F491128

General Info

Members Datasets Scaffolds Average Seq Length
1169 839 603 214

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10059856|Ga0157373_100598562
Length 256
Sequence MAIPRAAKTLRRTRIQEEKEELILEAALDVFSVRGFHGSTIDQIADVAGMSKPNLLYYFRTKEAMHRALIDRVLENWLEPLRAFDAEGDPEEEVRSYVRRKLEMARDYPRESRLFANEILQGAPNVIDILKGSLKDLVDEKAEVIRAWIRGGKMADCDPHHLIFSIWSTTQHYADFDVQVQAVLGPRNVVANRFEDAAQFLGDLFARGLGIGSAHKGCRVAIAAIVRGLDPAKIVRHLASRAGFRGLPRLRKGATS

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
48 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
59 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
60 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
61 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
62 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
63 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
64 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
65 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
66 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
67 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
68 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
69 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
70 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
71 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
72 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
73 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
74 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
75 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
76 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
77 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
78 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
79 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
80 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
81 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
82 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
83 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
84 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
85 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
86 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
87 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
88 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
89 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
90 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
91 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
92 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
93 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
94 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
95 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
96 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
97 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
98 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
99 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
100 2643221557 Ensifer sp. Root558 Isolate Unclassified
101 2643221558 Rhizobium sp. Root149 Isolate Unclassified
102 2643221582 Rhizobium sp. Root651 Isolate Unclassified
103 2643221599 Rhizobium sp. Root708 Isolate Unclassified
104 2643221607 Rhizobium sp. Root73 Isolate Unclassified
105 2643221610 Ensifer sp. Root74 Isolate Unclassified
106 2643221618 Ensifer sp. Root231 Isolate Unclassified
107 2643221626 Ensifer sp. Root31 Isolate Unclassified
108 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
109 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
110 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
111 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
112 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
113 2643221655 Ensifer sp. Root1252 Isolate Unclassified
114 2643221659 Ensifer sp. Root127 Isolate Unclassified
115 2643221668 Ensifer sp. Root423 Isolate Unclassified
116 2643221675 Ensifer sp. Root1298 Isolate Unclassified
117 2643221680 Ensifer sp. Root1312 Isolate Unclassified
118 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
119 2643221688 Rhizobium sp. Root482 Isolate Unclassified
120 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
121 2643221693 Rhizobium sp. Root491 Isolate Unclassified
122 2643221698 Ensifer sp. Root142 Isolate Unclassified
123 2643221712 Ensifer sp. Root258 Isolate Unclassified
124 2643221718 Rhizobium sp. Root268 Isolate Unclassified
125 2643221719 Rhizobium sp. Root274 Isolate Unclassified
126 2643221723 Ensifer sp. Root278 Isolate Unclassified
127 2643221726 Ensifer sp. Root954 Isolate Unclassified
128 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
129 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
130 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
131 2718217882 Rhizobium sp. N741 Isolate Nodule
132 2718217927 Rhizobium sp. N324 Isolate Nodule
133 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
134 2718218009 Rhizobium sp. N561 Isolate Nodule
135 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
136 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
137 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
138 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
139 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
140 2718218363 Rhizobium sp. N113 Isolate Nodule
141 2718218365 Rhizobium sp. N731 Isolate Nodule
142 2718218366 Rhizobium sp. N621 Isolate Nodule
143 2718218423 Rhizobium sp. N941 Isolate Nodule
144 2721755514 Rhizobium sp. N6212 Isolate Nodule
145 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
146 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
147 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
148 2721755809 Rhizobium sp. N541 Isolate Nodule
149 2721755810 Rhizobium sp. N871 Isolate Nodule
150 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
151 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
152 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
153 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
154 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
155 2728369365 Rhizobium sp. N1341 Isolate Nodule
156 2728369397 Rhizobium sp. N1314 Isolate Nodule
157 2738541293 Rhizobium sp. GV031 Isolate Unclassified
158 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
159 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
160 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
161 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
162 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
163 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
164 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
165 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
166 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
167 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
168 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
169 2791355256 Rhizobium sp. M10 Isolate Nodule
170 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
171 2791355260 Rhizobium sp. L9 Isolate Nodule
172 2791355261 Rhizobium sp. J15 Isolate Nodule
173 2791355262 Rhizobium sp. M1 Isolate Nodule
174 2791355263 Rhizobium chutanense C5 Isolate Nodule
175 2791355264 Rhizobium sp. S9 Isolate Nodule
176 2791355265 Rhizobium sp. H4 Isolate Nodule
177 2791355266 Rhizobium sp. L43 Isolate Nodule
178 2791355267 Rhizobium sp. L18 Isolate Nodule
179 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
180 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
181 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
182 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
183 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
184 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
185 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
186 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
187 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
188 2802429633 Rhizobium anhuiense J3 Isolate Nodule
189 2802429634 Rhizobium anhuiense S10 Isolate Nodule
190 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
191 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
192 2802429637 Rhizobium anhuiense C15 Isolate Nodule
193 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
194 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
195 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
196 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
197 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
198 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
199 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
200 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
201 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
202 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
203 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
204 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
205 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
206 2838048938 Rhizobium pisi 27/80 Isolate Nodule
207 2838061910 Rhizobium phaseoli L15 Isolate Nodule
208 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
209 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
210 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
211 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
212 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
213 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
214 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
215 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
216 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
217 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
218 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
219 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
220 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
221 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
222 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
223 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
224 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
225 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
226 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
227 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
228 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
229 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
230 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
231 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
232 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
233 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
234 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
235 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
236 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
237 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
238 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
239 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
240 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
241 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
242 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
243 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
244 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
245 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
246 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
247 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
248 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
249 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
250 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
251 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
252 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
253 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
254 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
255 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
256 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
257 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
258 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
259 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
260 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
261 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
262 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
263 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
264 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
265 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
266 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
267 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
268 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
269 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
270 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
271 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
272 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
273 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
274 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
275 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
276 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
277 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
278 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
279 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
280 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
281 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
282 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
283 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
284 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
285 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
286 2844163670 Ensifer sp. 1H6 Isolate Unclassified
287 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
288 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
289 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
290 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
291 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
292 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
293 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
294 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
295 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
296 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
297 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
298 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
299 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
300 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
301 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
302 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
303 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
304 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
305 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
306 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
307 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
308 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
309 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
310 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
311 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
312 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
313 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
314 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
315 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
316 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
317 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
318 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
319 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
320 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
321 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
322 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
323 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
324 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
325 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
326 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
327 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
328 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
329 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
330 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
331 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
332 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
333 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
334 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
335 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
336 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
337 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
338 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
339 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
340 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
341 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
342 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
343 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
344 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
345 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
346 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
347 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
348 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
349 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
350 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
351 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
352 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
353 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
354 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
355 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
356 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
357 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
358 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
359 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
360 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
361 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
362 2933599457 Rhizobium phaseoli M3 Isolate Nodule
363 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
364 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
365 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
366 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
367 2936381700 Rhizobium chutanense C16 Isolate Unclassified
368 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
369 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
370 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
371 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
372 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
373 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
374 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
375 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
376 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
377 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
378 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
379 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
380 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
381 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
382 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
383 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
384 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
385 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
386 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
387 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
388 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
389 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
390 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
391 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
392 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
393 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
394 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
395 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
396 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
397 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
398 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
399 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
400 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
401 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
402 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
403 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
404 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
405 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
406 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
407 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
408 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
409 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
410 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
411 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
412 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
413 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
414 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
415 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
416 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
417 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
418 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
419 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
420 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
421 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
422 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
423 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
424 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
425 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
426 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
427 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
428 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
429 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
430 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
431 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
432 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
433 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
434 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
435 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
436 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
437 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
438 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
439 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
440 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
441 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
442 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
443 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
444 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
445 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
446 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
447 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
448 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
449 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
450 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
451 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
452 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
453 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
454 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
455 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
456 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
457 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
458 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
459 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
460 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
461 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
462 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
463 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
464 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
465 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
466 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
467 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
468 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
469 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
470 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
471 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
472 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
473 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
474 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
475 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
476 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
477 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
478 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
479 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
480 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
481 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
482 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
483 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
484 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
485 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
486 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
487 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
488 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
489 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
490 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
491 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
492 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
493 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
494 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
495 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
496 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
497 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
498 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
499 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
500 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
501 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
502 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
503 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
504 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
505 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
506 2996887358 Rhizobium sp. R711 Isolate Nodule
507 2996893221 Rhizobium sp. R635 Isolate Nodule
508 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
509 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
510 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
511 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
512 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
513 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
514 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
515 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
516 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
517 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
518 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
519 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
520 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
521 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
522 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
523 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
524 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
525 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
526 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
527 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
528 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
529 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
530 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
531 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
532 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
533 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
534 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
535 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
536 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
537 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
538 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
539 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
540 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
541 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
542 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
543 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
544 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
545 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
546 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
547 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
548 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
549 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
550 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
551 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
552 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
553 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
554 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
555 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
556 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
557 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
558 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
559 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
560 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
561 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
562 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
563 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
564 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
565 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
566 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
567 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
568 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
569 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
570 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
571 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
572 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
573 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
574 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
575 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
576 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
577 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
578 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
579 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
580 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
581 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
582 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
583 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
584 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
585 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
586 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
587 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
588 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
589 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
590 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
591 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
592 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
593 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
594 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
595 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
596 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
597 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
598 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
599 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
600 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
601 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
602 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
603 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
604 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
605 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
606 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
607 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
608 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
609 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
610 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
611 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
612 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
613 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
614 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
615 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
616 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
617 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
618 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
619 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
631 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
634 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
635 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
636 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
637 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
639 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
640 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
641 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
642 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
643 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
644 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
645 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
646 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
647 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
648 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
649 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
650 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
651 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
652 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
653 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
654 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
655 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
656 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
657 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
658 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
659 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
660 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
661 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
662 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
663 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
664 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
665 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
666 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
667 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
668 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
669 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
670 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
671 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
672 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
673 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
674 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
675 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
676 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
677 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
678 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
679 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
680 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
681 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
682 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
683 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
684 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
685 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
686 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
687 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
688 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
689 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
690 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
691 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
692 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
693 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
694 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
695 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
696 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
697 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
698 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
699 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
700 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
701 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
702 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
703 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
704 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
705 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
706 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
707 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
708 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
709 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
710 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
711 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
712 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
713 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
714 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
715 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
716 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
717 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
718 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
719 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
720 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
721 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
722 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
723 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
724 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
725 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
726 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
727 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
728 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
729 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
730 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
731 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
732 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
733 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
734 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
735 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
736 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
737 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
738 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
739 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
740 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
741 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
742 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
743 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
744 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
745 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
746 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
747 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
748 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
749 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
750 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
751 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
752 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
753 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
754 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
755 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
756 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
757 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
758 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
759 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
760 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
761 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
762 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
763 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
764 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
765 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
766 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
767 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
768 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
769 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
770 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
771 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
772 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
773 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
774 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
775 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
776 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
777 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
778 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
779 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
780 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
781 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
782 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
783 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
784 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
785 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
786 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
787 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
788 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
789 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
790 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
791 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
792 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
793 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
794 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
795 8005258706 Rhizobium sp. R693 Isolate Nodule
796 8005275841 Rhizobium sp. N4311 Isolate Nodule
797 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
798 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
799 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
800 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
801 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
802 8005321885 Rhizobium sp. R72 Isolate Nodule
803 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
804 8005382845 Rhizobium sp. R634 Isolate Nodule
805 8005395548 Rhizobium sp. R339 Isolate Nodule
806 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
807 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
808 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
809 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
810 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
811 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
812 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
813 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
814 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
815 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
816 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
817 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
818 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
819 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
820 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
821 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
822 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
823 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
824 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
825 8018176218 Rhizobium sp. N122 Isolate Nodule
826 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
827 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
828 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
829 8024501048 Rhizobium sp. H4 Isolate Nodule
830 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
831 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
832 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
833 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
834 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
835 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
836 8056382006 Rhizobium croatiense 13T Isolate Nodule
837 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
838 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
839 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.58
Metatranscriptomes 0
Isolates 48.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 19.08
Nodule 37.13
Rhizoplane 1.28
Rhizosphere 23.87
Stem 0
Stem Tuber 0
Unclassified 18.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003788 3300001979 Bacteria 6584
2 JGI25155J39150_1000066 3300002704 Bacteria 69429
3 JGI25156J39149_1000075 3300002705 Bacteria 76505
4 JGI25162J39368_1000149 3300002737 Bacteria 76227
5 JGI25162J39368_1000211 3300002737 Bacteria 61063
6 JGI25154J39366_1000075 3300002738 Bacteria 91249
7 JGI25158J39367_1007705 3300002739 Bacteria 1511
8 JGI25157J39369_1000051 3300002741 Bacteria 111770
9 JGI25157J39369_1000077 3300002741 Bacteria 86251
10 JGI25152J39213_1001494 3300002773 Bacteria 9965
11 JGI25152J39213_1002234 3300002773 Bacteria 7523
12 JGI25152J39213_1005813 3300002773 Bacteria 3500
13 JGI25150J39212_1000091 3300002774 Bacteria 52487
14 JGI25159J45721_1000008 3300002987 Bacteria 172667
15 JGI25159J45721_1000108 3300002987 Bacteria 39183
16 JGI25159J45721_1000780 3300002987 Bacteria 13855
17 JGI25151J46595_10000027 3300003187 Bacteria 208739
18 JGI25151J46595_10002158 3300003187 Bacteria 12188
19 JGI25151J46595_10004382 3300003187 Bacteria 7481
20 JGI25151J46595_10012482 3300003187 Bacteria 3863
21 JGI25151J46595_10023359 3300003187 Bacteria 2548
22 JGI25151J46595_10047616 3300003187 Bacteria 1490
23 JGI25151J46595_10055434 3300003187 Bacteria 1307
24 JGI25151J46595_10074492 3300003187 Bacteria 1011
25 JGI25165J46597_1000938 3300003214 Bacteria 19980
26 JGI25165J46597_1002398 3300003214 Bacteria 6181
27 JGI25165J46597_1002483 3300003214 Bacteria 5872
28 JGI25165J46597_1004248 3300003214 Bacteria 3148
29 JGI25165J46597_1009796 3300003214 Bacteria 1424
30 JGI25165J46597_1017219 3300003214 Bacteria 964
31 JGI25153J46596_10000608 3300003215 Bacteria 21909
32 JGI25153J46596_10008080 3300003215 Bacteria 5074
33 JGI25153J46596_10009737 3300003215 Bacteria 4420
34 JGI25153J46596_10012364 3300003215 Bacteria 3689
35 rootL2_10086412 3300003322 Bacteria 4482
36 rootH1_10065041 3300003323 Bacteria 2023
37 JGI25160J50197_1000001 3300003354 Bacteria 782301
38 JGI25160J50197_1000033 3300003354 Bacteria 172667
39 JGI25160J50197_1004300 3300003354 Bacteria 6173
40 JGI25160J50197_1007945 3300003354 Bacteria 4086
41 JGI25160J50197_1008515 3300003354 Bacteria 3902
42 JGI25161J50226_1000001 3300003374 Bacteria 655036
43 JGI25161J50226_1000163 3300003374 Bacteria 46470
44 JGI25161J50226_1001306 3300003374 Bacteria 7853
45 Ga0055539_1006088 3300003752 Bacteria 1549
46 Ga0055526_1000653 3300003771 Bacteria 26790
47 Ga0055526_1003270 3300003771 Bacteria 10402
48 Ga0055526_1004503 3300003771 Bacteria 8344
49 Ga0055526_1009408 3300003771 Bacteria 4703
50 Ga0055526_1018944 3300003771 Bacteria 2534
51 Ga0055526_1053325 3300003771 Bacteria 906
52 Ga0055524_1001395 3300003775 Bacteria 13921
53 Ga0055524_1003836 3300003775 Bacteria 7138
54 Ga0055524_1015273 3300003775 Bacteria 2807
55 Ga0055524_1050455 3300003775 Bacteria 948
56 Ga0055536_1011754 3300003781 Bacteria 3313
57 Ga0055536_1013708 3300003781 Bacteria 2899
58 Ga0055528_1000247 3300003790 Bacteria 45698
59 Ga0055528_1000662 3300003790 Bacteria 25014
60 Ga0055528_1002272 3300003790 Bacteria 10414
61 Ga0055528_1014668 3300003790 Bacteria 2883
62 Ga0055528_1016745 3300003790 Bacteria 2574
63 Ga0055528_1028597 3300003790 Bacteria 1534
64 Ga0055528_1040398 3300003790 Bacteria 1052
65 Ga0055540_1000607 3300003792 Bacteria 25671
66 Ga0055531_10020251 3300003794 Bacteria 2642
67 Ga0058692_1001033 3300003856 Bacteria 10914
68 Ga0055543_1000007 3300004625 Bacteria 204042
69 Ga0055543_1000026 3300004625 Bacteria 136177
70 Ga0055543_1000104 3300004625 Bacteria 73576
71 Ga0055543_1000108 3300004625 Bacteria 71519
72 Ga0065165_1000008 3300005262 Bacteria 334429
73 Ga0065165_1000178 3300005262 Bacteria 113319
74 Ga0065165_1005090 3300005262 Bacteria 7640
75 Ga0065165_1012225 3300005262 Bacteria 3511
76 Ga0065165_1019621 3300005262 Bacteria 2405
77 Ga0065714_10204228 3300005288 Bacteria 886
78 Ga0070670_100001446 3300005331 Bacteria 19064
79 Ga0070691_10157642 3300005341 Bacteria 1168
80 Ga0070668_100042312 3300005347 Bacteria 3491
81 Ga0070668_100094527 3300005347 Bacteria 2360
82 Ga0070669_100083445 3300005353 Bacteria 2383
83 Ga0070671_100079695 3300005355 Bacteria 2738
84 Ga0070659_100651969 3300005366 Bacteria 908
85 Ga0068867_100905795 3300005459 Bacteria 794
86 Ga0070699_100038600 3300005518 Bacteria 4135
87 Ga0068853_100033702 3300005539 Bacteria 4345
88 Ga0070665_100171732 3300005548 Bacteria 2169
89 Ga0070665_100235377 3300005548 Bacteria 1832
90 Ga0070665_100287596 3300005548 Bacteria 1646
91 Ga0070665_100503729 3300005548 Bacteria 1222
92 Ga0070665_100827186 3300005548 Bacteria 939
93 Ga0068855_100189071 3300005563 Bacteria 2324
94 Ga0068857_100287715 3300005577 Bacteria 1513
95 Ga0068854_100272227 3300005578 Bacteria 1360
96 Ga0068854_100625399 3300005578 Bacteria 922
97 Ga0068856_100048755 3300005614 Bacteria 4174
98 Ga0068852_100187250 3300005616 Bacteria 1950
99 Ga0075365_10003643 3300006038 Bacteria 7985
100 Ga0075365_10014685 3300006038 Bacteria 4716
101 Ga0075368_10025975 3300006042 Bacteria 2250
102 Ga0075363_100013044 3300006048 Bacteria 4017
103 Ga0075363_100088881 3300006048 Bacteria 1698
104 Ga0075364_10084672 3300006051 Bacteria 2099
105 Ga0075362_10007229 3300006177 Bacteria 4190
106 Ga0075362_10008871 3300006177 Bacteria 3865
107 Ga0075367_10001877 3300006178 Bacteria 9292
108 Ga0075367_10180137 3300006178 Bacteria 1317
109 Ga0075369_10004638 3300006186 Bacteria 5096
110 Ga0075369_10083430 3300006186 Bacteria 1419
111 Ga0075369_10133907 3300006186 Bacteria 1127
112 Ga0075369_10138065 3300006186 Bacteria 1110
113 Ga0075366_10014942 3300006195 Bacteria 4439
114 Ga0075366_10088768 3300006195 Bacteria 1851
115 Ga0075370_10015910 3300006353 Bacteria 4038
116 Ga0075370_10032694 3300006353 Bacteria 2909
117 Ga0079104_1004042 3300006946 Bacteria 6477
118 Ga0099826_10002800 3300006948 Bacteria 11467
119 Ga0099826_10084719 3300006948 Bacteria 1960
120 Ga0105251_10011125 3300009011 Bacteria 5160
121 Ga0105250_10025969 3300009092 Bacteria 2359
122 Ga0105240_10000014 3300009093 Bacteria 482033
123 Ga0105243_10004033 3300009148 Bacteria 11688
124 Ga0105243_10173488 3300009148 Bacteria 1869
125 Ga0105242_11556278 3300009176 Bacteria 693
126 Ga0105248_10073235 3300009177 Bacteria 3850
127 Ga0105237_10034929 3300009545 Bacteria 5088
128 Ga0105249_10176767 3300009553 Bacteria 2074
129 Ga0105249_10372058 3300009553 Bacteria 1453
130 Ga0123341_1000018 3300009765 Bacteria 81421
131 Ga0123342_1019829 3300009766 Bacteria 5039
132 Ga0123342_1021678 3300009766 Bacteria 4474
133 Ga0105239_10133420 3300010375 Bacteria 2763
134 Ga0105239_10439865 3300010375 Bacteria 1478
135 Ga0105239_11283490 3300010375 Bacteria 845
136 Ga0105246_10244698 3300011119 Bacteria 1420
137 Ga0157373_10008186 3300013100 Bacteria 7777
138 Ga0157373_10059856 3300013100 Bacteria 2698
139 Ga0157371_10000165 3300013102 Bacteria 96321
140 Ga0157370_10000015 3300013104 Bacteria 185771
141 Ga0157370_10000295 3300013104 Bacteria 63297
142 Ga0157370_10733755 3300013104 Bacteria 901
143 Ga0157370_10920224 3300013104 Bacteria 793
144 Ga0171463_1007 3300013249 Bacteria 301198
145 Ga0157374_10453016 3300013296 Bacteria 1285
146 Ga0157378_11177236 3300013297 Bacteria 805
147 Ga0163163_10261109 3300014325 Bacteria 1783
148 Ga0163163_10694136 3300014325 Bacteria 1081
149 Ga0182007_10000385 3300015262 Bacteria 27600
150 Ga0182005_1012099 3300015265 Bacteria 2444
151 Ga0183363_1084 3300015690 Bacteria 28436
152 Ga0214544_1000010 3300021320 Bacteria 270164
153 Ga0214542_1000023 3300021321 Bacteria 191557
154 Ga0214542_1018659 3300021321 Bacteria 5780
155 Ga0214543_1000019 3300021327 Bacteria 267908
156 Ga0214543_1000022 3300021327 Bacteria 241930
157 Ga0228711_1000017 3300022739 Bacteria 121084
158 Ga0228710_1000005 3300022740 Bacteria 233531
159 Ga0209435_100005 3300025206 Bacteria 573745
160 Ga0209436_100058 3300025208 Bacteria 60755
161 Ga0209436_107112 3300025208 Bacteria 2377
162 Ga0209672_102660 3300025228 Bacteria 4187
163 Ga0207427_101601 3300025231 Bacteria 7738
164 Ga0207427_109989 3300025231 Bacteria 1001
165 Ga0209437_100058 3300025233 Bacteria 357279
166 Ga0209437_100060 3300025233 Bacteria 355034
167 Ga0207425_1000043 3300025245 Bacteria 208791
168 Ga0207425_1000436 3300025245 Bacteria 27617
169 Ga0207425_1006357 3300025245 Bacteria 3239
170 Ga0207425_1009106 3300025245 Bacteria 2492
171 Ga0209646_1000011 3300025246 Bacteria 573745
172 Ga0209646_1004996 3300025246 Bacteria 2356
173 Ga0209646_1008318 3300025246 Bacteria 1672
174 Ga0209026_1000008 3300025250 Bacteria 573745
175 Ga0209677_100289 3300025253 Bacteria 33302
176 Ga0209148_1009441 3300025254 Bacteria 1898
177 Ga0209759_1000004 3300025256 Bacteria 573745
178 Ga0209129_1000072 3300025258 Bacteria 208805
179 Ga0209129_1000128 3300025258 Bacteria 130420
180 Ga0209129_1000976 3300025258 Bacteria 17199
181 Ga0209129_1002097 3300025258 Bacteria 10213
182 Ga0209129_1002855 3300025258 Bacteria 7982
183 Ga0209233_1000137 3300025261 Bacteria 200314
184 Ga0209233_1000149 3300025261 Bacteria 181183
185 Ga0209233_1000160 3300025261 Bacteria 159035
186 Ga0209233_1000391 3300025261 Bacteria 37267
187 Ga0209673_1000025 3300025273 Bacteria 404572
188 Ga0209673_1000125 3300025273 Bacteria 168465
189 Ga0209673_1000256 3300025273 Bacteria 100514
190 Ga0209673_1001756 3300025273 Bacteria 18064
191 Ga0209673_1002926 3300025273 Bacteria 10752
192 Ga0209673_1003474 3300025273 Bacteria 9256
193 Ga0209673_1007827 3300025273 Bacteria 4847
194 Ga0209673_1008164 3300025273 Bacteria 4703
195 Ga0209673_1008302 3300025273 Bacteria 4634
196 Ga0209130_1000003 3300025284 Bacteria 677988
197 Ga0209130_1000017 3300025284 Bacteria 388431
198 Ga0209130_1000023 3300025284 Bacteria 359355
199 Ga0209675_1010916 3300025291 Bacteria 3057
200 Ga0209676_1001868 3300025292 Bacteria 17327
201 Ga0209676_1006852 3300025292 Bacteria 5518
202 Ga0209676_1024122 3300025292 Bacteria 1977
203 Ga0209025_1000120 3300025294 Bacteria 208791
204 Ga0209025_1000153 3300025294 Bacteria 170548
205 Ga0209025_1000154 3300025294 Bacteria 170288
206 Ga0209025_1000451 3300025294 Bacteria 80470
207 Ga0209025_1000537 3300025294 Bacteria 71838
208 Ga0209025_1001209 3300025294 Bacteria 36250
209 Ga0209025_1003817 3300025294 Bacteria 13758
210 Ga0209025_1005577 3300025294 Bacteria 10192
211 Ga0209025_1011938 3300025294 Bacteria 5647
212 Ga0209025_1039768 3300025294 Bacteria 2046
213 Ga0209564_1000013 3300025295 Bacteria 775755
214 Ga0209564_1000259 3300025295 Bacteria 112570
215 Ga0209564_1000841 3300025295 Bacteria 41363
216 Ga0209564_1002070 3300025295 Bacteria 17245
217 Ga0209564_1002604 3300025295 Bacteria 13811
218 Ga0209564_1012686 3300025295 Bacteria 3649
219 Ga0209564_1038895 3300025295 Bacteria 1316
220 Ga0209758_1000058 3300025297 Bacteria 331603
221 Ga0209758_1000111 3300025297 Bacteria 208790
222 Ga0209758_1000254 3300025297 Bacteria 107330
223 Ga0209758_1000592 3300025297 Bacteria 56476
224 Ga0209758_1000678 3300025297 Bacteria 50806
225 Ga0209758_1002403 3300025297 Bacteria 19211
226 Ga0209758_1003028 3300025297 Bacteria 16025
227 Ga0209758_1017165 3300025297 Bacteria 3623
228 Ga0209758_1037612 3300025297 Bacteria 1868
229 Ga0209050_1003484 3300025298 Bacteria 11532
230 Ga0209050_1003752 3300025298 Bacteria 10896
231 Ga0209050_1005160 3300025298 Bacteria 8364
232 Ga0209050_1062493 3300025298 Bacteria 872
233 Ga0209256_1000211 3300025299 Bacteria 110131
234 Ga0209256_1000283 3300025299 Bacteria 89387
235 Ga0209256_1000669 3300025299 Bacteria 46351
236 Ga0209256_1001412 3300025299 Bacteria 24978
237 Ga0209256_1003656 3300025299 Bacteria 10516
238 Ga0209256_1004483 3300025299 Bacteria 8729
239 Ga0209256_1006546 3300025299 Bacteria 6114
240 Ga0209256_1016918 3300025299 Bacteria 2454
241 Ga0209256_1040947 3300025299 Bacteria 1180
242 Ga0207426_1000006 3300025302 Bacteria 1025969
243 Ga0207426_1000011 3300025302 Bacteria 791203
244 Ga0207426_1000087 3300025302 Bacteria 288870
245 Ga0207426_1000208 3300025302 Bacteria 140385
246 Ga0207426_1000936 3300025302 Bacteria 29086
247 Ga0209051_1000434 3300025303 Bacteria 56673
248 Ga0209051_1002705 3300025303 Bacteria 12332
249 Ga0209051_1004907 3300025303 Bacteria 8010
250 Ga0209051_1011248 3300025303 Bacteria 4437
251 Ga0209051_1012412 3300025303 Bacteria 4122
252 Ga0209051_1039670 3300025303 Bacteria 1697
253 Ga0209257_1004213 3300025304 Bacteria 11397
254 Ga0209257_1004483 3300025304 Bacteria 10782
255 Ga0209257_1007250 3300025304 Bacteria 6779
256 Ga0209257_1016341 3300025304 Bacteria 3007
257 Ga0209257_1034067 3300025304 Bacteria 1594
258 Ga0207645_10109053 3300025907 Bacteria 1791
259 Ga0207695_10000037 3300025913 Bacteria 476303
260 Ga0207671_10000080 3300025914 Bacteria 148567
261 Ga0207681_10091707 3300025923 Bacteria 2171
262 Ga0207650_10000624 3300025925 Bacteria 28219
263 Ga0207644_10027543 3300025931 Bacteria 3927
264 Ga0207706_10351285 3300025933 Bacteria 1282
265 Ga0207709_10127522 3300025935 Bacteria 1728
266 Ga0207667_10131111 3300025949 Bacteria 2582
267 Ga0207658_10147628 3300025986 Bacteria 1912
268 Ga0207639_10025043 3300026041 Bacteria 4325
269 Ga0207702_10054621 3300026078 Bacteria 3385
270 Ga0207674_10351580 3300026116 Bacteria 1425
271 Ga0207698_10047370 3300026142 Bacteria 3256
272 Ga0209281_1000082 3300027111 Bacteria 257684
273 Ga0209281_1000484 3300027111 Bacteria 55133
274 Ga0209371_1000022 3300027312 Bacteria 536342
275 Ga0209371_1002954 3300027312 Bacteria 8852
276 Ga0209282_1000006 3300027666 Bacteria 276998
277 Ga0209282_1001136 3300027666 Bacteria 14219
278 Ga0209282_1068856 3300027666 Bacteria 1936
279 Ga0209813_10004514 3300027866 Bacteria 3329
280 Ga0209813_10096147 3300027866 Bacteria 1001
281 Ga0268266_10292161 3300028379 Bacteria 1518
282 Ga0268266_10314642 3300028379 Bacteria 1464
283 Ga0307515_10000017 3300028794 Bacteria 550465
284 Ga0307515_10000130 3300028794 Bacteria 179263
285 Ga0307515_10005257 3300028794 Bacteria 26313
286 Ga0307515_10042022 3300028794 Bacteria 7169
287 Ga0268256_1000019 3300030500 Bacteria 587949
288 Ga0268256_1002919 3300030500 Bacteria 8174
289 Ga0265327_10016350 3300031251 Bacteria 4715
290 Ga0307513_10000852 3300031456 Bacteria 44393
291 Ga0307513_10056156 3300031456 Bacteria 4206
292 Ga0307513_10182779 3300031456 Bacteria 1958
293 Ga0307408_100080226 3300031548 Bacteria 2437
294 Ga0307408_100121403 3300031548 Bacteria 2025
295 Ga0307408_100338903 3300031548 Bacteria 1272
296 Ga0316575_10020985 3300031665 Bacteria 2510
297 Ga0307405_10002738 3300031731 Bacteria 7893
298 Ga0307406_10014143 3300031901 Bacteria 4585
299 Ga0307412_10018020 3300031911 Bacteria 4238
300 Ga0307412_10257700 3300031911 Bacteria 1358
301 Ga0315914_1000003 3300031967 Bacteria 314370
302 Ga0307409_100089557 3300031995 Bacteria 2516
303 Ga0307409_100164769 3300031995 Bacteria 1944
304 Ga0307409_100260217 3300031995 Bacteria 1592
305 Ga0307414_10056049 3300032004 Bacteria 2762
306 Ga0307411_10158468 3300032005 Bacteria 1692
307 Ga0315913_1000001 3300033430 Bacteria 284459
308 Ga0315915_1000008 3300033464 Bacteria 258517
309 Ga0373925_0585369 3300037068 Bacteria 919
310 Ga0395905_0002480 3300037471 Bacteria 20425
311 Ga0395905_0259794 3300037471 Bacteria 1621
312 Ga0439439_0045386 3300041406 Bacteria 1146
313 Ga0439466_0020023 3300041411 Bacteria 2390
314 Ga0439466_0070051 3300041411 Bacteria 1118
315 Ga0439465_0011939 3300041413 Bacteria 2720
316 Ga0451793_0390538 3300041452 Bacteria 1808
317 Ga0451802_0380304 3300041460 Bacteria 1120
318 Ga0451837_0579824 3300041494 Bacteria 1221
319 Ga0451837_1454385 3300041494 Bacteria 2193
320 Ga0451839_0129781 3300041496 Bacteria 1321
321 Ga0451841_0349814 3300041498 Bacteria 1987
322 Ga0451845_0929087 3300041501 Bacteria 1604
323 Ga0451845_0940005 3300041501 Bacteria 1160
324 Ga0451847_0518503 3300041503 Bacteria 1367
325 Ga0451849_1316711 3300041505 Bacteria 1516
326 Ga0451851_0685669 3300041507 Bacteria 5290
327 Ga0451843_0014488 3300041509 Bacteria 1757
328 Ga0451855_0518258 3300041511 Bacteria 1331
329 Ga0439448_0112238 3300042005 Bacteria 932
330 Ga0439432_068820 3300042006 Bacteria 1082
331 Ga0439432_070457 3300042006 Bacteria 1067
332 Ga0439462_0066998 3300042015 Bacteria 974
333 Ga0450910_025641 3300042147 Bacteria 908
334 Ga0439459_0007619 3300042438 Bacteria 1833
335 Ga0450918_034782 3300042531 Bacteria 895
336 Ga0466965_0201646 3300044683 Bacteria 1055
337 Ga0466963_0094205 3300044694 Bacteria 2042
338 Ga0466958_0134493 3300045836 Bacteria 1554
339 Ga0495592_0138707 3300046454 Bacteria 1693
340 Ga0495629_0148195 3300046459 Bacteria 1631
341 Ga0495638_0000746 3300046460 Bacteria 34841
342 Ga0495638_0026696 3300046460 Bacteria 3742
343 Ga0495638_0097787 3300046460 Bacteria 1759
344 Ga0495638_0279828 3300046460 Bacteria 907
345 Ga0495605_0006714 3300046474 Bacteria 6581
346 Ga0495605_0215382 3300046474 Bacteria 832
347 Ga0495664_0113926 3300046477 Bacteria 1633
348 Ga0495585_0008427 3300046492 Bacteria 6250
349 Ga0495585_0009784 3300046492 Bacteria 5736
350 Ga0495585_0116693 3300046492 Bacteria 1415
351 Ga0495607_0200986 3300046501 Bacteria 986
352 Ga0495583_0006653 3300046506 Bacteria 7499
353 Ga0495583_0028326 3300046506 Bacteria 2755
354 Ga0495606_0003935 3300046507 Bacteria 15284
355 Ga0495606_0020624 3300046507 Bacteria 4851
356 Ga0495610_0002265 3300046512 Bacteria 16259
357 Ga0495610_0006541 3300046512 Bacteria 7984
358 Ga0495618_0162508 3300046514 Bacteria 1423
359 Ga0495628_0492586 3300046516 Bacteria 886
360 Ga0495631_0005776 3300046518 Bacteria 6453
361 Ga0495631_0051559 3300046518 Bacteria 1798
362 Ga0495632_0007633 3300046519 Bacteria 6762
363 Ga0495632_0026990 3300046519 Bacteria 3014
364 Ga0495643_0062431 3300046522 Bacteria 1972
365 Ga0495643_0078135 3300046522 Bacteria 1728
366 Ga0495643_0120276 3300046522 Bacteria 1327
367 Ga0495648_0063942 3300046524 Bacteria 2170
368 Ga0495648_0082233 3300046524 Bacteria 1829
369 Ga0495648_0123541 3300046524 Bacteria 1387
370 Ga0495654_0083310 3300046530 Bacteria 1495
371 Ga0495609_0010907 3300046538 Bacteria 4341
372 Ga0495597_0005601 3300046542 Bacteria 6624
373 Ga0495622_0018804 3300046557 Bacteria 3218
374 Ga0495633_0009077 3300046558 Bacteria 5528
375 Ga0495656_0105174 3300046615 Bacteria 1312
376 Ga0495668_0006000 3300046616 Bacteria 8064
377 Ga0495611_0009032 3300046648 Bacteria 4216
378 Ga0495625_0032768 3300046660 Bacteria 3849
379 Ga0495625_0047808 3300046660 Bacteria 3084
380 Ga0495625_0120288 3300046660 Bacteria 1787
381 Ga0495588_0002287 3300046674 Bacteria 8201
382 Ga0495588_0042451 3300046674 Bacteria 2325
383 Ga0495588_0059283 3300046674 Bacteria 1980
384 Ga0495657_0093998 3300046675 Bacteria 1918
385 Ga0495658_0037279 3300046683 Bacteria 2687
386 Ga0495670_0026395 3300046691 Bacteria 2875
387 Ga0495649_0129445 3300046694 Bacteria 1332
388 Ga0495600_0039143 3300046809 Bacteria 3087
389 Ga0495660_0003412 3300046810 Bacteria 9835
390 Ga0495660_0071768 3300046810 Bacteria 1835
391 Ga0495604_0047267 3300047317 Bacteria 3352
392 Ga0495636_0045643 3300047318 Bacteria 1827
393 Ga0495687_012262 3300047443 Bacteria 4541
394 Ga0495681_0002688 3300047470 Bacteria 12597
395 Ga0495686_0003605 3300047472 Bacteria 13275
396 Ga0495686_0007947 3300047472 Bacteria 7869
397 Ga0495686_0022549 3300047472 Bacteria 4166
398 Ga0495686_0032290 3300047472 Bacteria 3389
399 Ga0495686_0168117 3300047472 Bacteria 1277
400 Ga0495626_0090455 3300048091 Bacteria 1346
401 Ga0496102_0374896 3300048905 Bacteria 1339
402 Ga0496106_0000206 3300048909 Bacteria 41054
403 Ga0496110_0227179 3300048913 Bacteria 1697
404 Ga0496111_0103939 3300048914 Bacteria 2089
405 Ga0496111_0133822 3300048914 Bacteria 1835
406 Ga0496116_0002588 3300048919 Bacteria 18844
407 Ga0496116_0013733 3300048919 Bacteria 6511
408 Ga0496116_0014973 3300048919 Bacteria 6154
409 Ga0496116_0024233 3300048919 Bacteria 4493
410 Ga0496116_0032986 3300048919 Bacteria 3682
411 Ga0496116_0041518 3300048919 Bacteria 3155
412 Ga0496116_0059647 3300048919 Bacteria 2480
413 Ga0496116_0063443 3300048919 Bacteria 2380
414 Ga0496116_0074708 3300048919 Bacteria 2130
415 Ga0496116_0095276 3300048919 Bacteria 1797
416 Ga0496116_0127558 3300048919 Bacteria 1458
417 Ga0496116_0280500 3300048919 Bacteria 807
418 Ga0496117_0000002 3300048920 Bacteria 2483758
419 Ga0496117_0006417 3300048920 Bacteria 11920
420 Ga0496117_0016935 3300048920 Bacteria 6111
421 Ga0496117_0018549 3300048920 Bacteria 5756
422 Ga0496117_0020840 3300048920 Bacteria 5332
423 Ga0496117_0214582 3300048920 Bacteria 1076
424 Ga0496117_0283163 3300048920 Bacteria 886
425 Ga0496118_0000736 3300048921 Bacteria 52853
426 Ga0496118_0003614 3300048921 Bacteria 19207
427 Ga0496118_0012215 3300048921 Bacteria 8273
428 Ga0496118_0013249 3300048921 Bacteria 7820
429 Ga0496118_0015735 3300048921 Bacteria 6984
430 Ga0496118_0024569 3300048921 Bacteria 5196
431 Ga0496118_0031374 3300048921 Bacteria 4407
432 Ga0496118_0111121 3300048921 Bacteria 1818
433 Ga0496118_0155626 3300048921 Bacteria 1422
434 Ga0496119_0051829 3300048922 Bacteria 2518
435 Ga0496119_0123203 3300048922 Bacteria 1422
436 Ga0496119_0196193 3300048922 Bacteria 1048
437 Ga0496120_0000534 3300048923 Bacteria 58507
438 Ga0496120_0078409 3300048923 Bacteria 1796
439 Ga0496120_0094728 3300048923 Bacteria 1588
440 Ga0496120_0173112 3300048923 Bacteria 1066
441 Ga0496121_0000003 3300048924 Bacteria 1191431
442 Ga0496121_0003150 3300048924 Bacteria 23794
443 Ga0496121_0005802 3300048924 Bacteria 15658
444 Ga0496121_0015046 3300048924 Bacteria 8142
445 Ga0496121_0016685 3300048924 Bacteria 7558
446 Ga0496121_0046075 3300048924 Bacteria 3737
447 Ga0496121_0070292 3300048924 Bacteria 2821
448 Ga0496121_0077913 3300048924 Bacteria 2637
449 Ga0496121_0146056 3300048924 Bacteria 1747
450 Ga0496121_0199453 3300048924 Bacteria 1427
451 Ga0496121_0281553 3300048924 Bacteria 1137
452 Ga0496121_0330959 3300048924 Bacteria 1022
453 Ga0496121_0528230 3300048924 Bacteria 743
454 Ga0496122_0000004 3300048925 Bacteria 645283
455 Ga0496122_0000042 3300048925 Bacteria 280482
456 Ga0496122_0001309 3300048925 Bacteria 40891
457 Ga0496122_0004381 3300048925 Bacteria 17581
458 Ga0496122_0007678 3300048925 Bacteria 11890
459 Ga0496122_0015087 3300048925 Bacteria 7411
460 Ga0496122_0028356 3300048925 Bacteria 4754
461 Ga0496122_0074739 3300048925 Bacteria 2395
462 Ga0496122_0132371 3300048925 Bacteria 1581
463 Ga0496122_0144349 3300048925 Bacteria 1482
464 Ga0496123_0000007 3300048926 Bacteria 645283
465 Ga0496123_0000030 3300048926 Bacteria 291764
466 Ga0496123_0002726 3300048926 Bacteria 21189
467 Ga0496123_0005862 3300048926 Bacteria 12166
468 Ga0496123_0010546 3300048926 Bacteria 8147
469 Ga0496123_0067993 3300048926 Bacteria 2246
470 Ga0496123_0113899 3300048926 Bacteria 1539
471 Ga0496123_0147014 3300048926 Bacteria 1278
472 Ga0496123_0161628 3300048926 Bacteria 1193
473 Ga0496123_0194204 3300048926 Bacteria 1047
474 Ga0496123_0243415 3300048926 Bacteria 892
475 Ga0496124_0000067 3300048927 Bacteria 222576
476 Ga0496124_0001796 3300048927 Bacteria 29836
477 Ga0496124_0009377 3300048927 Bacteria 10085
478 Ga0496124_0025882 3300048927 Bacteria 5302
479 Ga0496124_0029536 3300048927 Bacteria 4882
480 Ga0496124_0035242 3300048927 Bacteria 4380
481 Ga0496124_0103507 3300048927 Bacteria 2303
482 Ga0496124_0130926 3300048927 Bacteria 1993
483 Ga0496124_0159566 3300048927 Bacteria 1759
484 Ga0496124_0313292 3300048927 Bacteria 1127
485 Ga0496124_0513512 3300048927 Bacteria 800
486 Ga0496125_0000262 3300048928 Bacteria 108389
487 Ga0496125_0001869 3300048928 Bacteria 28927
488 Ga0496125_0008714 3300048928 Bacteria 10556
489 Ga0496125_0020251 3300048928 Bacteria 6247
490 Ga0496125_0036049 3300048928 Bacteria 4326
491 Ga0496125_0135589 3300048928 Bacteria 1723
492 Ga0496125_0175165 3300048928 Bacteria 1436
493 Ga0496125_0230354 3300048928 Bacteria 1185
494 Ga0496126_0023200 3300048929 Bacteria 6015
495 Ga0496126_0117257 3300048929 Bacteria 2313
496 Ga0496126_0125188 3300048929 Bacteria 2225
497 Ga0495678_007866 3300049459 Bacteria 5476
498 Ga0495682_0092962 3300049460 Bacteria 1083
499 Ga0501031_0170494 3300049568 Bacteria 1422
500 Ga0501032_0102600 3300049569 Bacteria 1895
501 Ga0501032_0117579 3300049569 Bacteria 1758
502 Ga0501032_0504106 3300049569 Bacteria 773
503 Ga0501033_0000162 3300049570 Bacteria 63932
504 Ga0501033_0082910 3300049570 Bacteria 2351
505 Ga0501034_0055270 3300049571 Bacteria 3995
506 Ga0501034_0134389 3300049571 Bacteria 2455
507 Ga0501034_0219344 3300049571 Bacteria 1855
508 Ga0501034_0400366 3300049571 Bacteria 1295
509 Ga0501036_0232940 3300049572 Bacteria 1545
510 Ga0501036_0366316 3300049572 Bacteria 1203
511 Ga0501036_0561906 3300049572 Bacteria 948
512 Ga0501037_0043729 3300049573 Bacteria 3291
513 Ga0501037_0054331 3300049573 Bacteria 2929
514 Ga0501037_0150722 3300049573 Bacteria 1662
515 Ga0501038_0072292 3300049574 Bacteria 2923
516 Ga0501038_0115156 3300049574 Bacteria 2223
517 Ga0501038_0594429 3300049574 Bacteria 838
518 Ga0501039_0085556 3300049575 Bacteria 2456
519 Ga0501043_0056257 3300049579 Bacteria 3089
520 Ga0501043_0300071 3300049579 Bacteria 1228
521 Ga0501043_0364571 3300049579 Bacteria 1096
522 Ga0501043_0536005 3300049579 Bacteria 871
523 Ga0501043_0710979 3300049579 Bacteria 733
524 Ga0501046_0103988 3300049580 Bacteria 2177
525 Ga0501046_0230412 3300049580 Bacteria 1369
526 Ga0501046_0290583 3300049580 Bacteria 1196
527 Ga0501047_0122483 3300049581 Bacteria 2482
528 Ga0501047_0355225 3300049581 Bacteria 1302
529 Ga0501047_0610722 3300049581 Bacteria 912
530 Ga0501048_0053502 3300049582 Bacteria 2871
531 Ga0501067_0192451 3300049583 Bacteria 1136
532 Ga0501068_0086676 3300049584 Bacteria 1928
533 Ga0501069_0004804 3300049585 Bacteria 6995
534 Ga0501069_0012813 3300049585 Bacteria 4464
535 Ga0501070_0005027 3300049586 Bacteria 11280
536 Ga0501070_0074579 3300049586 Bacteria 2808
537 Ga0501070_0128557 3300049586 Bacteria 2093
538 Ga0501070_0168831 3300049586 Bacteria 1802
539 Ga0501070_0205537 3300049586 Bacteria 1617
540 Ga0501072_0095179 3300049588 Bacteria 2367
541 Ga0501073_0029623 3300049589 Bacteria 3911
542 Ga0501073_0163381 3300049589 Bacteria 1542
543 Ga0501073_0495917 3300049589 Bacteria 844
544 Ga0501074_0020287 3300049590 Bacteria 4830
545 Ga0501242_034076 3300049674 Bacteria 699
546 Ga0501079_0333403 3300049741 Bacteria 1188
547 Ga0501083_0143782 3300049744 Bacteria 1561
548 Ga0501280_003284 3300049776 Bacteria 2511
549 Ga0501035_0062977 3300049822 Bacteria 3299
550 Ga0501035_0065835 3300049822 Bacteria 3216
551 Ga0501035_0079755 3300049822 Bacteria 2891
552 Ga0501035_0279882 3300049822 Bacteria 1410
553 Ga0501044_0009602 3300049823 Bacteria 10529
554 Ga0501044_0052923 3300049823 Bacteria 4179
555 Ga0501044_0141758 3300049823 Bacteria 2392
556 Ga0501044_0226587 3300049823 Bacteria 1818
557 Ga0501044_0227485 3300049823 Bacteria 1814
558 Ga0501044_0527751 3300049823 Bacteria 1080
559 Ga0501045_0364081 3300049824 Bacteria 1076
560 nmdc:mga03683_84493_c1 3300050489 Bacteria 1376
561 nmdc:mga03n38_288801_c1 3300050490 Bacteria 878
562 nmdc:mga00v17_32522_c1 3300050491 Bacteria 3084
563 nmdc:mga00v17_7_c1 3300050491 Bacteria 167228
564 nmdc:mga0yw44_74616_c1 3300050492 Bacteria 2113
565 nmdc:mga0k408_20799_c1 3300050493 Bacteria 3682
566 nmdc:mga0k408_23469_c1 3300050493 Bacteria 3480
567 nmdc:mga07m45_22855_c2 3300050496 Bacteria 2888
568 nmdc:mga07m45_42699_c1 3300050496 Bacteria 2543
569 nmdc:mga0sz30_316_c1 3300050516 Bacteria 18483
570 nmdc:mga0sz30_58453_c1 3300050516 Bacteria 1644
571 nmdc:mga0sz30_9620_c2 3300050516 Bacteria 2418
572 Ga0500610_0011228 3300053079 Bacteria 4070
573 Ga0500610_0040164 3300053079 Bacteria 2417
574 Ga0500578_0144413 3300053086 Bacteria 1486
575 Ga0500654_074812 3300053099 Bacteria 1624
576 Ga0500556_0116673 3300053104 Bacteria 1039
577 Ga0500560_072899 3300053107 Bacteria 1133
578 Ga0500569_000623 3300053109 Bacteria 6024
579 Ga0500569_054539 3300053109 Bacteria 1216
580 Ga0500607_128747 3300053121 Bacteria 1211
581 Ga0500608_070734 3300053122 Bacteria 1659
582 Ga0500618_003259 3300053125 Bacteria 5642
583 Ga0500618_015135 3300053125 Bacteria 1955
584 Ga0500618_021205 3300053125 Bacteria 1587
585 Ga0500658_0005826 3300053134 Bacteria 4589
586 Ga0500658_0017918 3300053134 Bacteria 2650
587 Ga0500559_0031953 3300053136 Bacteria 2259
588 Ga0500568_0005180 3300053139 Bacteria 6795
589 Ga0500568_0008144 3300053139 Bacteria 5080
590 Ga0500590_016038 3300053148 Bacteria 3870
591 Ga0500604_0017758 3300053151 Bacteria 1974
592 Ga0500616_0002773 3300053153 Bacteria 14146
593 Ga0500616_0069966 3300053153 Bacteria 1792
594 Ga0500616_0136462 3300053153 Bacteria 1152
595 Ga0500616_0147707 3300053153 Bacteria 1091
596 Ga0500622_0009008 3300053156 Bacteria 5545
597 Ga0500622_0011876 3300053156 Bacteria 4733
598 Ga0500627_0009901 3300053158 Bacteria 3455
599 Ga0500633_0015777 3300053160 Bacteria 2175
600 Ga0500634_0014987 3300053161 Bacteria 4105
601 Ga0500636_0001803 3300053177 Bacteria 11727
602 Ga0500636_0219458 3300053177 Bacteria 992
603 Ga0466962_0235311 3300061719 Bacteria 898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0112238 Ga0439448_0112238_312_920 202
2 3300031456 Ga0307513_10182779 Ga0307513_101827792 204
3 iso_pu_bacteria 2643221558 2643811102 206
4 iso_pu_bacteria 2837651117 2837654682 206
5 iso_pu_bacteria 8018150411 8018154097 206
6 3300049581 Ga0501047_0122483 Ga0501047_0122483_301_936 207
7 iso_pu_bacteria 2600254933 2600374009 207
8 iso_pu_bacteria 2995392953 2995395658 207
9 iso_pu_bacteria 2509276033 2509447552 208
10 iso_pu_bacteria 2510065019 2510134382 208
11 iso_pu_bacteria 2510917030 2511194902 208
12 iso_pu_bacteria 2513237084 2513567506 208
13 iso_pu_bacteria 2513237093 2513632011 208
14 iso_pu_bacteria 2513237103 2513712515 208
15 iso_pu_bacteria 2515075009 2515113543 208
16 iso_pu_bacteria 2519899620 2520378433 208
17 iso_pu_bacteria 2582581298 2585225244 208
18 iso_pu_bacteria 2585427528 2585542768 208
19 iso_pu_bacteria 2585427529 2585547800 208
20 iso_pu_bacteria 2585427593 2585841410 208
21 iso_pu_bacteria 2615840624 2616296639 208
22 iso_pu_bacteria 2718217882 2719182261 208
23 iso_pu_bacteria 2718217927 2719386851 208
24 iso_pu_bacteria 2718217997 2719666589 208
25 iso_pu_bacteria 2718218009 2719732977 208
26 iso_pu_bacteria 2718218199 2720493009 208
27 iso_pu_bacteria 2718218232 2720614487 208
28 iso_pu_bacteria 2718218233 2720621261 208
29 iso_pu_bacteria 2718218235 2720632587 208
30 iso_pu_bacteria 2718218269 2720776311 208
31 iso_pu_bacteria 2718218363 2721148374 208
32 iso_pu_bacteria 2718218365 2721159760 208
33 iso_pu_bacteria 2718218366 2721165188 208
34 iso_pu_bacteria 2718218423 2721400574 208
35 iso_pu_bacteria 2721755514 2722841358 208
36 iso_pu_bacteria 2721755556 2723027901 208
37 iso_pu_bacteria 2721755684 2723561530 208
38 iso_pu_bacteria 2721755685 2723568159 208
39 iso_pu_bacteria 2721755809 2724039387 208
40 iso_pu_bacteria 2721755810 2724045733 208
41 iso_pu_bacteria 2721755819 2724090918 208
42 iso_pu_bacteria 2721755822 2724105424 208
43 iso_pu_bacteria 2721755823 2724111250 208
44 iso_pu_bacteria 2724679232 2725950224 208
45 iso_pu_bacteria 2728369352 2730108837 208
46 iso_pu_bacteria 2728369365 2730165496 208
47 iso_pu_bacteria 2728369397 2730299392 208
48 iso_pu_bacteria 2738541333 2739033250 208
49 iso_pu_bacteria 2765235942 2766066297 208
50 iso_pu_bacteria 2791355253 2793283765 208
51 iso_pu_bacteria 2791355259 2793314322 208
52 iso_pu_bacteria 2791355260 2793323812 208
53 iso_pu_bacteria 2791355261 2793329715 208
54 iso_pu_bacteria 2791355264 2793349684 208
55 iso_pu_bacteria 2791355266 2793363025 208
56 iso_pu_bacteria 2802429633 2806047508 208
57 iso_pu_bacteria 2802429634 2806055142 208
58 iso_pu_bacteria 2802429635 2806063048 208
59 iso_pu_bacteria 2802429636 2806069783 208
60 iso_pu_bacteria 2802429637 2806075712 208
61 iso_pu_bacteria 2818991461 2819685372 208
62 iso_pu_bacteria 2838016132 2838019921 208
63 iso_pu_bacteria 2838022645 2838023427 208
64 iso_pu_bacteria 2838042994 2838045624 208
65 iso_pu_bacteria 2838048938 2838052730 208
66 iso_pu_bacteria 2838061910 2838064987 208
67 iso_pu_bacteria 2838068647 2838069714 208
68 iso_pu_bacteria 2838668709 2838671783 208
69 iso_pu_bacteria 2838680041 2838683013 208
70 iso_pu_bacteria 2838686498 2838686624 208
71 iso_pu_bacteria 2838694306 2838698044 208
72 iso_pu_bacteria 2838701080 2838704462 208
73 iso_pu_bacteria 2838707686 2838711158 208
74 iso_pu_bacteria 2838729681 2838734866 208
75 iso_pu_bacteria 2838742623 2838747481 208
76 iso_pu_bacteria 2841851746 2841854453 208
77 iso_pu_bacteria 2841864319 2841867401 208
78 iso_pu_bacteria 2842077413 2842079334 208
79 iso_pu_bacteria 2842110456 2842115562 208
80 iso_pu_bacteria 2842118031 2842118156 208
81 iso_pu_bacteria 2842146304 2842149680 208
82 iso_pu_bacteria 2842156927 2842158528 208
83 iso_pu_bacteria 2842163707 2842169026 208
84 iso_pu_bacteria 2842180545 2842182142 208
85 iso_pu_bacteria 2842192696 2842195617 208
86 iso_pu_bacteria 2842198810 2842198941 208
87 iso_pu_bacteria 2842205361 2842210938 208
88 iso_pu_bacteria 2842217011 2842218375 208
89 iso_pu_bacteria 2842229732 2842229858 208
90 iso_pu_bacteria 2842237096 2842240069 208
91 iso_pu_bacteria 2842243621 2842243747 208
92 iso_pu_bacteria 2842250916 2842254153 208
93 iso_pu_bacteria 2842257432 2842258168 208
94 iso_pu_bacteria 2842264693 2842268921 208
95 iso_pu_bacteria 2842271015 2842271838 208
96 iso_pu_bacteria 2842278818 2842284391 208
97 iso_pu_bacteria 2842285085 2842285176 208
98 iso_pu_bacteria 2842291075 2842292996 208
99 iso_pu_bacteria 2842304105 2842305451 208
100 iso_pu_bacteria 2842311132 2842314175 208
101 iso_pu_bacteria 2842317721 2842319979 208
102 iso_pu_bacteria 2842341865 2842347628 208
103 iso_pu_bacteria 2842363717 2842368722 208
104 iso_pu_bacteria 2842370503 2842373642 208
105 iso_pu_bacteria 2842377471 2842379393 208
106 iso_pu_bacteria 2842384541 2842384666 208
107 iso_pu_bacteria 2842395702 2842400570 208
108 iso_pu_bacteria 2842402390 2842402534 208
109 iso_pu_bacteria 2842409023 2842410095 208
110 iso_pu_bacteria 2842415677 2842416743 208
111 iso_pu_bacteria 2842422224 2842423328 208
112 iso_pu_bacteria 2842428310 2842433157 208
113 iso_pu_bacteria 2842434925 2842439462 208
114 iso_pu_bacteria 2842441272 2842446091 208
115 iso_pu_bacteria 2842447887 2842449119 208
116 iso_pu_bacteria 2842462802 2842467304 208
117 iso_pu_bacteria 2842469257 2842474099 208
118 iso_pu_bacteria 2842489311 2842493481 208
119 iso_pu_bacteria 2842495871 2842497631 208
120 iso_pu_bacteria 2844454524 2844457922 208
121 iso_pu_bacteria 2857516855 2857516995 208
122 iso_pu_bacteria 2919100787 2919105602 208
123 iso_pu_bacteria 2933586486 2933591977 208
124 iso_pu_bacteria 2933599457 2933600521 208
125 iso_pu_bacteria 2935894831 2935896573 208
126 iso_pu_bacteria 2936367885 2936371613 208
127 iso_pu_bacteria 2936375103 2936376986 208
128 iso_pu_bacteria 2996893221 2996898061 208
129 iso_pu_bacteria 3005445848 3005448840 208
130 iso_pu_bacteria 639633055 639649589 208
131 iso_pu_bacteria 8005282627 8005284378 208
132 iso_pu_bacteria 8005301065 8005303574 208
133 iso_pu_bacteria 8005376324 8005382672 208
134 iso_pu_bacteria 8005382845 8005384634 208
135 iso_pu_bacteria 8005395548 8005395663 208
136 iso_pu_bacteria 8005430974 8005433900 208
137 iso_pu_bacteria 8005460587 8005464229 208
138 iso_pu_bacteria 8005556819 8005561643 208
139 iso_pu_bacteria 8005563573 8005568420 208
140 iso_pu_bacteria 8005570704 8005573040 208
141 iso_pu_bacteria 8005619151 8005622698 208
142 iso_pu_bacteria 8005626139 8005630213 208
143 iso_pu_bacteria 8005688590 8005691647 208
144 iso_pu_bacteria 8018127388 8018127583 208
145 iso_pu_bacteria 8018163183 8018163337 208
146 iso_pu_bacteria 8024479707 8024486101 208
147 iso_pu_bacteria 8055431914 8055432267 208
148 3300005288 Ga0065714_10204228 Ga0065714_102042281 209
149 3300005347 Ga0070668_100042312 Ga0070668_1000423124 209
150 3300005459 Ga0068867_100905795 Ga0068867_1009057951 209
151 3300005518 Ga0070699_100038600 Ga0070699_1000386003 209
152 3300005539 Ga0068853_100033702 Ga0068853_1000337024 209
153 3300005548 Ga0070665_100171732 Ga0070665_1001717323 209
154 3300005548 Ga0070665_100827186 Ga0070665_1008271862 209
155 3300009553 Ga0105249_10372058 Ga0105249_103720582 209
156 3300013297 Ga0157378_11177236 Ga0157378_111772361 209
157 3300014325 Ga0163163_10694136 Ga0163163_106941362 209
158 3300025907 Ga0207645_10109053 Ga0207645_101090532 209
159 3300025986 Ga0207658_10147628 Ga0207658_101476282 209
160 3300026041 Ga0207639_10025043 Ga0207639_100250433 209
161 3300042438 Ga0439459_0007619 Ga0439459_0007619_715_1344 209
162 3300048905 Ga0496102_0374896 Ga0496102_0374896_542_1171 209
163 3300049586 Ga0501070_0074579 Ga0501070_0074579_1905_2540 209
164 3300049822 Ga0501035_0065835 Ga0501035_0065835_2313_2948 209
165 iso_pu_bacteria 2508501122 2509108026 209
166 iso_pu_bacteria 2509276019 2509376794 209
167 iso_pu_bacteria 2510065057 2510304091 209
168 iso_pu_bacteria 2511231052 2511502525 209
169 iso_pu_bacteria 2512047086 2512533899 209
170 iso_pu_bacteria 2512875026 2512970342 209
171 iso_pu_bacteria 2513237086 2513583158 209
172 iso_pu_bacteria 2513237089 2513601406 209
173 iso_pu_bacteria 2513237091 2513620316 209
174 iso_pu_bacteria 2513237138 2513867903 209
175 iso_pu_bacteria 2513237140 2513881788 209
176 iso_pu_bacteria 2513237143 2513904932 209
177 iso_pu_bacteria 2513237156 2513983603 209
178 iso_pu_bacteria 2513237160 2514003147 209
179 iso_pu_bacteria 2515154107 2515609313 209
180 iso_pu_bacteria 2516143018 2516206054 209
181 iso_pu_bacteria 2516653046 2516893900 209
182 iso_pu_bacteria 2517487022 2517570620 209
183 iso_pu_bacteria 2537561587 2537873884 209
184 iso_pu_bacteria 2551306084 2551675292 209
185 iso_pu_bacteria 2551306084 2551676702 209
186 iso_pu_bacteria 2551306085 2551689424 209
187 iso_pu_bacteria 2551306086 2551696002 209
188 iso_pu_bacteria 2551306087 2551697252 209
189 iso_pu_bacteria 2551306089 2551708860 209
190 iso_pu_bacteria 2551306090 2551716347 209
191 iso_pu_bacteria 2551306091 2551726445 209
192 iso_pu_bacteria 2551306092 2551731798 209
193 iso_pu_bacteria 2551306093 2551740963 209
194 iso_pu_bacteria 2554235003 2554248524 209
195 iso_pu_bacteria 2558860100 2558865848 209
196 iso_pu_bacteria 2558860242 2559295612 209
197 iso_pu_bacteria 2585427633 2585996806 209
198 iso_pu_bacteria 2585427634 2586001391 209
199 iso_pu_bacteria 2599185210 2599601935 209
200 iso_pu_bacteria 2600255279 2601609810 209
201 iso_pu_bacteria 2600255308 2601746585 209
202 iso_pu_bacteria 2643221582 2643920072 209
203 iso_pu_bacteria 2643221693 2644523420 209
204 iso_pu_bacteria 2657244999 2657684847 209
205 iso_pu_bacteria 2690316117 2692315161 209
206 iso_pu_bacteria 2751185821 2753463336 209
207 iso_pu_bacteria 2791355082 2792581554 209
208 iso_pu_bacteria 2791355091 2792620463 209
209 iso_pu_bacteria 2791355092 2792625821 209
210 iso_pu_bacteria 2791355094 2792638763 209
211 iso_pu_bacteria 2802428858 2802716699 209
212 iso_pu_bacteria 2802428859 2802725510 209
213 iso_pu_bacteria 2802428860 2802730398 209
214 iso_pu_bacteria 2802428861 2802737630 209
215 iso_pu_bacteria 2802428862 2802742980 209
216 iso_pu_bacteria 2802428863 2802750404 209
217 iso_pu_bacteria 2802429268 2804753023 209
218 iso_pu_bacteria 2808606387 2808987655 209
219 iso_pu_bacteria 2818991439 2819559328 209
220 iso_pu_bacteria 2821123053 2821125896 209
221 iso_pu_bacteria 2838675328 2838675500 209
222 iso_pu_bacteria 2838714209 2838714381 209
223 iso_pu_bacteria 2838719591 2838721817 209
224 iso_pu_bacteria 2838724970 2838725142 209
225 iso_pu_bacteria 2841846520 2841848800 209
226 iso_pu_bacteria 2841859092 2841862472 209
227 iso_pu_bacteria 2842124991 2842125169 209
228 iso_pu_bacteria 2842130223 2842130395 209
229 iso_pu_bacteria 2842152218 2842154435 209
230 iso_pu_bacteria 2842170452 2842170624 209
231 iso_pu_bacteria 2842175837 2842178055 209
232 iso_pu_bacteria 2842187318 2842187490 209
233 iso_pu_bacteria 2842211629 2842211801 209
234 iso_pu_bacteria 2842224351 2842226579 209
235 iso_pu_bacteria 2842515876 2842519256 209
236 iso_pu_bacteria 2847417321 2847419783 209
237 iso_pu_bacteria 2848992105 2848994799 209
238 iso_pu_bacteria 2850079185 2850081797 209
239 iso_pu_bacteria 2855825444 2855826625 209
240 iso_pu_bacteria 2855839649 2855842016 209
241 iso_pu_bacteria 2855872281 2855877298 209
242 iso_pu_bacteria 2857531043 2857532458 209
243 iso_pu_bacteria 2858800743 2858802690 209
244 iso_pu_bacteria 2899792073 2899795846 209
245 iso_pu_bacteria 2899845264 2899847244 209
246 iso_pu_bacteria 2913295892 2913299100 209
247 iso_pu_bacteria 2915980308 2915981160 209
248 iso_pu_bacteria 2915986958 2915989935 209
249 iso_pu_bacteria 2915993759 2915998530 209
250 iso_pu_bacteria 2916000859 2916005067 209
251 iso_pu_bacteria 2916007675 2916012993 209
252 iso_pu_bacteria 2916014648 2916021093 209
253 iso_pu_bacteria 2916021584 2916023038 209
254 iso_pu_bacteria 2916028427 2916034200 209
255 iso_pu_bacteria 2916035215 2916039342 209
256 iso_pu_bacteria 2916041962 2916044394 209
257 iso_pu_bacteria 2916048683 2916050442 209
258 iso_pu_bacteria 2916055098 2916061511 209
259 iso_pu_bacteria 2916061851 2916062023 209
260 iso_pu_bacteria 2916068649 2916073425 209
261 iso_pu_bacteria 2916076590 2916080492 209
262 iso_pu_bacteria 2919114240 2919114412 209
263 iso_pu_bacteria 2921201388 2921205785 209
264 iso_pu_bacteria 2921208531 2921209695 209
265 iso_pu_bacteria 2921237296 2921239278 209
266 iso_pu_bacteria 2921244191 2921247812 209
267 iso_pu_bacteria 2921250672 2921251669 209
268 iso_pu_bacteria 2921257292 2921262634 209
269 iso_pu_bacteria 2921263974 2921269633 209
270 iso_pu_bacteria 2921282425 2921287152 209
271 iso_pu_bacteria 2921289301 2921294100 209
272 iso_pu_bacteria 2921296804 2921300511 209
273 iso_pu_bacteria 2924144063 2924148564 209
274 iso_pu_bacteria 2924150972 2924151511 209
275 iso_pu_bacteria 2924158325 2924159905 209
276 iso_pu_bacteria 2924165586 2924167533 209
277 iso_pu_bacteria 2924172951 2924174476 209
278 iso_pu_bacteria 2924179722 2924183745 209
279 iso_pu_bacteria 2924186466 2924193109 209
280 iso_pu_bacteria 2924193448 2924196459 209
281 iso_pu_bacteria 2924200457 2924203909 209
282 iso_pu_bacteria 2924207177 2924210820 209
283 iso_pu_bacteria 2924214083 2924218198 209
284 iso_pu_bacteria 2924221636 2924227399 209
285 iso_pu_bacteria 2924228884 2924233252 209
286 iso_pu_bacteria 2926754445 2926755432 209
287 iso_pu_bacteria 2926760298 2926762541 209
288 iso_pu_bacteria 2933006813 2933009080 209
289 iso_pu_bacteria 2933011516 2933014572 209
290 iso_pu_bacteria 2933594066 2933596320 209
291 iso_pu_bacteria 2936996657 2937002776 209
292 iso_pu_bacteria 2937002841 2937005341 209
293 iso_pu_bacteria 2937009748 2937012876 209
294 iso_pu_bacteria 2937016420 2937021858 209
295 iso_pu_bacteria 2937023124 2937027351 209
296 iso_pu_bacteria 2937029754 2937035651 209
297 iso_pu_bacteria 2937036028 2937039684 209
298 iso_pu_bacteria 2937042894 2937043853 209
299 iso_pu_bacteria 2937049772 2937050298 209
300 iso_pu_bacteria 2937056579 2937058363 209
301 iso_pu_bacteria 2937063883 2937068678 209
302 iso_pu_bacteria 2937071275 2937072399 209
303 iso_pu_bacteria 2937078374 2937080713 209
304 iso_pu_bacteria 2937084907 2937090116 209
305 iso_pu_bacteria 2937091812 2937097419 209
306 iso_pu_bacteria 2937098957 2937101134 209
307 iso_pu_bacteria 2937106411 2937110229 209
308 iso_pu_bacteria 2937113482 2937117666 209
309 iso_pu_bacteria 2937119839 2937124498 209
310 iso_pu_bacteria 2937126314 2937131444 209
311 iso_pu_bacteria 2957375807 2957380674 209
312 iso_pu_bacteria 2957382221 2957382529 209
313 iso_pu_bacteria 2957388812 2957389491 209
314 iso_pu_bacteria 2957395598 2957397268 209
315 iso_pu_bacteria 2957402308 2957408332 209
316 iso_pu_bacteria 2957408893 2957412912 209
317 iso_pu_bacteria 2957415311 2957418953 209
318 iso_pu_bacteria 2957430029 2957435893 209
319 iso_pu_bacteria 2957437181 2957440162 209
320 iso_pu_bacteria 2957443900 2957450583 209
321 iso_pu_bacteria 2957450854 2957455319 209
322 iso_pu_bacteria 2957457609 2957460439 209
323 iso_pu_bacteria 2957464669 2957468831 209
324 iso_pu_bacteria 2957471148 2957472908 209
325 iso_pu_bacteria 2957478035 2957483572 209
326 iso_pu_bacteria 2957484790 2957489167 209
327 iso_pu_bacteria 2957491536 2957497978 209
328 iso_pu_bacteria 2957498199 2957501704 209
329 iso_pu_bacteria 2957505466 2957512291 209
330 iso_pu_bacteria 2960584000 2960586179 209
331 iso_pu_bacteria 2960591022 2960591826 209
332 iso_pu_bacteria 2960597568 2960602094 209
333 iso_pu_bacteria 2960603979 2960610432 209
334 iso_pu_bacteria 2960610863 2960614852 209
335 iso_pu_bacteria 2960617483 2960618008 209
336 iso_pu_bacteria 2960624210 2960630087 209
337 iso_pu_bacteria 2960631154 2960634027 209
338 iso_pu_bacteria 2960637947 2960638961 209
339 iso_pu_bacteria 2960645483 2960651125 209
340 iso_pu_bacteria 2960652885 2960658496 209
341 iso_pu_bacteria 2960660292 2960667138 209
342 iso_pu_bacteria 2960667422 2960670737 209
343 iso_pu_bacteria 2960674078 2960675872 209
344 iso_pu_bacteria 2960680706 2960680790 209
345 iso_pu_bacteria 2960687367 2960688214 209
346 iso_pu_bacteria 2960693952 2960696571 209
347 iso_pu_bacteria 2964607997 2964614174 209
348 iso_pu_bacteria 2964615318 2964617159 209
349 iso_pu_bacteria 2964621998 2964622764 209
350 iso_pu_bacteria 2964628898 2964632822 209
351 iso_pu_bacteria 2964636051 2964639131 209
352 iso_pu_bacteria 2964643177 2964646261 209
353 iso_pu_bacteria 2964649959 2964651236 209
354 iso_pu_bacteria 2964656573 2964663319 209
355 iso_pu_bacteria 2964663802 2964667653 209
356 iso_pu_bacteria 2964670856 2964673319 209
357 iso_pu_bacteria 2964678106 2964680032 209
358 iso_pu_bacteria 2964685014 2964689208 209
359 iso_pu_bacteria 2964691889 2964694816 209
360 iso_pu_bacteria 2964698721 2964699325 209
361 iso_pu_bacteria 2964705432 2964706487 209
362 iso_pu_bacteria 2964712639 2964718779 209
363 iso_pu_bacteria 2964719344 2964722227 209
364 iso_pu_bacteria 2967664464 2967666728 209
365 iso_pu_bacteria 2967671571 2967673244 209
366 iso_pu_bacteria 2967678726 2967685835 209
367 iso_pu_bacteria 2967686174 2967690026 209
368 iso_pu_bacteria 2967693043 2967699046 209
369 iso_pu_bacteria 2967699805 2967702243 209
370 iso_pu_bacteria 2967706974 2967712885 209
371 iso_pu_bacteria 2967714385 2967720398 209
372 iso_pu_bacteria 2967721400 2967722378 209
373 iso_pu_bacteria 2967728569 2967732310 209
374 iso_pu_bacteria 2967735183 2967739875 209
375 iso_pu_bacteria 2967742019 2967744918 209
376 iso_pu_bacteria 2967748971 2967749318 209
377 iso_pu_bacteria 2967755722 2967759640 209
378 iso_pu_bacteria 2967762386 2967763608 209
379 iso_pu_bacteria 2967769361 2967772714 209
380 iso_pu_bacteria 2967775926 2967776368 209
381 iso_pu_bacteria 2970019648 2970024306 209
382 iso_pu_bacteria 2970026789 2970027568 209
383 iso_pu_bacteria 2970033650 2970035993 209
384 iso_pu_bacteria 2970040964 2970045189 209
385 iso_pu_bacteria 2970047711 2970049052 209
386 iso_pu_bacteria 2970054988 2970056237 209
387 iso_pu_bacteria 2970061556 2970066035 209
388 iso_pu_bacteria 2970068827 2970071002 209
389 iso_pu_bacteria 2970076120 2970079432 209
390 iso_pu_bacteria 2970082768 2970084600 209
391 iso_pu_bacteria 2970088815 2970094262 209
392 iso_pu_bacteria 2970095765 2970097188 209
393 iso_pu_bacteria 2970102677 2970103957 209
394 iso_pu_bacteria 2970109326 2970111883 209
395 iso_pu_bacteria 2970116247 2970120570 209
396 iso_pu_bacteria 2970122695 2970126345 209
397 iso_pu_bacteria 2970129317 2970135863 209
398 iso_pu_bacteria 2970136068 2970141797 209
399 iso_pu_bacteria 2970143518 2970147147 209
400 iso_pu_bacteria 2970149975 2970152468 209
401 iso_pu_bacteria 2970156795 2970162619 209
402 iso_pu_bacteria 2970164137 2970168286 209
403 iso_pu_bacteria 2970170962 2970172681 209
404 iso_pu_bacteria 2970177841 2970181095 209
405 iso_pu_bacteria 2970184632 2970186255 209
406 iso_pu_bacteria 2970191845 2970196138 209
407 iso_pu_bacteria 2977516862 2977519323 209
408 iso_pu_bacteria 2977523885 2977524427 209
409 iso_pu_bacteria 2977530762 2977536379 209
410 iso_pu_bacteria 2977537788 2977543326 209
411 iso_pu_bacteria 2977544691 2977549656 209
412 iso_pu_bacteria 2977551784 2977553036 209
413 iso_pu_bacteria 2977558990 2977559943 209
414 iso_pu_bacteria 2977565890 2977568832 209
415 iso_pu_bacteria 2977572785 2977574076 209
416 iso_pu_bacteria 2977579622 2977585935 209
417 iso_pu_bacteria 2979089926 2979092191 209
418 iso_pu_bacteria 2979095461 2979100421 209
419 iso_pu_bacteria 2979100975 2979104177 209
420 iso_pu_bacteria 2984509177 2984511245 209
421 iso_pu_bacteria 2984518228 2984522394 209
422 iso_pu_bacteria 2984537506 2984541696 209
423 iso_pu_bacteria 2984601300 2984604055 209
424 iso_pu_bacteria 2989349275 2989351053 209
425 iso_pu_bacteria 2989771324 2989773324 209
426 iso_pu_bacteria 3005409236 3005409380 209
427 iso_pu_bacteria 643692032 643826677 209
428 iso_pu_bacteria 648276728 648739514 209
429 iso_pu_bacteria 650716007 650740822 209
430 iso_pu_bacteria 8003570095 8003571894 209
431 iso_pu_bacteria 8003992118 8003994451 209
432 iso_pu_bacteria 8003999396 8004002157 209
433 iso_pu_bacteria 8049293176 8049295636 209
434 iso_pu_bacteria 8054460903 8054463236 209
435 3300003214 JGI25165J46597_1002483 JGI25165J46597_10024834 210
436 3300005366 Ga0070659_100651969 Ga0070659_1006519691 210
437 3300005577 Ga0068857_100287715 Ga0068857_1002877152 210
438 3300005578 Ga0068854_100625399 Ga0068854_1006253992 210
439 3300006186 Ga0075369_10138065 Ga0075369_101380652 210
440 3300025231 Ga0207427_101601 Ga0207427_1016014 210
441 3300025261 Ga0209233_1000391 Ga0209233_10003917 210
442 3300025933 Ga0207706_10351285 Ga0207706_103512852 210
443 3300026116 Ga0207674_10351580 Ga0207674_103515802 210
444 3300046522 Ga0495643_0120276 Ga0495643_0120276_624_1265 210
445 3300048924 Ga0496121_0528230 Ga0496121_0528230_38_676 210
446 3300048927 Ga0496124_0513512 Ga0496124_0513512_136_771 210
447 3300049569 Ga0501032_0117579 Ga0501032_0117579_263_895 210
448 3300049571 Ga0501034_0219344 Ga0501034_0219344_538_1179 210
449 3300049574 Ga0501038_0115156 Ga0501038_0115156_1537_2169 210
450 3300049579 Ga0501043_0710979 Ga0501043_0710979_84_716 210
451 3300049581 Ga0501047_0610722 Ga0501047_0610722_159_791 210
452 3300049823 Ga0501044_0527751 Ga0501044_0527751_318_950 210
453 3300053079 Ga0500610_0040164 Ga0500610_0040164_1357_1998 210
454 iso_pu_bacteria 2510461069 2510841702 210
455 iso_pu_bacteria 2510917022 2511131938 210
456 iso_pu_bacteria 2510917026 2511175401 210
457 iso_pu_bacteria 2510917028 2511182666 210
458 iso_pu_bacteria 2513237088 2513598392 210
459 iso_pu_bacteria 2513237144 2513910632 210
460 iso_pu_bacteria 2513237146 2513928077 210
461 iso_pu_bacteria 2513237159 2513997554 210
462 iso_pu_bacteria 2524023209 2524459021 210
463 iso_pu_bacteria 2534681796 2535517251 210
464 iso_pu_bacteria 2558860983 2561469031 210
465 iso_pu_bacteria 2582581283 2585167575 210
466 iso_pu_bacteria 2582581294 2585205088 210
467 iso_pu_bacteria 2582581299 2585230693 210
468 iso_pu_bacteria 2582581304 2585259130 210
469 iso_pu_bacteria 2582581306 2585265800 210
470 iso_pu_bacteria 2582581307 2585273978 210
471 iso_pu_bacteria 2582581308 2585279439 210
472 iso_pu_bacteria 2582581315 2585322901 210
473 iso_pu_bacteria 2582581316 2585331067 210
474 iso_pu_bacteria 2582581865 2585389047 210
475 iso_pu_bacteria 2582581866 2585395194 210
476 iso_pu_bacteria 2582581867 2585404590 210
477 iso_pu_bacteria 2585427527 2585531077 210
478 iso_pu_bacteria 2585427530 2585553002 210
479 iso_pu_bacteria 2585427531 2585560429 210
480 iso_pu_bacteria 2585427590 2585824873 210
481 iso_pu_bacteria 2585427609 2585903789 210
482 iso_pu_bacteria 2585428125 2587981092 210
483 iso_pu_bacteria 2599185156 2599332115 210
484 iso_pu_bacteria 2599185170 2599421086 210
485 iso_pu_bacteria 2599185352 2600196053 210
486 iso_pu_bacteria 2615840626 2616307012 210
487 iso_pu_bacteria 2615840698 2616554626 210
488 iso_pu_bacteria 2617270742 2617384874 210
489 iso_pu_bacteria 2643221557 2643804405 210
490 iso_pu_bacteria 2643221599 2644002928 210
491 iso_pu_bacteria 2643221607 2644052065 210
492 iso_pu_bacteria 2643221610 2644065176 210
493 iso_pu_bacteria 2643221618 2644105469 210
494 iso_pu_bacteria 2643221626 2644146472 210
495 iso_pu_bacteria 2643221634 2644196673 210
496 iso_pu_bacteria 2643221636 2644204858 210
497 iso_pu_bacteria 2643221637 2644208677 210
498 iso_pu_bacteria 2643221643 2644237908 210
499 iso_pu_bacteria 2643221653 2644299004 210
500 iso_pu_bacteria 2643221655 2644308220 210
501 iso_pu_bacteria 2643221659 2644334044 210
502 iso_pu_bacteria 2643221668 2644377585 210
503 iso_pu_bacteria 2643221675 2644416848 210
504 iso_pu_bacteria 2643221680 2644449888 210
505 iso_pu_bacteria 2643221686 2644484808 210
506 iso_pu_bacteria 2643221688 2644494195 210
507 iso_pu_bacteria 2643221689 2644500636 210
508 iso_pu_bacteria 2643221698 2644541641 210
509 iso_pu_bacteria 2643221712 2644615502 210
510 iso_pu_bacteria 2643221718 2644652207 210
511 iso_pu_bacteria 2643221719 2644657232 210
512 iso_pu_bacteria 2643221723 2644672758 210
513 iso_pu_bacteria 2643221726 2644690023 210
514 iso_pu_bacteria 2667528174 2671111870 210
515 iso_pu_bacteria 2738541293 2738805434 210
516 iso_pu_bacteria 2738541317 2738944206 210
517 iso_pu_bacteria 2775507049 2776914315 210
518 iso_pu_bacteria 2775507266 2778173392 210
519 iso_pu_bacteria 2818991272 2819240981 210
520 iso_pu_bacteria 2818991448 2819609917 210
521 iso_pu_bacteria 2818991453 2819640028 210
522 iso_pu_bacteria 2838029111 2838033229 210
523 iso_pu_bacteria 2838035591 2838041449 210
524 iso_pu_bacteria 2838074704 2838079656 210
525 iso_pu_bacteria 2838661181 2838665840 210
526 iso_pu_bacteria 2842298080 2842298373 210
527 iso_pu_bacteria 2842357229 2842360385 210
528 iso_pu_bacteria 2842475841 2842480106 210
529 iso_pu_bacteria 2842482326 2842483699 210
530 iso_pu_bacteria 2842502639 2842505109 210
531 iso_pu_bacteria 2842509118 2842510389 210
532 iso_pu_bacteria 2842521101 2842522203 210
533 iso_pu_bacteria 2842922631 2842924470 210
534 iso_pu_bacteria 2844163670 2844166383 210
535 iso_pu_bacteria 2852387548 2852390804 210
536 iso_pu_bacteria 2854896431 2854900523 210
537 iso_pu_bacteria 2854916844 2854917430 210
538 iso_pu_bacteria 2891373044 2891377708 210
539 iso_pu_bacteria 2896384573 2896391232 210
540 iso_pu_bacteria 2899803654 2899806712 210
541 iso_pu_bacteria 2913308742 2913308825 210
542 iso_pu_bacteria 2919171160 2919173099 210
543 iso_pu_bacteria 2919408235 2919410370 210
544 iso_pu_bacteria 2920760137 2920761168 210
545 iso_pu_bacteria 2920822456 2920825644 210
546 iso_pu_bacteria 2923556063 2923562250 210
547 iso_pu_bacteria 2929138655 2929141157 210
548 iso_pu_bacteria 2933016740 2933023677 210
549 iso_pu_bacteria 2941499720 2941504589 210
550 iso_pu_bacteria 2989776772 2989779573 210
551 iso_pu_bacteria 2996887358 2996892544 210
552 iso_pu_bacteria 3003930520 3003934664 210
553 iso_pu_bacteria 3005416602 3005418806 210
554 iso_pu_bacteria 3005452660 3005455064 210
555 iso_pu_bacteria 8005246636 8005249814 210
556 iso_pu_bacteria 8005258706 8005264829 210
557 iso_pu_bacteria 8005314921 8005318302 210
558 iso_pu_bacteria 8005321885 8005327071 210
559 iso_pu_bacteria 8005484373 8005488817 210
560 iso_pu_bacteria 8005542996 8005546071 210
561 iso_pu_bacteria 8005645114 8005645807 210
562 iso_pu_bacteria 8005682033 8005682511 210
563 iso_pu_bacteria 8024486573 8024488437 210
564 iso_pu_bacteria 8046767195 8046772632 210
565 iso_pu_bacteria 8054558443 8054561896 210
566 iso_pu_bacteria 8057575449 8057576909 210
567 3300013104 Ga0157370_10920224 Ga0157370_109202242 211
568 3300031665 Ga0316575_10020985 Ga0316575_100209851 211
569 3300048925 Ga0496122_0000042 Ga0496122_0000042_205861_206496 211
570 3300048926 Ga0496123_0000030 Ga0496123_0000030_85264_85899 211
571 iso_pu_bacteria 2891048133 2891050475 211
572 iso_pu_bacteria 8005658619 8005658775 211
573 3300002773 JGI25152J39213_1001494 JGI25152J39213_10014942 212
574 3300002987 JGI25159J45721_1000780 JGI25159J45721_10007801 212
575 3300003187 JGI25151J46595_10002158 JGI25151J46595_100021589 212
576 3300003187 JGI25151J46595_10055434 JGI25151J46595_100554341 212
577 3300003215 JGI25153J46596_10008080 JGI25153J46596_100080804 212
578 3300003215 JGI25153J46596_10009737 JGI25153J46596_100097373 212
579 3300003354 JGI25160J50197_1004300 JGI25160J50197_10043002 212
580 3300003354 JGI25160J50197_1007945 JGI25160J50197_10079452 212
581 3300003374 JGI25161J50226_1000163 JGI25161J50226_100016331 212
582 3300003771 Ga0055526_1003270 Ga0055526_10032709 212
583 3300003771 Ga0055526_1004503 Ga0055526_10045035 212
584 3300003771 Ga0055526_1053325 Ga0055526_10533252 212
585 3300003775 Ga0055524_1001395 Ga0055524_10013955 212
586 3300003790 Ga0055528_1000247 Ga0055528_10002471 212
587 3300003790 Ga0055528_1002272 Ga0055528_10022722 212
588 3300003790 Ga0055528_1016745 Ga0055528_10167452 212
589 3300003790 Ga0055528_1028597 Ga0055528_10285972 212
590 3300003792 Ga0055540_1000607 Ga0055540_10006071 212
591 3300004625 Ga0055543_1000104 Ga0055543_100010471 212
592 3300004625 Ga0055543_1000108 Ga0055543_100010846 212
593 3300005262 Ga0065165_1019621 Ga0065165_10196212 212
594 3300006038 Ga0075365_10014685 Ga0075365_100146853 212
595 3300006048 Ga0075363_100088881 Ga0075363_1000888811 212
596 3300006177 Ga0075362_10008871 Ga0075362_100088713 212
597 3300006186 Ga0075369_10004638 Ga0075369_100046384 212
598 3300006186 Ga0075369_10083430 Ga0075369_100834302 212
599 3300006195 Ga0075366_10014942 Ga0075366_100149422 212
600 3300009765 Ga0123341_1000018 Ga0123341_100001856 212
601 3300009766 Ga0123342_1021678 Ga0123342_10216782 212
602 3300025208 Ga0209436_100058 Ga0209436_10005867 212
603 3300025245 Ga0207425_1000436 Ga0207425_100043626 212
604 3300025245 Ga0207425_1006357 Ga0207425_10063572 212
605 3300025245 Ga0207425_1009106 Ga0207425_10091063 212
606 3300025258 Ga0209129_1000976 Ga0209129_100097612 212
607 3300025258 Ga0209129_1002855 Ga0209129_10028557 212
608 3300025273 Ga0209673_1000025 Ga0209673_10000252 212
609 3300025273 Ga0209673_1000256 Ga0209673_100025660 212
610 3300025273 Ga0209673_1002926 Ga0209673_10029261 212
611 3300025273 Ga0209673_1003474 Ga0209673_10034746 212
612 3300025273 Ga0209673_1008164 Ga0209673_10081642 212
613 3300025273 Ga0209673_1008302 Ga0209673_10083022 212
614 3300025284 Ga0209130_1000023 Ga0209130_1000023143 212
615 3300025291 Ga0209675_1010916 Ga0209675_10109162 212
616 3300025294 Ga0209025_1000537 Ga0209025_100053750 212
617 3300025294 Ga0209025_1003817 Ga0209025_10038177 212
618 3300025295 Ga0209564_1000259 Ga0209564_100025970 212
619 3300025295 Ga0209564_1000841 Ga0209564_100084114 212
620 3300025295 Ga0209564_1002070 Ga0209564_10020708 212
621 3300025295 Ga0209564_1038895 Ga0209564_10388952 212
622 3300025297 Ga0209758_1000254 Ga0209758_1000254106 212
623 3300025297 Ga0209758_1000592 Ga0209758_100059261 212
624 3300025297 Ga0209758_1000678 Ga0209758_100067812 212
625 3300025297 Ga0209758_1002403 Ga0209758_100240311 212
626 3300025297 Ga0209758_1003028 Ga0209758_100302816 212
627 3300025298 Ga0209050_1005160 Ga0209050_10051609 212
628 3300025299 Ga0209256_1000283 Ga0209256_100028331 212
629 3300025299 Ga0209256_1000669 Ga0209256_100066917 212
630 3300025299 Ga0209256_1006546 Ga0209256_10065462 212
631 3300025299 Ga0209256_1016918 Ga0209256_10169182 212
632 3300025302 Ga0207426_1000087 Ga0207426_1000087219 212
633 3300025302 Ga0207426_1000208 Ga0207426_1000208126 212
634 3300025303 Ga0209051_1000434 Ga0209051_100043447 212
635 3300025303 Ga0209051_1002705 Ga0209051_10027059 212
636 3300025303 Ga0209051_1004907 Ga0209051_10049079 212
637 3300025304 Ga0209257_1004213 Ga0209257_10042138 212
638 3300025304 Ga0209257_1016341 Ga0209257_10163412 212
639 3300025304 Ga0209257_1034067 Ga0209257_10340672 212
640 3300028794 Ga0307515_10042022 Ga0307515_100420223 212
641 3300031456 Ga0307513_10056156 Ga0307513_100561565 212
642 3300041411 Ga0439466_0070051 Ga0439466_0070051_402_1052 212
643 3300041413 Ga0439465_0011939 Ga0439465_0011939_900_1550 212
644 3300041452 Ga0451793_0390538 Ga0451793_0390538_424_1074 212
645 3300041460 Ga0451802_0380304 Ga0451802_0380304_273_923 212
646 3300041494 Ga0451837_0579824 Ga0451837_0579824_507_1157 212
647 3300041494 Ga0451837_1454385 Ga0451837_1454385_1107_1757 212
648 3300041496 Ga0451839_0129781 Ga0451839_0129781_450_1100 212
649 3300041498 Ga0451841_0349814 Ga0451841_0349814_450_1100 212
650 3300041501 Ga0451845_0929087 Ga0451845_0929087_392_1042 212
651 3300041501 Ga0451845_0940005 Ga0451845_0940005_192_842 212
652 3300041503 Ga0451847_0518503 Ga0451847_0518503_268_918 212
653 3300041505 Ga0451849_1316711 Ga0451849_1316711_402_1052 212
654 3300041507 Ga0451851_0685669 Ga0451851_0685669_4139_4789 212
655 3300041509 Ga0451843_0014488 Ga0451843_0014488_723_1373 212
656 3300041511 Ga0451855_0518258 Ga0451855_0518258_506_1156 212
657 3300042006 Ga0439432_070457 Ga0439432_070457_197_847 212
658 3300046460 Ga0495638_0279828 Ga0495638_0279828_35_685 212
659 3300046492 Ga0495585_0116693 Ga0495585_0116693_695_1345 212
660 3300046507 Ga0495606_0020624 Ga0495606_0020624_2273_2923 212
661 3300046512 Ga0495610_0006541 Ga0495610_0006541_4654_5304 212
662 3300046518 Ga0495631_0051559 Ga0495631_0051559_932_1582 212
663 3300046522 Ga0495643_0062431 Ga0495643_0062431_780_1430 212
664 3300046522 Ga0495643_0078135 Ga0495643_0078135_951_1601 212
665 3300046524 Ga0495648_0123541 Ga0495648_0123541_175_825 212
666 3300046542 Ga0495597_0005601 Ga0495597_0005601_596_1246 212
667 3300046558 Ga0495633_0009077 Ga0495633_0009077_4054_4704 212
668 3300046660 Ga0495625_0047808 Ga0495625_0047808_204_854 212
669 3300046694 Ga0495649_0129445 Ga0495649_0129445_44_694 212
670 3300046810 Ga0495660_0003412 Ga0495660_0003412_92_742 212
671 3300047443 Ga0495687_012262 Ga0495687_012262_557_1207 212
672 3300047472 Ga0495686_0022549 Ga0495686_0022549_619_1269 212
673 3300047472 Ga0495686_0168117 Ga0495686_0168117_190_936 212
674 3300048091 Ga0495626_0090455 Ga0495626_0090455_277_927 212
675 3300048909 Ga0496106_0000206 Ga0496106_0000206_37819_38457 212
676 3300048913 Ga0496110_0227179 Ga0496110_0227179_536_1174 212
677 3300048914 Ga0496111_0133822 Ga0496111_0133822_608_1246 212
678 3300048919 Ga0496116_0280500 Ga0496116_0280500_79_729 212
679 3300048921 Ga0496118_0012215 Ga0496118_0012215_619_1269 212
680 3300048921 Ga0496118_0031374 Ga0496118_0031374_3668_4318 212
681 3300048924 Ga0496121_0015046 Ga0496121_0015046_1888_2538 212
682 3300048924 Ga0496121_0281553 Ga0496121_0281553_213_851 212
683 3300048924 Ga0496121_0330959 Ga0496121_0330959_137_787 212
684 3300048925 Ga0496122_0028356 Ga0496122_0028356_724_1374 212
685 3300048926 Ga0496123_0194204 Ga0496123_0194204_11_661 212
686 3300048927 Ga0496124_0025882 Ga0496124_0025882_3784_4434 212
687 3300048927 Ga0496124_0159566 Ga0496124_0159566_523_1161 212
688 3300048928 Ga0496125_0020251 Ga0496125_0020251_5226_5876 212
689 3300049570 Ga0501033_0000162 Ga0501033_0000162_11602_12300 212
690 3300049579 Ga0501043_0536005 Ga0501043_0536005_130_780 212
691 3300049580 Ga0501046_0230412 Ga0501046_0230412_612_1262 212
692 3300049583 Ga0501067_0192451 Ga0501067_0192451_410_1060 212
693 3300049585 Ga0501069_0012813 Ga0501069_0012813_3564_4202 212
694 3300049586 Ga0501070_0005027 Ga0501070_0005027_8701_9339 212
695 3300049589 Ga0501073_0163381 Ga0501073_0163381_37_675 212
696 3300049589 Ga0501073_0495917 Ga0501073_0495917_192_830 212
697 3300049590 Ga0501074_0020287 Ga0501074_0020287_2255_2893 212
698 3300049741 Ga0501079_0333403 Ga0501079_0333403_225_863 212
699 3300049744 Ga0501083_0143782 Ga0501083_0143782_174_824 212
700 3300049822 Ga0501035_0062977 Ga0501035_0062977_2390_3088 212
701 3300049823 Ga0501044_0009602 Ga0501044_0009602_3916_4554 212
702 3300050492 nmdc:mga0yw44_74616_c1 nmdc:mga0yw44_74616_c1_631_1281 212
703 3300050493 nmdc:mga0k408_23469_c1 nmdc:mga0k408_23469_c1_924_1574 212
704 3300050496 nmdc:mga07m45_22855_c2 nmdc:mga07m45_22855_c2_2186_2863 212
705 3300050516 nmdc:mga0sz30_58453_c1 nmdc:mga0sz30_58453_c1_417_1067 212
706 3300050516 nmdc:mga0sz30_9620_c2 nmdc:mga0sz30_9620_c2_752_1402 212
707 3300053109 Ga0500569_000623 Ga0500569_000623_862_1512 212
708 3300053125 Ga0500618_015135 Ga0500618_015135_554_1300 212
709 3300053125 Ga0500618_021205 Ga0500618_021205_120_758 212
710 3300053134 Ga0500658_0005826 Ga0500658_0005826_1306_1956 212
711 3300053134 Ga0500658_0017918 Ga0500658_0017918_1542_2180 212
712 3300053139 Ga0500568_0008144 Ga0500568_0008144_3881_4519 212
713 3300053153 Ga0500616_0147707 Ga0500616_0147707_184_834 212
714 3300053156 Ga0500622_0009008 Ga0500622_0009008_3989_4639 212
715 3300053160 Ga0500633_0015777 Ga0500633_0015777_857_1495 212
716 iso_pu_bacteria 2509276021 2509390161 212
717 iso_pu_bacteria 2510461076 2510895807 212
718 iso_pu_bacteria 2513237085 2513577840 212
719 iso_pu_bacteria 2513237162 2514017886 212
720 iso_pu_bacteria 2515154113 2515635259 212
721 iso_pu_bacteria 2515154114 2515643835 212
722 iso_pu_bacteria 2515154116 2515654923 212
723 iso_pu_bacteria 2515154134 2515739901 212
724 iso_pu_bacteria 2516653077 2517037159 212
725 iso_pu_bacteria 2516653085 2517077498 212
726 iso_pu_bacteria 2517093000 2517096266 212
727 iso_pu_bacteria 2517287029 2517408127 212
728 iso_pu_bacteria 2585427526 2585524927 212
729 iso_pu_bacteria 2791355256 2793294002 212
730 iso_pu_bacteria 2791355262 2793335097 212
731 iso_pu_bacteria 2791355263 2793342312 212
732 iso_pu_bacteria 2791355265 2793355333 212
733 iso_pu_bacteria 2791355267 2793369894 212
734 iso_pu_bacteria 2802429605 2805929552 212
735 iso_pu_bacteria 2802429606 2805936856 212
736 iso_pu_bacteria 2933570622 2933571258 212
737 iso_pu_bacteria 2935901341 2935901468 212
738 iso_pu_bacteria 2936381700 2936383424 212
739 iso_pu_bacteria 8005275841 8005281662 212
740 iso_pu_bacteria 8005289223 8005289630 212
741 iso_pu_bacteria 8005307578 8005314086 212
742 iso_pu_bacteria 8005497431 8005501335 212
743 iso_pu_bacteria 8005668836 8005672754 212
744 iso_pu_bacteria 8005695170 8005696782 212
745 iso_pu_bacteria 8018176218 8018178965 212
746 iso_pu_bacteria 8023680758 8023682743 212
747 iso_pu_bacteria 8024501048 8024501175 212
748 iso_pu_bacteria 8056375014 8056377027 212
749 iso_pu_bacteria 8056382006 8056387349 212
750 iso_pu_bacteria 8057874678 8057881913 212
751 3300003187 JGI25151J46595_10047616 JGI25151J46595_100476162 213
752 3300003856 Ga0058692_1001033 Ga0058692_100103310 213
753 3300005353 Ga0070669_100083445 Ga0070669_1000834452 213
754 3300005548 Ga0070665_100503729 Ga0070665_1005037292 213
755 3300005578 Ga0068854_100272227 Ga0068854_1002722271 213
756 3300006042 Ga0075368_10025975 Ga0075368_100259752 213
757 3300006048 Ga0075363_100013044 Ga0075363_1000130442 213
758 3300006177 Ga0075362_10007229 Ga0075362_100072292 213
759 3300006186 Ga0075369_10133907 Ga0075369_101339071 213
760 3300006195 Ga0075366_10088768 Ga0075366_100887683 213
761 3300006353 Ga0075370_10032694 Ga0075370_100326945 213
762 3300006946 Ga0079104_1004042 Ga0079104_10040423 213
763 3300006948 Ga0099826_10002800 Ga0099826_100028007 213
764 3300006948 Ga0099826_10084719 Ga0099826_100847192 213
765 3300009148 Ga0105243_10004033 Ga0105243_100040335 213
766 3300010375 Ga0105239_10439865 Ga0105239_104398652 213
767 3300010375 Ga0105239_11283490 Ga0105239_112834902 213
768 3300013100 Ga0157373_10008186 Ga0157373_100081866 213
769 3300013102 Ga0157371_10000165 Ga0157371_1000016581 213
770 3300013104 Ga0157370_10000295 Ga0157370_1000029544 213
771 3300013296 Ga0157374_10453016 Ga0157374_104530162 213
772 3300021320 Ga0214544_1000010 Ga0214544_1000010143 213
773 3300021321 Ga0214542_1000023 Ga0214542_1000023107 213
774 3300021321 Ga0214542_1018659 Ga0214542_10186591 213
775 3300021327 Ga0214543_1000019 Ga0214543_1000019182 213
776 3300021327 Ga0214543_1000022 Ga0214543_1000022219 213
777 3300022739 Ga0228711_1000017 Ga0228711_100001777 213
778 3300022740 Ga0228710_1000005 Ga0228710_1000005176 213
779 3300025294 Ga0209025_1000154 Ga0209025_100015433 213
780 3300025923 Ga0207681_10091707 Ga0207681_100917072 213
781 3300027111 Ga0209281_1000082 Ga0209281_1000082124 213
782 3300027111 Ga0209281_1000484 Ga0209281_100048458 213
783 3300027312 Ga0209371_1000022 Ga0209371_1000022350 213
784 3300027312 Ga0209371_1002954 Ga0209371_10029542 213
785 3300027666 Ga0209282_1000006 Ga0209282_1000006146 213
786 3300027666 Ga0209282_1001136 Ga0209282_100113610 213
787 3300027666 Ga0209282_1068856 Ga0209282_10688562 213
788 3300027866 Ga0209813_10004514 Ga0209813_100045143 213
789 3300027866 Ga0209813_10096147 Ga0209813_100961471 213
790 3300028794 Ga0307515_10000130 Ga0307515_10000130141 213
791 3300028794 Ga0307515_10005257 Ga0307515_100052571 213
792 3300030500 Ga0268256_1000019 Ga0268256_1000019170 213
793 3300030500 Ga0268256_1002919 Ga0268256_10029196 213
794 3300031548 Ga0307408_100338903 Ga0307408_1003389032 213
795 3300031967 Ga0315914_1000003 Ga0315914_1000003201 213
796 3300031995 Ga0307409_100089557 Ga0307409_1000895572 213
797 3300033430 Ga0315913_1000001 Ga0315913_1000001152 213
798 3300033464 Ga0315915_1000008 Ga0315915_1000008135 213
799 3300037068 Ga0373925_0585369 Ga0373925_0585369_186_833 213
800 3300037471 Ga0395905_0002480 Ga0395905_0002480_6388_7029 213
801 3300037471 Ga0395905_0259794 Ga0395905_0259794_879_1544 213
802 3300041411 Ga0439466_0020023 Ga0439466_0020023_1322_1963 213
803 3300046460 Ga0495638_0026696 Ga0495638_0026696_2515_3156 213
804 3300046460 Ga0495638_0097787 Ga0495638_0097787_750_1391 213
805 3300046516 Ga0495628_0492586 Ga0495628_0492586_156_803 213
806 3300046674 Ga0495588_0002287 Ga0495588_0002287_172_813 213
807 3300047470 Ga0495681_0002688 Ga0495681_0002688_5228_5869 213
808 3300048919 Ga0496116_0032986 Ga0496116_0032986_1464_2105 213
809 3300048919 Ga0496116_0095276 Ga0496116_0095276_522_1163 213
810 3300048920 Ga0496117_0000002 Ga0496117_0000002_194177_194818 213
811 3300048921 Ga0496118_0000736 Ga0496118_0000736_44989_45630 213
812 3300048921 Ga0496118_0024569 Ga0496118_0024569_4116_4772 213
813 3300048921 Ga0496118_0155626 Ga0496118_0155626_396_1037 213
814 3300048922 Ga0496119_0123203 Ga0496119_0123203_259_900 213
815 3300048923 Ga0496120_0000534 Ga0496120_0000534_31319_31960 213
816 3300048923 Ga0496120_0173112 Ga0496120_0173112_211_852 213
817 3300048924 Ga0496121_0003150 Ga0496121_0003150_11487_12131 213
818 3300048924 Ga0496121_0046075 Ga0496121_0046075_1525_2184 213
819 3300048924 Ga0496121_0146056 Ga0496121_0146056_210_851 213
820 3300048925 Ga0496122_0000004 Ga0496122_0000004_450858_451499 213
821 3300048926 Ga0496123_0000007 Ga0496123_0000007_450858_451499 213
822 3300048926 Ga0496123_0243415 Ga0496123_0243415_172_828 213
823 3300048928 Ga0496125_0175165 Ga0496125_0175165_291_932 213
824 3300049569 Ga0501032_0102600 Ga0501032_0102600_1190_1840 213
825 3300049569 Ga0501032_0504106 Ga0501032_0504106_92_733 213
826 3300049571 Ga0501034_0055270 Ga0501034_0055270_1695_2345 213
827 3300049572 Ga0501036_0366316 Ga0501036_0366316_510_1160 213
828 3300049573 Ga0501037_0043729 Ga0501037_0043729_1296_1946 213
829 3300049574 Ga0501038_0594429 Ga0501038_0594429_90_746 213
830 3300049575 Ga0501039_0085556 Ga0501039_0085556_1611_2261 213
831 3300049579 Ga0501043_0300071 Ga0501043_0300071_171_821 213
832 3300049580 Ga0501046_0103988 Ga0501046_0103988_724_1374 213
833 3300049581 Ga0501047_0355225 Ga0501047_0355225_227_877 213
834 3300049582 Ga0501048_0053502 Ga0501048_0053502_560_1216 213
835 3300049584 Ga0501068_0086676 Ga0501068_0086676_1219_1875 213
836 3300049585 Ga0501069_0004804 Ga0501069_0004804_4187_4843 213
837 3300049586 Ga0501070_0128557 Ga0501070_0128557_52_708 213
838 3300049586 Ga0501070_0205537 Ga0501070_0205537_353_1078 213
839 3300049588 Ga0501072_0095179 Ga0501072_0095179_1126_1776 213
840 3300049589 Ga0501073_0029623 Ga0501073_0029623_3113_3769 213
841 3300049674 Ga0501242_034076 Ga0501242_034076_12_653 213
842 3300049822 Ga0501035_0079755 Ga0501035_0079755_1555_2280 213
843 3300049822 Ga0501035_0279882 Ga0501035_0279882_734_1390 213
844 3300049823 Ga0501044_0226587 Ga0501044_0226587_859_1584 213
845 3300049823 Ga0501044_0227485 Ga0501044_0227485_429_1085 213
846 3300050489 nmdc:mga03683_84493_c1 nmdc:mga03683_84493_c1_154_795 213
847 3300050490 nmdc:mga03n38_288801_c1 nmdc:mga03n38_288801_c1_191_832 213
848 3300050491 nmdc:mga00v17_7_c1 nmdc:mga00v17_7_c1_76135_76776 213
849 3300050493 nmdc:mga0k408_20799_c1 nmdc:mga0k408_20799_c1_191_832 213
850 3300050496 nmdc:mga07m45_42699_c1 nmdc:mga07m45_42699_c1_421_1062 213
851 3300050516 nmdc:mga0sz30_316_c1 nmdc:mga0sz30_316_c1_765_1406 213
852 3300053104 Ga0500556_0116673 Ga0500556_0116673_191_832 213
853 3300053107 Ga0500560_072899 Ga0500560_072899_40_681 213
854 3300053122 Ga0500608_070734 Ga0500608_070734_892_1533 213
855 3300053125 Ga0500618_003259 Ga0500618_003259_3323_3964 213
856 3300053136 Ga0500559_0031953 Ga0500559_0031953_529_1194 213
857 3300053153 Ga0500616_0136462 Ga0500616_0136462_46_687 213
858 3300053156 Ga0500622_0011876 Ga0500622_0011876_3262_3903 213
859 3300053177 Ga0500636_0001803 Ga0500636_0001803_2416_3072 213
860 iso_pu_bacteria 2524023207 2524448277 213
861 3300001979 JGI24740J21852_10003788 JGI24740J21852_100037889 214
862 3300002704 JGI25155J39150_1000066 JGI25155J39150_100006627 214
863 3300002705 JGI25156J39149_1000075 JGI25156J39149_100007542 214
864 3300002737 JGI25162J39368_1000149 JGI25162J39368_100014929 214
865 3300002737 JGI25162J39368_1000211 JGI25162J39368_100021129 214
866 3300002738 JGI25154J39366_1000075 JGI25154J39366_100007543 214
867 3300002739 JGI25158J39367_1007705 JGI25158J39367_10077052 214
868 3300002741 JGI25157J39369_1000051 JGI25157J39369_100005180 214
869 3300002741 JGI25157J39369_1000077 JGI25157J39369_100007754 214
870 3300002773 JGI25152J39213_1002234 JGI25152J39213_10022348 214
871 3300002773 JGI25152J39213_1005813 JGI25152J39213_10058132 214
872 3300002774 JGI25150J39212_1000091 JGI25150J39212_100009122 214
873 3300002987 JGI25159J45721_1000008 JGI25159J45721_100000891 214
874 3300002987 JGI25159J45721_1000108 JGI25159J45721_100010816 214
875 3300003187 JGI25151J46595_10000027 JGI25151J46595_1000002735 214
876 3300003187 JGI25151J46595_10004382 JGI25151J46595_100043823 214
877 3300003187 JGI25151J46595_10012482 JGI25151J46595_100124822 214
878 3300003187 JGI25151J46595_10023359 JGI25151J46595_100233592 214
879 3300003187 JGI25151J46595_10074492 JGI25151J46595_100744922 214
880 3300003214 JGI25165J46597_1000938 JGI25165J46597_100093823 214
881 3300003214 JGI25165J46597_1002398 JGI25165J46597_10023985 214
882 3300003214 JGI25165J46597_1004248 JGI25165J46597_10042482 214
883 3300003214 JGI25165J46597_1009796 JGI25165J46597_10097962 214
884 3300003214 JGI25165J46597_1017219 JGI25165J46597_10172191 214
885 3300003215 JGI25153J46596_10000608 JGI25153J46596_100006082 214
886 3300003215 JGI25153J46596_10012364 JGI25153J46596_100123642 214
887 3300003322 rootL2_10086412 rootL2_100864124 214
888 3300003323 rootH1_10065041 rootH1_100650412 214
889 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001175 214
890 3300003354 JGI25160J50197_1000033 JGI25160J50197_100003384 214
891 3300003354 JGI25160J50197_1008515 JGI25160J50197_10085152 214
892 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001593 214
893 3300003374 JGI25161J50226_1001306 JGI25161J50226_10013062 214
894 3300003752 Ga0055539_1006088 Ga0055539_10060881 214
895 3300003771 Ga0055526_1000653 Ga0055526_100065313 214
896 3300003771 Ga0055526_1009408 Ga0055526_10094081 214
897 3300003771 Ga0055526_1018944 Ga0055526_10189442 214
898 3300003775 Ga0055524_1003836 Ga0055524_10038368 214
899 3300003775 Ga0055524_1015273 Ga0055524_10152731 214
900 3300003775 Ga0055524_1050455 Ga0055524_10504552 214
901 3300003781 Ga0055536_1011754 Ga0055536_10117542 214
902 3300003781 Ga0055536_1013708 Ga0055536_10137082 214
903 3300003790 Ga0055528_1000662 Ga0055528_100066212 214
904 3300003790 Ga0055528_1014668 Ga0055528_10146682 214
905 3300003790 Ga0055528_1040398 Ga0055528_10403982 214
906 3300003794 Ga0055531_10020251 Ga0055531_100202512 214
907 3300004625 Ga0055543_1000007 Ga0055543_100000720 214
908 3300004625 Ga0055543_1000026 Ga0055543_100002656 214
909 3300005262 Ga0065165_1000008 Ga0065165_1000008288 214
910 3300005262 Ga0065165_1000178 Ga0065165_100017884 214
911 3300005262 Ga0065165_1005090 Ga0065165_10050904 214
912 3300005262 Ga0065165_1012225 Ga0065165_10122252 214
913 3300005331 Ga0070670_100001446 Ga0070670_10000144618 214
914 3300005341 Ga0070691_10157642 Ga0070691_101576421 214
915 3300005347 Ga0070668_100094527 Ga0070668_1000945271 214
916 3300005355 Ga0070671_100079695 Ga0070671_1000796952 214
917 3300005548 Ga0070665_100235377 Ga0070665_1002353772 214
918 3300005548 Ga0070665_100287596 Ga0070665_1002875962 214
919 3300005563 Ga0068855_100189071 Ga0068855_1001890712 214
920 3300005614 Ga0068856_100048755 Ga0068856_1000487554 214
921 3300005616 Ga0068852_100187250 Ga0068852_1001872502 214
922 3300006038 Ga0075365_10003643 Ga0075365_100036439 214
923 3300006051 Ga0075364_10084672 Ga0075364_100846722 214
924 3300006178 Ga0075367_10001877 Ga0075367_100018778 214
925 3300006178 Ga0075367_10180137 Ga0075367_101801372 214
926 3300006353 Ga0075370_10015910 Ga0075370_100159101 214
927 3300009011 Ga0105251_10011125 Ga0105251_100111252 214
928 3300009092 Ga0105250_10025969 Ga0105250_100259692 214
929 3300009093 Ga0105240_10000014 Ga0105240_10000014123 214
930 3300009148 Ga0105243_10173488 Ga0105243_101734881 214
931 3300009176 Ga0105242_11556278 Ga0105242_115562781 214
932 3300009177 Ga0105248_10073235 Ga0105248_100732351 214
933 3300009545 Ga0105237_10034929 Ga0105237_100349293 214
934 3300009553 Ga0105249_10176767 Ga0105249_101767673 214
935 3300009766 Ga0123342_1019829 Ga0123342_10198292 214
936 3300010375 Ga0105239_10133420 Ga0105239_101334202 214
937 3300011119 Ga0105246_10244698 Ga0105246_102446981 214
938 3300013100 Ga0157373_10059856 Ga0157373_100598562 214
939 3300013104 Ga0157370_10000015 Ga0157370_10000015123 214
940 3300013104 Ga0157370_10733755 Ga0157370_107337551 214
941 3300013249 Ga0171463_1007 Ga0171463_1007208 214
942 3300014325 Ga0163163_10261109 Ga0163163_102611092 214
943 3300015262 Ga0182007_10000385 Ga0182007_1000038522 214
944 3300015265 Ga0182005_1012099 Ga0182005_10120992 214
945 3300015690 Ga0183363_1084 Ga0183363_108412 214
946 3300025206 Ga0209435_100005 Ga0209435_100005472 214
947 3300025208 Ga0209436_107112 Ga0209436_1071121 214
948 3300025228 Ga0209672_102660 Ga0209672_1026603 214
949 3300025231 Ga0207427_109989 Ga0207427_1099891 214
950 3300025233 Ga0209437_100058 Ga0209437_100058113 214
951 3300025233 Ga0209437_100060 Ga0209437_100060147 214
952 3300025245 Ga0207425_1000043 Ga0207425_100004334 214
953 3300025246 Ga0209646_1000011 Ga0209646_1000011472 214
954 3300025246 Ga0209646_1004996 Ga0209646_10049962 214
955 3300025246 Ga0209646_1008318 Ga0209646_10083182 214
956 3300025250 Ga0209026_1000008 Ga0209026_1000008472 214
957 3300025253 Ga0209677_100289 Ga0209677_1002893 214
958 3300025254 Ga0209148_1009441 Ga0209148_10094412 214
959 3300025256 Ga0209759_1000004 Ga0209759_1000004472 214
960 3300025258 Ga0209129_1000072 Ga0209129_1000072160 214
961 3300025258 Ga0209129_1000128 Ga0209129_100012883 214
962 3300025258 Ga0209129_1002097 Ga0209129_10020979 214
963 3300025261 Ga0209233_1000137 Ga0209233_1000137124 214
964 3300025261 Ga0209233_1000149 Ga0209233_100014971 214
965 3300025261 Ga0209233_1000160 Ga0209233_100016084 214
966 3300025273 Ga0209673_1000125 Ga0209673_100012596 214
967 3300025273 Ga0209673_1001756 Ga0209673_10017563 214
968 3300025273 Ga0209673_1007827 Ga0209673_10078272 214
969 3300025284 Ga0209130_1000003 Ga0209130_1000003599 214
970 3300025284 Ga0209130_1000017 Ga0209130_100001793 214
971 3300025292 Ga0209676_1001868 Ga0209676_100186812 214
972 3300025292 Ga0209676_1006852 Ga0209676_10068525 214
973 3300025292 Ga0209676_1024122 Ga0209676_10241223 214
974 3300025294 Ga0209025_1000120 Ga0209025_1000120160 214
975 3300025294 Ga0209025_1000153 Ga0209025_100015384 214
976 3300025294 Ga0209025_1000451 Ga0209025_100045126 214
977 3300025294 Ga0209025_1001209 Ga0209025_100120929 214
978 3300025294 Ga0209025_1005577 Ga0209025_10055777 214
979 3300025294 Ga0209025_1011938 Ga0209025_10119386 214
980 3300025294 Ga0209025_1039768 Ga0209025_10397682 214
981 3300025295 Ga0209564_1000013 Ga0209564_1000013542 214
982 3300025295 Ga0209564_1002604 Ga0209564_10026042 214
983 3300025295 Ga0209564_1012686 Ga0209564_10126862 214
984 3300025297 Ga0209758_1000058 Ga0209758_1000058188 214
985 3300025297 Ga0209758_1000111 Ga0209758_1000111161 214
986 3300025297 Ga0209758_1017165 Ga0209758_10171652 214
987 3300025297 Ga0209758_1037612 Ga0209758_10376122 214
988 3300025298 Ga0209050_1003484 Ga0209050_100348415 214
989 3300025298 Ga0209050_1003752 Ga0209050_10037529 214
990 3300025298 Ga0209050_1062493 Ga0209050_10624931 214
991 3300025299 Ga0209256_1000211 Ga0209256_100021133 214
992 3300025299 Ga0209256_1001412 Ga0209256_100141219 214
993 3300025299 Ga0209256_1003656 Ga0209256_10036563 214
994 3300025299 Ga0209256_1004483 Ga0209256_10044831 214
995 3300025299 Ga0209256_1040947 Ga0209256_10409472 214
996 3300025302 Ga0207426_1000006 Ga0207426_100000692 214
997 3300025302 Ga0207426_1000011 Ga0207426_1000011176 214
998 3300025302 Ga0207426_1000936 Ga0207426_10009369 214
999 3300025303 Ga0209051_1011248 Ga0209051_10112484 214
1000 3300025303 Ga0209051_1012412 Ga0209051_10124122 214
1001 3300025303 Ga0209051_1039670 Ga0209051_10396702 214
1002 3300025304 Ga0209257_1004483 Ga0209257_100448313 214
1003 3300025304 Ga0209257_1007250 Ga0209257_10072506 214
1004 3300025913 Ga0207695_10000037 Ga0207695_10000037123 214
1005 3300025914 Ga0207671_10000080 Ga0207671_10000080124 214
1006 3300025925 Ga0207650_10000624 Ga0207650_100006242 214
1007 3300025931 Ga0207644_10027543 Ga0207644_100275433 214
1008 3300025935 Ga0207709_10127522 Ga0207709_101275221 214
1009 3300025949 Ga0207667_10131111 Ga0207667_101311112 214
1010 3300026078 Ga0207702_10054621 Ga0207702_100546213 214
1011 3300026142 Ga0207698_10047370 Ga0207698_100473703 214
1012 3300028379 Ga0268266_10292161 Ga0268266_102921612 214
1013 3300028379 Ga0268266_10314642 Ga0268266_103146422 214
1014 3300028794 Ga0307515_10000017 Ga0307515_10000017226 214
1015 3300031251 Ga0265327_10016350 Ga0265327_100163502 214
1016 3300031456 Ga0307513_10000852 Ga0307513_100008527 214
1017 3300031548 Ga0307408_100080226 Ga0307408_1000802262 214
1018 3300031548 Ga0307408_100121403 Ga0307408_1001214032 214
1019 3300031731 Ga0307405_10002738 Ga0307405_100027382 214
1020 3300031901 Ga0307406_10014143 Ga0307406_100141434 214
1021 3300031911 Ga0307412_10018020 Ga0307412_100180205 214
1022 3300031911 Ga0307412_10257700 Ga0307412_102577002 214
1023 3300031995 Ga0307409_100164769 Ga0307409_1001647692 214
1024 3300031995 Ga0307409_100260217 Ga0307409_1002602172 214
1025 3300032004 Ga0307414_10056049 Ga0307414_100560492 214
1026 3300032005 Ga0307411_10158468 Ga0307411_101584682 214
1027 3300041406 Ga0439439_0045386 Ga0439439_0045386_418_1062 214
1028 3300042006 Ga0439432_068820 Ga0439432_068820_178_822 214
1029 3300042015 Ga0439462_0066998 Ga0439462_0066998_121_894 214
1030 3300042147 Ga0450910_025641 Ga0450910_025641_211_861 214
1031 3300042531 Ga0450918_034782 Ga0450918_034782_81_854 214
1032 3300044683 Ga0466965_0201646 Ga0466965_0201646_78_776 214
1033 3300044694 Ga0466963_0094205 Ga0466963_0094205_872_1516 214
1034 3300045836 Ga0466958_0134493 Ga0466958_0134493_347_991 214
1035 3300046454 Ga0495592_0138707 Ga0495592_0138707_112_798 214
1036 3300046459 Ga0495629_0148195 Ga0495629_0148195_674_1360 214
1037 3300046460 Ga0495638_0000746 Ga0495638_0000746_31480_32136 214
1038 3300046474 Ga0495605_0006714 Ga0495605_0006714_656_1312 214
1039 3300046474 Ga0495605_0215382 Ga0495605_0215382_93_749 214
1040 3300046477 Ga0495664_0113926 Ga0495664_0113926_101_787 214
1041 3300046492 Ga0495585_0008427 Ga0495585_0008427_696_1352 214
1042 3300046492 Ga0495585_0009784 Ga0495585_0009784_4615_5271 214
1043 3300046501 Ga0495607_0200986 Ga0495607_0200986_208_864 214
1044 3300046506 Ga0495583_0006653 Ga0495583_0006653_5225_5881 214
1045 3300046506 Ga0495583_0028326 Ga0495583_0028326_374_1030 214
1046 3300046507 Ga0495606_0003935 Ga0495606_0003935_7015_7662 214
1047 3300046512 Ga0495610_0002265 Ga0495610_0002265_1435_2091 214
1048 3300046514 Ga0495618_0162508 Ga0495618_0162508_518_1204 214
1049 3300046518 Ga0495631_0005776 Ga0495631_0005776_5220_5876 214
1050 3300046519 Ga0495632_0007633 Ga0495632_0007633_5462_6118 214
1051 3300046519 Ga0495632_0026990 Ga0495632_0026990_1647_2303 214
1052 3300046524 Ga0495648_0063942 Ga0495648_0063942_666_1322 214
1053 3300046524 Ga0495648_0082233 Ga0495648_0082233_523_1209 214
1054 3300046530 Ga0495654_0083310 Ga0495654_0083310_356_1012 214
1055 3300046538 Ga0495609_0010907 Ga0495609_0010907_2301_2957 214
1056 3300046557 Ga0495622_0018804 Ga0495622_0018804_1995_2681 214
1057 3300046615 Ga0495656_0105174 Ga0495656_0105174_259_915 214
1058 3300046616 Ga0495668_0006000 Ga0495668_0006000_2246_2902 214
1059 3300046648 Ga0495611_0009032 Ga0495611_0009032_604_1260 214
1060 3300046660 Ga0495625_0032768 Ga0495625_0032768_341_997 214
1061 3300046660 Ga0495625_0120288 Ga0495625_0120288_982_1638 214
1062 3300046674 Ga0495588_0042451 Ga0495588_0042451_744_1430 214
1063 3300046674 Ga0495588_0059283 Ga0495588_0059283_88_738 214
1064 3300046675 Ga0495657_0093998 Ga0495657_0093998_849_1535 214
1065 3300046683 Ga0495658_0037279 Ga0495658_0037279_636_1322 214
1066 3300046691 Ga0495670_0026395 Ga0495670_0026395_1592_2248 214
1067 3300046809 Ga0495600_0039143 Ga0495600_0039143_2119_2805 214
1068 3300046810 Ga0495660_0071768 Ga0495660_0071768_347_1003 214
1069 3300047317 Ga0495604_0047267 Ga0495604_0047267_2170_2856 214
1070 3300047318 Ga0495636_0045643 Ga0495636_0045643_526_1182 214
1071 3300047472 Ga0495686_0003605 Ga0495686_0003605_3400_4047 214
1072 3300047472 Ga0495686_0007947 Ga0495686_0007947_1353_2009 214
1073 3300047472 Ga0495686_0032290 Ga0495686_0032290_1682_2332 214
1074 3300048914 Ga0496111_0103939 Ga0496111_0103939_174_830 214
1075 3300048919 Ga0496116_0002588 Ga0496116_0002588_7594_8250 214
1076 3300048919 Ga0496116_0013733 Ga0496116_0013733_816_1460 214
1077 3300048919 Ga0496116_0014973 Ga0496116_0014973_3174_3830 214
1078 3300048919 Ga0496116_0024233 Ga0496116_0024233_1830_2486 214
1079 3300048919 Ga0496116_0041518 Ga0496116_0041518_175_831 214
1080 3300048919 Ga0496116_0059647 Ga0496116_0059647_904_1560 214
1081 3300048919 Ga0496116_0063443 Ga0496116_0063443_500_1150 214
1082 3300048919 Ga0496116_0074708 Ga0496116_0074708_66_716 214
1083 3300048919 Ga0496116_0127558 Ga0496116_0127558_299_943 214
1084 3300048920 Ga0496117_0006417 Ga0496117_0006417_6187_6843 214
1085 3300048920 Ga0496117_0016935 Ga0496117_0016935_3191_3847 214
1086 3300048920 Ga0496117_0018549 Ga0496117_0018549_1206_1856 214
1087 3300048920 Ga0496117_0020840 Ga0496117_0020840_2405_3055 214
1088 3300048920 Ga0496117_0214582 Ga0496117_0214582_61_705 214
1089 3300048920 Ga0496117_0283163 Ga0496117_0283163_10_654 214
1090 3300048921 Ga0496118_0003614 Ga0496118_0003614_2257_2901 214
1091 3300048921 Ga0496118_0013249 Ga0496118_0013249_768_1424 214
1092 3300048921 Ga0496118_0015735 Ga0496118_0015735_401_1057 214
1093 3300048921 Ga0496118_0111121 Ga0496118_0111121_818_1468 214
1094 3300048922 Ga0496119_0051829 Ga0496119_0051829_771_1427 214
1095 3300048922 Ga0496119_0196193 Ga0496119_0196193_156_800 214
1096 3300048923 Ga0496120_0078409 Ga0496120_0078409_133_789 214
1097 3300048923 Ga0496120_0094728 Ga0496120_0094728_10_654 214
1098 3300048924 Ga0496121_0000003 Ga0496121_0000003_771811_772461 214
1099 3300048924 Ga0496121_0005802 Ga0496121_0005802_14277_14921 214
1100 3300048924 Ga0496121_0016685 Ga0496121_0016685_6045_6701 214
1101 3300048924 Ga0496121_0070292 Ga0496121_0070292_1262_1909 214
1102 3300048924 Ga0496121_0077913 Ga0496121_0077913_407_1063 214
1103 3300048924 Ga0496121_0199453 Ga0496121_0199453_97_741 214
1104 3300048925 Ga0496122_0001309 Ga0496122_0001309_7850_8500 214
1105 3300048925 Ga0496122_0004381 Ga0496122_0004381_878_1522 214
1106 3300048925 Ga0496122_0007678 Ga0496122_0007678_3503_4159 214
1107 3300048925 Ga0496122_0015087 Ga0496122_0015087_6118_6774 214
1108 3300048925 Ga0496122_0074739 Ga0496122_0074739_1333_1989 214
1109 3300048925 Ga0496122_0132371 Ga0496122_0132371_830_1474 214
1110 3300048925 Ga0496122_0144349 Ga0496122_0144349_47_703 214
1111 3300048926 Ga0496123_0002726 Ga0496123_0002726_12690_13340 214
1112 3300048926 Ga0496123_0005862 Ga0496123_0005862_8945_9601 214
1113 3300048926 Ga0496123_0010546 Ga0496123_0010546_6091_6747 214
1114 3300048926 Ga0496123_0067993 Ga0496123_0067993_450_1100 214
1115 3300048926 Ga0496123_0113899 Ga0496123_0113899_186_842 214
1116 3300048926 Ga0496123_0147014 Ga0496123_0147014_433_1077 214
1117 3300048926 Ga0496123_0161628 Ga0496123_0161628_52_696 214
1118 3300048927 Ga0496124_0000067 Ga0496124_0000067_83079_83729 214
1119 3300048927 Ga0496124_0001796 Ga0496124_0001796_25458_26108 214
1120 3300048927 Ga0496124_0009377 Ga0496124_0009377_1830_2486 214
1121 3300048927 Ga0496124_0029536 Ga0496124_0029536_1657_2313 214
1122 3300048927 Ga0496124_0035242 Ga0496124_0035242_1633_2283 214
1123 3300048927 Ga0496124_0103507 Ga0496124_0103507_1019_1663 214
1124 3300048927 Ga0496124_0130926 Ga0496124_0130926_312_968 214
1125 3300048927 Ga0496124_0313292 Ga0496124_0313292_311_955 214
1126 3300048928 Ga0496125_0000262 Ga0496125_0000262_30730_31380 214
1127 3300048928 Ga0496125_0001869 Ga0496125_0001869_3164_3814 214
1128 3300048928 Ga0496125_0008714 Ga0496125_0008714_6455_7111 214
1129 3300048928 Ga0496125_0036049 Ga0496125_0036049_1005_1661 214
1130 3300048928 Ga0496125_0135589 Ga0496125_0135589_472_1116 214
1131 3300048928 Ga0496125_0230354 Ga0496125_0230354_466_1116 214
1132 3300048929 Ga0496126_0023200 Ga0496126_0023200_3631_4281 214
1133 3300048929 Ga0496126_0117257 Ga0496126_0117257_813_1556 214
1134 3300048929 Ga0496126_0125188 Ga0496126_0125188_891_1535 214
1135 3300049459 Ga0495678_007866 Ga0495678_007866_1658_2314 214
1136 3300049460 Ga0495682_0092962 Ga0495682_0092962_67_723 214
1137 3300049568 Ga0501031_0170494 Ga0501031_0170494_650_1342 214
1138 3300049570 Ga0501033_0082910 Ga0501033_0082910_1125_1817 214
1139 3300049571 Ga0501034_0134389 Ga0501034_0134389_959_1609 214
1140 3300049571 Ga0501034_0400366 Ga0501034_0400366_116_766 214
1141 3300049572 Ga0501036_0232940 Ga0501036_0232940_91_741 214
1142 3300049572 Ga0501036_0561906 Ga0501036_0561906_112_804 214
1143 3300049573 Ga0501037_0054331 Ga0501037_0054331_704_1396 214
1144 3300049573 Ga0501037_0150722 Ga0501037_0150722_169_819 214
1145 3300049574 Ga0501038_0072292 Ga0501038_0072292_657_1349 214
1146 3300049579 Ga0501043_0056257 Ga0501043_0056257_1695_2345 214
1147 3300049579 Ga0501043_0364571 Ga0501043_0364571_294_986 214
1148 3300049580 Ga0501046_0290583 Ga0501046_0290583_67_759 214
1149 3300049586 Ga0501070_0168831 Ga0501070_0168831_675_1367 214
1150 3300049776 Ga0501280_003284 Ga0501280_003284_482_1135 214
1151 3300049823 Ga0501044_0052923 Ga0501044_0052923_2144_2836 214
1152 3300049823 Ga0501044_0141758 Ga0501044_0141758_1139_1831 214
1153 3300049824 Ga0501045_0364081 Ga0501045_0364081_207_857 214
1154 3300050491 nmdc:mga00v17_32522_c1 nmdc:mga00v17_32522_c1_154_804 214
1155 3300053079 Ga0500610_0011228 Ga0500610_0011228_2973_3629 214
1156 3300053086 Ga0500578_0144413 Ga0500578_0144413_384_1040 214
1157 3300053099 Ga0500654_074812 Ga0500654_074812_790_1440 214
1158 3300053109 Ga0500569_054539 Ga0500569_054539_531_1187 214
1159 3300053121 Ga0500607_128747 Ga0500607_128747_13_699 214
1160 3300053139 Ga0500568_0005180 Ga0500568_0005180_5233_5889 214
1161 3300053148 Ga0500590_016038 Ga0500590_016038_1022_1708 214
1162 3300053151 Ga0500604_0017758 Ga0500604_0017758_298_984 214
1163 3300053153 Ga0500616_0002773 Ga0500616_0002773_5232_5888 214
1164 3300053153 Ga0500616_0069966 Ga0500616_0069966_554_1198 214
1165 3300053158 Ga0500627_0009901 Ga0500627_0009901_1533_2189 214
1166 3300053161 Ga0500634_0014987 Ga0500634_0014987_3304_3972 214
1167 3300053177 Ga0500636_0219458 Ga0500636_0219458_119_805 214
1168 3300061719 Ga0466962_0235311 Ga0466962_0235311_19_663 214
1169 iso_pu_bacteria 8056875544 8056875949 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08362

TetR_C_3

YcdC-like protein, C-terminal region

70

212

0.98

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

23

69

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xk4-assembly2.cif.gz_D e. coli transcriptional regulator rutr with dihydrouracil 0.912 19 208
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.9034 22 212
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.8945 22 212
4xk4-assembly2.cif.gz_D e. coli transcriptional regulator rutr with dihydrouracil 0.8816 19 208
3s5r-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator of the tetr family (syn_02108) from syntrophus aciditrophicus at 2.60 a resolution 0.8583 19 209
ID Description Score Start End Superfamily
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9814 22 68 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.977 19 68 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9757 19 68 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9745 19 68 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9726 19 61 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I3QGZ9-F1-model_v4 Transcriptional regulator, TetR family 0.9753 5 209 GO:0000976
GO:0003700
GO:0045892
AF-A0A527IDU9-F1-model_v4 deleted 0.9721 5 181
AF-A0A436G578-F1-model_v4 TetR family transcriptional regulator 0.9669 5 148 GO:0000976
GO:0003700
GO:0045892
AF-A0A4Q2QQE5-F1-model_v4 HTH-type transcriptional regulator RutR 0.9638 57 185 GO:0045892
AF-A0A529UJ84-F1-model_v4 deleted 0.9629 3 172

Feature Viewer

pLDDT pTM Quality
89.22 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map