F491122
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1169 | 423 | 2338 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300005341|Ga0070691_10011384|Ga0070691_100113842 |
| Length | 319 |
| Sequence | MAKPVPTLEPRGNLHEGLALEKLECQYRRVGYIRMSEALVANNLPIPSVVGSLDAYIGAVHRIPVLAADEEHDLAQRYREDEDLDAARKLVMSHLRFVVHVARGYSGYGLQMSDLIQEGNIGLMKAVKRFDPDHGVRLVSFAVHWIRAEMHEFILRNWRIVKVATTKAQRKLFFNLRKSKKRLGWMNMEEVRGIAKDLGVPEATVLEMESRLSGRDIGFDAPTESDDDAPPAPVAYLEDHGADPYLQLADADQEEHQLGTLHHAMAKLDDRTRDIIRRRWLAEDKATLQDLADDYGVSAERIRQLEANAMKKMRGAFAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 104 | 3300013043 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 127 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 132 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 218 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 223 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 241 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 251 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 252 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 253 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 254 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 255 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 266 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 325 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 326 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 331 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 358 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 364 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 365 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 372 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 373 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 396 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 397 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 398 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 399 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 400 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 401 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 402 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 403 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 404 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 405 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 406 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 407 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 408 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 409 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 410 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 411 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 412 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 413 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 414 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 415 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 416 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 417 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 418 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 419 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 420 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 421 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 422 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 423 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.27 |
| Metatranscriptomes | 6.33 |
| Isolates | 2.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.9 |
| Nodule | 0 |
| Rhizoplane | 1.8 |
| Rhizosphere | 81.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070691_10011384 | 3300005341 | Bacteria | 4061 |
| 2 | JGI24736J21556_1005833 | 3300001904 | Bacteria | 2081 |
| 3 | JGI24741J21665_1001431 | 3300001915 | Bacteria | 6842 |
| 4 | JGI24741J21665_1002991 | 3300001915 | Bacteria | 4203 |
| 5 | JGI24741J21665_1008614 | 3300001915 | Bacteria | 1915 |
| 6 | JGI24740J21852_10001314 | 3300001979 | Bacteria | 11301 |
| 7 | JGI24740J21852_10001573 | 3300001979 | Bacteria | 10475 |
| 8 | JGI24740J21852_10028364 | 3300001979 | Bacteria | 1850 |
| 9 | JGI24735J21928_10037679 | 3300002067 | Bacteria | 1417 |
| 10 | JGI24738J21930_10000049 | 3300002075 | Bacteria | 24227 |
| 11 | JGI25156J39149_1006884 | 3300002705 | Bacteria | 3055 |
| 12 | JGI25156J39149_1010192 | 3300002705 | Bacteria | 2226 |
| 13 | JGI25162J39368_1000635 | 3300002737 | Bacteria | 24948 |
| 14 | JGI25162J39368_1001055 | 3300002737 | Bacteria | 16892 |
| 15 | JGI25162J39368_1002694 | 3300002737 | Bacteria | 6462 |
| 16 | JGI25162J39368_1002705 | 3300002737 | Bacteria | 6435 |
| 17 | JGI25154J39366_1008838 | 3300002738 | Bacteria | 1274 |
| 18 | JGI25157J39369_1000353 | 3300002741 | Bacteria | 32220 |
| 19 | JGI25157J39369_1000406 | 3300002741 | Bacteria | 29500 |
| 20 | JGI25157J39369_1000648 | 3300002741 | Bacteria | 19387 |
| 21 | JGI25157J39369_1001436 | 3300002741 | Bacteria | 8994 |
| 22 | JGI25157J39369_1005049 | 3300002741 | Bacteria | 2226 |
| 23 | JGI25163J39215_1000162 | 3300002771 | Bacteria | 26431 |
| 24 | JGI25164J39214_1000122 | 3300002772 | Bacteria | 74977 |
| 25 | JGI25164J39214_1000257 | 3300002772 | Bacteria | 40031 |
| 26 | JGI25164J39214_1000559 | 3300002772 | Bacteria | 16891 |
| 27 | JGI25164J39214_1000707 | 3300002772 | Bacteria | 12894 |
| 28 | JGI25165J46597_1000213 | 3300003214 | Bacteria | 82308 |
| 29 | JGI25165J46597_1000241 | 3300003214 | Bacteria | 74955 |
| 30 | JGI25165J46597_1000466 | 3300003214 | Bacteria | 40031 |
| 31 | JGI25165J46597_1002012 | 3300003214 | Bacteria | 7776 |
| 32 | JGI25153J46596_10006655 | 3300003215 | Bacteria | 5813 |
| 33 | Ga0006770J48903_1011460 | 3300003305 | Bacteria | 1229 |
| 34 | Ga0006777J48905_1098760 | 3300003308 | Bacteria | 955 |
| 35 | Ga0006556J51387_1021400 | 3300003479 | Bacteria | 957 |
| 36 | Ga0006560J51390_1024723 | 3300003565 | Bacteria | 957 |
| 37 | Ga0006554J51385_1022907 | 3300003567 | Bacteria | 956 |
| 38 | Ga0006554J51385_1025379 | 3300003567 | Bacteria | 909 |
| 39 | Ga0006562J51391_1003223 | 3300003578 | Bacteria | 7041 |
| 40 | Ga0007429J51699_1039952 | 3300003579 | Bacteria | 981 |
| 41 | Ga0006780_1001835 | 3300003735 | Bacteria | 963 |
| 42 | Ga0055538_1001094 | 3300003751 | Bacteria | 5899 |
| 43 | Ga0055533_1001011 | 3300003756 | Bacteria | 8155 |
| 44 | Ga0055525_1000202 | 3300003759 | Bacteria | 69078 |
| 45 | Ga0055527_1000112 | 3300003760 | Bacteria | 58193 |
| 46 | Ga0055527_1000161 | 3300003760 | Bacteria | 46585 |
| 47 | Ga0055527_1002009 | 3300003760 | Bacteria | 3695 |
| 48 | Ga0055535_1000237 | 3300003761 | Bacteria | 58193 |
| 49 | Ga0055535_1000319 | 3300003761 | Bacteria | 48508 |
| 50 | Ga0055535_1000428 | 3300003761 | Bacteria | 39316 |
| 51 | Ga0055535_1000777 | 3300003761 | Bacteria | 23397 |
| 52 | Ga0055535_1001141 | 3300003761 | Bacteria | 15731 |
| 53 | Ga0055542_1000271 | 3300003762 | Bacteria | 58193 |
| 54 | Ga0055542_1000350 | 3300003762 | Bacteria | 48508 |
| 55 | Ga0055542_1000794 | 3300003762 | Bacteria | 23397 |
| 56 | Ga0055542_1001035 | 3300003762 | Bacteria | 17437 |
| 57 | Ga0055542_1001044 | 3300003762 | Bacteria | 17228 |
| 58 | Ga0055542_1001137 | 3300003762 | Bacteria | 15733 |
| 59 | Ga0055529_1000196 | 3300003763 | Bacteria | 82308 |
| 60 | Ga0055529_1000371 | 3300003763 | Bacteria | 48508 |
| 61 | Ga0055529_1000582 | 3300003763 | Bacteria | 29431 |
| 62 | Ga0055529_1000679 | 3300003763 | Bacteria | 23397 |
| 63 | Ga0055530_10009404 | 3300003791 | Bacteria | 3760 |
| 64 | Ga0065165_1000645 | 3300005262 | Bacteria | 50499 |
| 65 | Ga0065165_1009635 | 3300005262 | Bacteria | 4297 |
| 66 | Ga0070676_10120226 | 3300005328 | Bacteria | 1648 |
| 67 | Ga0070683_100015208 | 3300005329 | Bacteria | 6756 |
| 68 | Ga0070683_100074228 | 3300005329 | Bacteria | 3176 |
| 69 | Ga0070683_100103716 | 3300005329 | Bacteria | 2680 |
| 70 | Ga0070690_100063134 | 3300005330 | Bacteria | 2390 |
| 71 | Ga0070670_100071978 | 3300005331 | Bacteria | 2969 |
| 72 | Ga0070670_100089744 | 3300005331 | Bacteria | 2642 |
| 73 | Ga0070670_100102486 | 3300005331 | Bacteria | 2465 |
| 74 | Ga0070670_100137995 | 3300005331 | Bacteria | 2108 |
| 75 | Ga0068869_100051399 | 3300005334 | Bacteria | 2990 |
| 76 | Ga0068869_100070993 | 3300005334 | Bacteria | 2578 |
| 77 | Ga0070666_10000082 | 3300005335 | Bacteria | 68562 |
| 78 | Ga0070666_10038157 | 3300005335 | Bacteria | 3196 |
| 79 | Ga0070666_10263763 | 3300005335 | Bacteria | 1222 |
| 80 | Ga0070680_100000794 | 3300005336 | Bacteria | 22227 |
| 81 | Ga0070680_100024481 | 3300005336 | Bacteria | 4824 |
| 82 | Ga0070680_100224060 | 3300005336 | Bacteria | 1587 |
| 83 | Ga0070680_100271479 | 3300005336 | Bacteria | 1436 |
| 84 | Ga0070680_100310419 | 3300005336 | Bacteria | 1338 |
| 85 | Ga0070682_100039630 | 3300005337 | Bacteria | 2895 |
| 86 | Ga0068868_100131728 | 3300005338 | Bacteria | 2046 |
| 87 | Ga0068868_100325318 | 3300005338 | Bacteria | 1311 |
| 88 | Ga0070660_100084524 | 3300005339 | Bacteria | 2494 |
| 89 | Ga0070689_100038715 | 3300005340 | Bacteria | 3648 |
| 90 | Ga0070689_100264356 | 3300005340 | Bacteria | 1423 |
| 91 | Ga0070691_10022007 | 3300005341 | Bacteria | 2955 |
| 92 | Ga0070661_100020352 | 3300005344 | Bacteria | 4730 |
| 93 | Ga0070661_100031222 | 3300005344 | Bacteria | 3850 |
| 94 | Ga0070661_100068285 | 3300005344 | Bacteria | 2612 |
| 95 | Ga0070661_100168790 | 3300005344 | Bacteria | 1661 |
| 96 | Ga0070661_100208653 | 3300005344 | Bacteria | 1495 |
| 97 | Ga0070661_100285353 | 3300005344 | Bacteria | 1281 |
| 98 | Ga0070661_100324184 | 3300005344 | Bacteria | 1204 |
| 99 | Ga0070661_100408540 | 3300005344 | Bacteria | 1074 |
| 100 | Ga0070661_100457195 | 3300005344 | Bacteria | 1016 |
| 101 | Ga0070692_10005435 | 3300005345 | Bacteria | 5435 |
| 102 | Ga0070692_10008195 | 3300005345 | Bacteria | 4649 |
| 103 | Ga0070668_100004102 | 3300005347 | Bacteria | 10785 |
| 104 | Ga0070668_100371697 | 3300005347 | Bacteria | 1215 |
| 105 | Ga0070669_100234168 | 3300005353 | Bacteria | 1457 |
| 106 | Ga0070675_100114275 | 3300005354 | Bacteria | 2288 |
| 107 | Ga0070671_100052946 | 3300005355 | Bacteria | 3374 |
| 108 | Ga0070671_100222308 | 3300005355 | Bacteria | 1602 |
| 109 | Ga0070673_100135964 | 3300005364 | Bacteria | 2069 |
| 110 | Ga0070673_100252878 | 3300005364 | Bacteria | 1537 |
| 111 | Ga0070659_100016676 | 3300005366 | Bacteria | 5517 |
| 112 | Ga0070659_100023317 | 3300005366 | Bacteria | 4735 |
| 113 | Ga0070659_100166517 | 3300005366 | Bacteria | 1804 |
| 114 | Ga0070659_100299547 | 3300005366 | Bacteria | 1340 |
| 115 | Ga0070667_100007627 | 3300005367 | Bacteria | 8974 |
| 116 | Ga0070667_100018757 | 3300005367 | Bacteria | 5737 |
| 117 | Ga0070667_100066071 | 3300005367 | Bacteria | 3072 |
| 118 | Ga0070667_100068733 | 3300005367 | Bacteria | 3014 |
| 119 | Ga0070667_100093945 | 3300005367 | Bacteria | 2583 |
| 120 | Ga0070667_100105476 | 3300005367 | Bacteria | 2439 |
| 121 | Ga0070714_100000179 | 3300005435 | Bacteria | 50940 |
| 122 | Ga0070714_100023842 | 3300005435 | Bacteria | 5033 |
| 123 | Ga0070713_100000397 | 3300005436 | Bacteria | 27956 |
| 124 | Ga0070713_100066434 | 3300005436 | Bacteria | 3033 |
| 125 | Ga0070711_100015518 | 3300005439 | Bacteria | 4822 |
| 126 | Ga0070663_100000050 | 3300005455 | Bacteria | 52933 |
| 127 | Ga0070663_100282759 | 3300005455 | Bacteria | 1322 |
| 128 | Ga0070678_100033594 | 3300005456 | Bacteria | 3563 |
| 129 | Ga0070678_100204589 | 3300005456 | Bacteria | 1632 |
| 130 | Ga0070662_100000577 | 3300005457 | Bacteria | 22334 |
| 131 | Ga0070681_10000064 | 3300005458 | Bacteria | 77251 |
| 132 | Ga0070681_10000066 | 3300005458 | Bacteria | 75733 |
| 133 | Ga0070681_10012034 | 3300005458 | Bacteria | 8580 |
| 134 | Ga0070681_10024654 | 3300005458 | Bacteria | 6053 |
| 135 | Ga0070681_10226422 | 3300005458 | Bacteria | 1784 |
| 136 | Ga0070681_10301333 | 3300005458 | Bacteria | 1512 |
| 137 | Ga0068867_100552997 | 3300005459 | Bacteria | 997 |
| 138 | Ga0070699_100115325 | 3300005518 | Bacteria | 2360 |
| 139 | Ga0070679_100000351 | 3300005530 | Bacteria | 39203 |
| 140 | Ga0070679_100000596 | 3300005530 | Bacteria | 30711 |
| 141 | Ga0070679_100023344 | 3300005530 | Bacteria | 6053 |
| 142 | Ga0070679_100131355 | 3300005530 | Bacteria | 2485 |
| 143 | Ga0070679_100200068 | 3300005530 | Bacteria | 1964 |
| 144 | Ga0070679_100287871 | 3300005530 | Bacteria | 1595 |
| 145 | Ga0070684_100075180 | 3300005535 | Bacteria | 2979 |
| 146 | Ga0070684_100096131 | 3300005535 | Bacteria | 2640 |
| 147 | Ga0068853_100019976 | 3300005539 | Bacteria | 5565 |
| 148 | Ga0068853_100031878 | 3300005539 | Bacteria | 4461 |
| 149 | Ga0068853_100033491 | 3300005539 | Bacteria | 4360 |
| 150 | Ga0068853_100036748 | 3300005539 | Bacteria | 4166 |
| 151 | Ga0068853_100055226 | 3300005539 | Bacteria | 3423 |
| 152 | Ga0068853_100078887 | 3300005539 | Bacteria | 2878 |
| 153 | Ga0068853_100079234 | 3300005539 | Bacteria | 2872 |
| 154 | Ga0068853_100079236 | 3300005539 | Bacteria | 2872 |
| 155 | Ga0068853_100139260 | 3300005539 | Bacteria | 2177 |
| 156 | Ga0068853_100628967 | 3300005539 | Bacteria | 1020 |
| 157 | Ga0070686_100336817 | 3300005544 | Bacteria | 1129 |
| 158 | Ga0070696_100000448 | 3300005546 | Bacteria | 25817 |
| 159 | Ga0070696_100001287 | 3300005546 | Bacteria | 16345 |
| 160 | Ga0070696_100011151 | 3300005546 | Bacteria | 6013 |
| 161 | Ga0070693_100005381 | 3300005547 | Bacteria | 6141 |
| 162 | Ga0070665_100000069 | 3300005548 | Bacteria | 202384 |
| 163 | Ga0070665_100003657 | 3300005548 | Bacteria | 16292 |
| 164 | Ga0070665_100018876 | 3300005548 | Bacteria | 6916 |
| 165 | Ga0070665_100072690 | 3300005548 | Bacteria | 3446 |
| 166 | Ga0070665_100221200 | 3300005548 | Bacteria | 1894 |
| 167 | Ga0070665_100384351 | 3300005548 | Bacteria | 1411 |
| 168 | Ga0070665_100416325 | 3300005548 | Bacteria | 1352 |
| 169 | Ga0068855_100007313 | 3300005563 | Bacteria | 13379 |
| 170 | Ga0068855_100012264 | 3300005563 | Bacteria | 10359 |
| 171 | Ga0068855_100018321 | 3300005563 | Bacteria | 8410 |
| 172 | Ga0068855_100047245 | 3300005563 | Bacteria | 5086 |
| 173 | Ga0068855_100072584 | 3300005563 | Bacteria | 4000 |
| 174 | Ga0068855_100081051 | 3300005563 | Bacteria | 3762 |
| 175 | Ga0068855_100371610 | 3300005563 | Bacteria | 1571 |
| 176 | Ga0068855_100467955 | 3300005563 | Bacteria | 1373 |
| 177 | Ga0070664_100015898 | 3300005564 | Bacteria | 6161 |
| 178 | Ga0070664_100040296 | 3300005564 | Bacteria | 3937 |
| 179 | Ga0070664_100048394 | 3300005564 | Bacteria | 3593 |
| 180 | Ga0068857_100034172 | 3300005577 | Bacteria | 4498 |
| 181 | Ga0068857_100047755 | 3300005577 | Bacteria | 3801 |
| 182 | Ga0068857_100048945 | 3300005577 | Bacteria | 3750 |
| 183 | Ga0068857_100062451 | 3300005577 | Bacteria | 3311 |
| 184 | Ga0068857_100074206 | 3300005577 | Bacteria | 3032 |
| 185 | Ga0068857_100102800 | 3300005577 | Bacteria | 2565 |
| 186 | Ga0068854_100034482 | 3300005578 | Bacteria | 3536 |
| 187 | Ga0068854_100060358 | 3300005578 | Bacteria | 2743 |
| 188 | Ga0068854_100062217 | 3300005578 | Bacteria | 2705 |
| 189 | Ga0068856_100000789 | 3300005614 | Bacteria | 34283 |
| 190 | Ga0068856_100012115 | 3300005614 | Bacteria | 8350 |
| 191 | Ga0068856_100022478 | 3300005614 | Bacteria | 6131 |
| 192 | Ga0068856_100035573 | 3300005614 | Bacteria | 4881 |
| 193 | Ga0068856_100060487 | 3300005614 | Bacteria | 3742 |
| 194 | Ga0068856_100184584 | 3300005614 | Bacteria | 2099 |
| 195 | Ga0068856_100193207 | 3300005614 | Bacteria | 2049 |
| 196 | Ga0068852_100028818 | 3300005616 | Bacteria | 4549 |
| 197 | Ga0068852_100029930 | 3300005616 | Bacteria | 4477 |
| 198 | Ga0068852_100081976 | 3300005616 | Bacteria | 2865 |
| 199 | Ga0068852_100083509 | 3300005616 | Bacteria | 2840 |
| 200 | Ga0068852_100117637 | 3300005616 | Bacteria | 2427 |
| 201 | Ga0068852_100120681 | 3300005616 | Bacteria | 2399 |
| 202 | Ga0068852_100188878 | 3300005616 | Bacteria | 1942 |
| 203 | Ga0068852_100370260 | 3300005616 | Bacteria | 1403 |
| 204 | Ga0068859_100001009 | 3300005617 | Bacteria | 28824 |
| 205 | Ga0068859_100049313 | 3300005617 | Bacteria | 4229 |
| 206 | Ga0068859_100249620 | 3300005617 | Bacteria | 1865 |
| 207 | Ga0068859_100280542 | 3300005617 | Bacteria | 1759 |
| 208 | Ga0068864_100017137 | 3300005618 | Bacteria | 6041 |
| 209 | Ga0068864_100075848 | 3300005618 | Bacteria | 2936 |
| 210 | Ga0068861_100128912 | 3300005719 | Bacteria | 2051 |
| 211 | Ga0068851_10002163 | 3300005834 | Bacteria | 8638 |
| 212 | Ga0068851_10002817 | 3300005834 | Bacteria | 7667 |
| 213 | Ga0068851_10028539 | 3300005834 | Bacteria | 2758 |
| 214 | Ga0068851_10096864 | 3300005834 | Bacteria | 1560 |
| 215 | Ga0068851_10265912 | 3300005834 | Bacteria | 977 |
| 216 | Ga0068870_10068785 | 3300005840 | Bacteria | 1925 |
| 217 | Ga0068863_100002720 | 3300005841 | Bacteria | 17466 |
| 218 | Ga0068863_100003887 | 3300005841 | Bacteria | 14765 |
| 219 | Ga0068863_100010407 | 3300005841 | Bacteria | 9040 |
| 220 | Ga0068863_100083533 | 3300005841 | Bacteria | 3026 |
| 221 | Ga0068858_100000993 | 3300005842 | Bacteria | 29279 |
| 222 | Ga0068858_100046344 | 3300005842 | Bacteria | 4030 |
| 223 | Ga0068858_100215708 | 3300005842 | Bacteria | 1817 |
| 224 | Ga0068860_100001038 | 3300005843 | Bacteria | 30545 |
| 225 | Ga0068860_100005080 | 3300005843 | Bacteria | 13385 |
| 226 | Ga0068860_100119361 | 3300005843 | Bacteria | 2524 |
| 227 | Ga0068860_100190135 | 3300005843 | Bacteria | 1987 |
| 228 | Ga0068860_100362740 | 3300005843 | Bacteria | 1428 |
| 229 | Ga0068862_100000258 | 3300005844 | Bacteria | 58921 |
| 230 | Ga0068862_100052798 | 3300005844 | Bacteria | 3479 |
| 231 | Ga0068862_100156540 | 3300005844 | Bacteria | 2031 |
| 232 | Ga0081455_10120819 | 3300005937 | Bacteria | 2064 |
| 233 | Ga0081540_1000701 | 3300005983 | Bacteria | 31202 |
| 234 | Ga0075364_10000071 | 3300006051 | Bacteria | 39405 |
| 235 | Ga0075369_10012548 | 3300006186 | Bacteria | 3348 |
| 236 | Ga0097621_100033122 | 3300006237 | Bacteria | 4112 |
| 237 | Ga0068871_100011892 | 3300006358 | Bacteria | 6404 |
| 238 | Ga0068871_100054227 | 3300006358 | Bacteria | 3251 |
| 239 | Ga0068871_100110802 | 3300006358 | Bacteria | 2308 |
| 240 | Ga0068865_100014448 | 3300006881 | Bacteria | 5016 |
| 241 | Ga0068865_100022064 | 3300006881 | Bacteria | 4146 |
| 242 | Ga0068865_100043578 | 3300006881 | Bacteria | 3067 |
| 243 | Ga0075436_100013074 | 3300006914 | Bacteria | 5690 |
| 244 | Ga0097620_100001009 | 3300006931 | Bacteria | 28824 |
| 245 | Ga0097620_100049310 | 3300006931 | Bacteria | 4229 |
| 246 | Ga0097620_100249610 | 3300006931 | Bacteria | 1865 |
| 247 | Ga0097620_100280533 | 3300006931 | Bacteria | 1759 |
| 248 | Ga0105240_10009570 | 3300009093 | Bacteria | 13717 |
| 249 | Ga0105240_10013527 | 3300009093 | Bacteria | 11202 |
| 250 | Ga0105240_10016144 | 3300009093 | Bacteria | 10120 |
| 251 | Ga0105240_10118790 | 3300009093 | Bacteria | 3186 |
| 252 | Ga0105240_10164197 | 3300009093 | Bacteria | 2635 |
| 253 | Ga0105240_10636444 | 3300009093 | Bacteria | 1171 |
| 254 | Ga0105245_10209203 | 3300009098 | Bacteria | 1877 |
| 255 | Ga0105247_10001182 | 3300009101 | Bacteria | 19426 |
| 256 | Ga0105247_10161608 | 3300009101 | Bacteria | 1483 |
| 257 | Ga0105241_10002838 | 3300009174 | Bacteria | 12949 |
| 258 | Ga0105241_10007604 | 3300009174 | Bacteria | 7965 |
| 259 | Ga0105241_10052552 | 3300009174 | Bacteria | 3112 |
| 260 | Ga0105241_10137828 | 3300009174 | Bacteria | 1983 |
| 261 | Ga0105241_10212372 | 3300009174 | Bacteria | 1622 |
| 262 | Ga0105241_10251296 | 3300009174 | Bacteria | 1499 |
| 263 | Ga0105241_10288904 | 3300009174 | Bacteria | 1403 |
| 264 | Ga0105242_10003171 | 3300009176 | Bacteria | 12835 |
| 265 | Ga0105248_10000482 | 3300009177 | Bacteria | 45516 |
| 266 | Ga0105248_10012830 | 3300009177 | Bacteria | 9244 |
| 267 | Ga0105248_10084287 | 3300009177 | Bacteria | 3575 |
| 268 | Ga0105248_10366629 | 3300009177 | Bacteria | 1622 |
| 269 | Ga0105248_10455807 | 3300009177 | Bacteria | 1441 |
| 270 | Ga0105248_10679289 | 3300009177 | Bacteria | 1162 |
| 271 | Ga0105237_10000022 | 3300009545 | Bacteria | 228427 |
| 272 | Ga0105237_10001674 | 3300009545 | Bacteria | 28696 |
| 273 | Ga0105237_10011328 | 3300009545 | Bacteria | 9434 |
| 274 | Ga0105237_10062347 | 3300009545 | Bacteria | 3728 |
| 275 | Ga0105237_10522404 | 3300009545 | Bacteria | 1194 |
| 276 | Ga0105237_10563850 | 3300009545 | Bacteria | 1145 |
| 277 | Ga0105238_10000438 | 3300009551 | Bacteria | 43895 |
| 278 | Ga0105238_10000798 | 3300009551 | Bacteria | 32638 |
| 279 | Ga0105238_10001541 | 3300009551 | Bacteria | 23092 |
| 280 | Ga0105238_10003674 | 3300009551 | Bacteria | 15287 |
| 281 | Ga0105238_10023744 | 3300009551 | Bacteria | 6249 |
| 282 | Ga0105238_10106031 | 3300009551 | Bacteria | 2792 |
| 283 | Ga0105238_10136861 | 3300009551 | Bacteria | 2427 |
| 284 | Ga0105249_10000589 | 3300009553 | Bacteria | 33192 |
| 285 | Ga0105249_10171246 | 3300009553 | Bacteria | 2106 |
| 286 | Ga0105249_10564030 | 3300009553 | Bacteria | 1191 |
| 287 | Ga0105239_10000201 | 3300010375 | Bacteria | 87658 |
| 288 | Ga0105239_10007421 | 3300010375 | Bacteria | 12578 |
| 289 | Ga0105239_10007651 | 3300010375 | Bacteria | 12381 |
| 290 | Ga0105239_10008115 | 3300010375 | Bacteria | 11985 |
| 291 | Ga0105239_10013121 | 3300010375 | Bacteria | 9207 |
| 292 | Ga0105239_10020642 | 3300010375 | Bacteria | 7268 |
| 293 | Ga0105239_10030408 | 3300010375 | Bacteria | 5938 |
| 294 | Ga0105239_10074374 | 3300010375 | Bacteria | 3736 |
| 295 | Ga0105239_10149948 | 3300010375 | Bacteria | 2602 |
| 296 | Ga0105239_10181804 | 3300010375 | Bacteria | 2353 |
| 297 | Ga0105246_10006308 | 3300011119 | Bacteria | 7237 |
| 298 | Ga0105246_10036685 | 3300011119 | Bacteria | 3286 |
| 299 | Ga0157314_1000145 | 3300012500 | Bacteria | 7863 |
| 300 | Ga0154018_119159 | 3300013043 | Bacteria | 975 |
| 301 | Ga0154016_120722 | 3300013045 | Bacteria | 960 |
| 302 | Ga0154014_144769 | 3300013052 | Bacteria | 944 |
| 303 | Ga0154012_153308 | 3300013059 | Bacteria | 988 |
| 304 | Ga0154010_128674 | 3300013062 | Bacteria | 915 |
| 305 | Ga0154010_137221 | 3300013062 | Bacteria | 959 |
| 306 | Ga0154010_169066 | 3300013062 | Bacteria | 1102 |
| 307 | Ga0157373_10013510 | 3300013100 | Bacteria | 5987 |
| 308 | Ga0157373_10070693 | 3300013100 | Bacteria | 2466 |
| 309 | Ga0157373_10072968 | 3300013100 | Bacteria | 2422 |
| 310 | Ga0157373_10120799 | 3300013100 | Bacteria | 1841 |
| 311 | Ga0157371_10081985 | 3300013102 | Bacteria | 2284 |
| 312 | Ga0157371_10205774 | 3300013102 | Bacteria | 1412 |
| 313 | Ga0157370_10000790 | 3300013104 | Bacteria | 39799 |
| 314 | Ga0157370_10013975 | 3300013104 | Bacteria | 8243 |
| 315 | Ga0157370_10019123 | 3300013104 | Bacteria | 6886 |
| 316 | Ga0157370_10020159 | 3300013104 | Bacteria | 6665 |
| 317 | Ga0157370_10029677 | 3300013104 | Bacteria | 5363 |
| 318 | Ga0157370_10053374 | 3300013104 | Bacteria | 3854 |
| 319 | Ga0157370_10116902 | 3300013104 | Bacteria | 2491 |
| 320 | Ga0157370_10199775 | 3300013104 | Bacteria | 1855 |
| 321 | Ga0157370_10258179 | 3300013104 | Bacteria | 1611 |
| 322 | Ga0157369_10000653 | 3300013105 | Bacteria | 44847 |
| 323 | Ga0157369_10005513 | 3300013105 | Bacteria | 14697 |
| 324 | Ga0157369_10034736 | 3300013105 | Bacteria | 5530 |
| 325 | Ga0157369_10036355 | 3300013105 | Bacteria | 5397 |
| 326 | Ga0157369_10147374 | 3300013105 | Bacteria | 2488 |
| 327 | Ga0157369_10231269 | 3300013105 | Bacteria | 1933 |
| 328 | Ga0157369_10317399 | 3300013105 | Bacteria | 1620 |
| 329 | Ga0157369_10408488 | 3300013105 | Bacteria | 1408 |
| 330 | Ga0157374_10004750 | 3300013296 | Bacteria | 11393 |
| 331 | Ga0157374_10304223 | 3300013296 | Bacteria | 1578 |
| 332 | Ga0157378_10000274 | 3300013297 | Bacteria | 50288 |
| 333 | Ga0157378_10085828 | 3300013297 | Bacteria | 2852 |
| 334 | Ga0157378_10100938 | 3300013297 | Bacteria | 2635 |
| 335 | Ga0163162_10028068 | 3300013306 | Bacteria | 5568 |
| 336 | Ga0163162_10335862 | 3300013306 | Bacteria | 1643 |
| 337 | Ga0163162_10560110 | 3300013306 | Bacteria | 1271 |
| 338 | Ga0157372_10000289 | 3300013307 | Bacteria | 55971 |
| 339 | Ga0157372_10023002 | 3300013307 | Bacteria | 6754 |
| 340 | Ga0157372_10027186 | 3300013307 | Bacteria | 6228 |
| 341 | Ga0157372_10028526 | 3300013307 | Bacteria | 6092 |
| 342 | Ga0157372_10038723 | 3300013307 | Bacteria | 5261 |
| 343 | Ga0157372_10039411 | 3300013307 | Bacteria | 5214 |
| 344 | Ga0157372_10049484 | 3300013307 | Bacteria | 4673 |
| 345 | Ga0157372_10098349 | 3300013307 | Bacteria | 3338 |
| 346 | Ga0157372_10475805 | 3300013307 | Bacteria | 1456 |
| 347 | Ga0157375_10000387 | 3300013308 | Bacteria | 40109 |
| 348 | Ga0157375_10305718 | 3300013308 | Bacteria | 1754 |
| 349 | Ga0163163_10000041 | 3300014325 | Bacteria | 142066 |
| 350 | Ga0163163_10001574 | 3300014325 | Bacteria | 19234 |
| 351 | Ga0163163_10077088 | 3300014325 | Bacteria | 3329 |
| 352 | Ga0157380_10536545 | 3300014326 | Bacteria | 1145 |
| 353 | Ga0182008_10009913 | 3300014497 | Bacteria | 5123 |
| 354 | Ga0182008_10025453 | 3300014497 | Bacteria | 3005 |
| 355 | Ga0157379_10008854 | 3300014968 | Bacteria | 8777 |
| 356 | Ga0157379_10230329 | 3300014968 | Bacteria | 1679 |
| 357 | Ga0157376_10027179 | 3300014969 | Bacteria | 4533 |
| 358 | Ga0157376_10041558 | 3300014969 | Bacteria | 3765 |
| 359 | Ga0157376_10050654 | 3300014969 | Bacteria | 3446 |
| 360 | Ga0157376_10194802 | 3300014969 | Bacteria | 1861 |
| 361 | Ga0182006_1000065 | 3300015261 | Bacteria | 152292 |
| 362 | Ga0182007_10009823 | 3300015262 | Bacteria | 3821 |
| 363 | Ga0182007_10014154 | 3300015262 | Bacteria | 3017 |
| 364 | Ga0182005_1000135 | 3300015265 | Bacteria | 52531 |
| 365 | Ga0182005_1001395 | 3300015265 | Bacteria | 9815 |
| 366 | Ga0183369_1004 | 3300015685 | Bacteria | 539301 |
| 367 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 368 | Ga0197907_10180164 | 3300020069 | Bacteria | 1195 |
| 369 | Ga0197907_10245422 | 3300020069 | Bacteria | 956 |
| 370 | Ga0197907_11156423 | 3300020069 | Bacteria | 919 |
| 371 | Ga0197907_11176821 | 3300020069 | Bacteria | 1097 |
| 372 | Ga0206356_10295912 | 3300020070 | Bacteria | 1073 |
| 373 | Ga0206356_11283223 | 3300020070 | Bacteria | 1046 |
| 374 | Ga0206356_11568899 | 3300020070 | Bacteria | 1016 |
| 375 | Ga0206349_1140085 | 3300020075 | Bacteria | 946 |
| 376 | Ga0206349_1283811 | 3300020075 | Bacteria | 893 |
| 377 | Ga0206349_1676871 | 3300020075 | Bacteria | 967 |
| 378 | Ga0206349_1702833 | 3300020075 | Bacteria | 1519 |
| 379 | Ga0206355_1403507 | 3300020076 | Bacteria | 969 |
| 380 | Ga0206355_1420628 | 3300020076 | Bacteria | 1026 |
| 381 | Ga0206355_1721824 | 3300020076 | Bacteria | 902 |
| 382 | Ga0206351_10235719 | 3300020077 | Bacteria | 1013 |
| 383 | Ga0206351_10410724 | 3300020077 | Bacteria | 946 |
| 384 | Ga0206352_10077414 | 3300020078 | Bacteria | 982 |
| 385 | Ga0206352_10339572 | 3300020078 | Bacteria | 972 |
| 386 | Ga0206352_10564291 | 3300020078 | Bacteria | 1176 |
| 387 | Ga0206352_10847784 | 3300020078 | Bacteria | 1192 |
| 388 | Ga0206352_11034105 | 3300020078 | Bacteria | 1037 |
| 389 | Ga0206350_10448320 | 3300020080 | Bacteria | 935 |
| 390 | Ga0206350_11040687 | 3300020080 | Bacteria | 1460 |
| 391 | Ga0206350_11180810 | 3300020080 | Bacteria | 1080 |
| 392 | Ga0206354_11364663 | 3300020081 | Bacteria | 957 |
| 393 | Ga0206354_11401936 | 3300020081 | Bacteria | 986 |
| 394 | Ga0206353_10112022 | 3300020082 | Bacteria | 998 |
| 395 | Ga0206353_11111473 | 3300020082 | Bacteria | 1693 |
| 396 | Ga0206353_11572226 | 3300020082 | Bacteria | 959 |
| 397 | Ga0154015_1492826 | 3300020610 | Bacteria | 1183 |
| 398 | Ga0154015_1617911 | 3300020610 | Bacteria | 967 |
| 399 | Ga0154015_1647404 | 3300020610 | Bacteria | 1563 |
| 400 | Ga0224712_10060903 | 3300022467 | Bacteria | 1503 |
| 401 | Ga0224712_10134847 | 3300022467 | Bacteria | 1081 |
| 402 | Ga0224712_10149954 | 3300022467 | Bacteria | 1032 |
| 403 | Ga0224712_10173134 | 3300022467 | Bacteria | 969 |
| 404 | Ga0224712_10177821 | 3300022467 | Bacteria | 957 |
| 405 | Ga0209435_103024 | 3300025206 | Bacteria | 1935 |
| 406 | Ga0209784_100119 | 3300025224 | Bacteria | 82900 |
| 407 | Ga0209566_103651 | 3300025225 | Bacteria | 2289 |
| 408 | Ga0209674_100014 | 3300025226 | Bacteria | 704989 |
| 409 | Ga0209674_100079 | 3300025226 | Bacteria | 205836 |
| 410 | Ga0209674_100862 | 3300025226 | Bacteria | 9963 |
| 411 | Ga0209674_100875 | 3300025226 | Bacteria | 9811 |
| 412 | Ga0209674_101251 | 3300025226 | Bacteria | 7152 |
| 413 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 414 | Ga0209672_100108 | 3300025228 | Bacteria | 96721 |
| 415 | Ga0209672_100121 | 3300025228 | Bacteria | 83609 |
| 416 | Ga0209672_101356 | 3300025228 | Bacteria | 9185 |
| 417 | Ga0209563_100045 | 3300025230 | Bacteria | 377102 |
| 418 | Ga0207427_100037 | 3300025231 | Bacteria | 303108 |
| 419 | Ga0207427_100068 | 3300025231 | Bacteria | 164460 |
| 420 | Ga0207427_100142 | 3300025231 | Bacteria | 82907 |
| 421 | Ga0207427_100233 | 3300025231 | Bacteria | 46070 |
| 422 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 423 | Ga0209437_100074 | 3300025233 | Bacteria | 300858 |
| 424 | Ga0209437_100162 | 3300025233 | Bacteria | 147864 |
| 425 | Ga0209437_100285 | 3300025233 | Bacteria | 74366 |
| 426 | Ga0209437_100305 | 3300025233 | Bacteria | 67799 |
| 427 | Ga0209437_101060 | 3300025233 | Bacteria | 9032 |
| 428 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 429 | Ga0209258_100057 | 3300025242 | Bacteria | 334259 |
| 430 | Ga0209258_100127 | 3300025242 | Bacteria | 177606 |
| 431 | Ga0209258_100152 | 3300025242 | Bacteria | 160154 |
| 432 | Ga0209258_100185 | 3300025242 | Bacteria | 132820 |
| 433 | Ga0209258_105004 | 3300025242 | Bacteria | 2356 |
| 434 | Ga0209646_1001834 | 3300025246 | Bacteria | 5254 |
| 435 | Ga0209646_1002202 | 3300025246 | Bacteria | 4500 |
| 436 | Ga0209646_1002230 | 3300025246 | Bacteria | 4454 |
| 437 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 438 | Ga0209026_1000055 | 3300025250 | Bacteria | 237197 |
| 439 | Ga0209026_1000200 | 3300025250 | Bacteria | 82913 |
| 440 | Ga0209026_1000360 | 3300025250 | Bacteria | 42836 |
| 441 | Ga0209026_1000606 | 3300025250 | Bacteria | 23102 |
| 442 | Ga0209026_1002343 | 3300025250 | Bacteria | 7176 |
| 443 | Ga0209677_101408 | 3300025253 | Bacteria | 10434 |
| 444 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 445 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 446 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 447 | Ga0209148_1000036 | 3300025254 | Bacteria | 530505 |
| 448 | Ga0209148_1000042 | 3300025254 | Bacteria | 464111 |
| 449 | Ga0209148_1000068 | 3300025254 | Bacteria | 335510 |
| 450 | Ga0209759_1000185 | 3300025256 | Bacteria | 100505 |
| 451 | Ga0209759_1000339 | 3300025256 | Bacteria | 61740 |
| 452 | Ga0209759_1000454 | 3300025256 | Bacteria | 46927 |
| 453 | Ga0209759_1003532 | 3300025256 | Bacteria | 6192 |
| 454 | Ga0209759_1007318 | 3300025256 | Bacteria | 3566 |
| 455 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 456 | Ga0209233_1000040 | 3300025261 | Bacteria | 530395 |
| 457 | Ga0209233_1000096 | 3300025261 | Bacteria | 303482 |
| 458 | Ga0209233_1000172 | 3300025261 | Bacteria | 146504 |
| 459 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 460 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 461 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 462 | Ga0209455_1000071 | 3300025272 | Bacteria | 300858 |
| 463 | Ga0209455_1000142 | 3300025272 | Bacteria | 138027 |
| 464 | Ga0209455_1007774 | 3300025272 | Bacteria | 2987 |
| 465 | Ga0209758_1005675 | 3300025297 | Bacteria | 9441 |
| 466 | Ga0209758_1016755 | 3300025297 | Bacteria | 3701 |
| 467 | Ga0209256_1005353 | 3300025299 | Bacteria | 7432 |
| 468 | Ga0209256_1030489 | 3300025299 | Bacteria | 1488 |
| 469 | Ga0209051_1002617 | 3300025303 | Bacteria | 12644 |
| 470 | Ga0209051_1019072 | 3300025303 | Bacteria | 3008 |
| 471 | Ga0209257_1023830 | 3300025304 | Bacteria | 2137 |
| 472 | Ga0207656_10001161 | 3300025321 | Bacteria | 8653 |
| 473 | Ga0207656_10015250 | 3300025321 | Bacteria | 2972 |
| 474 | Ga0207656_10046194 | 3300025321 | Bacteria | 1867 |
| 475 | Ga0207656_10048133 | 3300025321 | Bacteria | 1834 |
| 476 | Ga0207656_10116853 | 3300025321 | Bacteria | 1238 |
| 477 | Ga0207656_10124291 | 3300025321 | Bacteria | 1204 |
| 478 | Ga0207710_10055305 | 3300025900 | Bacteria | 1789 |
| 479 | Ga0207710_10086541 | 3300025900 | Bacteria | 1461 |
| 480 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 481 | Ga0207680_10003572 | 3300025903 | Bacteria | 7306 |
| 482 | Ga0207680_10094908 | 3300025903 | Bacteria | 1905 |
| 483 | Ga0207680_10135719 | 3300025903 | Bacteria | 1626 |
| 484 | Ga0207680_10410806 | 3300025903 | Bacteria | 957 |
| 485 | Ga0207647_10000014 | 3300025904 | Bacteria | 143525 |
| 486 | Ga0207647_10000055 | 3300025904 | Bacteria | 86547 |
| 487 | Ga0207647_10000939 | 3300025904 | Bacteria | 22542 |
| 488 | Ga0207647_10013011 | 3300025904 | Bacteria | 5781 |
| 489 | Ga0207647_10016810 | 3300025904 | Bacteria | 4986 |
| 490 | Ga0207645_10038593 | 3300025907 | Bacteria | 3062 |
| 491 | Ga0207645_10248430 | 3300025907 | Bacteria | 1176 |
| 492 | Ga0207643_10008052 | 3300025908 | Bacteria | 5653 |
| 493 | Ga0207705_10001038 | 3300025909 | Bacteria | 22575 |
| 494 | Ga0207705_10004066 | 3300025909 | Bacteria | 11102 |
| 495 | Ga0207705_10008600 | 3300025909 | Bacteria | 7442 |
| 496 | Ga0207705_10014785 | 3300025909 | Bacteria | 5612 |
| 497 | Ga0207654_10009527 | 3300025911 | Bacteria | 4935 |
| 498 | Ga0207654_10055289 | 3300025911 | Bacteria | 2297 |
| 499 | Ga0207654_10069475 | 3300025911 | Bacteria | 2087 |
| 500 | Ga0207654_10171301 | 3300025911 | Bacteria | 1410 |
| 501 | Ga0207654_10171875 | 3300025911 | Bacteria | 1408 |
| 502 | Ga0207707_10000039 | 3300025912 | Bacteria | 138817 |
| 503 | Ga0207707_10000068 | 3300025912 | Bacteria | 103683 |
| 504 | Ga0207707_10000105 | 3300025912 | Bacteria | 83206 |
| 505 | Ga0207707_10000133 | 3300025912 | Bacteria | 77264 |
| 506 | Ga0207707_10000848 | 3300025912 | Bacteria | 29884 |
| 507 | Ga0207707_10002257 | 3300025912 | Bacteria | 17437 |
| 508 | Ga0207707_10006604 | 3300025912 | Bacteria | 10121 |
| 509 | Ga0207707_10011699 | 3300025912 | Bacteria | 7636 |
| 510 | Ga0207707_10014987 | 3300025912 | Bacteria | 6751 |
| 511 | Ga0207707_10165535 | 3300025912 | Bacteria | 1932 |
| 512 | Ga0207707_10286642 | 3300025912 | Bacteria | 1425 |
| 513 | Ga0207695_10000275 | 3300025913 | Bacteria | 129123 |
| 514 | Ga0207695_10000750 | 3300025913 | Bacteria | 62486 |
| 515 | Ga0207695_10001177 | 3300025913 | Bacteria | 45115 |
| 516 | Ga0207695_10001986 | 3300025913 | Bacteria | 31587 |
| 517 | Ga0207695_10004061 | 3300025913 | Bacteria | 20124 |
| 518 | Ga0207695_10007149 | 3300025913 | Bacteria | 14286 |
| 519 | Ga0207695_10010190 | 3300025913 | Bacteria | 11529 |
| 520 | Ga0207695_10011212 | 3300025913 | Bacteria | 10873 |
| 521 | Ga0207695_10013350 | 3300025913 | Bacteria | 9803 |
| 522 | Ga0207695_10025042 | 3300025913 | Bacteria | 6693 |
| 523 | Ga0207695_10025597 | 3300025913 | Bacteria | 6601 |
| 524 | Ga0207695_10251666 | 3300025913 | Bacteria | 1666 |
| 525 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 526 | Ga0207671_10000205 | 3300025914 | Bacteria | 89701 |
| 527 | Ga0207671_10000689 | 3300025914 | Bacteria | 43697 |
| 528 | Ga0207671_10004084 | 3300025914 | Bacteria | 14127 |
| 529 | Ga0207671_10004501 | 3300025914 | Bacteria | 13265 |
| 530 | Ga0207671_10008570 | 3300025914 | Bacteria | 8651 |
| 531 | Ga0207671_10038209 | 3300025914 | Bacteria | 3558 |
| 532 | Ga0207671_10182050 | 3300025914 | Bacteria | 1636 |
| 533 | Ga0207671_10332394 | 3300025914 | Bacteria | 1203 |
| 534 | Ga0207663_10037830 | 3300025916 | Bacteria | 2912 |
| 535 | Ga0207663_10053511 | 3300025916 | Bacteria | 2522 |
| 536 | Ga0207660_10001051 | 3300025917 | Bacteria | 18277 |
| 537 | Ga0207660_10004808 | 3300025917 | Bacteria | 8787 |
| 538 | Ga0207660_10006302 | 3300025917 | Bacteria | 7695 |
| 539 | Ga0207660_10016646 | 3300025917 | Bacteria | 4871 |
| 540 | Ga0207660_10042897 | 3300025917 | Bacteria | 3177 |
| 541 | Ga0207657_10003243 | 3300025919 | Bacteria | 17418 |
| 542 | Ga0207657_10003424 | 3300025919 | Bacteria | 16938 |
| 543 | Ga0207657_10018160 | 3300025919 | Bacteria | 6728 |
| 544 | Ga0207657_10023070 | 3300025919 | Bacteria | 5803 |
| 545 | Ga0207657_10023215 | 3300025919 | Bacteria | 5781 |
| 546 | Ga0207657_10371275 | 3300025919 | Bacteria | 1127 |
| 547 | Ga0207649_10000952 | 3300025920 | Bacteria | 18029 |
| 548 | Ga0207649_10002276 | 3300025920 | Bacteria | 10799 |
| 549 | Ga0207649_10012058 | 3300025920 | Bacteria | 4782 |
| 550 | Ga0207649_10032167 | 3300025920 | Bacteria | 3125 |
| 551 | Ga0207649_10231698 | 3300025920 | Bacteria | 1321 |
| 552 | Ga0207652_10000081 | 3300025921 | Bacteria | 103132 |
| 553 | Ga0207652_10000707 | 3300025921 | Bacteria | 32390 |
| 554 | Ga0207652_10001040 | 3300025921 | Bacteria | 25417 |
| 555 | Ga0207652_10001332 | 3300025921 | Bacteria | 21932 |
| 556 | Ga0207652_10001828 | 3300025921 | Bacteria | 18451 |
| 557 | Ga0207652_10007164 | 3300025921 | Bacteria | 8993 |
| 558 | Ga0207652_10019836 | 3300025921 | Bacteria | 5534 |
| 559 | Ga0207652_10134865 | 3300025921 | Bacteria | 2204 |
| 560 | Ga0207652_10226968 | 3300025921 | Bacteria | 1683 |
| 561 | Ga0207652_10371311 | 3300025921 | Bacteria | 1291 |
| 562 | Ga0207681_10204662 | 3300025923 | Bacteria | 1517 |
| 563 | Ga0207694_10001808 | 3300025924 | Bacteria | 17820 |
| 564 | Ga0207694_10001816 | 3300025924 | Bacteria | 17775 |
| 565 | Ga0207694_10003563 | 3300025924 | Bacteria | 12357 |
| 566 | Ga0207694_10011793 | 3300025924 | Bacteria | 6594 |
| 567 | Ga0207694_10038315 | 3300025924 | Bacteria | 3685 |
| 568 | Ga0207694_10113630 | 3300025924 | Bacteria | 2156 |
| 569 | Ga0207694_10148202 | 3300025924 | Bacteria | 1890 |
| 570 | Ga0207694_10177884 | 3300025924 | Bacteria | 1724 |
| 571 | Ga0207694_10182946 | 3300025924 | Bacteria | 1700 |
| 572 | Ga0207650_10069021 | 3300025925 | Bacteria | 2655 |
| 573 | Ga0207650_10077962 | 3300025925 | Bacteria | 2506 |
| 574 | Ga0207650_10092602 | 3300025925 | Bacteria | 2312 |
| 575 | Ga0207659_10045238 | 3300025926 | Bacteria | 3102 |
| 576 | Ga0207687_10226125 | 3300025927 | Bacteria | 1476 |
| 577 | Ga0207700_10005275 | 3300025928 | Bacteria | 7708 |
| 578 | Ga0207664_10001629 | 3300025929 | Bacteria | 14782 |
| 579 | Ga0207664_10025625 | 3300025929 | Bacteria | 4446 |
| 580 | Ga0207664_10034260 | 3300025929 | Bacteria | 3910 |
| 581 | Ga0207644_10450274 | 3300025931 | Bacteria | 1057 |
| 582 | Ga0207644_10476201 | 3300025931 | Bacteria | 1028 |
| 583 | Ga0207690_10001535 | 3300025932 | Bacteria | 14436 |
| 584 | Ga0207690_10003927 | 3300025932 | Bacteria | 8790 |
| 585 | Ga0207690_10005093 | 3300025932 | Bacteria | 7761 |
| 586 | Ga0207690_10131938 | 3300025932 | Bacteria | 1830 |
| 587 | Ga0207706_10001818 | 3300025933 | Bacteria | 20947 |
| 588 | Ga0207706_10013232 | 3300025933 | Bacteria | 7505 |
| 589 | Ga0207706_10328937 | 3300025933 | Bacteria | 1330 |
| 590 | Ga0207706_10337009 | 3300025933 | Bacteria | 1312 |
| 591 | Ga0207686_10055736 | 3300025934 | Bacteria | 2481 |
| 592 | Ga0207670_10003294 | 3300025936 | Bacteria | 8558 |
| 593 | Ga0207704_10031739 | 3300025938 | Bacteria | 2980 |
| 594 | Ga0207704_10040966 | 3300025938 | Bacteria | 2712 |
| 595 | Ga0207704_10068939 | 3300025938 | Bacteria | 2232 |
| 596 | Ga0207704_10101850 | 3300025938 | Bacteria | 1916 |
| 597 | Ga0207691_10015606 | 3300025940 | Bacteria | 7221 |
| 598 | Ga0207711_10001370 | 3300025941 | Bacteria | 22957 |
| 599 | Ga0207711_10016047 | 3300025941 | Bacteria | 6215 |
| 600 | Ga0207689_10047719 | 3300025942 | Bacteria | 3533 |
| 601 | Ga0207661_10005240 | 3300025944 | Bacteria | 9116 |
| 602 | Ga0207661_10068478 | 3300025944 | Bacteria | 2890 |
| 603 | Ga0207661_10184604 | 3300025944 | Bacteria | 1824 |
| 604 | Ga0207661_10504917 | 3300025944 | Bacteria | 1105 |
| 605 | Ga0207679_10082370 | 3300025945 | Bacteria | 2463 |
| 606 | Ga0207679_10137859 | 3300025945 | Bacteria | 1967 |
| 607 | Ga0207679_10192136 | 3300025945 | Bacteria | 1698 |
| 608 | Ga0207667_10000193 | 3300025949 | Bacteria | 88949 |
| 609 | Ga0207667_10002544 | 3300025949 | Bacteria | 22682 |
| 610 | Ga0207667_10006246 | 3300025949 | Bacteria | 14460 |
| 611 | Ga0207667_10009306 | 3300025949 | Bacteria | 11587 |
| 612 | Ga0207667_10016947 | 3300025949 | Bacteria | 8220 |
| 613 | Ga0207667_10020574 | 3300025949 | Bacteria | 7333 |
| 614 | Ga0207667_10021032 | 3300025949 | Bacteria | 7236 |
| 615 | Ga0207667_10021806 | 3300025949 | Bacteria | 7090 |
| 616 | Ga0207667_10034907 | 3300025949 | Bacteria | 5398 |
| 617 | Ga0207667_10138628 | 3300025949 | Bacteria | 2505 |
| 618 | Ga0207667_10320024 | 3300025949 | Bacteria | 1584 |
| 619 | Ga0207667_10393382 | 3300025949 | Bacteria | 1411 |
| 620 | Ga0207667_10443814 | 3300025949 | Bacteria | 1319 |
| 621 | Ga0207651_10025419 | 3300025960 | Bacteria | 3680 |
| 622 | Ga0207712_10000117 | 3300025961 | Bacteria | 86479 |
| 623 | Ga0207712_10000170 | 3300025961 | Bacteria | 67105 |
| 624 | Ga0207712_10070242 | 3300025961 | Bacteria | 2515 |
| 625 | Ga0207712_10150433 | 3300025961 | Bacteria | 1797 |
| 626 | Ga0207712_10278520 | 3300025961 | Bacteria | 1364 |
| 627 | Ga0207668_10492466 | 3300025972 | Bacteria | 1053 |
| 628 | Ga0207640_10003299 | 3300025981 | Bacteria | 8704 |
| 629 | Ga0207640_10003627 | 3300025981 | Bacteria | 8333 |
| 630 | Ga0207640_10006583 | 3300025981 | Bacteria | 6377 |
| 631 | Ga0207640_10018248 | 3300025981 | Bacteria | 4119 |
| 632 | Ga0207640_10025525 | 3300025981 | Bacteria | 3578 |
| 633 | Ga0207640_10044756 | 3300025981 | Bacteria | 2838 |
| 634 | Ga0207640_10058957 | 3300025981 | Bacteria | 2531 |
| 635 | Ga0207640_10060673 | 3300025981 | Bacteria | 2501 |
| 636 | Ga0207658_10000104 | 3300025986 | Bacteria | 92659 |
| 637 | Ga0207658_10002932 | 3300025986 | Bacteria | 12216 |
| 638 | Ga0207658_10272880 | 3300025986 | Bacteria | 1446 |
| 639 | Ga0207658_10316044 | 3300025986 | Bacteria | 1350 |
| 640 | Ga0207677_10156663 | 3300026023 | Bacteria | 1764 |
| 641 | Ga0207677_10245021 | 3300026023 | Bacteria | 1452 |
| 642 | Ga0207703_10000890 | 3300026035 | Bacteria | 29311 |
| 643 | Ga0207703_10186718 | 3300026035 | Bacteria | 1833 |
| 644 | Ga0207639_10000824 | 3300026041 | Bacteria | 21085 |
| 645 | Ga0207639_10001564 | 3300026041 | Bacteria | 15355 |
| 646 | Ga0207639_10002356 | 3300026041 | Bacteria | 12694 |
| 647 | Ga0207639_10007227 | 3300026041 | Bacteria | 7565 |
| 648 | Ga0207639_10010669 | 3300026041 | Bacteria | 6363 |
| 649 | Ga0207639_10013837 | 3300026041 | Bacteria | 5657 |
| 650 | Ga0207639_10024385 | 3300026041 | Bacteria | 4377 |
| 651 | Ga0207639_10032989 | 3300026041 | Bacteria | 3816 |
| 652 | Ga0207639_10041045 | 3300026041 | Bacteria | 3459 |
| 653 | Ga0207639_10062707 | 3300026041 | Bacteria | 2876 |
| 654 | Ga0207639_10135461 | 3300026041 | Bacteria | 2044 |
| 655 | Ga0207639_10581284 | 3300026041 | Bacteria | 1031 |
| 656 | Ga0207678_10000365 | 3300026067 | Bacteria | 41123 |
| 657 | Ga0207678_10002082 | 3300026067 | Bacteria | 18143 |
| 658 | Ga0207678_10002205 | 3300026067 | Bacteria | 17586 |
| 659 | Ga0207678_10002713 | 3300026067 | Bacteria | 16052 |
| 660 | Ga0207678_10003194 | 3300026067 | Bacteria | 14831 |
| 661 | Ga0207678_10032921 | 3300026067 | Bacteria | 4516 |
| 662 | Ga0207678_10044243 | 3300026067 | Bacteria | 3852 |
| 663 | Ga0207678_10054332 | 3300026067 | Bacteria | 3449 |
| 664 | Ga0207678_10057945 | 3300026067 | Bacteria | 3333 |
| 665 | Ga0207678_10074449 | 3300026067 | Bacteria | 2910 |
| 666 | Ga0207678_10095635 | 3300026067 | Bacteria | 2538 |
| 667 | Ga0207708_10069454 | 3300026075 | Bacteria | 2697 |
| 668 | Ga0207702_10000311 | 3300026078 | Bacteria | 55554 |
| 669 | Ga0207702_10001604 | 3300026078 | Bacteria | 22369 |
| 670 | Ga0207702_10006991 | 3300026078 | Bacteria | 9658 |
| 671 | Ga0207702_10011355 | 3300026078 | Bacteria | 7426 |
| 672 | Ga0207702_10011573 | 3300026078 | Bacteria | 7352 |
| 673 | Ga0207702_10014929 | 3300026078 | Bacteria | 6443 |
| 674 | Ga0207702_10016909 | 3300026078 | Bacteria | 6036 |
| 675 | Ga0207702_10095214 | 3300026078 | Bacteria | 2616 |
| 676 | Ga0207702_10129370 | 3300026078 | Bacteria | 2270 |
| 677 | Ga0207702_10157191 | 3300026078 | Bacteria | 2073 |
| 678 | Ga0207702_10246089 | 3300026078 | Bacteria | 1677 |
| 679 | Ga0207641_10027645 | 3300026088 | Bacteria | 4685 |
| 680 | Ga0207641_10085107 | 3300026088 | Bacteria | 2754 |
| 681 | Ga0207641_10099289 | 3300026088 | Bacteria | 2561 |
| 682 | Ga0207641_10592602 | 3300026088 | Bacteria | 1084 |
| 683 | Ga0207641_10664200 | 3300026088 | Bacteria | 1024 |
| 684 | Ga0207648_10033885 | 3300026089 | Bacteria | 4503 |
| 685 | Ga0207676_10144517 | 3300026095 | Bacteria | 2041 |
| 686 | Ga0207676_10152840 | 3300026095 | Bacteria | 1990 |
| 687 | Ga0207674_10001639 | 3300026116 | Bacteria | 28811 |
| 688 | Ga0207674_10004159 | 3300026116 | Bacteria | 17503 |
| 689 | Ga0207674_10016073 | 3300026116 | Bacteria | 8197 |
| 690 | Ga0207674_10045898 | 3300026116 | Bacteria | 4490 |
| 691 | Ga0207674_10085744 | 3300026116 | Bacteria | 3144 |
| 692 | Ga0207674_10089265 | 3300026116 | Bacteria | 3075 |
| 693 | Ga0207674_10161593 | 3300026116 | Bacteria | 2194 |
| 694 | Ga0207674_10196595 | 3300026116 | Bacteria | 1966 |
| 695 | Ga0207674_10319796 | 3300026116 | Bacteria | 1501 |
| 696 | Ga0207675_100162323 | 3300026118 | Bacteria | 2132 |
| 697 | Ga0207698_10003970 | 3300026142 | Bacteria | 8968 |
| 698 | Ga0207698_10004405 | 3300026142 | Bacteria | 8578 |
| 699 | Ga0207698_10196590 | 3300026142 | Bacteria | 1802 |
| 700 | Ga0207698_10206910 | 3300026142 | Bacteria | 1762 |
| 701 | Ga0207698_10238228 | 3300026142 | Bacteria | 1656 |
| 702 | Ga0207698_10242328 | 3300026142 | Bacteria | 1644 |
| 703 | Ga0207698_10299886 | 3300026142 | Bacteria | 1495 |
| 704 | Ga0207698_10488152 | 3300026142 | Bacteria | 1196 |
| 705 | Ga0207698_10641472 | 3300026142 | Bacteria | 1051 |
| 706 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 707 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 708 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 709 | Ga0268266_10039830 | 3300028379 | Bacteria | 4003 |
| 710 | Ga0268266_10076896 | 3300028379 | Bacteria | 2901 |
| 711 | Ga0268266_10126191 | 3300028379 | Bacteria | 2284 |
| 712 | Ga0268266_10196942 | 3300028379 | Bacteria | 1842 |
| 713 | Ga0268266_10437115 | 3300028379 | Bacteria | 1242 |
| 714 | Ga0268266_10610141 | 3300028379 | Bacteria | 1048 |
| 715 | Ga0268265_10000471 | 3300028380 | Bacteria | 42560 |
| 716 | Ga0268265_10123701 | 3300028380 | Bacteria | 2136 |
| 717 | Ga0268265_10239069 | 3300028380 | Bacteria | 1601 |
| 718 | Ga0268265_10418637 | 3300028380 | Bacteria | 1243 |
| 719 | Ga0268264_10017655 | 3300028381 | Bacteria | 5842 |
| 720 | Ga0268264_10024517 | 3300028381 | Bacteria | 4925 |
| 721 | Ga0268264_10158058 | 3300028381 | Bacteria | 2039 |
| 722 | Ga0268264_10781252 | 3300028381 | Bacteria | 953 |
| 723 | Ga0265334_10000098 | 3300028573 | Bacteria | 60531 |
| 724 | Ga0307517_10083836 | 3300028786 | Bacteria | 2689 |
| 725 | Ga0265338_10034309 | 3300028800 | Bacteria | 4907 |
| 726 | Ga0316182_1350289 | 3300030745 | Bacteria | 3294 |
| 727 | Ga0265331_10003188 | 3300031250 | Bacteria | 10707 |
| 728 | Ga0265327_10000500 | 3300031251 | Bacteria | 68037 |
| 729 | Ga0265327_10001333 | 3300031251 | Bacteria | 31995 |
| 730 | Ga0265313_10000162 | 3300031595 | Bacteria | 70036 |
| 731 | Ga0265313_10033163 | 3300031595 | Bacteria | 2628 |
| 732 | Ga0307508_10014185 | 3300031616 | Bacteria | 7268 |
| 733 | Ga0307508_10213891 | 3300031616 | Bacteria | 1528 |
| 734 | Ga0316575_10018924 | 3300031665 | Bacteria | 2629 |
| 735 | Ga0316579_10000127 | 3300031691 | Bacteria | 21020 |
| 736 | Ga0316579_10001922 | 3300031691 | Bacteria | 7730 |
| 737 | Ga0307516_10069184 | 3300031730 | Bacteria | 3396 |
| 738 | Ga0307516_10087115 | 3300031730 | Bacteria | 2958 |
| 739 | Ga0307516_10150849 | 3300031730 | Bacteria | 2085 |
| 740 | Ga0307405_10066047 | 3300031731 | Bacteria | 2305 |
| 741 | Ga0307413_10006336 | 3300031824 | Bacteria | 5390 |
| 742 | Ga0307412_10000742 | 3300031911 | Bacteria | 18877 |
| 743 | Ga0307412_10041311 | 3300031911 | Bacteria | 2988 |
| 744 | Ga0307416_100594611 | 3300032002 | Bacteria | 1185 |
| 745 | Ga0316583_10001627 | 3300032133 | Bacteria | 7596 |
| 746 | Ga0307510_10002000 | 3300033180 | Bacteria | 22982 |
| 747 | Ga0316592_1029401 | 3300033524 | Bacteria | 1192 |
| 748 | Ga0316586_1025071 | 3300033527 | Bacteria | 1003 |
| 749 | Ga0316587_1015858 | 3300033529 | Bacteria | 1253 |
| 750 | Ga0316587_1031953 | 3300033529 | Bacteria | 932 |
| 751 | Ga0316596_1035459 | 3300033541 | Bacteria | 1304 |
| 752 | Ga0373959_0031804 | 3300034820 | Bacteria | 1069 |
| 753 | Ga0373955_0053755 | 3300035172 | Bacteria | 2200 |
| 754 | Ga0316574_0091334 | 3300035398 | Bacteria | 1941 |
| 755 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 756 | Ga0373937_0090575 | 3300036401 | Bacteria | 2832 |
| 757 | Ga0373937_0250803 | 3300036401 | Bacteria | 1669 |
| 758 | Ga0316582_0211423 | 3300036647 | Bacteria | 1325 |
| 759 | Ga0316582_0390258 | 3300036647 | Bacteria | 959 |
| 760 | Ga0316584_0109850 | 3300036712 | Bacteria | 2063 |
| 761 | Ga0316584_0373124 | 3300036712 | Bacteria | 1021 |
| 762 | Ga0373925_0614278 | 3300037068 | Bacteria | 896 |
| 763 | Ga0395899_0000081 | 3300037312 | Bacteria | 169527 |
| 764 | Ga0395899_0006004 | 3300037312 | Bacteria | 9429 |
| 765 | Ga0395899_0014586 | 3300037312 | Bacteria | 5998 |
| 766 | Ga0395899_0028107 | 3300037312 | Bacteria | 4236 |
| 767 | Ga0395899_0070636 | 3300037312 | Bacteria | 2555 |
| 768 | Ga0395899_0316559 | 3300037312 | Bacteria | 1052 |
| 769 | Ga0395900_0000024 | 3300037418 | Bacteria | 323480 |
| 770 | Ga0395900_0000078 | 3300037418 | Bacteria | 179292 |
| 771 | Ga0395900_0001276 | 3300037418 | Bacteria | 30788 |
| 772 | Ga0395900_0005061 | 3300037418 | Bacteria | 13832 |
| 773 | Ga0395900_0011285 | 3300037418 | Bacteria | 9138 |
| 774 | Ga0395900_0063005 | 3300037418 | Bacteria | 3811 |
| 775 | Ga0395900_0108085 | 3300037418 | Bacteria | 2858 |
| 776 | Ga0395900_0128419 | 3300037418 | Bacteria | 2598 |
| 777 | Ga0395900_0208825 | 3300037418 | Bacteria | 1972 |
| 778 | Ga0395898_0000044 | 3300037466 | Bacteria | 298164 |
| 779 | Ga0395898_0000202 | 3300037466 | Bacteria | 153541 |
| 780 | Ga0395898_0001760 | 3300037466 | Bacteria | 28357 |
| 781 | Ga0395898_0052238 | 3300037466 | Bacteria | 3992 |
| 782 | Ga0395905_0034294 | 3300037471 | Bacteria | 4766 |
| 783 | Ga0395901_0005913 | 3300038443 | Bacteria | 12389 |
| 784 | Ga0395901_0007079 | 3300038443 | Bacteria | 11337 |
| 785 | Ga0395901_0010379 | 3300038443 | Bacteria | 9433 |
| 786 | Ga0395901_0012449 | 3300038443 | Bacteria | 8633 |
| 787 | Ga0395901_0056302 | 3300038443 | Bacteria | 4090 |
| 788 | Ga0395901_0152125 | 3300038443 | Bacteria | 2431 |
| 789 | Ga0395901_0181235 | 3300038443 | Bacteria | 2209 |
| 790 | Ga0400483_046643 | 3300039062 | Bacteria | 24808 |
| 791 | Ga0400483_151143 | 3300039062 | Bacteria | 268199 |
| 792 | Ga0436365_1036717 | 3300039437 | Bacteria | 5287 |
| 793 | Ga0451802_0889336 | 3300041460 | Bacteria | 7740 |
| 794 | Ga0451802_1175688 | 3300041460 | Bacteria | 1092 |
| 795 | Ga0439437_004284 | 3300042000 | Bacteria | 1554 |
| 796 | Ga0439449_0004409 | 3300042007 | Bacteria | 5427 |
| 797 | Ga0439452_021907 | 3300042010 | Bacteria | 1659 |
| 798 | Ga0450908_000064 | 3300042184 | Bacteria | 21022 |
| 799 | Ga0439459_0001247 | 3300042438 | Bacteria | 3720 |
| 800 | Ga0451577_0003066 | 3300042876 | Bacteria | 18912 |
| 801 | Ga0451577_0031744 | 3300042876 | Bacteria | 4765 |
| 802 | Ga0451577_0121487 | 3300042876 | Bacteria | 2340 |
| 803 | Ga0451577_0206686 | 3300042876 | Bacteria | 1773 |
| 804 | Ga0466969_0003293 | 3300044656 | Bacteria | 8583 |
| 805 | Ga0466969_0008841 | 3300044656 | Bacteria | 5341 |
| 806 | Ga0466972_0002309 | 3300044658 | Bacteria | 9385 |
| 807 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 808 | Ga0466965_0002052 | 3300044683 | Bacteria | 8434 |
| 809 | Ga0466966_0015591 | 3300044684 | Bacteria | 5022 |
| 810 | Ga0466961_0000222 | 3300044693 | Bacteria | 38729 |
| 811 | Ga0466961_0001720 | 3300044693 | Bacteria | 13614 |
| 812 | Ga0466961_0003929 | 3300044693 | Bacteria | 9295 |
| 813 | Ga0466961_0038099 | 3300044693 | Bacteria | 3084 |
| 814 | Ga0466961_0078030 | 3300044693 | Bacteria | 2097 |
| 815 | Ga0453684_0000531 | 3300044712 | Bacteria | 145390 |
| 816 | Ga0453684_0276463 | 3300044712 | Bacteria | 1917 |
| 817 | Ga0466971_0001919 | 3300044719 | Bacteria | 8823 |
| 818 | Ga0466971_0002827 | 3300044719 | Bacteria | 7356 |
| 819 | Ga0466971_0018573 | 3300044719 | Bacteria | 3081 |
| 820 | Ga0466970_0000290 | 3300044765 | Bacteria | 24566 |
| 821 | Ga0466970_0002155 | 3300044765 | Bacteria | 9503 |
| 822 | Ga0466970_0107035 | 3300044765 | Bacteria | 1525 |
| 823 | Ga0466957_0002693 | 3300044842 | Bacteria | 9602 |
| 824 | Ga0466957_0002909 | 3300044842 | Bacteria | 9282 |
| 825 | Ga0466957_0144185 | 3300044842 | Bacteria | 1536 |
| 826 | Ga0466959_0000547 | 3300045049 | Bacteria | 21921 |
| 827 | Ga0466959_0023313 | 3300045049 | Bacteria | 4580 |
| 828 | Ga0466959_0046527 | 3300045049 | Bacteria | 3192 |
| 829 | Ga0466959_0062767 | 3300045049 | Bacteria | 2699 |
| 830 | Ga0451576_0000212 | 3300045051 | Bacteria | 145396 |
| 831 | Ga0466958_0021914 | 3300045836 | Bacteria | 3736 |
| 832 | Ga0495617_000081 | 3300046452 | Bacteria | 74014 |
| 833 | Ga0495617_000279 | 3300046452 | Bacteria | 29542 |
| 834 | Ga0495629_0245655 | 3300046459 | Bacteria | 1232 |
| 835 | Ga0495638_0000090 | 3300046460 | Bacteria | 148040 |
| 836 | Ga0495638_0000864 | 3300046460 | Bacteria | 31474 |
| 837 | Ga0495638_0000993 | 3300046460 | Bacteria | 28493 |
| 838 | Ga0495638_0001310 | 3300046460 | Bacteria | 23011 |
| 839 | Ga0495638_0011315 | 3300046460 | Bacteria | 6149 |
| 840 | Ga0495650_0000665 | 3300046471 | Bacteria | 44844 |
| 841 | Ga0495650_0001127 | 3300046471 | Bacteria | 29041 |
| 842 | Ga0495650_0004723 | 3300046471 | Bacteria | 9171 |
| 843 | Ga0495580_0114564 | 3300046472 | Bacteria | 1872 |
| 844 | Ga0495664_0166551 | 3300046477 | Bacteria | 1337 |
| 845 | Ga0495584_0000221 | 3300046491 | Bacteria | 41153 |
| 846 | Ga0495585_0000021 | 3300046492 | Bacteria | 155715 |
| 847 | Ga0495585_0002001 | 3300046492 | Bacteria | 15119 |
| 848 | Ga0495607_0000067 | 3300046501 | Bacteria | 102663 |
| 849 | Ga0495607_0000180 | 3300046501 | Bacteria | 67139 |
| 850 | Ga0495607_0007555 | 3300046501 | Bacteria | 7503 |
| 851 | Ga0495607_0149489 | 3300046501 | Bacteria | 1197 |
| 852 | Ga0495607_0182394 | 3300046501 | Bacteria | 1051 |
| 853 | Ga0495583_0029686 | 3300046506 | Bacteria | 2672 |
| 854 | Ga0495606_0002156 | 3300046507 | Bacteria | 23692 |
| 855 | Ga0495606_0003424 | 3300046507 | Bacteria | 16840 |
| 856 | Ga0495606_0005863 | 3300046507 | Bacteria | 11577 |
| 857 | Ga0495606_0008526 | 3300046507 | Bacteria | 8884 |
| 858 | Ga0495606_0034412 | 3300046507 | Bacteria | 3479 |
| 859 | Ga0495610_0002152 | 3300046512 | Bacteria | 16754 |
| 860 | Ga0495610_0017747 | 3300046512 | Bacteria | 4047 |
| 861 | Ga0495616_0000051 | 3300046513 | Bacteria | 106797 |
| 862 | Ga0495620_0000233 | 3300046515 | Bacteria | 41630 |
| 863 | Ga0495631_0000030 | 3300046518 | Bacteria | 86492 |
| 864 | Ga0495631_0000174 | 3300046518 | Bacteria | 43807 |
| 865 | Ga0495632_0000059 | 3300046519 | Bacteria | 121437 |
| 866 | Ga0495632_0003326 | 3300046519 | Bacteria | 11459 |
| 867 | Ga0495632_0028153 | 3300046519 | Bacteria | 2935 |
| 868 | Ga0495648_0001263 | 3300046524 | Bacteria | 25223 |
| 869 | Ga0495648_0001702 | 3300046524 | Bacteria | 21264 |
| 870 | Ga0495663_0005052 | 3300046525 | Bacteria | 3686 |
| 871 | Ga0495609_0003492 | 3300046538 | Bacteria | 8982 |
| 872 | Ga0495621_0000318 | 3300046539 | Bacteria | 11661 |
| 873 | Ga0495645_0033484 | 3300046543 | Bacteria | 3749 |
| 874 | Ga0495622_0002827 | 3300046557 | Bacteria | 8285 |
| 875 | Ga0495633_0018139 | 3300046558 | Bacteria | 3579 |
| 876 | Ga0495656_0017250 | 3300046615 | Bacteria | 2753 |
| 877 | Ga0495656_0021796 | 3300046615 | Bacteria | 2499 |
| 878 | Ga0495668_0009167 | 3300046616 | Bacteria | 6096 |
| 879 | Ga0495611_0000002 | 3300046648 | Bacteria | 705677 |
| 880 | Ga0495611_0000032 | 3300046648 | Bacteria | 110000 |
| 881 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 882 | Ga0495625_0021596 | 3300046660 | Bacteria | 4952 |
| 883 | Ga0495625_0025382 | 3300046660 | Bacteria | 4496 |
| 884 | Ga0495635_0058411 | 3300046663 | Bacteria | 2654 |
| 885 | Ga0495661_0001129 | 3300046665 | Bacteria | 23341 |
| 886 | Ga0495588_0211156 | 3300046674 | Bacteria | 1025 |
| 887 | Ga0495623_0188615 | 3300046679 | Bacteria | 1193 |
| 888 | Ga0495658_0057844 | 3300046683 | Bacteria | 2216 |
| 889 | Ga0495670_0004265 | 3300046691 | Bacteria | 7002 |
| 890 | Ga0495670_0041807 | 3300046691 | Bacteria | 2287 |
| 891 | Ga0495670_0049770 | 3300046691 | Bacteria | 2097 |
| 892 | Ga0495671_0000183 | 3300046692 | Bacteria | 55588 |
| 893 | Ga0495649_0002519 | 3300046694 | Bacteria | 12861 |
| 894 | Ga0495649_0112881 | 3300046694 | Bacteria | 1440 |
| 895 | Ga0495589_0000140 | 3300046794 | Bacteria | 66538 |
| 896 | Ga0495660_0000144 | 3300046810 | Bacteria | 77040 |
| 897 | Ga0495660_0000370 | 3300046810 | Bacteria | 39413 |
| 898 | Ga0495636_0005385 | 3300047318 | Bacteria | 5028 |
| 899 | Ga0495636_0012769 | 3300047318 | Bacteria | 3327 |
| 900 | Ga0495636_0016374 | 3300047318 | Bacteria | 2961 |
| 901 | Ga0495683_0000879 | 3300047323 | Bacteria | 21211 |
| 902 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 903 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 904 | Ga0495673_0000310 | 3300047469 | Bacteria | 64112 |
| 905 | Ga0495673_0000576 | 3300047469 | Bacteria | 36971 |
| 906 | Ga0495684_0282187 | 3300047471 | Bacteria | 1198 |
| 907 | Ga0495686_0000024 | 3300047472 | Bacteria | 400343 |
| 908 | Ga0495686_0001292 | 3300047472 | Bacteria | 28233 |
| 909 | Ga0496100_0214077 | 3300048903 | Bacteria | 1411 |
| 910 | Ga0496101_0007212 | 3300048904 | Bacteria | 7195 |
| 911 | Ga0496102_0122150 | 3300048905 | Bacteria | 2433 |
| 912 | Ga0496102_0548961 | 3300048905 | Bacteria | 1078 |
| 913 | Ga0496103_0193809 | 3300048906 | Bacteria | 1306 |
| 914 | Ga0496103_0256613 | 3300048906 | Bacteria | 1125 |
| 915 | Ga0496103_0415265 | 3300048906 | Bacteria | 864 |
| 916 | Ga0496104_0000005 | 3300048907 | Bacteria | 620360 |
| 917 | Ga0496104_0384930 | 3300048907 | Bacteria | 1315 |
| 918 | Ga0496105_0000084 | 3300048908 | Bacteria | 67834 |
| 919 | Ga0496106_0004620 | 3300048909 | Bacteria | 10214 |
| 920 | Ga0496106_0245959 | 3300048909 | Bacteria | 1429 |
| 921 | Ga0496107_0141975 | 3300048910 | Bacteria | 1775 |
| 922 | Ga0496108_0026306 | 3300048911 | Bacteria | 4798 |
| 923 | Ga0496114_0148213 | 3300048917 | Bacteria | 2035 |
| 924 | Ga0496115_0000002 | 3300048918 | Bacteria | 365286 |
| 925 | Ga0496115_0000656 | 3300048918 | Bacteria | 25825 |
| 926 | Ga0496115_0001959 | 3300048918 | Bacteria | 14695 |
| 927 | Ga0496115_0015375 | 3300048918 | Bacteria | 5804 |
| 928 | Ga0496116_0005410 | 3300048919 | Bacteria | 11874 |
| 929 | Ga0496117_0008734 | 3300048920 | Bacteria | 9571 |
| 930 | Ga0496117_0012451 | 3300048920 | Bacteria | 7493 |
| 931 | Ga0496117_0023978 | 3300048920 | Bacteria | 4843 |
| 932 | Ga0496117_0082968 | 3300048920 | Bacteria | 2097 |
| 933 | Ga0496118_0000274 | 3300048921 | Bacteria | 90649 |
| 934 | Ga0496118_0000506 | 3300048921 | Bacteria | 64566 |
| 935 | Ga0496118_0003013 | 3300048921 | Bacteria | 21759 |
| 936 | Ga0496118_0005279 | 3300048921 | Bacteria | 14746 |
| 937 | Ga0496118_0007012 | 3300048921 | Bacteria | 12137 |
| 938 | Ga0496118_0023225 | 3300048921 | Bacteria | 5392 |
| 939 | Ga0496118_0053820 | 3300048921 | Bacteria | 3054 |
| 940 | Ga0496119_0001163 | 3300048922 | Bacteria | 32910 |
| 941 | Ga0496119_0015604 | 3300048922 | Bacteria | 5834 |
| 942 | Ga0496120_0000110 | 3300048923 | Bacteria | 137494 |
| 943 | Ga0496120_0002377 | 3300048923 | Bacteria | 19203 |
| 944 | Ga0496121_0000096 | 3300048924 | Bacteria | 207449 |
| 945 | Ga0496121_0001317 | 3300048924 | Bacteria | 42556 |
| 946 | Ga0496121_0019979 | 3300048924 | Bacteria | 6664 |
| 947 | Ga0496121_0123777 | 3300048924 | Bacteria | 1948 |
| 948 | Ga0496122_0000136 | 3300048925 | Bacteria | 170671 |
| 949 | Ga0496122_0014555 | 3300048925 | Bacteria | 7595 |
| 950 | Ga0496122_0028316 | 3300048925 | Bacteria | 4759 |
| 951 | Ga0496122_0114697 | 3300048925 | Bacteria | 1757 |
| 952 | Ga0496123_0000733 | 3300048926 | Bacteria | 53230 |
| 953 | Ga0496123_0005861 | 3300048926 | Bacteria | 12168 |
| 954 | Ga0496123_0012400 | 3300048926 | Bacteria | 7272 |
| 955 | Ga0496123_0031893 | 3300048926 | Bacteria | 3825 |
| 956 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 957 | Ga0496124_0000223 | 3300048927 | Bacteria | 110726 |
| 958 | Ga0496124_0000231 | 3300048927 | Bacteria | 109077 |
| 959 | Ga0496124_0032107 | 3300048927 | Bacteria | 4643 |
| 960 | Ga0496125_0000647 | 3300048928 | Bacteria | 58140 |
| 961 | Ga0496125_0010458 | 3300048928 | Bacteria | 9383 |
| 962 | Ga0496125_0073108 | 3300048928 | Bacteria | 2668 |
| 963 | Ga0496126_0000052 | 3300048929 | Bacteria | 312383 |
| 964 | Ga0496126_0002686 | 3300048929 | Bacteria | 23501 |
| 965 | Ga0496126_0014510 | 3300048929 | Bacteria | 7962 |
| 966 | Ga0496126_0141435 | 3300048929 | Bacteria | 2071 |
| 967 | Ga0496126_0421105 | 3300048929 | Bacteria | 1079 |
| 968 | Ga0495678_000026 | 3300049459 | Bacteria | 226978 |
| 969 | Ga0495678_025883 | 3300049459 | Bacteria | 2513 |
| 970 | Ga0495682_0001797 | 3300049460 | Bacteria | 10821 |
| 971 | Ga0501031_0009284 | 3300049568 | Bacteria | 6391 |
| 972 | Ga0501031_0016300 | 3300049568 | Bacteria | 4825 |
| 973 | Ga0501031_0029107 | 3300049568 | Bacteria | 3603 |
| 974 | Ga0501031_0033744 | 3300049568 | Bacteria | 3340 |
| 975 | Ga0501032_0000678 | 3300049569 | Bacteria | 27681 |
| 976 | Ga0501032_0013499 | 3300049569 | Bacteria | 5808 |
| 977 | Ga0501032_0016748 | 3300049569 | Bacteria | 5150 |
| 978 | Ga0501032_0058353 | 3300049569 | Bacteria | 2591 |
| 979 | Ga0501032_0066967 | 3300049569 | Bacteria | 2400 |
| 980 | Ga0501033_0000755 | 3300049570 | Bacteria | 29773 |
| 981 | Ga0501033_0054174 | 3300049570 | Bacteria | 2968 |
| 982 | Ga0501033_0056767 | 3300049570 | Bacteria | 2893 |
| 983 | Ga0501033_0066229 | 3300049570 | Bacteria | 2656 |
| 984 | Ga0501033_0087244 | 3300049570 | Bacteria | 2284 |
| 985 | Ga0501034_0000688 | 3300049571 | Bacteria | 51342 |
| 986 | Ga0501034_0001482 | 3300049571 | Bacteria | 30999 |
| 987 | Ga0501034_0007644 | 3300049571 | Bacteria | 11497 |
| 988 | Ga0501034_0007651 | 3300049571 | Bacteria | 11495 |
| 989 | Ga0501034_0009926 | 3300049571 | Bacteria | 9948 |
| 990 | Ga0501034_0016057 | 3300049571 | Bacteria | 7683 |
| 991 | Ga0501034_0034650 | 3300049571 | Bacteria | 5119 |
| 992 | Ga0501036_0045034 | 3300049572 | Bacteria | 3738 |
| 993 | Ga0501036_0095511 | 3300049572 | Bacteria | 2513 |
| 994 | Ga0501036_0115260 | 3300049572 | Bacteria | 2270 |
| 995 | Ga0501037_0001436 | 3300049573 | Bacteria | 17488 |
| 996 | Ga0501037_0019719 | 3300049573 | Bacteria | 4974 |
| 997 | Ga0501037_0077025 | 3300049573 | Bacteria | 2420 |
| 998 | Ga0501038_0017639 | 3300049574 | Bacteria | 6451 |
| 999 | Ga0501038_0028916 | 3300049574 | Bacteria | 4918 |
| 1000 | Ga0501038_0148372 | 3300049574 | Bacteria | 1913 |
| 1001 | Ga0501038_0308053 | 3300049574 | Bacteria | 1241 |
| 1002 | Ga0501039_0015122 | 3300049575 | Bacteria | 5904 |
| 1003 | Ga0501043_0007285 | 3300049579 | Bacteria | 8783 |
| 1004 | Ga0501043_0011545 | 3300049579 | Bacteria | 6916 |
| 1005 | Ga0501043_0022960 | 3300049579 | Bacteria | 4891 |
| 1006 | Ga0501043_0052698 | 3300049579 | Bacteria | 3195 |
| 1007 | Ga0501043_0079632 | 3300049579 | Bacteria | 2574 |
| 1008 | Ga0501043_0238484 | 3300049579 | Bacteria | 1403 |
| 1009 | Ga0501043_0341184 | 3300049579 | Bacteria | 1139 |
| 1010 | Ga0501046_0001087 | 3300049580 | Bacteria | 26659 |
| 1011 | Ga0501046_0004875 | 3300049580 | Bacteria | 12090 |
| 1012 | Ga0501046_0007538 | 3300049580 | Bacteria | 9545 |
| 1013 | Ga0501046_0051959 | 3300049580 | Bacteria | 3232 |
| 1014 | Ga0501046_0087808 | 3300049580 | Bacteria | 2395 |
| 1015 | Ga0501047_0000580 | 3300049581 | Bacteria | 38921 |
| 1016 | Ga0501047_0001659 | 3300049581 | Bacteria | 21645 |
| 1017 | Ga0501047_0002225 | 3300049581 | Bacteria | 18570 |
| 1018 | Ga0501047_0017698 | 3300049581 | Bacteria | 6827 |
| 1019 | Ga0501047_0019254 | 3300049581 | Bacteria | 6548 |
| 1020 | Ga0501047_0020797 | 3300049581 | Bacteria | 6303 |
| 1021 | Ga0501047_0021662 | 3300049581 | Bacteria | 6171 |
| 1022 | Ga0501047_0031601 | 3300049581 | Bacteria | 5107 |
| 1023 | Ga0501047_0046307 | 3300049581 | Bacteria | 4203 |
| 1024 | Ga0501047_0072126 | 3300049581 | Bacteria | 3324 |
| 1025 | Ga0501047_0106662 | 3300049581 | Bacteria | 2682 |
| 1026 | Ga0501047_0111347 | 3300049581 | Bacteria | 2620 |
| 1027 | Ga0501048_0014036 | 3300049582 | Bacteria | 5938 |
| 1028 | Ga0501048_0018118 | 3300049582 | Bacteria | 5181 |
| 1029 | Ga0501048_0022809 | 3300049582 | Bacteria | 4577 |
| 1030 | Ga0501048_0251326 | 3300049582 | Bacteria | 1255 |
| 1031 | Ga0501067_0002108 | 3300049583 | Bacteria | 10959 |
| 1032 | Ga0501067_0009740 | 3300049583 | Bacteria | 5318 |
| 1033 | Ga0501068_0058465 | 3300049584 | Bacteria | 2339 |
| 1034 | Ga0501068_0181585 | 3300049584 | Bacteria | 1330 |
| 1035 | Ga0501069_0000665 | 3300049585 | Bacteria | 15959 |
| 1036 | Ga0501069_0025354 | 3300049585 | Bacteria | 3240 |
| 1037 | Ga0501069_0041817 | 3300049585 | Bacteria | 2534 |
| 1038 | Ga0501069_0100398 | 3300049585 | Bacteria | 1642 |
| 1039 | Ga0501069_0101872 | 3300049585 | Bacteria | 1630 |
| 1040 | Ga0501069_0119223 | 3300049585 | Bacteria | 1506 |
| 1041 | Ga0501070_0002275 | 3300049586 | Bacteria | 16886 |
| 1042 | Ga0501070_0003593 | 3300049586 | Bacteria | 13408 |
| 1043 | Ga0501070_0003908 | 3300049586 | Bacteria | 12859 |
| 1044 | Ga0501070_0005647 | 3300049586 | Bacteria | 10669 |
| 1045 | Ga0501070_0007223 | 3300049586 | Bacteria | 9431 |
| 1046 | Ga0501070_0010640 | 3300049586 | Bacteria | 7776 |
| 1047 | Ga0501070_0014304 | 3300049586 | Bacteria | 6679 |
| 1048 | Ga0501070_0040710 | 3300049586 | Bacteria | 3874 |
| 1049 | Ga0501070_0101535 | 3300049586 | Bacteria | 2379 |
| 1050 | Ga0501070_0127329 | 3300049586 | Bacteria | 2104 |
| 1051 | Ga0501071_0041156 | 3300049587 | Bacteria | 3309 |
| 1052 | Ga0501072_0000602 | 3300049588 | Bacteria | 25926 |
| 1053 | Ga0501073_0001527 | 3300049589 | Bacteria | 17139 |
| 1054 | Ga0501073_0011295 | 3300049589 | Bacteria | 6533 |
| 1055 | Ga0501073_0012620 | 3300049589 | Bacteria | 6164 |
| 1056 | Ga0501073_0021218 | 3300049589 | Bacteria | 4682 |
| 1057 | Ga0501073_0022213 | 3300049589 | Bacteria | 4572 |
| 1058 | Ga0501073_0053591 | 3300049589 | Bacteria | 2823 |
| 1059 | Ga0501073_0054062 | 3300049589 | Bacteria | 2812 |
| 1060 | Ga0501073_0102407 | 3300049589 | Bacteria | 1988 |
| 1061 | Ga0501074_0005683 | 3300049590 | Bacteria | 8984 |
| 1062 | Ga0501074_0012997 | 3300049590 | Bacteria | 6051 |
| 1063 | Ga0501074_0036535 | 3300049590 | Bacteria | 3558 |
| 1064 | Ga0501074_0046043 | 3300049590 | Bacteria | 3154 |
| 1065 | Ga0501074_0047228 | 3300049590 | Bacteria | 3112 |
| 1066 | Ga0501207_009352 | 3300049654 | Bacteria | 1431 |
| 1067 | Ga0501249_021011 | 3300049679 | Bacteria | 1423 |
| 1068 | Ga0501079_0373150 | 3300049741 | Bacteria | 1118 |
| 1069 | Ga0501080_0000763 | 3300049742 | Bacteria | 26129 |
| 1070 | Ga0501080_0001364 | 3300049742 | Bacteria | 20418 |
| 1071 | Ga0501080_0001456 | 3300049742 | Bacteria | 19921 |
| 1072 | Ga0501080_0007137 | 3300049742 | Bacteria | 10084 |
| 1073 | Ga0501080_0008805 | 3300049742 | Bacteria | 9173 |
| 1074 | Ga0501080_0009911 | 3300049742 | Bacteria | 8705 |
| 1075 | Ga0501080_0012256 | 3300049742 | Bacteria | 7854 |
| 1076 | Ga0501080_0049113 | 3300049742 | Bacteria | 3927 |
| 1077 | Ga0501080_0058838 | 3300049742 | Bacteria | 3576 |
| 1078 | Ga0501080_0151652 | 3300049742 | Bacteria | 2142 |
| 1079 | Ga0501081_0084130 | 3300049743 | Bacteria | 2231 |
| 1080 | Ga0501083_0001017 | 3300049744 | Bacteria | 18677 |
| 1081 | Ga0501083_0006358 | 3300049744 | Bacteria | 8373 |
| 1082 | Ga0501265_000466 | 3300049762 | Bacteria | 4259 |
| 1083 | Ga0501270_008718 | 3300049767 | Bacteria | 1291 |
| 1084 | Ga0501275_000025 | 3300049772 | Bacteria | 16584 |
| 1085 | Ga0501035_0004757 | 3300049822 | Bacteria | 12891 |
| 1086 | Ga0501035_0010342 | 3300049822 | Bacteria | 8652 |
| 1087 | Ga0501035_0011465 | 3300049822 | Bacteria | 8219 |
| 1088 | Ga0501035_0012372 | 3300049822 | Bacteria | 7887 |
| 1089 | Ga0501035_0020421 | 3300049822 | Bacteria | 6083 |
| 1090 | Ga0501035_0024924 | 3300049822 | Bacteria | 5485 |
| 1091 | Ga0501035_0044032 | 3300049822 | Bacteria | 4021 |
| 1092 | Ga0501035_0130040 | 3300049822 | Bacteria | 2195 |
| 1093 | Ga0501044_0007246 | 3300049823 | Bacteria | 12193 |
| 1094 | Ga0501044_0008572 | 3300049823 | Bacteria | 11199 |
| 1095 | Ga0501044_0009608 | 3300049823 | Bacteria | 10525 |
| 1096 | Ga0501044_0011110 | 3300049823 | Bacteria | 9767 |
| 1097 | Ga0501044_0018543 | 3300049823 | Bacteria | 7457 |
| 1098 | Ga0501044_0024616 | 3300049823 | Bacteria | 6387 |
| 1099 | Ga0501044_0028366 | 3300049823 | Bacteria | 5909 |
| 1100 | Ga0501044_0029309 | 3300049823 | Bacteria | 5804 |
| 1101 | Ga0501044_0076191 | 3300049823 | Bacteria | 3405 |
| 1102 | Ga0501044_0085541 | 3300049823 | Bacteria | 3186 |
| 1103 | Ga0501044_0100747 | 3300049823 | Bacteria | 2906 |
| 1104 | Ga0501044_0163974 | 3300049823 | Bacteria | 2197 |
| 1105 | nmdc:mga00v17_215_c1 | 3300050491 | Bacteria | 34819 |
| 1106 | nmdc:mga08y16_299301_c1 | 3300050511 | Bacteria | 1658 |
| 1107 | nmdc:mga0sz30_56391_c1 | 3300050516 | Bacteria | 1673 |
| 1108 | Ga0500643_000031 | 3300053087 | Bacteria | 204488 |
| 1109 | Ga0500643_002977 | 3300053087 | Bacteria | 8390 |
| 1110 | Ga0500651_0000113 | 3300053093 | Bacteria | 49604 |
| 1111 | Ga0500651_0001194 | 3300053093 | Bacteria | 12890 |
| 1112 | Ga0500555_000300 | 3300053103 | Bacteria | 21325 |
| 1113 | Ga0500597_000195 | 3300053120 | Bacteria | 12461 |
| 1114 | Ga0500568_0001305 | 3300053139 | Bacteria | 16371 |
| 1115 | Ga0500634_0000182 | 3300053161 | Bacteria | 20828 |
| 1116 | Ga0500645_000965 | 3300053730 | Bacteria | 16337 |
| 1117 | Ga0500645_044407 | 3300053730 | Bacteria | 1307 |
| 1118 | Ga0501084_0033367 | 3300054114 | Bacteria | 4307 |
| 1119 | Ga0501084_0161389 | 3300054114 | Bacteria | 1891 |
| 1120 | Ga0587084_018696 | 3300059477 | Bacteria | 1014 |
| 1121 | Ga0587073_0049003 | 3300059492 | Bacteria | 951 |
| 1122 | Ga0587085_019047 | 3300059506 | Bacteria | 1025 |
| 1123 | Ga0587088_027191 | 3300059508 | Bacteria | 998 |
| 1124 | Ga0587088_033105 | 3300059508 | Bacteria | 935 |
| 1125 | Ga0587090_019932 | 3300059510 | Bacteria | 1039 |
| 1126 | Ga0587109_035462 | 3300059624 | Bacteria | 967 |
| 1127 | Ga0587115_013587 | 3300059626 | Bacteria | 1056 |
| 1128 | Ga0587128_023747 | 3300059630 | Bacteria | 964 |
| 1129 | Ga0587130_005438 | 3300059631 | Bacteria | 1142 |
| 1130 | Ga0587062_011668 | 3300059639 | Bacteria | 1113 |
| 1131 | Ga0587068_026592 | 3300059641 | Bacteria | 980 |
| 1132 | Ga0587072_035781 | 3300059643 | Bacteria | 947 |
| 1133 | Ga0587114_016948 | 3300059655 | Bacteria | 982 |
| 1134 | Ga0587120_005274 | 3300059659 | Bacteria | 988 |
| 1135 | Ga0587111_0046351 | 3300060346 | Bacteria | 945 |
| 1136 | Ga0501082_0000044 | 3300060353 | Bacteria | 86405 |
| 1137 | Ga0501082_0033187 | 3300060353 | Bacteria | 4453 |
| 1138 | Ga0501082_0182779 | 3300060353 | Bacteria | 1824 |
| 1139 | Ga0466962_0003700 | 3300061719 | Bacteria | 7293 |
| 1140 | Ga0466962_0006846 | 3300061719 | Bacteria | 5467 |
| 1141 | Ga0466962_0149004 | 3300061719 | Bacteria | 1135 |
| 1142 | 2538834074 | 2537561836 | Bacteria | 3910579 |
| 1143 | 2572254198 | 2571042365 | Bacteria | 3289345 |
| 1144 | 2595447594 | 2593339238 | Bacteria | 4182970 |
| 1145 | 2595452902 | 2593339239 | Bacteria | 4124669 |
| 1146 | 2643829002 | 2643221562 | Bacteria | 4048635 |
| 1147 | 2643895821 | 2643221577 | Bacteria | 3710843 |
| 1148 | 2644478013 | 2643221685 | Bacteria | 3673288 |
| 1149 | 2644528050 | 2643221695 | Bacteria | 3441323 |
| 1150 | 2687584630 | 2687453130 | Bacteria | 4227172 |
| 1151 | 2721025619 | 2718218334 | Bacteria | 4765486 |
| 1152 | 2735834415 | 2734482264 | Unclassified | 5014763 |
| 1153 | 2739225861 | 2738543009 | Bacteria | 4944499 |
| 1154 | 2739733951 | 2739367700 | Bacteria | 4747630 |
| 1155 | 2819564903 | 2818991440 | Bacteria | 4774720 |
| 1156 | 2842782487 | 2842780639 | Bacteria | 4337790 |
| 1157 | 2842917297 | 2842914999 | Bacteria | 4419378 |
| 1158 | 2842920837 | 2842918807 | Bacteria | 4289178 |
| 1159 | 2852651900 | 2852649853 | Bacteria | 4036942 |
| 1160 | 2884338955 | 2884338543 | Bacteria | 4610696 |
| 1161 | 2895395990 | 2895395659 | Bacteria | 3983269 |
| 1162 | 2904465576 | 2904463128 | Bacteria | 4775606 |
| 1163 | 2919086351 | 2919085039 | Bacteria | 4532964 |
| 1164 | 2919407739 | 2919404418 | Bacteria | 4232372 |
| 1165 | 2928966113 | 2928963466 | Bacteria | 5165703 |
| 1166 | 2939613262 | 2939611941 | Bacteria | 3892017 |
| 1167 | 2941473270 | 2941471342 | Bacteria | 5018624 |
| 1168 | 2953996115 | 2953994433 | Bacteria | 4303959 |
| 1169 | 8003017805 | 8003014200 | Bacteria | 4059994 |
| 1170 | Ga0070691_10011384 | |||
| 1171 | JGI24736J21556_1005833 | |||
| 1172 | JGI24741J21665_1001431 | |||
| 1173 | JGI24741J21665_1002991 | |||
| 1174 | JGI24741J21665_1008614 | |||
| 1175 | JGI24740J21852_10001314 | |||
| 1176 | JGI24740J21852_10001573 | |||
| 1177 | JGI24740J21852_10028364 | |||
| 1178 | JGI24735J21928_10037679 | |||
| 1179 | JGI24738J21930_10000049 | |||
| 1180 | JGI25156J39149_1006884 | |||
| 1181 | JGI25156J39149_1010192 | |||
| 1182 | JGI25162J39368_1000635 | |||
| 1183 | JGI25162J39368_1001055 | |||
| 1184 | JGI25162J39368_1002694 | |||
| 1185 | JGI25162J39368_1002705 | |||
| 1186 | JGI25154J39366_1008838 | |||
| 1187 | JGI25157J39369_1000353 | |||
| 1188 | JGI25157J39369_1000406 | |||
| 1189 | JGI25157J39369_1000648 | |||
| 1190 | JGI25157J39369_1001436 | |||
| 1191 | JGI25157J39369_1005049 | |||
| 1192 | JGI25163J39215_1000162 | |||
| 1193 | JGI25164J39214_1000122 | |||
| 1194 | JGI25164J39214_1000257 | |||
| 1195 | JGI25164J39214_1000559 | |||
| 1196 | JGI25164J39214_1000707 | |||
| 1197 | JGI25165J46597_1000213 | |||
| 1198 | JGI25165J46597_1000241 | |||
| 1199 | JGI25165J46597_1000466 | |||
| 1200 | JGI25165J46597_1002012 | |||
| 1201 | JGI25153J46596_10006655 | |||
| 1202 | Ga0006770J48903_1011460 | |||
| 1203 | Ga0006777J48905_1098760 | |||
| 1204 | Ga0006556J51387_1021400 | |||
| 1205 | Ga0006560J51390_1024723 | |||
| 1206 | Ga0006554J51385_1022907 | |||
| 1207 | Ga0006554J51385_1025379 | |||
| 1208 | Ga0006562J51391_1003223 | |||
| 1209 | Ga0007429J51699_1039952 | |||
| 1210 | Ga0006780_1001835 | |||
| 1211 | Ga0055538_1001094 | |||
| 1212 | Ga0055533_1001011 | |||
| 1213 | Ga0055525_1000202 | |||
| 1214 | Ga0055527_1000112 | |||
| 1215 | Ga0055527_1000161 | |||
| 1216 | Ga0055527_1002009 | |||
| 1217 | Ga0055535_1000237 | |||
| 1218 | Ga0055535_1000319 | |||
| 1219 | Ga0055535_1000428 | |||
| 1220 | Ga0055535_1000777 | |||
| 1221 | Ga0055535_1001141 | |||
| 1222 | Ga0055542_1000271 | |||
| 1223 | Ga0055542_1000350 | |||
| 1224 | Ga0055542_1000794 | |||
| 1225 | Ga0055542_1001035 | |||
| 1226 | Ga0055542_1001044 | |||
| 1227 | Ga0055542_1001137 | |||
| 1228 | Ga0055529_1000196 | |||
| 1229 | Ga0055529_1000371 | |||
| 1230 | Ga0055529_1000582 | |||
| 1231 | Ga0055529_1000679 | |||
| 1232 | Ga0055530_10009404 | |||
| 1233 | Ga0065165_1000645 | |||
| 1234 | Ga0065165_1009635 | |||
| 1235 | Ga0070676_10120226 | |||
| 1236 | Ga0070683_100015208 | |||
| 1237 | Ga0070683_100074228 | |||
| 1238 | Ga0070683_100103716 | |||
| 1239 | Ga0070690_100063134 | |||
| 1240 | Ga0070670_100071978 | |||
| 1241 | Ga0070670_100089744 | |||
| 1242 | Ga0070670_100102486 | |||
| 1243 | Ga0070670_100137995 | |||
| 1244 | Ga0068869_100051399 | |||
| 1245 | Ga0068869_100070993 | |||
| 1246 | Ga0070666_10000082 | |||
| 1247 | Ga0070666_10038157 | |||
| 1248 | Ga0070666_10263763 | |||
| 1249 | Ga0070680_100000794 | |||
| 1250 | Ga0070680_100024481 | |||
| 1251 | Ga0070680_100224060 | |||
| 1252 | Ga0070680_100271479 | |||
| 1253 | Ga0070680_100310419 | |||
| 1254 | Ga0070682_100039630 | |||
| 1255 | Ga0068868_100131728 | |||
| 1256 | Ga0068868_100325318 | |||
| 1257 | Ga0070660_100084524 | |||
| 1258 | Ga0070689_100038715 | |||
| 1259 | Ga0070689_100264356 | |||
| 1260 | Ga0070691_10022007 | |||
| 1261 | Ga0070661_100020352 | |||
| 1262 | Ga0070661_100031222 | |||
| 1263 | Ga0070661_100068285 | |||
| 1264 | Ga0070661_100168790 | |||
| 1265 | Ga0070661_100208653 | |||
| 1266 | Ga0070661_100285353 | |||
| 1267 | Ga0070661_100324184 | |||
| 1268 | Ga0070661_100408540 | |||
| 1269 | Ga0070661_100457195 | |||
| 1270 | Ga0070692_10005435 | |||
| 1271 | Ga0070692_10008195 | |||
| 1272 | Ga0070668_100004102 | |||
| 1273 | Ga0070668_100371697 | |||
| 1274 | Ga0070669_100234168 | |||
| 1275 | Ga0070675_100114275 | |||
| 1276 | Ga0070671_100052946 | |||
| 1277 | Ga0070671_100222308 | |||
| 1278 | Ga0070673_100135964 | |||
| 1279 | Ga0070673_100252878 | |||
| 1280 | Ga0070659_100016676 | |||
| 1281 | Ga0070659_100023317 | |||
| 1282 | Ga0070659_100166517 | |||
| 1283 | Ga0070659_100299547 | |||
| 1284 | Ga0070667_100007627 | |||
| 1285 | Ga0070667_100018757 | |||
| 1286 | Ga0070667_100066071 | |||
| 1287 | Ga0070667_100068733 | |||
| 1288 | Ga0070667_100093945 | |||
| 1289 | Ga0070667_100105476 | |||
| 1290 | Ga0070714_100000179 | |||
| 1291 | Ga0070714_100023842 | |||
| 1292 | Ga0070713_100000397 | |||
| 1293 | Ga0070713_100066434 | |||
| 1294 | Ga0070711_100015518 | |||
| 1295 | Ga0070663_100000050 | |||
| 1296 | Ga0070663_100282759 | |||
| 1297 | Ga0070678_100033594 | |||
| 1298 | Ga0070678_100204589 | |||
| 1299 | Ga0070662_100000577 | |||
| 1300 | Ga0070681_10000064 | |||
| 1301 | Ga0070681_10000066 | |||
| 1302 | Ga0070681_10012034 | |||
| 1303 | Ga0070681_10024654 | |||
| 1304 | Ga0070681_10226422 | |||
| 1305 | Ga0070681_10301333 | |||
| 1306 | Ga0068867_100552997 | |||
| 1307 | Ga0070699_100115325 | |||
| 1308 | Ga0070679_100000351 | |||
| 1309 | Ga0070679_100000596 | |||
| 1310 | Ga0070679_100023344 | |||
| 1311 | Ga0070679_100131355 | |||
| 1312 | Ga0070679_100200068 | |||
| 1313 | Ga0070679_100287871 | |||
| 1314 | Ga0070684_100075180 | |||
| 1315 | Ga0070684_100096131 | |||
| 1316 | Ga0068853_100019976 | |||
| 1317 | Ga0068853_100031878 | |||
| 1318 | Ga0068853_100033491 | |||
| 1319 | Ga0068853_100036748 | |||
| 1320 | Ga0068853_100055226 | |||
| 1321 | Ga0068853_100078887 | |||
| 1322 | Ga0068853_100079234 | |||
| 1323 | Ga0068853_100079236 | |||
| 1324 | Ga0068853_100139260 | |||
| 1325 | Ga0068853_100628967 | |||
| 1326 | Ga0070686_100336817 | |||
| 1327 | Ga0070696_100000448 | |||
| 1328 | Ga0070696_100001287 | |||
| 1329 | Ga0070696_100011151 | |||
| 1330 | Ga0070693_100005381 | |||
| 1331 | Ga0070665_100000069 | |||
| 1332 | Ga0070665_100003657 | |||
| 1333 | Ga0070665_100018876 | |||
| 1334 | Ga0070665_100072690 | |||
| 1335 | Ga0070665_100221200 | |||
| 1336 | Ga0070665_100384351 | |||
| 1337 | Ga0070665_100416325 | |||
| 1338 | Ga0068855_100007313 | |||
| 1339 | Ga0068855_100012264 | |||
| 1340 | Ga0068855_100018321 | |||
| 1341 | Ga0068855_100047245 | |||
| 1342 | Ga0068855_100072584 | |||
| 1343 | Ga0068855_100081051 | |||
| 1344 | Ga0068855_100371610 | |||
| 1345 | Ga0068855_100467955 | |||
| 1346 | Ga0070664_100015898 | |||
| 1347 | Ga0070664_100040296 | |||
| 1348 | Ga0070664_100048394 | |||
| 1349 | Ga0068857_100034172 | |||
| 1350 | Ga0068857_100047755 | |||
| 1351 | Ga0068857_100048945 | |||
| 1352 | Ga0068857_100062451 | |||
| 1353 | Ga0068857_100074206 | |||
| 1354 | Ga0068857_100102800 | |||
| 1355 | Ga0068854_100034482 | |||
| 1356 | Ga0068854_100060358 | |||
| 1357 | Ga0068854_100062217 | |||
| 1358 | Ga0068856_100000789 | |||
| 1359 | Ga0068856_100012115 | |||
| 1360 | Ga0068856_100022478 | |||
| 1361 | Ga0068856_100035573 | |||
| 1362 | Ga0068856_100060487 | |||
| 1363 | Ga0068856_100184584 | |||
| 1364 | Ga0068856_100193207 | |||
| 1365 | Ga0068852_100028818 | |||
| 1366 | Ga0068852_100029930 | |||
| 1367 | Ga0068852_100081976 | |||
| 1368 | Ga0068852_100083509 | |||
| 1369 | Ga0068852_100117637 | |||
| 1370 | Ga0068852_100120681 | |||
| 1371 | Ga0068852_100188878 | |||
| 1372 | Ga0068852_100370260 | |||
| 1373 | Ga0068859_100001009 | |||
| 1374 | Ga0068859_100049313 | |||
| 1375 | Ga0068859_100249620 | |||
| 1376 | Ga0068859_100280542 | |||
| 1377 | Ga0068864_100017137 | |||
| 1378 | Ga0068864_100075848 | |||
| 1379 | Ga0068861_100128912 | |||
| 1380 | Ga0068851_10002163 | |||
| 1381 | Ga0068851_10002817 | |||
| 1382 | Ga0068851_10028539 | |||
| 1383 | Ga0068851_10096864 | |||
| 1384 | Ga0068851_10265912 | |||
| 1385 | Ga0068870_10068785 | |||
| 1386 | Ga0068863_100002720 | |||
| 1387 | Ga0068863_100003887 | |||
| 1388 | Ga0068863_100010407 | |||
| 1389 | Ga0068863_100083533 | |||
| 1390 | Ga0068858_100000993 | |||
| 1391 | Ga0068858_100046344 | |||
| 1392 | Ga0068858_100215708 | |||
| 1393 | Ga0068860_100001038 | |||
| 1394 | Ga0068860_100005080 | |||
| 1395 | Ga0068860_100119361 | |||
| 1396 | Ga0068860_100190135 | |||
| 1397 | Ga0068860_100362740 | |||
| 1398 | Ga0068862_100000258 | |||
| 1399 | Ga0068862_100052798 | |||
| 1400 | Ga0068862_100156540 | |||
| 1401 | Ga0081455_10120819 | |||
| 1402 | Ga0081540_1000701 | |||
| 1403 | Ga0075364_10000071 | |||
| 1404 | Ga0075369_10012548 | |||
| 1405 | Ga0097621_100033122 | |||
| 1406 | Ga0068871_100011892 | |||
| 1407 | Ga0068871_100054227 | |||
| 1408 | Ga0068871_100110802 | |||
| 1409 | Ga0068865_100014448 | |||
| 1410 | Ga0068865_100022064 | |||
| 1411 | Ga0068865_100043578 | |||
| 1412 | Ga0075436_100013074 | |||
| 1413 | Ga0097620_100001009 | |||
| 1414 | Ga0097620_100049310 | |||
| 1415 | Ga0097620_100249610 | |||
| 1416 | Ga0097620_100280533 | |||
| 1417 | Ga0105240_10009570 | |||
| 1418 | Ga0105240_10013527 | |||
| 1419 | Ga0105240_10016144 | |||
| 1420 | Ga0105240_10118790 | |||
| 1421 | Ga0105240_10164197 | |||
| 1422 | Ga0105240_10636444 | |||
| 1423 | Ga0105245_10209203 | |||
| 1424 | Ga0105247_10001182 | |||
| 1425 | Ga0105247_10161608 | |||
| 1426 | Ga0105241_10002838 | |||
| 1427 | Ga0105241_10007604 | |||
| 1428 | Ga0105241_10052552 | |||
| 1429 | Ga0105241_10137828 | |||
| 1430 | Ga0105241_10212372 | |||
| 1431 | Ga0105241_10251296 | |||
| 1432 | Ga0105241_10288904 | |||
| 1433 | Ga0105242_10003171 | |||
| 1434 | Ga0105248_10000482 | |||
| 1435 | Ga0105248_10012830 | |||
| 1436 | Ga0105248_10084287 | |||
| 1437 | Ga0105248_10366629 | |||
| 1438 | Ga0105248_10455807 | |||
| 1439 | Ga0105248_10679289 | |||
| 1440 | Ga0105237_10000022 | |||
| 1441 | Ga0105237_10001674 | |||
| 1442 | Ga0105237_10011328 | |||
| 1443 | Ga0105237_10062347 | |||
| 1444 | Ga0105237_10522404 | |||
| 1445 | Ga0105237_10563850 | |||
| 1446 | Ga0105238_10000438 | |||
| 1447 | Ga0105238_10000798 | |||
| 1448 | Ga0105238_10001541 | |||
| 1449 | Ga0105238_10003674 | |||
| 1450 | Ga0105238_10023744 | |||
| 1451 | Ga0105238_10106031 | |||
| 1452 | Ga0105238_10136861 | |||
| 1453 | Ga0105249_10000589 | |||
| 1454 | Ga0105249_10171246 | |||
| 1455 | Ga0105249_10564030 | |||
| 1456 | Ga0105239_10000201 | |||
| 1457 | Ga0105239_10007421 | |||
| 1458 | Ga0105239_10007651 | |||
| 1459 | Ga0105239_10008115 | |||
| 1460 | Ga0105239_10013121 | |||
| 1461 | Ga0105239_10020642 | |||
| 1462 | Ga0105239_10030408 | |||
| 1463 | Ga0105239_10074374 | |||
| 1464 | Ga0105239_10149948 | |||
| 1465 | Ga0105239_10181804 | |||
| 1466 | Ga0105246_10006308 | |||
| 1467 | Ga0105246_10036685 | |||
| 1468 | Ga0157314_1000145 | |||
| 1469 | Ga0154018_119159 | |||
| 1470 | Ga0154016_120722 | |||
| 1471 | Ga0154014_144769 | |||
| 1472 | Ga0154012_153308 | |||
| 1473 | Ga0154010_128674 | |||
| 1474 | Ga0154010_137221 | |||
| 1475 | Ga0154010_169066 | |||
| 1476 | Ga0157373_10013510 | |||
| 1477 | Ga0157373_10070693 | |||
| 1478 | Ga0157373_10072968 | |||
| 1479 | Ga0157373_10120799 | |||
| 1480 | Ga0157371_10081985 | |||
| 1481 | Ga0157371_10205774 | |||
| 1482 | Ga0157370_10000790 | |||
| 1483 | Ga0157370_10013975 | |||
| 1484 | Ga0157370_10019123 | |||
| 1485 | Ga0157370_10020159 | |||
| 1486 | Ga0157370_10029677 | |||
| 1487 | Ga0157370_10053374 | |||
| 1488 | Ga0157370_10116902 | |||
| 1489 | Ga0157370_10199775 | |||
| 1490 | Ga0157370_10258179 | |||
| 1491 | Ga0157369_10000653 | |||
| 1492 | Ga0157369_10005513 | |||
| 1493 | Ga0157369_10034736 | |||
| 1494 | Ga0157369_10036355 | |||
| 1495 | Ga0157369_10147374 | |||
| 1496 | Ga0157369_10231269 | |||
| 1497 | Ga0157369_10317399 | |||
| 1498 | Ga0157369_10408488 | |||
| 1499 | Ga0157374_10004750 | |||
| 1500 | Ga0157374_10304223 | |||
| 1501 | Ga0157378_10000274 | |||
| 1502 | Ga0157378_10085828 | |||
| 1503 | Ga0157378_10100938 | |||
| 1504 | Ga0163162_10028068 | |||
| 1505 | Ga0163162_10335862 | |||
| 1506 | Ga0163162_10560110 | |||
| 1507 | Ga0157372_10000289 | |||
| 1508 | Ga0157372_10023002 | |||
| 1509 | Ga0157372_10027186 | |||
| 1510 | Ga0157372_10028526 | |||
| 1511 | Ga0157372_10038723 | |||
| 1512 | Ga0157372_10039411 | |||
| 1513 | Ga0157372_10049484 | |||
| 1514 | Ga0157372_10098349 | |||
| 1515 | Ga0157372_10475805 | |||
| 1516 | Ga0157375_10000387 | |||
| 1517 | Ga0157375_10305718 | |||
| 1518 | Ga0163163_10000041 | |||
| 1519 | Ga0163163_10001574 | |||
| 1520 | Ga0163163_10077088 | |||
| 1521 | Ga0157380_10536545 | |||
| 1522 | Ga0182008_10009913 | |||
| 1523 | Ga0182008_10025453 | |||
| 1524 | Ga0157379_10008854 | |||
| 1525 | Ga0157379_10230329 | |||
| 1526 | Ga0157376_10027179 | |||
| 1527 | Ga0157376_10041558 | |||
| 1528 | Ga0157376_10050654 | |||
| 1529 | Ga0157376_10194802 | |||
| 1530 | Ga0182006_1000065 | |||
| 1531 | Ga0182007_10009823 | |||
| 1532 | Ga0182007_10014154 | |||
| 1533 | Ga0182005_1000135 | |||
| 1534 | Ga0182005_1001395 | |||
| 1535 | Ga0183369_1004 | |||
| 1536 | Ga0183368_1002 | |||
| 1537 | Ga0197907_10180164 | |||
| 1538 | Ga0197907_10245422 | |||
| 1539 | Ga0197907_11156423 | |||
| 1540 | Ga0197907_11176821 | |||
| 1541 | Ga0206356_10295912 | |||
| 1542 | Ga0206356_11283223 | |||
| 1543 | Ga0206356_11568899 | |||
| 1544 | Ga0206349_1140085 | |||
| 1545 | Ga0206349_1283811 | |||
| 1546 | Ga0206349_1676871 | |||
| 1547 | Ga0206349_1702833 | |||
| 1548 | Ga0206355_1403507 | |||
| 1549 | Ga0206355_1420628 | |||
| 1550 | Ga0206355_1721824 | |||
| 1551 | Ga0206351_10235719 | |||
| 1552 | Ga0206351_10410724 | |||
| 1553 | Ga0206352_10077414 | |||
| 1554 | Ga0206352_10339572 | |||
| 1555 | Ga0206352_10564291 | |||
| 1556 | Ga0206352_10847784 | |||
| 1557 | Ga0206352_11034105 | |||
| 1558 | Ga0206350_10448320 | |||
| 1559 | Ga0206350_11040687 | |||
| 1560 | Ga0206350_11180810 | |||
| 1561 | Ga0206354_11364663 | |||
| 1562 | Ga0206354_11401936 | |||
| 1563 | Ga0206353_10112022 | |||
| 1564 | Ga0206353_11111473 | |||
| 1565 | Ga0206353_11572226 | |||
| 1566 | Ga0154015_1492826 | |||
| 1567 | Ga0154015_1617911 | |||
| 1568 | Ga0154015_1647404 | |||
| 1569 | Ga0224712_10060903 | |||
| 1570 | Ga0224712_10134847 | |||
| 1571 | Ga0224712_10149954 | |||
| 1572 | Ga0224712_10173134 | |||
| 1573 | Ga0224712_10177821 | |||
| 1574 | Ga0209435_103024 | |||
| 1575 | Ga0209784_100119 | |||
| 1576 | Ga0209566_103651 | |||
| 1577 | Ga0209674_100014 | |||
| 1578 | Ga0209674_100079 | |||
| 1579 | Ga0209674_100862 | |||
| 1580 | Ga0209674_100875 | |||
| 1581 | Ga0209674_101251 | |||
| 1582 | Ga0209672_100005 | |||
| 1583 | Ga0209672_100108 | |||
| 1584 | Ga0209672_100121 | |||
| 1585 | Ga0209672_101356 | |||
| 1586 | Ga0209563_100045 | |||
| 1587 | Ga0207427_100037 | |||
| 1588 | Ga0207427_100068 | |||
| 1589 | Ga0207427_100142 | |||
| 1590 | Ga0207427_100233 | |||
| 1591 | Ga0209437_100005 | |||
| 1592 | Ga0209437_100074 | |||
| 1593 | Ga0209437_100162 | |||
| 1594 | Ga0209437_100285 | |||
| 1595 | Ga0209437_100305 | |||
| 1596 | Ga0209437_101060 | |||
| 1597 | Ga0209258_100006 | |||
| 1598 | Ga0209258_100057 | |||
| 1599 | Ga0209258_100127 | |||
| 1600 | Ga0209258_100152 | |||
| 1601 | Ga0209258_100185 | |||
| 1602 | Ga0209258_105004 | |||
| 1603 | Ga0209646_1001834 | |||
| 1604 | Ga0209646_1002202 | |||
| 1605 | Ga0209646_1002230 | |||
| 1606 | Ga0209026_1000010 | |||
| 1607 | Ga0209026_1000055 | |||
| 1608 | Ga0209026_1000200 | |||
| 1609 | Ga0209026_1000360 | |||
| 1610 | Ga0209026_1000606 | |||
| 1611 | Ga0209026_1002343 | |||
| 1612 | Ga0209677_101408 | |||
| 1613 | Ga0209148_1000005 | |||
| 1614 | Ga0209148_1000012 | |||
| 1615 | Ga0209148_1000014 | |||
| 1616 | Ga0209148_1000036 | |||
| 1617 | Ga0209148_1000042 | |||
| 1618 | Ga0209148_1000068 | |||
| 1619 | Ga0209759_1000185 | |||
| 1620 | Ga0209759_1000339 | |||
| 1621 | Ga0209759_1000454 | |||
| 1622 | Ga0209759_1003532 | |||
| 1623 | Ga0209759_1007318 | |||
| 1624 | Ga0209233_1000011 | |||
| 1625 | Ga0209233_1000040 | |||
| 1626 | Ga0209233_1000096 | |||
| 1627 | Ga0209233_1000172 | |||
| 1628 | Ga0209455_1000008 | |||
| 1629 | Ga0209455_1000014 | |||
| 1630 | Ga0209455_1000016 | |||
| 1631 | Ga0209455_1000071 | |||
| 1632 | Ga0209455_1000142 | |||
| 1633 | Ga0209455_1007774 | |||
| 1634 | Ga0209758_1005675 | |||
| 1635 | Ga0209758_1016755 | |||
| 1636 | Ga0209256_1005353 | |||
| 1637 | Ga0209256_1030489 | |||
| 1638 | Ga0209051_1002617 | |||
| 1639 | Ga0209051_1019072 | |||
| 1640 | Ga0209257_1023830 | |||
| 1641 | Ga0207656_10001161 | |||
| 1642 | Ga0207656_10015250 | |||
| 1643 | Ga0207656_10046194 | |||
| 1644 | Ga0207656_10048133 | |||
| 1645 | Ga0207656_10116853 | |||
| 1646 | Ga0207656_10124291 | |||
| 1647 | Ga0207710_10055305 | |||
| 1648 | Ga0207710_10086541 | |||
| 1649 | Ga0207680_10000003 | |||
| 1650 | Ga0207680_10003572 | |||
| 1651 | Ga0207680_10094908 | |||
| 1652 | Ga0207680_10135719 | |||
| 1653 | Ga0207680_10410806 | |||
| 1654 | Ga0207647_10000014 | |||
| 1655 | Ga0207647_10000055 | |||
| 1656 | Ga0207647_10000939 | |||
| 1657 | Ga0207647_10013011 | |||
| 1658 | Ga0207647_10016810 | |||
| 1659 | Ga0207645_10038593 | |||
| 1660 | Ga0207645_10248430 | |||
| 1661 | Ga0207643_10008052 | |||
| 1662 | Ga0207705_10001038 | |||
| 1663 | Ga0207705_10004066 | |||
| 1664 | Ga0207705_10008600 | |||
| 1665 | Ga0207705_10014785 | |||
| 1666 | Ga0207654_10009527 | |||
| 1667 | Ga0207654_10055289 | |||
| 1668 | Ga0207654_10069475 | |||
| 1669 | Ga0207654_10171301 | |||
| 1670 | Ga0207654_10171875 | |||
| 1671 | Ga0207707_10000039 | |||
| 1672 | Ga0207707_10000068 | |||
| 1673 | Ga0207707_10000105 | |||
| 1674 | Ga0207707_10000133 | |||
| 1675 | Ga0207707_10000848 | |||
| 1676 | Ga0207707_10002257 | |||
| 1677 | Ga0207707_10006604 | |||
| 1678 | Ga0207707_10011699 | |||
| 1679 | Ga0207707_10014987 | |||
| 1680 | Ga0207707_10165535 | |||
| 1681 | Ga0207707_10286642 | |||
| 1682 | Ga0207695_10000275 | |||
| 1683 | Ga0207695_10000750 | |||
| 1684 | Ga0207695_10001177 | |||
| 1685 | Ga0207695_10001986 | |||
| 1686 | Ga0207695_10004061 | |||
| 1687 | Ga0207695_10007149 | |||
| 1688 | Ga0207695_10010190 | |||
| 1689 | Ga0207695_10011212 | |||
| 1690 | Ga0207695_10013350 | |||
| 1691 | Ga0207695_10025042 | |||
| 1692 | Ga0207695_10025597 | |||
| 1693 | Ga0207695_10251666 | |||
| 1694 | Ga0207671_10000009 | |||
| 1695 | Ga0207671_10000205 | |||
| 1696 | Ga0207671_10000689 | |||
| 1697 | Ga0207671_10004084 | |||
| 1698 | Ga0207671_10004501 | |||
| 1699 | Ga0207671_10008570 | |||
| 1700 | Ga0207671_10038209 | |||
| 1701 | Ga0207671_10182050 | |||
| 1702 | Ga0207671_10332394 | |||
| 1703 | Ga0207663_10037830 | |||
| 1704 | Ga0207663_10053511 | |||
| 1705 | Ga0207660_10001051 | |||
| 1706 | Ga0207660_10004808 | |||
| 1707 | Ga0207660_10006302 | |||
| 1708 | Ga0207660_10016646 | |||
| 1709 | Ga0207660_10042897 | |||
| 1710 | Ga0207657_10003243 | |||
| 1711 | Ga0207657_10003424 | |||
| 1712 | Ga0207657_10018160 | |||
| 1713 | Ga0207657_10023070 | |||
| 1714 | Ga0207657_10023215 | |||
| 1715 | Ga0207657_10371275 | |||
| 1716 | Ga0207649_10000952 | |||
| 1717 | Ga0207649_10002276 | |||
| 1718 | Ga0207649_10012058 | |||
| 1719 | Ga0207649_10032167 | |||
| 1720 | Ga0207649_10231698 | |||
| 1721 | Ga0207652_10000081 | |||
| 1722 | Ga0207652_10000707 | |||
| 1723 | Ga0207652_10001040 | |||
| 1724 | Ga0207652_10001332 | |||
| 1725 | Ga0207652_10001828 | |||
| 1726 | Ga0207652_10007164 | |||
| 1727 | Ga0207652_10019836 | |||
| 1728 | Ga0207652_10134865 | |||
| 1729 | Ga0207652_10226968 | |||
| 1730 | Ga0207652_10371311 | |||
| 1731 | Ga0207681_10204662 | |||
| 1732 | Ga0207694_10001808 | |||
| 1733 | Ga0207694_10001816 | |||
| 1734 | Ga0207694_10003563 | |||
| 1735 | Ga0207694_10011793 | |||
| 1736 | Ga0207694_10038315 | |||
| 1737 | Ga0207694_10113630 | |||
| 1738 | Ga0207694_10148202 | |||
| 1739 | Ga0207694_10177884 | |||
| 1740 | Ga0207694_10182946 | |||
| 1741 | Ga0207650_10069021 | |||
| 1742 | Ga0207650_10077962 | |||
| 1743 | Ga0207650_10092602 | |||
| 1744 | Ga0207659_10045238 | |||
| 1745 | Ga0207687_10226125 | |||
| 1746 | Ga0207700_10005275 | |||
| 1747 | Ga0207664_10001629 | |||
| 1748 | Ga0207664_10025625 | |||
| 1749 | Ga0207664_10034260 | |||
| 1750 | Ga0207644_10450274 | |||
| 1751 | Ga0207644_10476201 | |||
| 1752 | Ga0207690_10001535 | |||
| 1753 | Ga0207690_10003927 | |||
| 1754 | Ga0207690_10005093 | |||
| 1755 | Ga0207690_10131938 | |||
| 1756 | Ga0207706_10001818 | |||
| 1757 | Ga0207706_10013232 | |||
| 1758 | Ga0207706_10328937 | |||
| 1759 | Ga0207706_10337009 | |||
| 1760 | Ga0207686_10055736 | |||
| 1761 | Ga0207670_10003294 | |||
| 1762 | Ga0207704_10031739 | |||
| 1763 | Ga0207704_10040966 | |||
| 1764 | Ga0207704_10068939 | |||
| 1765 | Ga0207704_10101850 | |||
| 1766 | Ga0207691_10015606 | |||
| 1767 | Ga0207711_10001370 | |||
| 1768 | Ga0207711_10016047 | |||
| 1769 | Ga0207689_10047719 | |||
| 1770 | Ga0207661_10005240 | |||
| 1771 | Ga0207661_10068478 | |||
| 1772 | Ga0207661_10184604 | |||
| 1773 | Ga0207661_10504917 | |||
| 1774 | Ga0207679_10082370 | |||
| 1775 | Ga0207679_10137859 | |||
| 1776 | Ga0207679_10192136 | |||
| 1777 | Ga0207667_10000193 | |||
| 1778 | Ga0207667_10002544 | |||
| 1779 | Ga0207667_10006246 | |||
| 1780 | Ga0207667_10009306 | |||
| 1781 | Ga0207667_10016947 | |||
| 1782 | Ga0207667_10020574 | |||
| 1783 | Ga0207667_10021032 | |||
| 1784 | Ga0207667_10021806 | |||
| 1785 | Ga0207667_10034907 | |||
| 1786 | Ga0207667_10138628 | |||
| 1787 | Ga0207667_10320024 | |||
| 1788 | Ga0207667_10393382 | |||
| 1789 | Ga0207667_10443814 | |||
| 1790 | Ga0207651_10025419 | |||
| 1791 | Ga0207712_10000117 | |||
| 1792 | Ga0207712_10000170 | |||
| 1793 | Ga0207712_10070242 | |||
| 1794 | Ga0207712_10150433 | |||
| 1795 | Ga0207712_10278520 | |||
| 1796 | Ga0207668_10492466 | |||
| 1797 | Ga0207640_10003299 | |||
| 1798 | Ga0207640_10003627 | |||
| 1799 | Ga0207640_10006583 | |||
| 1800 | Ga0207640_10018248 | |||
| 1801 | Ga0207640_10025525 | |||
| 1802 | Ga0207640_10044756 | |||
| 1803 | Ga0207640_10058957 | |||
| 1804 | Ga0207640_10060673 | |||
| 1805 | Ga0207658_10000104 | |||
| 1806 | Ga0207658_10002932 | |||
| 1807 | Ga0207658_10272880 | |||
| 1808 | Ga0207658_10316044 | |||
| 1809 | Ga0207677_10156663 | |||
| 1810 | Ga0207677_10245021 | |||
| 1811 | Ga0207703_10000890 | |||
| 1812 | Ga0207703_10186718 | |||
| 1813 | Ga0207639_10000824 | |||
| 1814 | Ga0207639_10001564 | |||
| 1815 | Ga0207639_10002356 | |||
| 1816 | Ga0207639_10007227 | |||
| 1817 | Ga0207639_10010669 | |||
| 1818 | Ga0207639_10013837 | |||
| 1819 | Ga0207639_10024385 | |||
| 1820 | Ga0207639_10032989 | |||
| 1821 | Ga0207639_10041045 | |||
| 1822 | Ga0207639_10062707 | |||
| 1823 | Ga0207639_10135461 | |||
| 1824 | Ga0207639_10581284 | |||
| 1825 | Ga0207678_10000365 | |||
| 1826 | Ga0207678_10002082 | |||
| 1827 | Ga0207678_10002205 | |||
| 1828 | Ga0207678_10002713 | |||
| 1829 | Ga0207678_10003194 | |||
| 1830 | Ga0207678_10032921 | |||
| 1831 | Ga0207678_10044243 | |||
| 1832 | Ga0207678_10054332 | |||
| 1833 | Ga0207678_10057945 | |||
| 1834 | Ga0207678_10074449 | |||
| 1835 | Ga0207678_10095635 | |||
| 1836 | Ga0207708_10069454 | |||
| 1837 | Ga0207702_10000311 | |||
| 1838 | Ga0207702_10001604 | |||
| 1839 | Ga0207702_10006991 | |||
| 1840 | Ga0207702_10011355 | |||
| 1841 | Ga0207702_10011573 | |||
| 1842 | Ga0207702_10014929 | |||
| 1843 | Ga0207702_10016909 | |||
| 1844 | Ga0207702_10095214 | |||
| 1845 | Ga0207702_10129370 | |||
| 1846 | Ga0207702_10157191 | |||
| 1847 | Ga0207702_10246089 | |||
| 1848 | Ga0207641_10027645 | |||
| 1849 | Ga0207641_10085107 | |||
| 1850 | Ga0207641_10099289 | |||
| 1851 | Ga0207641_10592602 | |||
| 1852 | Ga0207641_10664200 | |||
| 1853 | Ga0207648_10033885 | |||
| 1854 | Ga0207676_10144517 | |||
| 1855 | Ga0207676_10152840 | |||
| 1856 | Ga0207674_10001639 | |||
| 1857 | Ga0207674_10004159 | |||
| 1858 | Ga0207674_10016073 | |||
| 1859 | Ga0207674_10045898 | |||
| 1860 | Ga0207674_10085744 | |||
| 1861 | Ga0207674_10089265 | |||
| 1862 | Ga0207674_10161593 | |||
| 1863 | Ga0207674_10196595 | |||
| 1864 | Ga0207674_10319796 | |||
| 1865 | Ga0207675_100162323 | |||
| 1866 | Ga0207698_10003970 | |||
| 1867 | Ga0207698_10004405 | |||
| 1868 | Ga0207698_10196590 | |||
| 1869 | Ga0207698_10206910 | |||
| 1870 | Ga0207698_10238228 | |||
| 1871 | Ga0207698_10242328 | |||
| 1872 | Ga0207698_10299886 | |||
| 1873 | Ga0207698_10488152 | |||
| 1874 | Ga0207698_10641472 | |||
| 1875 | Ga0268266_10000001 | |||
| 1876 | Ga0268266_10000007 | |||
| 1877 | Ga0268266_10000011 | |||
| 1878 | Ga0268266_10039830 | |||
| 1879 | Ga0268266_10076896 | |||
| 1880 | Ga0268266_10126191 | |||
| 1881 | Ga0268266_10196942 | |||
| 1882 | Ga0268266_10437115 | |||
| 1883 | Ga0268266_10610141 | |||
| 1884 | Ga0268265_10000471 | |||
| 1885 | Ga0268265_10123701 | |||
| 1886 | Ga0268265_10239069 | |||
| 1887 | Ga0268265_10418637 | |||
| 1888 | Ga0268264_10017655 | |||
| 1889 | Ga0268264_10024517 | |||
| 1890 | Ga0268264_10158058 | |||
| 1891 | Ga0268264_10781252 | |||
| 1892 | Ga0265334_10000098 | |||
| 1893 | Ga0307517_10083836 | |||
| 1894 | Ga0265338_10034309 | |||
| 1895 | Ga0316182_1350289 | |||
| 1896 | Ga0265331_10003188 | |||
| 1897 | Ga0265327_10000500 | |||
| 1898 | Ga0265327_10001333 | |||
| 1899 | Ga0265313_10000162 | |||
| 1900 | Ga0265313_10033163 | |||
| 1901 | Ga0307508_10014185 | |||
| 1902 | Ga0307508_10213891 | |||
| 1903 | Ga0316575_10018924 | |||
| 1904 | Ga0316579_10000127 | |||
| 1905 | Ga0316579_10001922 | |||
| 1906 | Ga0307516_10069184 | |||
| 1907 | Ga0307516_10087115 | |||
| 1908 | Ga0307516_10150849 | |||
| 1909 | Ga0307405_10066047 | |||
| 1910 | Ga0307413_10006336 | |||
| 1911 | Ga0307412_10000742 | |||
| 1912 | Ga0307412_10041311 | |||
| 1913 | Ga0307416_100594611 | |||
| 1914 | Ga0316583_10001627 | |||
| 1915 | Ga0307510_10002000 | |||
| 1916 | Ga0316592_1029401 | |||
| 1917 | Ga0316586_1025071 | |||
| 1918 | Ga0316587_1015858 | |||
| 1919 | Ga0316587_1031953 | |||
| 1920 | Ga0316596_1035459 | |||
| 1921 | Ga0373959_0031804 | |||
| 1922 | Ga0373955_0053755 | |||
| 1923 | Ga0316574_0091334 | |||
| 1924 | Ga0373927_0000002 | |||
| 1925 | Ga0373937_0090575 | |||
| 1926 | Ga0373937_0250803 | |||
| 1927 | Ga0316582_0211423 | |||
| 1928 | Ga0316582_0390258 | |||
| 1929 | Ga0316584_0109850 | |||
| 1930 | Ga0316584_0373124 | |||
| 1931 | Ga0373925_0614278 | |||
| 1932 | Ga0395899_0000081 | |||
| 1933 | Ga0395899_0006004 | |||
| 1934 | Ga0395899_0014586 | |||
| 1935 | Ga0395899_0028107 | |||
| 1936 | Ga0395899_0070636 | |||
| 1937 | Ga0395899_0316559 | |||
| 1938 | Ga0395900_0000024 | |||
| 1939 | Ga0395900_0000078 | |||
| 1940 | Ga0395900_0001276 | |||
| 1941 | Ga0395900_0005061 | |||
| 1942 | Ga0395900_0011285 | |||
| 1943 | Ga0395900_0063005 | |||
| 1944 | Ga0395900_0108085 | |||
| 1945 | Ga0395900_0128419 | |||
| 1946 | Ga0395900_0208825 | |||
| 1947 | Ga0395898_0000044 | |||
| 1948 | Ga0395898_0000202 | |||
| 1949 | Ga0395898_0001760 | |||
| 1950 | Ga0395898_0052238 | |||
| 1951 | Ga0395905_0034294 | |||
| 1952 | Ga0395901_0005913 | |||
| 1953 | Ga0395901_0007079 | |||
| 1954 | Ga0395901_0010379 | |||
| 1955 | Ga0395901_0012449 | |||
| 1956 | Ga0395901_0056302 | |||
| 1957 | Ga0395901_0152125 | |||
| 1958 | Ga0395901_0181235 | |||
| 1959 | Ga0400483_046643 | |||
| 1960 | Ga0400483_151143 | |||
| 1961 | Ga0436365_1036717 | |||
| 1962 | Ga0451802_0889336 | |||
| 1963 | Ga0451802_1175688 | |||
| 1964 | Ga0439437_004284 | |||
| 1965 | Ga0439449_0004409 | |||
| 1966 | Ga0439452_021907 | |||
| 1967 | Ga0450908_000064 | |||
| 1968 | Ga0439459_0001247 | |||
| 1969 | Ga0451577_0003066 | |||
| 1970 | Ga0451577_0031744 | |||
| 1971 | Ga0451577_0121487 | |||
| 1972 | Ga0451577_0206686 | |||
| 1973 | Ga0466969_0003293 | |||
| 1974 | Ga0466969_0008841 | |||
| 1975 | Ga0466972_0002309 | |||
| 1976 | Ga0466982_0000001 | |||
| 1977 | Ga0466965_0002052 | |||
| 1978 | Ga0466966_0015591 | |||
| 1979 | Ga0466961_0000222 | |||
| 1980 | Ga0466961_0001720 | |||
| 1981 | Ga0466961_0003929 | |||
| 1982 | Ga0466961_0038099 | |||
| 1983 | Ga0466961_0078030 | |||
| 1984 | Ga0453684_0000531 | |||
| 1985 | Ga0453684_0276463 | |||
| 1986 | Ga0466971_0001919 | |||
| 1987 | Ga0466971_0002827 | |||
| 1988 | Ga0466971_0018573 | |||
| 1989 | Ga0466970_0000290 | |||
| 1990 | Ga0466970_0002155 | |||
| 1991 | Ga0466970_0107035 | |||
| 1992 | Ga0466957_0002693 | |||
| 1993 | Ga0466957_0002909 | |||
| 1994 | Ga0466957_0144185 | |||
| 1995 | Ga0466959_0000547 | |||
| 1996 | Ga0466959_0023313 | |||
| 1997 | Ga0466959_0046527 | |||
| 1998 | Ga0466959_0062767 | |||
| 1999 | Ga0451576_0000212 | |||
| 2000 | Ga0466958_0021914 | |||
| 2001 | Ga0495617_000081 | |||
| 2002 | Ga0495617_000279 | |||
| 2003 | Ga0495629_0245655 | |||
| 2004 | Ga0495638_0000090 | |||
| 2005 | Ga0495638_0000864 | |||
| 2006 | Ga0495638_0000993 | |||
| 2007 | Ga0495638_0001310 | |||
| 2008 | Ga0495638_0011315 | |||
| 2009 | Ga0495650_0000665 | |||
| 2010 | Ga0495650_0001127 | |||
| 2011 | Ga0495650_0004723 | |||
| 2012 | Ga0495580_0114564 | |||
| 2013 | Ga0495664_0166551 | |||
| 2014 | Ga0495584_0000221 | |||
| 2015 | Ga0495585_0000021 | |||
| 2016 | Ga0495585_0002001 | |||
| 2017 | Ga0495607_0000067 | |||
| 2018 | Ga0495607_0000180 | |||
| 2019 | Ga0495607_0007555 | |||
| 2020 | Ga0495607_0149489 | |||
| 2021 | Ga0495607_0182394 | |||
| 2022 | Ga0495583_0029686 | |||
| 2023 | Ga0495606_0002156 | |||
| 2024 | Ga0495606_0003424 | |||
| 2025 | Ga0495606_0005863 | |||
| 2026 | Ga0495606_0008526 | |||
| 2027 | Ga0495606_0034412 | |||
| 2028 | Ga0495610_0002152 | |||
| 2029 | Ga0495610_0017747 | |||
| 2030 | Ga0495616_0000051 | |||
| 2031 | Ga0495620_0000233 | |||
| 2032 | Ga0495631_0000030 | |||
| 2033 | Ga0495631_0000174 | |||
| 2034 | Ga0495632_0000059 | |||
| 2035 | Ga0495632_0003326 | |||
| 2036 | Ga0495632_0028153 | |||
| 2037 | Ga0495648_0001263 | |||
| 2038 | Ga0495648_0001702 | |||
| 2039 | Ga0495663_0005052 | |||
| 2040 | Ga0495609_0003492 | |||
| 2041 | Ga0495621_0000318 | |||
| 2042 | Ga0495645_0033484 | |||
| 2043 | Ga0495622_0002827 | |||
| 2044 | Ga0495633_0018139 | |||
| 2045 | Ga0495656_0017250 | |||
| 2046 | Ga0495656_0021796 | |||
| 2047 | Ga0495668_0009167 | |||
| 2048 | Ga0495611_0000002 | |||
| 2049 | Ga0495611_0000032 | |||
| 2050 | Ga0495625_0000002 | |||
| 2051 | Ga0495625_0021596 | |||
| 2052 | Ga0495625_0025382 | |||
| 2053 | Ga0495635_0058411 | |||
| 2054 | Ga0495661_0001129 | |||
| 2055 | Ga0495588_0211156 | |||
| 2056 | Ga0495623_0188615 | |||
| 2057 | Ga0495658_0057844 | |||
| 2058 | Ga0495670_0004265 | |||
| 2059 | Ga0495670_0041807 | |||
| 2060 | Ga0495670_0049770 | |||
| 2061 | Ga0495671_0000183 | |||
| 2062 | Ga0495649_0002519 | |||
| 2063 | Ga0495649_0112881 | |||
| 2064 | Ga0495589_0000140 | |||
| 2065 | Ga0495660_0000144 | |||
| 2066 | Ga0495660_0000370 | |||
| 2067 | Ga0495636_0005385 | |||
| 2068 | Ga0495636_0012769 | |||
| 2069 | Ga0495636_0016374 | |||
| 2070 | Ga0495683_0000879 | |||
| 2071 | Ga0495679_000003 | |||
| 2072 | Ga0495673_0000004 | |||
| 2073 | Ga0495673_0000310 | |||
| 2074 | Ga0495673_0000576 | |||
| 2075 | Ga0495684_0282187 | |||
| 2076 | Ga0495686_0000024 | |||
| 2077 | Ga0495686_0001292 | |||
| 2078 | Ga0496100_0214077 | |||
| 2079 | Ga0496101_0007212 | |||
| 2080 | Ga0496102_0122150 | |||
| 2081 | Ga0496102_0548961 | |||
| 2082 | Ga0496103_0193809 | |||
| 2083 | Ga0496103_0256613 | |||
| 2084 | Ga0496103_0415265 | |||
| 2085 | Ga0496104_0000005 | |||
| 2086 | Ga0496104_0384930 | |||
| 2087 | Ga0496105_0000084 | |||
| 2088 | Ga0496106_0004620 | |||
| 2089 | Ga0496106_0245959 | |||
| 2090 | Ga0496107_0141975 | |||
| 2091 | Ga0496108_0026306 | |||
| 2092 | Ga0496114_0148213 | |||
| 2093 | Ga0496115_0000002 | |||
| 2094 | Ga0496115_0000656 | |||
| 2095 | Ga0496115_0001959 | |||
| 2096 | Ga0496115_0015375 | |||
| 2097 | Ga0496116_0005410 | |||
| 2098 | Ga0496117_0008734 | |||
| 2099 | Ga0496117_0012451 | |||
| 2100 | Ga0496117_0023978 | |||
| 2101 | Ga0496117_0082968 | |||
| 2102 | Ga0496118_0000274 | |||
| 2103 | Ga0496118_0000506 | |||
| 2104 | Ga0496118_0003013 | |||
| 2105 | Ga0496118_0005279 | |||
| 2106 | Ga0496118_0007012 | |||
| 2107 | Ga0496118_0023225 | |||
| 2108 | Ga0496118_0053820 | |||
| 2109 | Ga0496119_0001163 | |||
| 2110 | Ga0496119_0015604 | |||
| 2111 | Ga0496120_0000110 | |||
| 2112 | Ga0496120_0002377 | |||
| 2113 | Ga0496121_0000096 | |||
| 2114 | Ga0496121_0001317 | |||
| 2115 | Ga0496121_0019979 | |||
| 2116 | Ga0496121_0123777 | |||
| 2117 | Ga0496122_0000136 | |||
| 2118 | Ga0496122_0014555 | |||
| 2119 | Ga0496122_0028316 | |||
| 2120 | Ga0496122_0114697 | |||
| 2121 | Ga0496123_0000733 | |||
| 2122 | Ga0496123_0005861 | |||
| 2123 | Ga0496123_0012400 | |||
| 2124 | Ga0496123_0031893 | |||
| 2125 | Ga0496124_0000006 | |||
| 2126 | Ga0496124_0000223 | |||
| 2127 | Ga0496124_0000231 | |||
| 2128 | Ga0496124_0032107 | |||
| 2129 | Ga0496125_0000647 | |||
| 2130 | Ga0496125_0010458 | |||
| 2131 | Ga0496125_0073108 | |||
| 2132 | Ga0496126_0000052 | |||
| 2133 | Ga0496126_0002686 | |||
| 2134 | Ga0496126_0014510 | |||
| 2135 | Ga0496126_0141435 | |||
| 2136 | Ga0496126_0421105 | |||
| 2137 | Ga0495678_000026 | |||
| 2138 | Ga0495678_025883 | |||
| 2139 | Ga0495682_0001797 | |||
| 2140 | Ga0501031_0009284 | |||
| 2141 | Ga0501031_0016300 | |||
| 2142 | Ga0501031_0029107 | |||
| 2143 | Ga0501031_0033744 | |||
| 2144 | Ga0501032_0000678 | |||
| 2145 | Ga0501032_0013499 | |||
| 2146 | Ga0501032_0016748 | |||
| 2147 | Ga0501032_0058353 | |||
| 2148 | Ga0501032_0066967 | |||
| 2149 | Ga0501033_0000755 | |||
| 2150 | Ga0501033_0054174 | |||
| 2151 | Ga0501033_0056767 | |||
| 2152 | Ga0501033_0066229 | |||
| 2153 | Ga0501033_0087244 | |||
| 2154 | Ga0501034_0000688 | |||
| 2155 | Ga0501034_0001482 | |||
| 2156 | Ga0501034_0007644 | |||
| 2157 | Ga0501034_0007651 | |||
| 2158 | Ga0501034_0009926 | |||
| 2159 | Ga0501034_0016057 | |||
| 2160 | Ga0501034_0034650 | |||
| 2161 | Ga0501036_0045034 | |||
| 2162 | Ga0501036_0095511 | |||
| 2163 | Ga0501036_0115260 | |||
| 2164 | Ga0501037_0001436 | |||
| 2165 | Ga0501037_0019719 | |||
| 2166 | Ga0501037_0077025 | |||
| 2167 | Ga0501038_0017639 | |||
| 2168 | Ga0501038_0028916 | |||
| 2169 | Ga0501038_0148372 | |||
| 2170 | Ga0501038_0308053 | |||
| 2171 | Ga0501039_0015122 | |||
| 2172 | Ga0501043_0007285 | |||
| 2173 | Ga0501043_0011545 | |||
| 2174 | Ga0501043_0022960 | |||
| 2175 | Ga0501043_0052698 | |||
| 2176 | Ga0501043_0079632 | |||
| 2177 | Ga0501043_0238484 | |||
| 2178 | Ga0501043_0341184 | |||
| 2179 | Ga0501046_0001087 | |||
| 2180 | Ga0501046_0004875 | |||
| 2181 | Ga0501046_0007538 | |||
| 2182 | Ga0501046_0051959 | |||
| 2183 | Ga0501046_0087808 | |||
| 2184 | Ga0501047_0000580 | |||
| 2185 | Ga0501047_0001659 | |||
| 2186 | Ga0501047_0002225 | |||
| 2187 | Ga0501047_0017698 | |||
| 2188 | Ga0501047_0019254 | |||
| 2189 | Ga0501047_0020797 | |||
| 2190 | Ga0501047_0021662 | |||
| 2191 | Ga0501047_0031601 | |||
| 2192 | Ga0501047_0046307 | |||
| 2193 | Ga0501047_0072126 | |||
| 2194 | Ga0501047_0106662 | |||
| 2195 | Ga0501047_0111347 | |||
| 2196 | Ga0501048_0014036 | |||
| 2197 | Ga0501048_0018118 | |||
| 2198 | Ga0501048_0022809 | |||
| 2199 | Ga0501048_0251326 | |||
| 2200 | Ga0501067_0002108 | |||
| 2201 | Ga0501067_0009740 | |||
| 2202 | Ga0501068_0058465 | |||
| 2203 | Ga0501068_0181585 | |||
| 2204 | Ga0501069_0000665 | |||
| 2205 | Ga0501069_0025354 | |||
| 2206 | Ga0501069_0041817 | |||
| 2207 | Ga0501069_0100398 | |||
| 2208 | Ga0501069_0101872 | |||
| 2209 | Ga0501069_0119223 | |||
| 2210 | Ga0501070_0002275 | |||
| 2211 | Ga0501070_0003593 | |||
| 2212 | Ga0501070_0003908 | |||
| 2213 | Ga0501070_0005647 | |||
| 2214 | Ga0501070_0007223 | |||
| 2215 | Ga0501070_0010640 | |||
| 2216 | Ga0501070_0014304 | |||
| 2217 | Ga0501070_0040710 | |||
| 2218 | Ga0501070_0101535 | |||
| 2219 | Ga0501070_0127329 | |||
| 2220 | Ga0501071_0041156 | |||
| 2221 | Ga0501072_0000602 | |||
| 2222 | Ga0501073_0001527 | |||
| 2223 | Ga0501073_0011295 | |||
| 2224 | Ga0501073_0012620 | |||
| 2225 | Ga0501073_0021218 | |||
| 2226 | Ga0501073_0022213 | |||
| 2227 | Ga0501073_0053591 | |||
| 2228 | Ga0501073_0054062 | |||
| 2229 | Ga0501073_0102407 | |||
| 2230 | Ga0501074_0005683 | |||
| 2231 | Ga0501074_0012997 | |||
| 2232 | Ga0501074_0036535 | |||
| 2233 | Ga0501074_0046043 | |||
| 2234 | Ga0501074_0047228 | |||
| 2235 | Ga0501207_009352 | |||
| 2236 | Ga0501249_021011 | |||
| 2237 | Ga0501079_0373150 | |||
| 2238 | Ga0501080_0000763 | |||
| 2239 | Ga0501080_0001364 | |||
| 2240 | Ga0501080_0001456 | |||
| 2241 | Ga0501080_0007137 | |||
| 2242 | Ga0501080_0008805 | |||
| 2243 | Ga0501080_0009911 | |||
| 2244 | Ga0501080_0012256 | |||
| 2245 | Ga0501080_0049113 | |||
| 2246 | Ga0501080_0058838 | |||
| 2247 | Ga0501080_0151652 | |||
| 2248 | Ga0501081_0084130 | |||
| 2249 | Ga0501083_0001017 | |||
| 2250 | Ga0501083_0006358 | |||
| 2251 | Ga0501265_000466 | |||
| 2252 | Ga0501270_008718 | |||
| 2253 | Ga0501275_000025 | |||
| 2254 | Ga0501035_0004757 | |||
| 2255 | Ga0501035_0010342 | |||
| 2256 | Ga0501035_0011465 | |||
| 2257 | Ga0501035_0012372 | |||
| 2258 | Ga0501035_0020421 | |||
| 2259 | Ga0501035_0024924 | |||
| 2260 | Ga0501035_0044032 | |||
| 2261 | Ga0501035_0130040 | |||
| 2262 | Ga0501044_0007246 | |||
| 2263 | Ga0501044_0008572 | |||
| 2264 | Ga0501044_0009608 | |||
| 2265 | Ga0501044_0011110 | |||
| 2266 | Ga0501044_0018543 | |||
| 2267 | Ga0501044_0024616 | |||
| 2268 | Ga0501044_0028366 | |||
| 2269 | Ga0501044_0029309 | |||
| 2270 | Ga0501044_0076191 | |||
| 2271 | Ga0501044_0085541 | |||
| 2272 | Ga0501044_0100747 | |||
| 2273 | Ga0501044_0163974 | |||
| 2274 | nmdc:mga00v17_215_c1 | |||
| 2275 | nmdc:mga08y16_299301_c1 | |||
| 2276 | nmdc:mga0sz30_56391_c1 | |||
| 2277 | Ga0500643_000031 | |||
| 2278 | Ga0500643_002977 | |||
| 2279 | Ga0500651_0000113 | |||
| 2280 | Ga0500651_0001194 | |||
| 2281 | Ga0500555_000300 | |||
| 2282 | Ga0500597_000195 | |||
| 2283 | Ga0500568_0001305 | |||
| 2284 | Ga0500634_0000182 | |||
| 2285 | Ga0500645_000965 | |||
| 2286 | Ga0500645_044407 | |||
| 2287 | Ga0501084_0033367 | |||
| 2288 | Ga0501084_0161389 | |||
| 2289 | Ga0587084_018696 | |||
| 2290 | Ga0587073_0049003 | |||
| 2291 | Ga0587085_019047 | |||
| 2292 | Ga0587088_027191 | |||
| 2293 | Ga0587088_033105 | |||
| 2294 | Ga0587090_019932 | |||
| 2295 | Ga0587109_035462 | |||
| 2296 | Ga0587115_013587 | |||
| 2297 | Ga0587128_023747 | |||
| 2298 | Ga0587130_005438 | |||
| 2299 | Ga0587062_011668 | |||
| 2300 | Ga0587068_026592 | |||
| 2301 | Ga0587072_035781 | |||
| 2302 | Ga0587114_016948 | |||
| 2303 | Ga0587120_005274 | |||
| 2304 | Ga0587111_0046351 | |||
| 2305 | Ga0501082_0000044 | |||
| 2306 | Ga0501082_0033187 | |||
| 2307 | Ga0501082_0182779 | |||
| 2308 | Ga0466962_0003700 | |||
| 2309 | Ga0466962_0006846 | |||
| 2310 | Ga0466962_0149004 | |||
| 2311 | 2538834074 | |||
| 2312 | 2572254198 | |||
| 2313 | 2595447594 | |||
| 2314 | 2595452902 | |||
| 2315 | 2643829002 | |||
| 2316 | 2643895821 | |||
| 2317 | 2644478013 | |||
| 2318 | 2644528050 | |||
| 2319 | 2687584630 | |||
| 2320 | 2721025619 | |||
| 2321 | 2735834415 | |||
| 2322 | 2739225861 | |||
| 2323 | 2739733951 | |||
| 2324 | 2819564903 | |||
| 2325 | 2842782487 | |||
| 2326 | 2842917297 | |||
| 2327 | 2842920837 | |||
| 2328 | 2852651900 | |||
| 2329 | 2884338955 | |||
| 2330 | 2895395990 | |||
| 2331 | 2904465576 | |||
| 2332 | 2919086351 | |||
| 2333 | 2919407739 | |||
| 2334 | 2928966113 | |||
| 2335 | 2939613262 | |||
| 2336 | 2941473270 | |||
| 2337 | 2953996115 | |||
| 2338 | 8003017805 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy