068857_100413384 | Ga0068857_1004133844 | 89 |
| 597 | 3300005578 | Ga0068854_100000444 | Ga0068854_10000044412 | 89 |
| 598 | 3300005578 | Ga0068854_100069785 | Ga0068854_1000697857 | 89 |
| 599 | 3300005615 | Ga0070702_100224648 | Ga0070702_1002246481 | 89 |
| 600 | 3300005616 | Ga0068852_100300801 | Ga0068852_1003008011 | 89 |
| 601 | 3300005617 | Ga0068859_102157460 | Ga0068859_1021574601 | 89 |
| 602 | 3300005618 | Ga0068864_101792466 | Ga0068864_1017924662 | 89 |
| 603 | 3300005718 | Ga0068866_10000625 | Ga0068866_1000062515 | 89 |
| 604 | 3300005719 | Ga0068861_100176742 | Ga0068861_1001767423 | 89 |
| 605 | 3300005841 | Ga0068863_101351026 | Ga0068863_1013510261 | 89 |
| 606 | 3300005842 | Ga0068858_102515552 | Ga0068858_1025155521 | 89 |
| 607 | 3300005843 | Ga0068860_100025031 | Ga0068860_10002503110 | 89 |
| 608 | 3300005844 | Ga0068862_100494809 | Ga0068862_1004948093 | 89 |
| 609 | 3300006058 | Ga0075432_10577971 | Ga0075432_105779711 | 89 |
| 610 | 3300006163 | Ga0070715_10096457 | Ga0070715_100964571 | 89 |
| 611 | 3300006237 | Ga0097621_100040793 | Ga0097621_1000407931 | 89 |
| 612 | 3300006844 | Ga0075428_101952778 | Ga0075428_1019527782 | 89 |
| 613 | 3300006846 | Ga0075430_100150989 | Ga0075430_1001509895 | 89 |
| 614 | 3300006847 | Ga0075431_100018917 | Ga0075431_1000189174 | 89 |
| 615 | 3300006852 | Ga0075433_10030828 | Ga0075433_100308287 | 89 |
| 616 | 3300006871 | Ga0075434_100126654 | Ga0075434_1001266544 | 89 |
| 617 | 3300006881 | Ga0068865_100450966 | Ga0068865_1004509662 | 89 |
| 618 | 3300006881 | Ga0068865_102120411 | Ga0068865_1021204111 | 89 |
| 619 | 3300006914 | Ga0075436_100434782 | Ga0075436_1004347823 | 89 |
| 620 | 3300006931 | Ga0097620_102156521 | Ga0097620_1021565212 | 89 |
| 621 | 3300007076 | Ga0075435_100313249 | Ga0075435_1003132493 | 89 |
| 622 | 3300009093 | Ga0105240_10152415 | Ga0105240_101524154 | 89 |
| 623 | 3300009094 | Ga0111539_10475690 | Ga0111539_104756903 | 89 |
| 624 | 3300009098 | Ga0105245_10020560 | Ga0105245_100205609 | 89 |
| 625 | 3300009098 | Ga0105245_11323001 | Ga0105245_113230011 | 89 |
| 626 | 3300009147 | Ga0114129_10384224 | Ga0114129_103842242 | 89 |
| 627 | 3300009148 | Ga0105243_10286031 | Ga0105243_102860313 | 89 |
| 628 | 3300009148 | Ga0105243_11961932 | Ga0105243_119619321 | 89 |
| 629 | 3300009174 | Ga0105241_12192956 | Ga0105241_121929562 | 89 |
| 630 | 3300009176 | Ga0105242_10007285 | Ga0105242_1000728513 | 89 |
| 631 | 3300009177 | Ga0105248_10090668 | Ga0105248_100906683 | 89 |
| 632 | 3300009177 | Ga0105248_11862803 | Ga0105248_118628032 | 89 |
| 633 | 3300009177 | Ga0105248_12579348 | Ga0105248_125793481 | 89 |
| 634 | 3300009551 | Ga0105238_10763200 | Ga0105238_107632002 | 89 |
| 635 | 3300009551 | Ga0105238_10931241 | Ga0105238_109312413 | 89 |
| 636 | 3300009553 | Ga0105249_12651511 | Ga0105249_126515111 | 89 |
| 637 | 3300010375 | Ga0105239_10039556 | Ga0105239_100395565 | 89 |
| 638 | 3300010375 | Ga0105239_10443774 | Ga0105239_104437744 | 89 |
| 639 | 3300011119 | Ga0105246_10040974 | Ga0105246_100409743 | 89 |
| 640 | 3300013100 | Ga0157373_10824432 | Ga0157373_108244321 | 89 |
| 641 | 3300013297 | Ga0157378_10018282 | Ga0157378_100182829 | 89 |
| 642 | 3300013306 | Ga0163162_10396518 | Ga0163162_103965183 | 89 |
| 643 | 3300013306 | Ga0163162_10422599 | Ga0163162_104225994 | 89 |
| 644 | 3300013307 | Ga0157372_10703184 | Ga0157372_107031843 | 89 |
| 645 | 3300013307 | Ga0157372_12789528 | Ga0157372_127895282 | 89 |
| 646 | 3300013308 | Ga0157375_10392073 | Ga0157375_103920734 | 89 |
| 647 | 3300013308 | Ga0157375_10980544 | Ga0157375_109805443 | 89 |
| 648 | 3300014326 | Ga0157380_10119060 | Ga0157380_101190605 | 89 |
| 649 | 3300014326 | Ga0157380_10475785 | Ga0157380_104757853 | 89 |
| 650 | 3300014326 | Ga0157380_11090769 | Ga0157380_110907692 | 89 |
| 651 | 3300014745 | Ga0157377_10169018 | Ga0157377_101690181 | 89 |
| 652 | 3300014745 | Ga0157377_10657126 | Ga0157377_106571262 | 89 |
| 653 | 3300014968 | Ga0157379_10654301 | Ga0157379_106543012 | 89 |
| 654 | 3300014969 | Ga0157376_10507677 | Ga0157376_105076772 | 89 |
| 655 | 3300017792 | Ga0163161_10050412 | Ga0163161_100504121 | 89 |
| 656 | 3300025899 | Ga0207642_10000869 | Ga0207642_100008694 | 89 |
| 657 | 3300025907 | Ga0207645_10002969 | Ga0207645_1000296914 | 89 |
| 658 | 3300025908 | Ga0207643_10007495 | Ga0207643_1000749511 | 89 |
| 659 | 3300025911 | Ga0207654_10190775 | Ga0207654_101907754 | 89 |
| 660 | 3300025912 | Ga0207707_11115247 | Ga0207707_111152472 | 89 |
| 661 | 3300025912 | Ga0207707_11209998 | Ga0207707_112099981 | 89 |
| 662 | 3300025914 | Ga0207671_11284985 | Ga0207671_112849851 | 89 |
| 663 | 3300025917 | Ga0207660_10253121 | Ga0207660_102531214 | 89 |
| 664 | 3300025917 | Ga0207660_10441767 | Ga0207660_104417673 | 89 |
| 665 | 3300025918 | Ga0207662_10070949 | Ga0207662_100709495 | 89 |
| 666 | 3300025919 | Ga0207657_11151772 | Ga0207657_111517722 | 89 |
| 667 | 3300025923 | Ga0207681_10162842 | Ga0207681_101628421 | 89 |
| 668 | 3300025924 | Ga0207694_10765988 | Ga0207694_107659883 | 89 |
| 669 | 3300025924 | Ga0207694_11852719 | Ga0207694_118527191 | 89 |
| 670 | 3300025926 | Ga0207659_10076987 | Ga0207659_100769873 | 89 |
| 671 | 3300025926 | Ga0207659_11569423 | Ga0207659_115694232 | 89 |
| 672 | 3300025927 | Ga0207687_10361616 | Ga0207687_103616161 | 89 |
| 673 | 3300025931 | Ga0207644_10223074 | Ga0207644_102230743 | 89 |
| 674 | 3300025932 | Ga0207690_10812354 | Ga0207690_108123541 | 89 |
| 675 | 3300025933 | Ga0207706_10000025 | Ga0207706_1000002569 | 89 |
| 676 | 3300025933 | Ga0207706_10174699 | Ga0207706_101746993 | 89 |
| 677 | 3300025934 | Ga0207686_10001115 | Ga0207686_1000111513 | 89 |
| 678 | 3300025935 | Ga0207709_10032436 | Ga0207709_100324361 | 89 |
| 679 | 3300025935 | Ga0207709_10693245 | Ga0207709_106932452 | 89 |
| 680 | 3300025936 | Ga0207670_10987243 | Ga0207670_109872433 | 89 |
| 681 | 3300025937 | Ga0207669_10000638 | Ga0207669_1000063813 | 89 |
| 682 | 3300025938 | Ga0207704_10004727 | Ga0207704_100047279 | 89 |
| 683 | 3300025938 | Ga0207704_10861171 | Ga0207704_108611712 | 89 |
| 684 | 3300025941 | Ga0207711_11291209 | Ga0207711_112912092 | 89 |
| 685 | 3300025942 | Ga0207689_10002028 | Ga0207689_1000202823 | 89 |
| 686 | 3300025949 | Ga0207667_10289436 | Ga0207667_102894361 | 89 |
| 687 | 3300025960 | Ga0207651_10232942 | Ga0207651_102329424 | 89 |
| 688 | 3300025960 | Ga0207651_10539187 | Ga0207651_105391872 | 89 |
| 689 | 3300025961 | Ga0207712_10019662 | Ga0207712_100196629 | 89 |
| 690 | 3300025961 | Ga0207712_10453037 | Ga0207712_104530372 | 89 |
| 691 | 3300025961 | Ga0207712_11211803 | Ga0207712_112118031 | 89 |
| 692 | 3300025972 | Ga0207668_10182169 | Ga0207668_101821693 | 89 |
| 693 | 3300025972 | Ga0207668_11176157 | Ga0207668_111761571 | 89 |
| 694 | 3300025981 | Ga0207640_10066246 | Ga0207640_100662464 | 89 |
| 695 | 3300025986 | Ga0207658_10219081 | Ga0207658_102190813 | 89 |
| 696 | 3300026035 | Ga0207703_10159851 | Ga0207703_101598511 | 89 |
| 697 | 3300026041 | Ga0207639_11080565 | Ga0207639_110805652 | 89 |
| 698 | 3300026067 | Ga0207678_10103624 | Ga0207678_101036244 | 89 |
| 699 | 3300026075 | Ga0207708_10012624 | Ga0207708_100126246 | 89 |
| 700 | 3300026088 | Ga0207641_10091448 | Ga0207641_100914486 | 89 |
| 701 | 3300026089 | Ga0207648_10000138 | Ga0207648_1000013865 | 89 |
| 702 | 3300026095 | Ga0207676_11194171 | Ga0207676_111941712 | 89 |
| 703 | 3300026118 | Ga0207675_100006697 | Ga0207675_10000669716 | 89 |
| 704 | 3300026118 | Ga0207675_101501757 | Ga0207675_1015017572 | 89 |
| 705 | 3300026118 | Ga0207675_102030572 | Ga0207675_1020305722 | 89 |
| 706 | 3300026121 | Ga0207683_10006013 | Ga0207683_100060136 | 89 |
| 707 | 3300026121 | Ga0207683_11900586 | Ga0207683_119005862 | 89 |
| 708 | 3300026142 | Ga0207698_10070479 | Ga0207698_100704792 | 89 |
| 709 | 3300027717 | Ga0209998_10175771 | Ga0209998_101757711 | 89 |
| 710 | 3300027876 | Ga0209974_10013888 | Ga0209974_100138886 | 89 |
| 711 | 3300027907 | Ga0207428_10785885 | Ga0207428_107858852 | 89 |
| 712 | 3300028379 | Ga0268266_10077288 | Ga0268266_100772886 | 89 |
| 713 | 3300028380 | Ga0268265_10227173 | Ga0268265_102271733 | 89 |
| 714 | 3300028381 | Ga0268264_10012146 | Ga0268264_100121463 | 89 |
| 715 | 3300031548 | Ga0307408_100007121 | Ga0307408_1000071219 | 89 |
| 716 | 3300031548 | Ga0307408_102430427 | Ga0307408_1024304271 | 89 |
| 717 | 3300031731 | Ga0307405_10304193 | Ga0307405_103041933 | 89 |
| 718 | 3300031824 | Ga0307413_10346189 | Ga0307413_103461894 | 89 |
| 719 | 3300031852 | Ga0307410_10531368 | Ga0307410_105313683 | 89 |
| 720 | 3300031901 | Ga0307406_10206536 | Ga0307406_102065364 | 89 |
| 721 | 3300031911 | Ga0307412_10384216 | Ga0307412_103842163 | 89 |
| 722 | 3300031911 | Ga0307412_12241692 | Ga0307412_122416921 | 89 |
| 723 | 3300031995 | Ga0307409_100102187 | Ga0307409_1001021874 | 89 |
| 724 | 3300031995 | Ga0307409_100597630 | Ga0307409_1005976303 | 89 |
| 725 | 3300032002 | Ga0307416_100016925 | Ga0307416_1000169259 | 89 |
| 726 | 3300032002 | Ga0307416_100429662 | Ga0307416_1004296622 | 89 |
| 727 | 3300032004 | Ga0307414_10273173 | Ga0307414_102731732 | 89 |
| 728 | 3300032004 | Ga0307414_12198084 | Ga0307414_121980841 | 89 |
| 729 | 3300032005 | Ga0307411_10193734 | Ga0307411_101937342 | 89 |
| 730 | 3300032005 | Ga0307411_11900480 | Ga0307411_119004802 | 89 |
| 731 | 3300032126 | Ga0307415_100434528 | Ga0307415_1004345282 | 89 |
| 732 | 3300035241 | Ga0373961_0163450 | Ga0373961_0163450_268_540 | 89 |
| 733 | 3300038996 | Ga0242420_036891 | Ga0242420_036891_445_723 | 89 |
| 734 | 3300041406 | Ga0439439_0020628 | Ga0439439_0020628_412_702 | 89 |
| 735 | 3300041997 | Ga0439431_0009377 | Ga0439431_0009377_1296_1586 | 89 |
| 736 | 3300042004 | Ga0439445_0097230 | Ga0439445_0097230_364_633 | 89 |
| 737 | 3300042014 | Ga0439457_019297 | Ga0439457_019297_961_1251 | 89 |
| 738 | 3300042015 | Ga0439462_0032157 | Ga0439462_0032157_446_736 | 89 |
| 739 | 3300042127 | Ga0450890_057475 | Ga0450890_057475_14_283 | 89 |
| 740 | 3300042134 | Ga0450898_084983 | Ga0450898_084983_100_390 | 89 |
| 741 | 3300042147 | Ga0450910_019874 | Ga0450910_019874_694_966 | 89 |
| 742 | 3300042156 | Ga0439446_0004079 | Ga0439446_0004079_1603_1893 | 89 |
| 743 | 3300042156 | Ga0439446_0076459 | Ga0439446_0076459_610_924 | 89 |
| 744 | 3300042435 | Ga0439434_0196020 | Ga0439434_0196020_309_578 | 89 |
| 745 | 3300044901 | Ga0466960_0112845 | Ga0466960_0112845_165_446 | 89 |
| 746 | 3300044901 | Ga0466960_0379094 | Ga0466960_0379094_376_654 | 89 |
| 747 | 3300046455 | Ga0495603_0129979 | Ga0495603_0129979_1070_1342 | 89 |
| 748 | 3300046492 | Ga0495585_0034640 | Ga0495585_0034640_149_421 | 89 |
| 749 | 3300046499 | Ga0495594_0010292 | Ga0495594_0010292_618_890 | 89 |
| 750 | 3300046499 | Ga0495594_0036897 | Ga0495594_0036897_2289_2561 | 89 |
| 751 | 3300046615 | Ga0495656_0218455 | Ga0495656_0218455_283_567 | 89 |
| 752 | 3300046681 | Ga0495647_0521172 | Ga0495647_0521172_203_484 | 89 |
| 753 | 3300046684 | Ga0495669_0224871 | Ga0495669_0224871_26_298 | 89 |
| 754 | 3300048903 | Ga0496100_0227840 | Ga0496100_0227840_287_559 | 89 |
| 755 | 3300048904 | Ga0496101_0047340 | Ga0496101_0047340_324_617 | 89 |
| 756 | 3300048904 | Ga0496101_0555486 | Ga0496101_0555486_43_315 | 89 |
| 757 | 3300048904 | Ga0496101_0577224 | Ga0496101_0577224_35_307 | 89 |
| 758 | 3300048904 | Ga0496101_0938613 | Ga0496101_0938613_321_590 | 89 |
| 759 | 3300048905 | Ga0496102_0280261 | Ga0496102_0280261_1246_1515 | 89 |
| 760 | 3300048905 | Ga0496102_0870353 | Ga0496102_0870353_397_675 | 89 |
| 761 | 3300048906 | Ga0496103_0233696 | Ga0496103_0233696_118_390 | 89 |
| 762 | 3300048906 | Ga0496103_0826536 | Ga0496103_0826536_181_453 | 89 |
| 763 | 3300048907 | Ga0496104_0184083 | Ga0496104_0184083_29_322 | 89 |
| 764 | 3300048908 | Ga0496105_0264215 | Ga0496105_0264215_302_595 | 89 |
| 765 | 3300048909 | Ga0496106_0003759 | Ga0496106_0003759_6034_6306 | 89 |
| 766 | 3300048909 | Ga0496106_0078374 | Ga0496106_0078374_1682_1975 | 89 |
| 767 | 3300048909 | Ga0496106_0311866 | Ga0496106_0311866_403_681 | 89 |
| 768 | 3300048909 | Ga0496106_0331505 | Ga0496106_0331505_73_345 | 89 |
| 769 | 3300048909 | Ga0496106_0887585 | Ga0496106_0887585_240_509 | 89 |
| 770 | 3300048910 | Ga0496107_0077151 | Ga0496107_0077151_1772_2065 | 89 |
| 771 | 3300048910 | Ga0496107_0806281 | Ga0496107_0806281_217_495 | 89 |
| 772 | 3300048912 | Ga0496109_0039889 | Ga0496109_0039889_1199_1492 | 89 |
| 773 | 3300048913 | Ga0496110_0007094 | Ga0496110_0007094_3505_3798 | 89 |
| 774 | 3300048914 | Ga0496111_0001415 | Ga0496111_0001415_8252_8545 | 89 |
| 775 | 3300048915 | Ga0496112_0216716 | Ga0496112_0216716_1546_1839 | 89 |
| 776 | 3300048915 | Ga0496112_1529824 | Ga0496112_1529824_253_531 | 89 |
| 777 | 3300048917 | Ga0496114_0145538 | Ga0496114_0145538_180_473 | 89 |
| 778 | 3300048917 | Ga0496114_0269382 | Ga0496114_0269382_1117_1389 | 89 |
| 779 | 3300049522 | Ga0501299_161534 | Ga0501299_161534_180_449 | 89 |
| 780 | 3300049572 | Ga0501036_0643821 | Ga0501036_0643821_573_842 | 89 |
| 781 | 3300049576 | Ga0501040_1064113 | Ga0501040_1064113_165_434 | 89 |
| 782 | 3300049580 | Ga0501046_0784959 | Ga0501046_0784959_88_357 | 89 |
| 783 | 3300049584 | Ga0501068_1161056 | Ga0501068_1161056_206_478 | 89 |
| 784 | 3300049585 | Ga0501069_0131449 | Ga0501069_0131449_690_962 | 89 |
| 785 | 3300049586 | Ga0501070_0063385 | Ga0501070_0063385_575_847 | 89 |
| 786 | 3300049587 | Ga0501071_0281338 | Ga0501071_0281338_956_1231 | 89 |
| 787 | 3300049587 | Ga0501071_1503731 | Ga0501071_1503731_113_382 | 89 |
| 788 | 3300049588 | Ga0501072_0420172 | Ga0501072_0420172_232_507 | 89 |
| 789 | 3300049588 | Ga0501072_0950269 | Ga0501072_0950269_311_580 | 89 |
| 790 | 3300049590 | Ga0501074_0463936 | Ga0501074_0463936_296_565 | 89 |
| 791 | 3300049593 | Ga0501077_0572658 | Ga0501077_0572658_363_635 | 89 |
| 792 | 3300049741 | Ga0501079_1260629 | Ga0501079_1260629_100_375 | 89 |
| 793 | 3300049743 | Ga0501081_0164473 | Ga0501081_0164473_1215_1484 | 89 |
| 794 | 3300049824 | Ga0501045_0485282 | Ga0501045_0485282_52_321 | 89 |
| 795 | 3300050507 | nmdc:mga05p37_565454_c1 | nmdc:mga05p37_565454_c1_103_372 | 89 |
| 796 | 3300050509 | nmdc:mga0qj67_54443_c1 | nmdc:mga0qj67_54443_c1_2855_3127 | 89 |
| 797 | 3300050510 | nmdc:mga06r32_52016_c1 | nmdc:mga06r32_52016_c1_623_895 | 89 |
| 798 | 3300050511 | nmdc:mga08y16_498272_c1 | nmdc:mga08y16_498272_c1_485_757 | 89 |
| 799 | 3300050512 | nmdc:mga0n895_44735_c1 | nmdc:mga0n895_44735_c1_1052_1321 | 89 |
| 800 | 3300050513 | nmdc:mga0rr50_226862_c1 | nmdc:mga0rr50_226862_c1_558_827 | 89 |
| 801 | 3300050514 | nmdc:mga08x19_603223_c1 | nmdc:mga08x19_603223_c1_452_736 | 89 |
| 802 | 3300050515 | nmdc:mga0a205_11705_c1 | nmdc:mga0a205_11705_c1_3735_4004 | 89 |
| 803 | 3300054114 | Ga0501084_0533641 | Ga0501084_0533641_417_692 | 89 |
| 804 | 3300059421 | Ga0590071_064032 | Ga0590071_064032_271_543 | 89 |
| 805 | 3300059424 | Ga0590075_010024 | Ga0590075_010024_1443_1715 | 89 |
| 806 | 3300059426 | Ga0590077_041201 | Ga0590077_041201_361_633 | 89 |
| 807 | 3300060344 | Ga0587071_011239 | Ga0587071_011239_420_698 | 89 |
| 808 | 3300061734 | Ga0530510_0461644 | Ga0530510_0461644_12_284 | 89 |
| 809 | 3300031824 | Ga0307413_10011873 | Ga0307413_100118739 | 90 |
| 810 | 3300031852 | Ga0307410_10313960 | Ga0307410_103139602 | 90 |
| 811 | 3300031901 | Ga0307406_10040469 | Ga0307406_100404694 | 90 |
| 812 | 3300032002 | Ga0307416_100538020 | Ga0307416_1005380204 | 90 |
| 813 | 3300032004 | Ga0307414_10054914 | Ga0307414_100549143 | 90 |
| 814 | 3300032005 | Ga0307411_10158432 | Ga0307411_101584324 | 90 |
| 815 | 3300032126 | Ga0307415_100846712 | Ga0307415_1008467123 | 90 |
| 816 | 3300041997 | Ga0439431_0012021 | Ga0439431_0012021_960_1274 | 90 |
| 817 | 3300005444 | Ga0070694_100644995 | Ga0070694_1006449952 | 91 |
| 818 | 3300005445 | Ga0070708_101543029 | Ga0070708_1015430292 | 91 |
| 819 | 3300005467 | Ga0070706_100568247 | Ga0070706_1005682473 | 91 |
| 820 | 3300005518 | Ga0070699_102188397 | Ga0070699_1021883972 | 91 |
| 821 | 3300045976 | Ga0466967_1071083 | Ga0466967_1071083_282_563 | 91 |
| 822 | 3300003371 | JGI26145J50221_1029825 | JGI26145J50221_10298251 | 92 |
| 823 | 3300004799 | Ga0058863_11744258 | Ga0058863_117442582 | 92 |
| 824 | 3300004800 | Ga0058861_11902585 | Ga0058861_119025852 | 92 |
| 825 | 3300004803 | Ga0058862_12862010 | Ga0058862_128620101 | 92 |
| 826 | 3300005328 | Ga0070676_10894785 | Ga0070676_108947851 | 92 |
| 827 | 3300005329 | Ga0070683_100942413 | Ga0070683_1009424133 | 92 |
| 828 | 3300005331 | Ga0070670_100407826 | Ga0070670_1004078263 | 92 |
| 829 | 3300005334 | Ga0068869_101492079 | Ga0068869_1014920791 | 92 |
| 830 | 3300005336 | Ga0070680_100048659 | Ga0070680_1000486596 | 92 |
| 831 | 3300005337 | Ga0070682_100546693 | Ga0070682_1005466932 | 92 |
| 832 | 3300005339 | Ga0070660_100444041 | Ga0070660_1004440413 | 92 |
| 833 | 3300005344 | Ga0070661_100083639 | Ga0070661_1000836395 | 92 |
| 834 | 3300005353 | Ga0070669_101400285 | Ga0070669_1014002852 | 92 |
| 835 | 3300005353 | Ga0070669_101858838 | Ga0070669_1018588381 | 92 |
| 836 | 3300005354 | Ga0070675_101270869 | Ga0070675_1012708692 | 92 |
| 837 | 3300005365 | Ga0070688_100954398 | Ga0070688_1009543981 | 92 |
| 838 | 3300005366 | Ga0070659_100094353 | Ga0070659_1000943535 | 92 |
| 839 | 3300005434 | Ga0070709_10180504 | Ga0070709_101805044 | 92 |
| 840 | 3300005439 | Ga0070711_100034546 | Ga0070711_1000345464 | 92 |
| 841 | 3300005444 | Ga0070694_100280246 | Ga0070694_1002802461 | 92 |
| 842 | 3300005445 | Ga0070708_100034355 | Ga0070708_1000343557 | 92 |
| 843 | 3300005455 | Ga0070663_100075610 | Ga0070663_1000756104 | 92 |
| 844 | 3300005458 | Ga0070681_10128360 | Ga0070681_101283603 | 92 |
| 845 | 3300005458 | Ga0070681_10206973 | Ga0070681_102069734 | 92 |
| 846 | 3300005467 | Ga0070706_100568256 | Ga0070706_1005682561 | 92 |
| 847 | 3300005467 | Ga0070706_100662439 | Ga0070706_1006624393 | 92 |
| 848 | 3300005468 | Ga0070707_100143871 | Ga0070707_1001438716 | 92 |
| 849 | 3300005468 | Ga0070707_100787234 | Ga0070707_1007872342 | 92 |
| 850 | 3300005471 | Ga0070698_100280886 | Ga0070698_1002808864 | 92 |
| 851 | 3300005518 | Ga0070699_100279819 | Ga0070699_1002798193 | 92 |
| 852 | 3300005518 | Ga0070699_100791760 | Ga0070699_1007917603 | 92 |
| 853 | 3300005530 | Ga0070679_100145172 | Ga0070679_1001451725 | 92 |
| 854 | 3300005535 | Ga0070684_100454857 | Ga0070684_1004548573 | 92 |
| 855 | 3300005539 | Ga0068853_100908900 | Ga0068853_1009089003 | 92 |
| 856 | 3300005543 | Ga0070672_100992761 | Ga0070672_1009927611 | 92 |
| 857 | 3300005545 | Ga0070695_101185225 | Ga0070695_1011852251 | 92 |
| 858 | 3300005546 | Ga0070696_100680906 | Ga0070696_1006809062 | 92 |
| 859 | 3300005546 | Ga0070696_101775888 | Ga0070696_1017758882 | 92 |
| 860 | 3300005547 | Ga0070693_100136177 | Ga0070693_1001361773 | 92 |
| 861 | 3300005563 | Ga0068855_101252128 | Ga0068855_1012521282 | 92 |
| 862 | 3300005564 | Ga0070664_100333535 | Ga0070664_1003335353 | 92 |
| 863 | 3300005577 | Ga0068857_100347678 | Ga0068857_1003476783 | 92 |
| 864 | 3300005578 | Ga0068854_100705066 | Ga0068854_1007050662 | 92 |
| 865 | 3300005615 | Ga0070702_100784631 | Ga0070702_1007846311 | 92 |
| 866 | 3300005616 | Ga0068852_100404440 | Ga0068852_1004044402 | 92 |
| 867 | 3300005617 | Ga0068859_100051859 | Ga0068859_1000518594 | 92 |
| 868 | 3300005618 | Ga0068864_100836106 | Ga0068864_1008361062 | 92 |
| 869 | 3300005618 | Ga0068864_100997105 | Ga0068864_1009971053 | 92 |
| 870 | 3300005618 | Ga0068864_102032541 | Ga0068864_1020325412 | 92 |
| 871 | 3300005841 | Ga0068863_100236593 | Ga0068863_1002365933 | 92 |
| 872 | 3300005842 | Ga0068858_101178818 | Ga0068858_1011788181 | 92 |
| 873 | 3300006175 | Ga0070712_100426865 | Ga0070712_1004268653 | 92 |
| 874 | 3300006844 | Ga0075428_100152688 | Ga0075428_1001526883 | 92 |
| 875 | 3300006846 | Ga0075430_100328484 | Ga0075430_1003284843 | 92 |
| 876 | 3300006846 | Ga0075430_100429249 | Ga0075430_1004292493 | 92 |
| 877 | 3300006847 | Ga0075431_101690066 | Ga0075431_1016900662 | 92 |
| 878 | 3300006852 | Ga0075433_10288518 | Ga0075433_102885184 | 92 |
| 879 | 3300006871 | Ga0075434_100644571 | Ga0075434_1006445712 | 92 |
| 880 | 3300006914 | Ga0075436_100480752 | Ga0075436_1004807522 | 92 |
| 881 | 3300006931 | Ga0097620_100051857 | Ga0097620_1000518579 | 92 |
| 882 | 3300007076 | Ga0075435_100520585 | Ga0075435_1005205852 | 92 |
| 883 | 3300009147 | Ga0114129_10327586 | Ga0114129_103275863 | 92 |
| 884 | 3300009147 | Ga0114129_11139767 | Ga0114129_111397673 | 92 |
| 885 | 3300010375 | Ga0105239_12799455 | Ga0105239_127994552 | 92 |
| 886 | 3300011119 | Ga0105246_10564752 | Ga0105246_105647522 | 92 |
| 887 | 3300013100 | Ga0157373_10552518 | Ga0157373_105525182 | 92 |
| 888 | 3300013308 | Ga0157375_11897510 | Ga0157375_118975101 | 92 |
| 889 | 3300014745 | Ga0157377_11351813 | Ga0157377_113518131 | 92 |
| 890 | 3300014968 | Ga0157379_10946638 | Ga0157379_109466382 | 92 |
| 891 | 3300014968 | Ga0157379_11004220 | Ga0157379_110042202 | 92 |
| 892 | 3300014969 | Ga0157376_11128045 | Ga0157376_111280452 | 92 |
| 893 | 3300020080 | Ga0206350_10498630 | Ga0206350_104986302 | 92 |
| 894 | 3300025906 | Ga0207699_10623500 | Ga0207699_106235002 | 92 |
| 895 | 3300025907 | Ga0207645_10378613 | Ga0207645_103786132 | 92 |
| 896 | 3300025910 | Ga0207684_10229689 | Ga0207684_102296893 | 92 |
| 897 | 3300025910 | Ga0207684_10305111 | Ga0207684_103051112 | 92 |
| 898 | 3300025910 | Ga0207684_10438050 | Ga0207684_104380502 | 92 |
| 899 | 3300025912 | Ga0207707_10098552 | Ga0207707_100985525 | 92 |
| 900 | 3300025912 | Ga0207707_10170477 | Ga0207707_101704774 | 92 |
| 901 | 3300025912 | Ga0207707_11201620 | Ga0207707_112016202 | 92 |
| 902 | 3300025916 | Ga0207663_10079124 | Ga0207663_100791244 | 92 |
| 903 | 3300025917 | Ga0207660_10941522 | Ga0207660_109415222 | 92 |
| 904 | 3300025919 | Ga0207657_10511511 | Ga0207657_105115112 | 92 |
| 905 | 3300025921 | Ga0207652_10321015 | Ga0207652_103210154 | 92 |
| 906 | 3300025922 | Ga0207646_10036746 | Ga0207646_100367467 | 92 |
| 907 | 3300025922 | Ga0207646_10452978 | Ga0207646_104529783 | 92 |
| 908 | 3300025925 | Ga0207650_10522056 | Ga0207650_105220562 | 92 |
| 909 | 3300025932 | Ga0207690_10064627 | Ga0207690_100646273 | 92 |
| 910 | 3300025934 | Ga0207686_11160440 | Ga0207686_111604402 | 92 |
| 911 | 3300025939 | Ga0207665_10589027 | Ga0207665_105890272 | 92 |
| 912 | 3300025942 | Ga0207689_10457749 | Ga0207689_104577491 | 92 |
| 913 | 3300025944 | Ga0207661_10960756 | Ga0207661_109607563 | 92 |
| 914 | 3300025945 | Ga0207679_10456129 | Ga0207679_104561292 | 92 |
| 915 | 3300025945 | Ga0207679_11739576 | Ga0207679_117395762 | 92 |
| 916 | 3300025949 | Ga0207667_11310676 | Ga0207667_113106762 | 92 |
| 917 | 3300025981 | Ga0207640_11598659 | Ga0207640_115986592 | 92 |
| 918 | 3300026041 | Ga0207639_10270901 | Ga0207639_102709012 | 92 |
| 919 | 3300026067 | Ga0207678_10128015 | Ga0207678_101280154 | 92 |
| 920 | 3300026067 | Ga0207678_10712722 | Ga0207678_107127223 | 92 |
| 921 | 3300026095 | Ga0207676_10219571 | Ga0207676_102195712 | 92 |
| 922 | 3300026095 | Ga0207676_10771069 | Ga0207676_107710692 | 92 |
| 923 | 3300026116 | Ga0207674_10347999 | Ga0207674_103479993 | 92 |
| 924 | 3300026116 | Ga0207674_10351745 | Ga0207674_103517453 | 92 |
| 925 | 3300027543 | Ga0209999_1036477 | Ga0209999_10364772 | 92 |
| 926 | 3300027614 | Ga0209970_1041124 | Ga0209970_10411242 | 92 |
| 927 | 3300027682 | Ga0209971_1005664 | Ga0209971_10056643 | 92 |
| 928 | 3300027717 | Ga0209998_10090134 | Ga0209998_100901341 | 92 |
| 929 | 3300027876 | Ga0209974_10007380 | Ga0209974_100073808 | 92 |
| 930 | 3300027907 | Ga0207428_10277396 | Ga0207428_102773964 | 92 |
| 931 | 3300028381 | Ga0268264_12637842 | Ga0268264_126378421 | 92 |
| 932 | 3300031548 | Ga0307408_100281869 | Ga0307408_1002818692 | 92 |
| 933 | 3300031548 | Ga0307408_101364086 | Ga0307408_1013640862 | 92 |
| 934 | 3300031731 | Ga0307405_10163077 | Ga0307405_101630773 | 92 |
| 935 | 3300031824 | Ga0307413_10012580 | Ga0307413_100125802 | 92 |
| 936 | 3300031824 | Ga0307413_10130690 | Ga0307413_101306901 | 92 |
| 937 | 3300031824 | Ga0307413_10319626 | Ga0307413_103196262 | 92 |
| 938 | 3300031852 | Ga0307410_10013117 | Ga0307410_100131174 | 92 |
| 939 | 3300031852 | Ga0307410_10599876 | Ga0307410_105998762 | 92 |
| 940 | 3300031903 | Ga0307407_10094272 | Ga0307407_100942722 | 92 |
| 941 | 3300031911 | Ga0307412_10249970 | Ga0307412_102499702 | 92 |
| 942 | 3300031911 | Ga0307412_12006291 | Ga0307412_120062912 | 92 |
| 943 | 3300031995 | Ga0307409_100028220 | Ga0307409_1000282209 | 92 |
| 944 | 3300031995 | Ga0307409_100698018 | Ga0307409_1006980183 | 92 |
| 945 | 3300031995 | Ga0307409_101183516 | Ga0307409_1011835162 | 92 |
| 946 | 3300032002 | Ga0307416_100089622 | Ga0307416_1000896225 | 92 |
| 947 | 3300032002 | Ga0307416_100278279 | Ga0307416_1002782791 | 92 |
| 948 | 3300032002 | Ga0307416_101561833 | Ga0307416_1015618332 | 92 |
| 949 | 3300032002 | Ga0307416_101748361 | Ga0307416_1017483613 | 92 |
| 950 | 3300032004 | Ga0307414_10030049 | Ga0307414_100300492 | 92 |
| 951 | 3300032004 | Ga0307414_12008444 | Ga0307414_120084441 | 92 |
| 952 | 3300032005 | Ga0307411_10061799 | Ga0307411_100617995 | 92 |
| 953 | 3300032005 | Ga0307411_10083987 | Ga0307411_100839875 | 92 |
| 954 | 3300032005 | Ga0307411_10168662 | Ga0307411_101686623 | 92 |
| 955 | 3300032126 | Ga0307415_100161299 | Ga0307415_1001612993 | 92 |
| 956 | 3300032126 | Ga0307415_100416479 | Ga0307415_1004164793 | 92 |
| 957 | 3300032126 | Ga0307415_101188383 | Ga0307415_1011883833 | 92 |
| 958 | 3300032126 | Ga0307415_101975427 | Ga0307415_1019754272 | 92 |
| 959 | 3300034816 | Ga0373930_0205149 | Ga0373930_0205149_123_410 | 92 |
| 960 | 3300034820 | Ga0373959_0015002 | Ga0373959_0015002_958_1242 | 92 |
| 961 | 3300035083 | Ga0373926_0275828 | Ga0373926_0275828_299_583 | 92 |
| 962 | 3300035084 | Ga0373928_0019246 | Ga0373928_0019246_404_691 | 92 |
| 963 | 3300035085 | Ga0373929_0048444 | Ga0373929_0048444_111_398 | 92 |
| 964 | 3300035085 | Ga0373929_0141169 | Ga0373929_0141169_309_596 | 92 |
| 965 | 3300035088 | Ga0373940_0010034 | Ga0373940_0010034_661_948 | 92 |
| 966 | 3300035088 | Ga0373940_0068857 | Ga0373940_0068857_100_384 | 92 |
| 967 | 3300035090 | Ga0373949_0098380 | Ga0373949_0098380_75_359 | 92 |
| 968 | 3300035091 | Ga0373951_0028079 | Ga0373951_0028079_341_628 | 92 |
| 969 | 3300035112 | Ga0373932_0032020 | Ga0373932_0032020_632_910 | 92 |
| 970 | 3300035112 | Ga0373932_0071714 | Ga0373932_0071714_267_554 | 92 |
| 971 | 3300035114 | Ga0373939_0003994 | Ga0373939_0003994_1258_1542 | 92 |
| 972 | 3300035114 | Ga0373939_0252909 | Ga0373939_0252909_20_307 | 92 |
| 973 | 3300035114 | Ga0373939_0257797 | Ga0373939_0257797_218_496 | 92 |
| 974 | 3300035115 | Ga0373941_0111579 | Ga0373941_0111579_309_596 | 92 |
| 975 | 3300035121 | Ga0373960_0096120 | Ga0373960_0096120_387_674 | 92 |
| 976 | 3300035207 | Ga0373942_0088012 | Ga0373942_0088012_429_716 | 92 |
| 977 | 3300035207 | Ga0373942_0104546 | Ga0373942_0104546_113_397 | 92 |
| 978 | 3300035241 | Ga0373961_0017856 | Ga0373961_0017856_44_328 | 92 |
| 979 | 3300035241 | Ga0373961_0110993 | Ga0373961_0110993_399_686 | 92 |
| 980 | 3300035241 | Ga0373961_0232718 | Ga0373961_0232718_39_317 | 92 |
| 981 | 3300035242 | Ga0373962_0081746 | Ga0373962_0081746_288_575 | 92 |
| 982 | 3300035691 | Ga0373931_0113596 | Ga0373931_0113596_105_383 | 92 |
| 983 | 3300035691 | Ga0373931_0118715 | Ga0373931_0118715_838_1122 | 92 |
| 984 | 3300035691 | Ga0373931_0156788 | Ga0373931_0156788_1015_1302 | 92 |
| 985 | 3300035692 | Ga0373935_0136746 | Ga0373935_0136746_374_658 | 92 |
| 986 | 3300037068 | Ga0373925_0405252 | Ga0373925_0405252_625_912 | 92 |
| 987 | 3300037471 | Ga0395905_0552337 | Ga0395905_0552337_272_550 | 92 |
| 988 | 3300037471 | Ga0395905_0622518 | Ga0395905_0622518_608_895 | 92 |
| 989 | 3300037471 | Ga0395905_0763736 | Ga0395905_0763736_108_395 | 92 |
| 990 | 3300038443 | Ga0395901_0384581 | Ga0395901_0384581_465_752 | 92 |
| 991 | 3300038698 | Ga0242419_003452 | Ga0242419_003452_748_1035 | 92 |
| 992 | 3300038996 | Ga0242420_006765 | Ga0242420_006765_1071_1358 | 92 |
| 993 | 3300041441 | Ga0451787_750746 | Ga0451787_750746_235_513 | 92 |
| 994 | 3300042001 | Ga0439441_137200 | Ga0439441_137200_108_386 | 92 |
| 995 | 3300042005 | Ga0439448_0208916 | Ga0439448_0208916_57_344 | 92 |
| 996 | 3300042007 | Ga0439449_0234577 | Ga0439449_0234577_367_645 | 92 |
| 997 | 3300042127 | Ga0450890_005210 | Ga0450890_005210_754_1038 | 92 |
| 998 | 3300042438 | Ga0439459_0033962 | Ga0439459_0033962_240_524 | 92 |
| 999 | 3300042438 | Ga0439459_0046509 | Ga0439459_0046509_70_357 | 92 |
| 1000 | 3300042876 | Ga0451577_1966498 | Ga0451577_1966498_155_457 | 92 |
| 1001 | 3300044712 | Ga0453684_1310675 | Ga0453684_1310675_275_556 | 92 |
| 1002 | 3300045051 | Ga0451576_2448933 | Ga0451576_2448933_120_398 | 92 |
| 1003 | 3300045976 | Ga0466967_1294393 | Ga0466967_1294393_13_291 | 92 |
| 1004 | 3300046473 | Ga0495582_0533567 | Ga0495582_0533567_210_497 | 92 |
| 1005 | 3300046500 | Ga0495596_0436381 | Ga0495596_0436381_13_291 | 92 |
| 1006 | 3300046520 | Ga0495637_0361447 | Ga0495637_0361447_197_475 | 92 |
| 1007 | 3300046681 | Ga0495647_0205031 | Ga0495647_0205031_213_500 | 92 |
| 1008 | 3300048903 | Ga0496100_0335590 | Ga0496100_0335590_380_658 | 92 |
| 1009 | 3300048903 | Ga0496100_0702735 | Ga0496100_0702735_32_319 | 92 |
| 1010 | 3300048904 | Ga0496101_0049962 | Ga0496101_0049962_2090_2377 | 92 |
| 1011 | 3300048904 | Ga0496101_1279510 | Ga0496101_1279510_245_523 | 92 |
| 1012 | 3300048905 | Ga0496102_0168993 | Ga0496102_0168993_1751_2035 | 92 |
| 1013 | 3300048905 | Ga0496102_0214892 | Ga0496102_0214892_617_904 | 92 |
| 1014 | 3300048906 | Ga0496103_0152380 | Ga0496103_0152380_456_743 | 92 |
| 1015 | 3300048906 | Ga0496103_0217461 | Ga0496103_0217461_137_424 | 92 |
| 1016 | 3300048906 | Ga0496103_0299737 | Ga0496103_0299737_453_731 | 92 |
| 1017 | 3300048907 | Ga0496104_0065574 | Ga0496104_0065574_252_539 | 92 |
| 1018 | 3300048907 | Ga0496104_0081866 | Ga0496104_0081866_329_616 | 92 |
| 1019 | 3300048907 | Ga0496104_0305788 | Ga0496104_0305788_552_830 | 92 |
| 1020 | 3300048907 | Ga0496104_1716414 | Ga0496104_1716414_223_510 | 92 |
| 1021 | 3300048908 | Ga0496105_0104474 | Ga0496105_0104474_1038_1325 | 92 |
| 1022 | 3300048908 | Ga0496105_0132121 | Ga0496105_0132121_618_896 | 92 |
| 1023 | 3300048909 | Ga0496106_0128300 | Ga0496106_0128300_351_638 | 92 |
| 1024 | 3300048909 | Ga0496106_0814105 | Ga0496106_0814105_74_361 | 92 |
| 1025 | 3300048910 | Ga0496107_0748661 | Ga0496107_0748661_383_670 | 92 |
| 1026 | 3300048910 | Ga0496107_0827155 | Ga0496107_0827155_35_322 | 92 |
| 1027 | 3300048910 | Ga0496107_1064501 | Ga0496107_1064501_18_296 | 92 |
| 1028 | 3300048911 | Ga0496108_0012348 | Ga0496108_0012348_4780_5067 | 92 |
| 1029 | 3300048911 | Ga0496108_0076691 | Ga0496108_0076691_890_1177 | 92 |
| 1030 | 3300048911 | Ga0496108_0167980 | Ga0496108_0167980_1246_1524 | 92 |
| 1031 | 3300048912 | Ga0496109_0173149 | Ga0496109_0173149_634_921 | 92 |
| 1032 | 3300048912 | Ga0496109_0434182 | Ga0496109_0434182_320_607 | 92 |
| 1033 | 3300048912 | Ga0496109_1223699 | Ga0496109_1223699_382_660 | 92 |
| 1034 | 3300048913 | Ga0496110_0451480 | Ga0496110_0451480_497_784 | 92 |
| 1035 | 3300048913 | Ga0496110_0537967 | Ga0496110_0537967_512_790 | 92 |
| 1036 | 3300048914 | Ga0496111_0093771 | Ga0496111_0093771_989_1267 | 92 |
| 1037 | 3300048914 | Ga0496111_0190057 | Ga0496111_0190057_634_921 | 92 |
| 1038 | 3300048914 | Ga0496111_0228735 | Ga0496111_0228735_192_479 | 92 |
| 1039 | 3300048915 | Ga0496112_0024016 | Ga0496112_0024016_326_613 | 92 |
| 1040 | 3300048915 | Ga0496112_0053839 | Ga0496112_0053839_1914_2201 | 92 |
| 1041 | 3300048916 | Ga0496113_0063896 | Ga0496113_0063896_1889_2176 | 92 |
| 1042 | 3300048916 | Ga0496113_0142208 | Ga0496113_0142208_110_397 | 92 |
| 1043 | 3300048916 | Ga0496113_1315942 | Ga0496113_1315942_55_333 | 92 |
| 1044 | 3300048917 | Ga0496114_0047313 | Ga0496114_0047313_964_1251 | 92 |
| 1045 | 3300048917 | Ga0496114_0215901 | Ga0496114_0215901_1349_1627 | 92 |
| 1046 | 3300048918 | Ga0496115_0061354 | Ga0496115_0061354_861_1148 | 92 |
| 1047 | 3300049568 | Ga0501031_0141051 | Ga0501031_0141051_750_1028 | 92 |
| 1048 | 3300049570 | Ga0501033_0282204 | Ga0501033_0282204_767_1057 | 92 |
| 1049 | 3300049570 | Ga0501033_0323097 | Ga0501033_0323097_606_884 | 92 |
| 1050 | 3300049570 | Ga0501033_0579392 | Ga0501033_0579392_435_713 | 92 |
| 1051 | 3300049572 | Ga0501036_0358239 | Ga0501036_0358239_66_344 | 92 |
| 1052 | 3300049572 | Ga0501036_0438580 | Ga0501036_0438580_343_621 | 92 |
| 1053 | 3300049573 | Ga0501037_0072122 | Ga0501037_0072122_291_569 | 92 |
| 1054 | 3300049573 | Ga0501037_0707889 | Ga0501037_0707889_153_443 | 92 |
| 1055 | 3300049574 | Ga0501038_0112160 | Ga0501038_0112160_1880_2158 | 92 |
| 1056 | 3300049574 | Ga0501038_0328376 | Ga0501038_0328376_673_963 | 92 |
| 1057 | 3300049574 | Ga0501038_0946762 | Ga0501038_0946762_204_494 | 92 |
| 1058 | 3300049574 | Ga0501038_1086756 | Ga0501038_1086756_244_522 | 92 |
| 1059 | 3300049574 | Ga0501038_1109192 | Ga0501038_1109192_271_549 | 92 |
| 1060 | 3300049575 | Ga0501039_0112345 | Ga0501039_0112345_118_396 | 92 |
| 1061 | 3300049575 | Ga0501039_0283824 | Ga0501039_0283824_451_729 | 92 |
| 1062 | 3300049575 | Ga0501039_0602451 | Ga0501039_0602451_370_660 | 92 |
| 1063 | 3300049576 | Ga0501040_0080718 | Ga0501040_0080718_1736_2014 | 92 |
| 1064 | 3300049576 | Ga0501040_0114192 | Ga0501040_0114192_712_1002 | 92 |
| 1065 | 3300049576 | Ga0501040_0303360 | Ga0501040_0303360_461_739 | 92 |
| 1066 | 3300049576 | Ga0501040_0791412 | Ga0501040_0791412_174_464 | 92 |
| 1067 | 3300049576 | Ga0501040_0975250 | Ga0501040_0975250_108_386 | 92 |
| 1068 | 3300049577 | Ga0501041_0056716 | Ga0501041_0056716_1298_1576 | 92 |
| 1069 | 3300049577 | Ga0501041_0206300 | Ga0501041_0206300_177_467 | 92 |
| 1070 | 3300049577 | Ga0501041_0381060 | Ga0501041_0381060_505_783 | 92 |
| 1071 | 3300049577 | Ga0501041_0432310 | Ga0501041_0432310_385_675 | 92 |
| 1072 | 3300049578 | Ga0501042_0330152 | Ga0501042_0330152_643_921 | 92 |
| 1073 | 3300049579 | Ga0501043_0608566 | Ga0501043_0608566_70_348 | 92 |
| 1074 | 3300049580 | Ga0501046_0206933 | Ga0501046_0206933_1071_1349 | 92 |
| 1075 | 3300049580 | Ga0501046_0293363 | Ga0501046_0293363_732_1022 | 92 |
| 1076 | 3300049582 | Ga0501048_0007522 | Ga0501048_0007522_1505_1783 | 92 |
| 1077 | 3300049582 | Ga0501048_0119600 | Ga0501048_0119600_713_991 | 92 |
| 1078 | 3300049582 | Ga0501048_0307985 | Ga0501048_0307985_709_999 | 92 |
| 1079 | 3300049582 | Ga0501048_0468939 | Ga0501048_0468939_415_705 | 92 |
| 1080 | 3300049582 | Ga0501048_0916162 | Ga0501048_0916162_283_561 | 92 |
| 1081 | 3300049583 | Ga0501067_0031279 | Ga0501067_0031279_168_446 | 92 |
| 1082 | 3300049583 | Ga0501067_0185227 | Ga0501067_0185227_787_1065 | 92 |
| 1083 | 3300049583 | Ga0501067_0354778 | Ga0501067_0354778_71_358 | 92 |
| 1084 | 3300049584 | Ga0501068_0831621 | Ga0501068_0831621_280_570 | 92 |
| 1085 | 3300049585 | Ga0501069_0054197 | Ga0501069_0054197_1653_1940 | 92 |
| 1086 | 3300049585 | Ga0501069_0168546 | Ga0501069_0168546_692_970 | 92 |
| 1087 | 3300049585 | Ga0501069_0429712 | Ga0501069_0429712_387_665 | 92 |
| 1088 | 3300049586 | Ga0501070_0222680 | Ga0501070_0222680_638_928 | 92 |
| 1089 | 3300049586 | Ga0501070_0973915 | Ga0501070_0973915_19_306 | 92 |
| 1090 | 3300049586 | Ga0501070_1109598 | Ga0501070_1109598_13_291 | 92 |
| 1091 | 3300049587 | Ga0501071_0030822 | Ga0501071_0030822_857_1135 | 92 |
| 1092 | 3300049587 | Ga0501071_0695360 | Ga0501071_0695360_437_715 | 92 |
| 1093 | 3300049587 | Ga0501071_0819882 | Ga0501071_0819882_120_398 | 92 |
| 1094 | 3300049588 | Ga0501072_0233391 | Ga0501072_0233391_620_898 | 92 |
| 1095 | 3300049588 | Ga0501072_0364972 | Ga0501072_0364972_477_755 | 92 |
| 1096 | 3300049588 | Ga0501072_0410843 | Ga0501072_0410843_488_766 | 92 |
| 1097 | 3300049588 | Ga0501072_0459184 | Ga0501072_0459184_526_816 | 92 |
| 1098 | 3300049589 | Ga0501073_0438172 | Ga0501073_0438172_345_623 | 92 |
| 1099 | 3300049590 | Ga0501074_0064396 | Ga0501074_0064396_1116_1394 | 92 |
| 1100 | 3300049590 | Ga0501074_0237463 | Ga0501074_0237463_602_880 | 92 |
| 1101 | 3300049590 | Ga0501074_0264170 | Ga0501074_0264170_553_843 | 92 |
| 1102 | 3300049590 | Ga0501074_0588199 | Ga0501074_0588199_152_442 | 92 |
| 1103 | 3300049591 | Ga0501075_0006835 | Ga0501075_0006835_6945_7223 | 92 |
| 1104 | 3300049591 | Ga0501075_0039029 | Ga0501075_0039029_12_302 | 92 |
| 1105 | 3300049591 | Ga0501075_0197437 | Ga0501075_0197437_1169_1447 | 92 |
| 1106 | 3300049591 | Ga0501075_0567145 | Ga0501075_0567145_175_465 | 92 |
| 1107 | 3300049592 | Ga0501076_0006442 | Ga0501076_0006442_5891_6181 | 92 |
| 1108 | 3300049592 | Ga0501076_0047582 | Ga0501076_0047582_1172_1450 | 92 |
| 1109 | 3300049592 | Ga0501076_0228738 | Ga0501076_0228738_30_308 | 92 |
| 1110 | 3300049592 | Ga0501076_1211718 | Ga0501076_1211718_194_484 | 92 |
| 1111 | 3300049593 | Ga0501077_0002603 | Ga0501077_0002603_4614_4904 | 92 |
| 1112 | 3300049593 | Ga0501077_0015471 | Ga0501077_0015471_3030_3308 | 92 |
| 1113 | 3300049593 | Ga0501077_0048237 | Ga0501077_0048237_2037_2315 | 92 |
| 1114 | 3300049741 | Ga0501079_0020338 | Ga0501079_0020338_480_770 | 92 |
| 1115 | 3300049741 | Ga0501079_0025157 | Ga0501079_0025157_87_365 | 92 |
| 1116 | 3300049741 | Ga0501079_0506313 | Ga0501079_0506313_22_312 | 92 |
| 1117 | 3300049741 | Ga0501079_0513137 | Ga0501079_0513137_398_676 | 92 |
| 1118 | 3300049742 | Ga0501080_0130656 | Ga0501080_0130656_1107_1385 | 92 |
| 1119 | 3300049742 | Ga0501080_0212338 | Ga0501080_0212338_655_945 | 92 |
| 1120 | 3300049742 | Ga0501080_0740196 | Ga0501080_0740196_519_797 | 92 |
| 1121 | 3300049743 | Ga0501081_0049086 | Ga0501081_0049086_1127_1405 | 92 |
| 1122 | 3300049743 | Ga0501081_0445598 | Ga0501081_0445598_580_870 | 92 |
| 1123 | 3300049743 | Ga0501081_0456626 | Ga0501081_0456626_95_373 | 92 |
| 1124 | 3300049744 | Ga0501083_0336790 | Ga0501083_0336790_83_361 | 92 |
| 1125 | 3300049744 | Ga0501083_0553865 | Ga0501083_0553865_282_572 | 92 |
| 1126 | 3300049779 | Ga0501283_046396 | Ga0501283_046396_45_329 | 92 |
| 1127 | 3300049822 | Ga0501035_0946183 | Ga0501035_0946183_119_397 | 92 |
| 1128 | 3300049822 | Ga0501035_1123039 | Ga0501035_1123039_81_371 | 92 |
| 1129 | 3300049823 | Ga0501044_0891303 | Ga0501044_0891303_224_502 | 92 |
| 1130 | 3300049823 | Ga0501044_1357639 | Ga0501044_1357639_207_497 | 92 |
| 1131 | 3300049824 | Ga0501045_0069371 | Ga0501045_0069371_1722_2000 | 92 |
| 1132 | 3300049824 | Ga0501045_0101271 | Ga0501045_0101271_504_794 | 92 |
| 1133 | 3300049824 | Ga0501045_0231212 | Ga0501045_0231212_1004_1282 | 92 |
| 1134 | 3300050507 | nmdc:mga05p37_1968370_c1 | nmdc:mga05p37_1968370_c1_11_313 | 92 |
| 1135 | 3300050507 | nmdc:mga05p37_227975_c1 | nmdc:mga05p37_227975_c1_299_577 | 92 |
| 1136 | 3300050507 | nmdc:mga05p37_843703_c1 | nmdc:mga05p37_843703_c1_479_757 | 92 |
| 1137 | 3300050509 | nmdc:mga0qj67_954959_c1 | nmdc:mga0qj67_954959_c1_240_542 | 92 |
| 1138 | 3300050510 | nmdc:mga06r32_1172073_c1 | nmdc:mga06r32_1172073_c1_67_345 | 92 |
| 1139 | 3300050511 | nmdc:mga08y16_116742_c1 | nmdc:mga08y16_116742_c1_2471_2749 | 92 |
| 1140 | 3300050511 | nmdc:mga08y16_2039352_c1 | nmdc:mga08y16_2039352_c1_231_509 | 92 |
| 1141 | 3300050513 | nmdc:mga0rr50_1208234_c1 | nmdc:mga0rr50_1208234_c1_213_500 | 92 |
| 1142 | 3300050513 | nmdc:mga0rr50_491500_c1 | nmdc:mga0rr50_491500_c1_363_647 | 92 |
| 1143 | 3300050513 | nmdc:mga0rr50_840081_c1 | nmdc:mga0rr50_840081_c1_188_475 | 92 |
| 1144 | 3300050514 | nmdc:mga08x19_535547_c1 | nmdc:mga08x19_535547_c1_404_688 | 92 |
| 1145 | 3300050515 | nmdc:mga0a205_1311424_c1 | nmdc:mga0a205_1311424_c1_187_474 | 92 |
| 1146 | 3300050515 | nmdc:mga0a205_471649_c1 | nmdc:mga0a205_471649_c1_434_721 | 92 |
| 1147 | 3300053078 | Ga0495612_0197095 | Ga0495612_0197095_329_613 | 92 |
| 1148 | 3300054114 | Ga0501084_0021009 | Ga0501084_0021009_1783_2061 | 92 |
| 1149 | 3300054114 | Ga0501084_0055496 | Ga0501084_0055496_22_312 | 92 |
| 1150 | 3300054114 | Ga0501084_0177220 | Ga0501084_0177220_1077_1355 | 92 |
| 1151 | 3300054114 | Ga0501084_0290002 | Ga0501084_0290002_1028_1318 | 92 |
| 1152 | 3300054114 | Ga0501084_0291972 | Ga0501084_0291972_1048_1326 | 92 |
| 1153 | 3300059421 | Ga0590071_003425 | Ga0590071_003425_1220_1498 | 92 |
| 1154 | 3300059421 | Ga0590071_081582 | Ga0590071_081582_185_469 | 92 |
| 1155 | 3300059423 | Ga0590074_004419 | Ga0590074_004419_1691_1969 | 92 |
| 1156 | 3300059423 | Ga0590074_056058 | Ga0590074_056058_195_473 | 92 |
| 1157 | 3300059426 | Ga0590077_023866 | Ga0590077_023866_667_945 | 92 |
| 1158 | 3300060353 | Ga0501082_0052165 | Ga0501082_0052165_346_624 | 92 |
| 1159 | 3300060353 | Ga0501082_0114169 | Ga0501082_0114169_1397_1687 | 92 |
| 1160 | 3300060353 | Ga0501082_0154711 | Ga0501082_0154711_1307_1585 | 92 |
| 1161 | 3300060353 | Ga0501082_0202643 | Ga0501082_0202643_761_1051 | 92 |
| 1162 | 3300060353 | Ga0501082_1678475 | Ga0501082_1678475_186_464 | 92 |
| 1163 | 3300061734 | Ga0530510_0092411 | Ga0530510_0092411_332_610 | 92 |
| 1164 | 3300061734 | Ga0530510_0362046 | Ga0530510_0362046_179_457 | 92 |
| 1165 | 3300061734 | Ga0530510_0375174 | Ga0530510_0375174_405_683 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j4d-assembly2.cif.gz_ED | e. coli release factor 1 bound to the 70s ribosome in response to a pseudouridylated stop codon | 0.9601 | 12 | 90 |
| 1i96-assembly1.cif.gz_Q | crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) | 0.9557 | 12 | 92 |
| 4v8c-assembly1.cif.gz_CT | crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). | 0.9551 | 12 | 92 |
| 4v9k-assembly2.cif.gz_CQ | 70s ribosome translocation intermediate gdpnp-i containing elongation factor efg/gdpnp, mrna, and trna bound in the pe*/e state. | 0.9482 | 12 | 89 |
| 8qpp-assembly1.cif.gz_Q | bacillus subtilis muts2-collided disome complex (stalled 70s) | 0.9474 | 12 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P54036_1_116_2.40.50.1000 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.952 | 13 | 90 | 2.40.50.1000 |
| 3ms0Q00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9513 | 12 | 89 | 2.40.50.140 |
| af_Q2FW15_6_86_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9442 | 12 | 92 | 2.40.50.140 |
| af_Q9LHN1_1_100_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9424 | 13 | 92 | 2.40.50.140 |
| af_C6T0V9_1_79_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9401 | 13 | 92 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V5WNC0-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9784 | 12 | 92 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-B4X581-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.972 | 12 | 92 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A353QXD6-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9707 | 12 | 92 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7R6VYH1-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9701 | 12 | 88 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A3B0PD33-F1-model_v4 | 30S ribosomal protein S17 | 0.9697 | 9 | 82 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar