F491147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1170 | 486 | 1139 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300036459|Ga0372808_006082|Ga0372808_006082_157_1047 |
| Length | 296 |
| Sequence | MRQLSARASPTLIAPEVCCCRRASLFEPTIDNEEQAETTNMTDPKIPVTEDELHAFVDNELPAERRGDVEAWLAAHPEDAERVQSWRTMAEALHARYDAVANEPVPKRLEIERLMQQPRKWIYGMIAATLMAFVAGGGAGWLAHGAAVSPSMFKSFTVDALDAHRLYVVEVRHPVEVPGDERAHLQAWLTKRCGWDVQAPELDATGLKLVGGRLLPGPTGPASFLMYESASGERFTVYASKASAETTQMRYTTEDNDGALFWADHGVGYVVSGSSDRDRLTEVARLVYDQAEKSGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 5 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 6 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 7 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 10 | 2791355199 | |||
| 11 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 12 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 13 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 14 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 15 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 16 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 17 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 18 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 19 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 20 | 2906610324 | |||
| 21 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 22 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 23 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 24 | 2922425934 | |||
| 25 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 32 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 148 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 149 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 150 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 151 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 226 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 230 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 245 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 275 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 276 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 280 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 284 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 370 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 371 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 372 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 373 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 374 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 375 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 378 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 379 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 380 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 381 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 382 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 383 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 384 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 385 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 386 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 387 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 388 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 389 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 390 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 391 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 392 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 393 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 432 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 436 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 437 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 439 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 441 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 442 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 443 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 444 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 445 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 447 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 448 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 449 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 450 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 451 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 453 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 454 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 458 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 459 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 460 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 461 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 462 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 463 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 464 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 465 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 466 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 467 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 469 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 470 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 472 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 474 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 476 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 478 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 480 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 481 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 482 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 483 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 484 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 485 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 486 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 0.69 |
| Isolates | 2.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.6 |
| Nodule | 1.45 |
| Rhizoplane | 4.96 |
| Rhizosphere | 73.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1006317 | 3300000549 | Bacteria | 1479 |
| 2 | JGI24737J22298_10001768 | 3300001990 | Bacteria | 7736 |
| 3 | JGI25153J46596_10003412 | 3300003215 | Bacteria | 8898 |
| 4 | JGI25153J46596_10026735 | 3300003215 | Bacteria | 2037 |
| 5 | Ga0006777J48905_1012525 | 3300003308 | Bacteria | 1316 |
| 6 | rootH2_10115860 | 3300003320 | Bacteria | 1652 |
| 7 | rootL2_10024455 | 3300003322 | Bacteria | 1568 |
| 8 | rootH1_10044347 | 3300003323 | Bacteria | 2354 |
| 9 | JGI25404J52841_10037718 | 3300003659 | Bacteria | 1027 |
| 10 | Ga0055526_1031838 | 3300003771 | Bacteria | 1502 |
| 11 | Ga0065165_1041708 | 3300005262 | Bacteria | 1360 |
| 12 | Ga0070658_10019292 | 3300005327 | Bacteria | 5461 |
| 13 | Ga0070658_10034116 | 3300005327 | Bacteria | 4094 |
| 14 | Ga0070658_10271726 | 3300005327 | Bacteria | 1442 |
| 15 | Ga0070683_100003303 | 3300005329 | Bacteria | 13041 |
| 16 | Ga0070683_100040395 | 3300005329 | Bacteria | 4289 |
| 17 | Ga0070683_100049222 | 3300005329 | Bacteria | 3897 |
| 18 | Ga0070670_100184301 | 3300005331 | Bacteria | 1812 |
| 19 | Ga0068869_100092114 | 3300005334 | Bacteria | 2281 |
| 20 | Ga0070680_100030563 | 3300005336 | Bacteria | 4327 |
| 21 | Ga0070680_100261526 | 3300005336 | Bacteria | 1464 |
| 22 | Ga0070680_100417061 | 3300005336 | Bacteria | 1145 |
| 23 | Ga0068868_100304927 | 3300005338 | Bacteria | 1353 |
| 24 | Ga0070660_100001126 | 3300005339 | Bacteria | 18028 |
| 25 | Ga0070660_100047104 | 3300005339 | Bacteria | 3307 |
| 26 | Ga0070689_100652361 | 3300005340 | Bacteria | 915 |
| 27 | Ga0070661_100013721 | 3300005344 | Bacteria | 5692 |
| 28 | Ga0070668_100108941 | 3300005347 | Bacteria | 2203 |
| 29 | Ga0070668_100118734 | 3300005347 | Bacteria | 2111 |
| 30 | Ga0070668_100266734 | 3300005347 | Bacteria | 1425 |
| 31 | Ga0070668_100277616 | 3300005347 | Bacteria | 1398 |
| 32 | Ga0070668_100375144 | 3300005347 | Bacteria | 1209 |
| 33 | Ga0070668_100406455 | 3300005347 | Bacteria | 1163 |
| 34 | Ga0070675_100191642 | 3300005354 | Bacteria | 1771 |
| 35 | Ga0070671_100034539 | 3300005355 | Bacteria | 4186 |
| 36 | Ga0070671_100148618 | 3300005355 | Bacteria | 1978 |
| 37 | Ga0070671_100148721 | 3300005355 | Bacteria | 1977 |
| 38 | Ga0070674_100050181 | 3300005356 | Bacteria | 2872 |
| 39 | Ga0070659_100010953 | 3300005366 | Bacteria | 6694 |
| 40 | Ga0070659_100542944 | 3300005366 | Bacteria | 994 |
| 41 | Ga0070667_100059884 | 3300005367 | Bacteria | 3222 |
| 42 | Ga0070667_100100855 | 3300005367 | Bacteria | 2493 |
| 43 | Ga0070667_100303982 | 3300005367 | Bacteria | 1437 |
| 44 | Ga0070709_10018509 | 3300005434 | Bacteria | 4012 |
| 45 | Ga0070709_10020362 | 3300005434 | Bacteria | 3848 |
| 46 | Ga0070709_10075990 | 3300005434 | Bacteria | 2180 |
| 47 | Ga0070709_10277985 | 3300005434 | Bacteria | 1216 |
| 48 | Ga0070709_10362430 | 3300005434 | Bacteria | 1074 |
| 49 | Ga0070714_100002134 | 3300005435 | Bacteria | 14537 |
| 50 | Ga0070714_100022705 | 3300005435 | Bacteria | 5146 |
| 51 | Ga0070714_100026305 | 3300005435 | Bacteria | 4808 |
| 52 | Ga0070714_100084149 | 3300005435 | Bacteria | 2775 |
| 53 | Ga0070714_100460661 | 3300005435 | Bacteria | 1209 |
| 54 | Ga0070714_100563354 | 3300005435 | Bacteria | 1092 |
| 55 | Ga0070714_100633225 | 3300005435 | Bacteria | 1029 |
| 56 | Ga0070713_100024693 | 3300005436 | Bacteria | 4687 |
| 57 | Ga0070713_100027055 | 3300005436 | Bacteria | 4512 |
| 58 | Ga0070713_100053782 | 3300005436 | Bacteria | 3338 |
| 59 | Ga0070713_100062854 | 3300005436 | Bacteria | 3111 |
| 60 | Ga0070713_100097526 | 3300005436 | Bacteria | 2540 |
| 61 | Ga0070713_100140124 | 3300005436 | Bacteria | 2141 |
| 62 | Ga0070713_100464401 | 3300005436 | Bacteria | 1191 |
| 63 | Ga0070710_10000869 | 3300005437 | Bacteria | 14456 |
| 64 | Ga0070710_10002054 | 3300005437 | Bacteria | 9536 |
| 65 | Ga0070710_10034900 | 3300005437 | Bacteria | 2738 |
| 66 | Ga0070710_10076678 | 3300005437 | Bacteria | 1941 |
| 67 | Ga0070710_10481898 | 3300005437 | Bacteria | 846 |
| 68 | Ga0070701_10175276 | 3300005438 | Bacteria | 1251 |
| 69 | Ga0070711_100001638 | 3300005439 | Bacteria | 12376 |
| 70 | Ga0070711_100002128 | 3300005439 | Bacteria | 11223 |
| 71 | Ga0070711_100010247 | 3300005439 | Bacteria | 5797 |
| 72 | Ga0070711_100013567 | 3300005439 | Bacteria | 5117 |
| 73 | Ga0070711_100023165 | 3300005439 | Bacteria | 4034 |
| 74 | Ga0070711_100233615 | 3300005439 | Bacteria | 1435 |
| 75 | Ga0070711_100253020 | 3300005439 | Bacteria | 1383 |
| 76 | Ga0070711_100509365 | 3300005439 | Bacteria | 993 |
| 77 | Ga0070663_100024391 | 3300005455 | Bacteria | 4071 |
| 78 | Ga0070663_100030275 | 3300005455 | Bacteria | 3707 |
| 79 | Ga0070663_100078737 | 3300005455 | Bacteria | 2417 |
| 80 | Ga0070663_100162182 | 3300005455 | Bacteria | 1721 |
| 81 | Ga0070678_100056469 | 3300005456 | Bacteria | 2872 |
| 82 | Ga0070678_100066749 | 3300005456 | Bacteria | 2675 |
| 83 | Ga0070678_100098709 | 3300005456 | Bacteria | 2258 |
| 84 | Ga0070678_100158637 | 3300005456 | Bacteria | 1830 |
| 85 | Ga0070662_100024079 | 3300005457 | Bacteria | 4190 |
| 86 | Ga0070681_10019518 | 3300005458 | Bacteria | 6787 |
| 87 | Ga0070681_10057834 | 3300005458 | Bacteria | 3858 |
| 88 | Ga0070681_10058646 | 3300005458 | Bacteria | 3829 |
| 89 | Ga0070681_10109584 | 3300005458 | Bacteria | 2701 |
| 90 | Ga0070681_10273678 | 3300005458 | Bacteria | 1600 |
| 91 | Ga0068867_100008066 | 3300005459 | Bacteria | 7440 |
| 92 | Ga0070698_100077919 | 3300005471 | Bacteria | 3313 |
| 93 | Ga0070699_100497984 | 3300005518 | Bacteria | 1107 |
| 94 | Ga0070679_100013683 | 3300005530 | Bacteria | 7770 |
| 95 | Ga0070679_100030393 | 3300005530 | Bacteria | 5333 |
| 96 | Ga0070679_100060424 | 3300005530 | Bacteria | 3777 |
| 97 | Ga0070679_100092886 | 3300005530 | Bacteria | 3005 |
| 98 | Ga0070679_100146533 | 3300005530 | Bacteria | 2338 |
| 99 | Ga0070679_100197687 | 3300005530 | Bacteria | 1977 |
| 100 | Ga0070684_100030375 | 3300005535 | Bacteria | 4589 |
| 101 | Ga0070684_100096932 | 3300005535 | Bacteria | 2629 |
| 102 | Ga0070684_100115400 | 3300005535 | Bacteria | 2411 |
| 103 | Ga0070684_100243608 | 3300005535 | Bacteria | 1643 |
| 104 | Ga0070684_100246669 | 3300005535 | Bacteria | 1632 |
| 105 | Ga0070684_100807973 | 3300005535 | Bacteria | 877 |
| 106 | Ga0070697_100040365 | 3300005536 | Bacteria | 3776 |
| 107 | Ga0068853_100002631 | 3300005539 | Bacteria | 13517 |
| 108 | Ga0068853_100034375 | 3300005539 | Bacteria | 4302 |
| 109 | Ga0068853_100038437 | 3300005539 | Bacteria | 4076 |
| 110 | Ga0068853_100247085 | 3300005539 | Bacteria | 1636 |
| 111 | Ga0068853_100695666 | 3300005539 | Unclassified | 969 |
| 112 | Ga0070672_100069702 | 3300005543 | Bacteria | 2793 |
| 113 | Ga0070672_100230303 | 3300005543 | Bacteria | 1556 |
| 114 | Ga0070672_100250509 | 3300005543 | Bacteria | 1491 |
| 115 | Ga0070686_100090732 | 3300005544 | Bacteria | 2043 |
| 116 | Ga0070695_100395401 | 3300005545 | Bacteria | 1046 |
| 117 | Ga0070696_100272168 | 3300005546 | Bacteria | 1288 |
| 118 | Ga0070665_100054477 | 3300005548 | Bacteria | 4011 |
| 119 | Ga0070665_100063343 | 3300005548 | Bacteria | 3707 |
| 120 | Ga0070665_100103479 | 3300005548 | Bacteria | 2850 |
| 121 | Ga0070665_100155974 | 3300005548 | Bacteria | 2285 |
| 122 | Ga0070665_100246669 | 3300005548 | Bacteria | 1786 |
| 123 | Ga0070665_100375196 | 3300005548 | Bacteria | 1429 |
| 124 | Ga0068855_100009152 | 3300005563 | Bacteria | 11961 |
| 125 | Ga0068855_100012743 | 3300005563 | Bacteria | 10140 |
| 126 | Ga0068855_100029305 | 3300005563 | Bacteria | 6582 |
| 127 | Ga0068855_100107428 | 3300005563 | Bacteria | 3206 |
| 128 | Ga0068855_100108093 | 3300005563 | Bacteria | 3195 |
| 129 | Ga0068855_100233987 | 3300005563 | Bacteria | 2055 |
| 130 | Ga0068855_100350593 | 3300005563 | Bacteria | 1626 |
| 131 | Ga0068855_100477272 | 3300005563 | Bacteria | 1358 |
| 132 | Ga0068855_100870260 | 3300005563 | Bacteria | 953 |
| 133 | Ga0070664_100173417 | 3300005564 | Bacteria | 1914 |
| 134 | Ga0068857_100010916 | 3300005577 | Bacteria | 7907 |
| 135 | Ga0068857_100111646 | 3300005577 | Bacteria | 2458 |
| 136 | Ga0068857_100449801 | 3300005577 | Bacteria | 1204 |
| 137 | Ga0068854_100046207 | 3300005578 | Bacteria | 3099 |
| 138 | Ga0068854_100135231 | 3300005578 | Bacteria | 1886 |
| 139 | Ga0068854_100142231 | 3300005578 | Bacteria | 1842 |
| 140 | Ga0068854_100404860 | 3300005578 | Bacteria | 1130 |
| 141 | Ga0068854_100470440 | 3300005578 | Bacteria | 1053 |
| 142 | Ga0068856_100000505 | 3300005614 | Bacteria | 43297 |
| 143 | Ga0068856_100003706 | 3300005614 | Bacteria | 15331 |
| 144 | Ga0068856_100005176 | 3300005614 | Bacteria | 12875 |
| 145 | Ga0068856_100013224 | 3300005614 | Bacteria | 7992 |
| 146 | Ga0068856_100122875 | 3300005614 | Bacteria | 2599 |
| 147 | Ga0068856_100343639 | 3300005614 | Bacteria | 1511 |
| 148 | Ga0070702_100182398 | 3300005615 | Bacteria | 1375 |
| 149 | Ga0070702_100348618 | 3300005615 | Bacteria | 1042 |
| 150 | Ga0068852_100006419 | 3300005616 | Bacteria | 8497 |
| 151 | Ga0068852_100011300 | 3300005616 | Bacteria | 6716 |
| 152 | Ga0068852_100057367 | 3300005616 | Bacteria | 3369 |
| 153 | Ga0068852_100081648 | 3300005616 | Bacteria | 2870 |
| 154 | Ga0068852_100129445 | 3300005616 | Bacteria | 2322 |
| 155 | Ga0068852_100292315 | 3300005616 | Bacteria | 1574 |
| 156 | Ga0068852_100394018 | 3300005616 | Bacteria | 1361 |
| 157 | Ga0068859_100169985 | 3300005617 | Bacteria | 2261 |
| 158 | Ga0068864_100023598 | 3300005618 | Bacteria | 5168 |
| 159 | Ga0068864_100223959 | 3300005618 | Bacteria | 1736 |
| 160 | Ga0068866_10017775 | 3300005718 | Bacteria | 3203 |
| 161 | Ga0068861_100135350 | 3300005719 | Bacteria | 2004 |
| 162 | Ga0068861_100161939 | 3300005719 | Bacteria | 1846 |
| 163 | Ga0068861_100210584 | 3300005719 | Bacteria | 1637 |
| 164 | Ga0068861_100324686 | 3300005719 | Bacteria | 1341 |
| 165 | Ga0068851_10001156 | 3300005834 | Bacteria | 11450 |
| 166 | Ga0068851_10011174 | 3300005834 | Bacteria | 4205 |
| 167 | Ga0068851_10193561 | 3300005834 | Bacteria | 1131 |
| 168 | Ga0068870_10141997 | 3300005840 | Bacteria | 1406 |
| 169 | Ga0068863_100238926 | 3300005841 | Bacteria | 1753 |
| 170 | Ga0068863_100273194 | 3300005841 | Bacteria | 1636 |
| 171 | Ga0068858_100307433 | 3300005842 | Bacteria | 1513 |
| 172 | Ga0068860_100001118 | 3300005843 | Bacteria | 29537 |
| 173 | Ga0068860_100149647 | 3300005843 | Bacteria | 2247 |
| 174 | Ga0068860_100515333 | 3300005843 | Bacteria | 1195 |
| 175 | Ga0068862_100193470 | 3300005844 | Bacteria | 1831 |
| 176 | Ga0068862_100463610 | 3300005844 | Bacteria | 1196 |
| 177 | Ga0068862_100798318 | 3300005844 | Bacteria | 921 |
| 178 | Ga0081455_10026711 | 3300005937 | Bacteria | 5301 |
| 179 | Ga0081455_10054044 | 3300005937 | Bacteria | 3426 |
| 180 | Ga0081455_10067184 | 3300005937 | Bacteria | 2989 |
| 181 | Ga0081455_10085022 | 3300005937 | Bacteria | 2581 |
| 182 | Ga0081455_10330485 | 3300005937 | Bacteria | 1082 |
| 183 | Ga0081540_1003833 | 3300005983 | Bacteria | 11767 |
| 184 | Ga0081540_1003852 | 3300005983 | Bacteria | 11717 |
| 185 | Ga0081540_1014162 | 3300005983 | Bacteria | 5131 |
| 186 | Ga0081540_1053246 | 3300005983 | Bacteria | 1986 |
| 187 | Ga0081540_1097116 | 3300005983 | Bacteria | 1280 |
| 188 | Ga0081540_1121082 | 3300005983 | Bacteria | 1086 |
| 189 | Ga0081540_1128391 | 3300005983 | Bacteria | 1040 |
| 190 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 191 | Ga0081539_10000199 | 3300005985 | Bacteria | 139305 |
| 192 | Ga0081539_10011226 | 3300005985 | Bacteria | 7124 |
| 193 | Ga0081539_10091375 | 3300005985 | Bacteria | 1573 |
| 194 | Ga0070717_10000877 | 3300006028 | Bacteria | 19877 |
| 195 | Ga0070717_10050603 | 3300006028 | Bacteria | 3416 |
| 196 | Ga0070717_10052422 | 3300006028 | Bacteria | 3360 |
| 197 | Ga0070717_10259682 | 3300006028 | Bacteria | 1537 |
| 198 | Ga0070717_10276491 | 3300006028 | Bacteria | 1488 |
| 199 | Ga0075365_10034155 | 3300006038 | Bacteria | 3283 |
| 200 | Ga0075365_10074211 | 3300006038 | Bacteria | 2294 |
| 201 | Ga0075365_10135542 | 3300006038 | Bacteria | 1706 |
| 202 | Ga0075365_10254275 | 3300006038 | Bacteria | 1235 |
| 203 | Ga0075365_10293690 | 3300006038 | Bacteria | 1143 |
| 204 | Ga0075363_100000869 | 3300006048 | Bacteria | 10595 |
| 205 | Ga0075363_100059406 | 3300006048 | Bacteria | 2056 |
| 206 | Ga0075363_100205554 | 3300006048 | Bacteria | 1126 |
| 207 | Ga0075364_10041151 | 3300006051 | Bacteria | 2999 |
| 208 | Ga0075364_10289562 | 3300006051 | Bacteria | 1114 |
| 209 | Ga0075364_10334752 | 3300006051 | Bacteria | 1031 |
| 210 | Ga0070715_10000097 | 3300006163 | Bacteria | 21581 |
| 211 | Ga0070715_10012186 | 3300006163 | Bacteria | 3121 |
| 212 | Ga0070716_100036969 | 3300006173 | Bacteria | 2695 |
| 213 | Ga0070716_100088225 | 3300006173 | Bacteria | 1870 |
| 214 | Ga0070716_100130543 | 3300006173 | Bacteria | 1587 |
| 215 | Ga0070716_100219623 | 3300006173 | Bacteria | 1276 |
| 216 | Ga0070716_100533039 | 3300006173 | Bacteria | 872 |
| 217 | Ga0070712_100008651 | 3300006175 | Bacteria | 6410 |
| 218 | Ga0070712_100031048 | 3300006175 | Bacteria | 3596 |
| 219 | Ga0070712_100043775 | 3300006175 | Bacteria | 3084 |
| 220 | Ga0070712_100072270 | 3300006175 | Bacteria | 2470 |
| 221 | Ga0070712_100432392 | 3300006175 | Bacteria | 1093 |
| 222 | Ga0075362_10049030 | 3300006177 | Bacteria | 1885 |
| 223 | Ga0075367_10090351 | 3300006178 | Bacteria | 1862 |
| 224 | Ga0075367_10238426 | 3300006178 | Bacteria | 1139 |
| 225 | Ga0075369_10037853 | 3300006186 | Bacteria | 2056 |
| 226 | Ga0075366_10158205 | 3300006195 | Bacteria | 1372 |
| 227 | Ga0097621_100158115 | 3300006237 | Bacteria | 1946 |
| 228 | Ga0097621_100207232 | 3300006237 | Bacteria | 1704 |
| 229 | Ga0075370_10015658 | 3300006353 | Bacteria | 4065 |
| 230 | Ga0068871_100177603 | 3300006358 | Bacteria | 1828 |
| 231 | Ga0068871_100381292 | 3300006358 | Bacteria | 1252 |
| 232 | Ga0075428_100109348 | 3300006844 | Bacteria | 3012 |
| 233 | Ga0075428_100222393 | 3300006844 | Bacteria | 2038 |
| 234 | Ga0075434_100051816 | 3300006871 | Bacteria | 4078 |
| 235 | Ga0097620_100169978 | 3300006931 | Bacteria | 2261 |
| 236 | Ga0075435_100123099 | 3300007076 | Bacteria | 2165 |
| 237 | Ga0099794_10007546 | 3300007265 | Bacteria | 4474 |
| 238 | Ga0099794_10056404 | 3300007265 | Bacteria | 1901 |
| 239 | Ga0099795_10022059 | 3300007788 | Bacteria | 2097 |
| 240 | Ga0099795_10062412 | 3300007788 | Bacteria | 1386 |
| 241 | Ga0105250_10028114 | 3300009092 | Bacteria | 2265 |
| 242 | Ga0105240_10004584 | 3300009093 | Bacteria | 20953 |
| 243 | Ga0105240_10008073 | 3300009093 | Bacteria | 15126 |
| 244 | Ga0105240_10014611 | 3300009093 | Bacteria | 10714 |
| 245 | Ga0105240_10027790 | 3300009093 | Bacteria | 7402 |
| 246 | Ga0105240_10190656 | 3300009093 | Bacteria | 2411 |
| 247 | Ga0105240_10371331 | 3300009093 | Bacteria | 1617 |
| 248 | Ga0105245_10074181 | 3300009098 | Bacteria | 3095 |
| 249 | Ga0105245_10256732 | 3300009098 | Bacteria | 1700 |
| 250 | Ga0105245_10392154 | 3300009098 | Bacteria | 1386 |
| 251 | Ga0105245_11014968 | 3300009098 | Bacteria | 874 |
| 252 | Ga0105247_10047230 | 3300009101 | Bacteria | 2643 |
| 253 | Ga0105247_10221319 | 3300009101 | Bacteria | 1281 |
| 254 | Ga0105247_10307748 | 3300009101 | Bacteria | 1101 |
| 255 | Ga0114129_10029983 | 3300009147 | Bacteria | 7703 |
| 256 | Ga0105243_10013895 | 3300009148 | Bacteria | 6094 |
| 257 | Ga0105241_10006953 | 3300009174 | Bacteria | 8326 |
| 258 | Ga0105241_10202834 | 3300009174 | Bacteria | 1658 |
| 259 | Ga0105242_10046792 | 3300009176 | Bacteria | 3511 |
| 260 | Ga0105248_10104039 | 3300009177 | Bacteria | 3200 |
| 261 | Ga0105248_10232662 | 3300009177 | Bacteria | 2074 |
| 262 | Ga0105237_10059625 | 3300009545 | Bacteria | 3817 |
| 263 | Ga0105237_10068507 | 3300009545 | Bacteria | 3542 |
| 264 | Ga0105237_10084203 | 3300009545 | Bacteria | 3171 |
| 265 | Ga0105237_10111604 | 3300009545 | Bacteria | 2726 |
| 266 | Ga0105237_10359508 | 3300009545 | Bacteria | 1460 |
| 267 | Ga0105237_10370604 | 3300009545 | Bacteria | 1437 |
| 268 | Ga0105237_10540123 | 3300009545 | Bacteria | 1172 |
| 269 | Ga0105238_10000514 | 3300009551 | Bacteria | 40634 |
| 270 | Ga0105238_10003122 | 3300009551 | Bacteria | 16527 |
| 271 | Ga0105238_10005508 | 3300009551 | Bacteria | 12502 |
| 272 | Ga0105238_10052584 | 3300009551 | Bacteria | 4095 |
| 273 | Ga0105238_10094377 | 3300009551 | Bacteria | 2979 |
| 274 | Ga0105238_10387041 | 3300009551 | Bacteria | 1390 |
| 275 | Ga0105238_10494024 | 3300009551 | Bacteria | 1224 |
| 276 | Ga0105249_10133967 | 3300009553 | Bacteria | 2369 |
| 277 | Ga0105249_10198083 | 3300009553 | Bacteria | 1964 |
| 278 | Ga0099796_10012565 | 3300010159 | Bacteria | 2395 |
| 279 | Ga0105239_10005274 | 3300010375 | Bacteria | 15193 |
| 280 | Ga0105239_10006195 | 3300010375 | Bacteria | 13920 |
| 281 | Ga0105239_10098984 | 3300010375 | Bacteria | 3224 |
| 282 | Ga0105239_10154485 | 3300010375 | Bacteria | 2562 |
| 283 | Ga0105239_10203170 | 3300010375 | Bacteria | 2220 |
| 284 | Ga0105239_10489518 | 3300010375 | Bacteria | 1398 |
| 285 | Ga0105239_10688720 | 3300010375 | Bacteria | 1168 |
| 286 | Ga0105239_10709170 | 3300010375 | Bacteria | 1151 |
| 287 | Ga0157373_10078661 | 3300013100 | Bacteria | 2325 |
| 288 | Ga0157371_10010534 | 3300013102 | Bacteria | 7190 |
| 289 | Ga0157371_10304228 | 3300013102 | Unclassified | 1155 |
| 290 | Ga0157370_10043547 | 3300013104 | Bacteria | 4318 |
| 291 | Ga0157370_10085199 | 3300013104 | Bacteria | 2968 |
| 292 | Ga0157370_10423169 | 3300013104 | Bacteria | 1225 |
| 293 | Ga0157369_10013290 | 3300013105 | Bacteria | 9315 |
| 294 | Ga0157369_10042781 | 3300013105 | Bacteria | 4942 |
| 295 | Ga0157369_10045117 | 3300013105 | Bacteria | 4796 |
| 296 | Ga0157369_10249624 | 3300013105 | Bacteria | 1852 |
| 297 | Ga0157374_10071052 | 3300013296 | Bacteria | 3281 |
| 298 | Ga0157374_10094370 | 3300013296 | Bacteria | 2859 |
| 299 | Ga0157374_10505326 | 3300013296 | Bacteria | 1214 |
| 300 | Ga0157378_10230816 | 3300013297 | Bacteria | 1763 |
| 301 | Ga0157378_10324120 | 3300013297 | Bacteria | 1497 |
| 302 | Ga0157378_10641265 | 3300013297 | Bacteria | 1077 |
| 303 | Ga0163162_10013124 | 3300013306 | Bacteria | 8088 |
| 304 | Ga0163162_10062945 | 3300013306 | Bacteria | 3751 |
| 305 | Ga0163162_10308505 | 3300013306 | Bacteria | 1715 |
| 306 | Ga0157372_10045190 | 3300013307 | Bacteria | 4884 |
| 307 | Ga0157375_10004177 | 3300013308 | Bacteria | 12533 |
| 308 | Ga0163163_10094162 | 3300014325 | Bacteria | 3013 |
| 309 | Ga0163163_10115161 | 3300014325 | Bacteria | 2720 |
| 310 | Ga0163163_10142805 | 3300014325 | Bacteria | 2436 |
| 311 | Ga0163163_10277211 | 3300014325 | Bacteria | 1728 |
| 312 | Ga0163163_10600751 | 3300014325 | Bacteria | 1163 |
| 313 | Ga0157380_10506138 | 3300014326 | Bacteria | 1174 |
| 314 | Ga0157377_10082353 | 3300014745 | Bacteria | 1884 |
| 315 | Ga0157379_10120583 | 3300014968 | Bacteria | 2359 |
| 316 | Ga0157379_10156684 | 3300014968 | Bacteria | 2055 |
| 317 | Ga0157379_10162954 | 3300014968 | Bacteria | 2013 |
| 318 | Ga0157376_10119674 | 3300014969 | Bacteria | 2332 |
| 319 | Ga0157376_10187389 | 3300014969 | Bacteria | 1895 |
| 320 | Ga0157376_10535805 | 3300014969 | Bacteria | 1156 |
| 321 | Ga0163161_10066771 | 3300017792 | Bacteria | 2627 |
| 322 | Ga0197907_10288381 | 3300020069 | Bacteria | 1599 |
| 323 | Ga0197907_10522121 | 3300020069 | Bacteria | 2197 |
| 324 | Ga0206356_11303995 | 3300020070 | Bacteria | 1589 |
| 325 | Ga0206356_11334192 | 3300020070 | Bacteria | 1682 |
| 326 | Ga0206350_10556797 | 3300020080 | Bacteria | 1358 |
| 327 | Ga0206353_10940261 | 3300020082 | Bacteria | 2798 |
| 328 | Ga0213874_10031886 | 3300021377 | Bacteria | 1527 |
| 329 | Ga0213876_10010932 | 3300021384 | Bacteria | 4861 |
| 330 | Ga0213876_10085289 | 3300021384 | Bacteria | 1671 |
| 331 | Ga0213876_10190284 | 3300021384 | Bacteria | 1091 |
| 332 | Ga0213875_10155114 | 3300021388 | Bacteria | 1074 |
| 333 | Ga0213871_10005850 | 3300021441 | Bacteria | 2569 |
| 334 | Ga0224572_1001489 | 3300024225 | Bacteria | 3484 |
| 335 | Ga0224572_1007287 | 3300024225 | Bacteria | 2024 |
| 336 | Ga0228598_1008279 | 3300024227 | Bacteria | 2104 |
| 337 | Ga0209677_100241 | 3300025253 | Bacteria | 37674 |
| 338 | Ga0209148_1004574 | 3300025254 | Bacteria | 3369 |
| 339 | Ga0209233_1004313 | 3300025261 | Bacteria | 4860 |
| 340 | Ga0209233_1004699 | 3300025261 | Bacteria | 4605 |
| 341 | Ga0209455_1001933 | 3300025272 | Bacteria | 8558 |
| 342 | Ga0209564_1002116 | 3300025295 | Bacteria | 16873 |
| 343 | Ga0209758_1000720 | 3300025297 | Bacteria | 48767 |
| 344 | Ga0209758_1002070 | 3300025297 | Bacteria | 21421 |
| 345 | Ga0207656_10002763 | 3300025321 | Bacteria | 5957 |
| 346 | Ga0207656_10141760 | 3300025321 | Unclassified | 1133 |
| 347 | Ga0207653_10043061 | 3300025885 | Bacteria | 1486 |
| 348 | Ga0207682_10075127 | 3300025893 | Bacteria | 1438 |
| 349 | Ga0207692_10001993 | 3300025898 | Bacteria | 7798 |
| 350 | Ga0207692_10002157 | 3300025898 | Bacteria | 7518 |
| 351 | Ga0207642_10020500 | 3300025899 | Bacteria | 2582 |
| 352 | Ga0207710_10117487 | 3300025900 | Bacteria | 1267 |
| 353 | Ga0207647_10054116 | 3300025904 | Bacteria | 2470 |
| 354 | Ga0207685_10000990 | 3300025905 | Bacteria | 5494 |
| 355 | Ga0207685_10046986 | 3300025905 | Bacteria | 1646 |
| 356 | Ga0207699_10000253 | 3300025906 | Bacteria | 29543 |
| 357 | Ga0207699_10004697 | 3300025906 | Bacteria | 6525 |
| 358 | Ga0207699_10015823 | 3300025906 | Bacteria | 3930 |
| 359 | Ga0207699_10040953 | 3300025906 | Bacteria | 2672 |
| 360 | Ga0207699_10111963 | 3300025906 | Bacteria | 1751 |
| 361 | Ga0207699_10189381 | 3300025906 | Bacteria | 1387 |
| 362 | Ga0207699_10205930 | 3300025906 | Bacteria | 1335 |
| 363 | Ga0207705_10012927 | 3300025909 | Bacteria | 6023 |
| 364 | Ga0207705_10032892 | 3300025909 | Bacteria | 3705 |
| 365 | Ga0207705_10064461 | 3300025909 | Bacteria | 2648 |
| 366 | Ga0207705_10154377 | 3300025909 | Bacteria | 1722 |
| 367 | Ga0207654_10000526 | 3300025911 | Bacteria | 21868 |
| 368 | Ga0207654_10014836 | 3300025911 | Bacteria | 4033 |
| 369 | Ga0207707_10001093 | 3300025912 | Bacteria | 25844 |
| 370 | Ga0207707_10006358 | 3300025912 | Bacteria | 10317 |
| 371 | Ga0207707_10049372 | 3300025912 | Bacteria | 3666 |
| 372 | Ga0207707_10054162 | 3300025912 | Bacteria | 3492 |
| 373 | Ga0207707_10091475 | 3300025912 | Bacteria | 2659 |
| 374 | Ga0207707_10116020 | 3300025912 | Bacteria | 2340 |
| 375 | Ga0207707_10187798 | 3300025912 | Bacteria | 1803 |
| 376 | Ga0207707_10479515 | 3300025912 | Bacteria | 1062 |
| 377 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 378 | Ga0207695_10000286 | 3300025913 | Bacteria | 125310 |
| 379 | Ga0207695_10019088 | 3300025913 | Bacteria | 7907 |
| 380 | Ga0207695_10022532 | 3300025913 | Bacteria | 7146 |
| 381 | Ga0207695_10089735 | 3300025913 | Bacteria | 3090 |
| 382 | Ga0207695_10438549 | 3300025913 | Bacteria | 1190 |
| 383 | Ga0207671_10015168 | 3300025914 | Bacteria | 6052 |
| 384 | Ga0207671_10026189 | 3300025914 | Bacteria | 4372 |
| 385 | Ga0207671_10029468 | 3300025914 | Bacteria | 4098 |
| 386 | Ga0207671_10165071 | 3300025914 | Bacteria | 1717 |
| 387 | Ga0207671_10247068 | 3300025914 | Bacteria | 1402 |
| 388 | Ga0207671_10248510 | 3300025914 | Bacteria | 1398 |
| 389 | Ga0207671_10270796 | 3300025914 | Bacteria | 1338 |
| 390 | Ga0207693_10000541 | 3300025915 | Bacteria | 34205 |
| 391 | Ga0207693_10024218 | 3300025915 | Bacteria | 4820 |
| 392 | Ga0207693_10036490 | 3300025915 | Bacteria | 3875 |
| 393 | Ga0207693_10069864 | 3300025915 | Bacteria | 2748 |
| 394 | Ga0207693_10282442 | 3300025915 | Bacteria | 1301 |
| 395 | Ga0207663_10000261 | 3300025916 | Bacteria | 22957 |
| 396 | Ga0207663_10041918 | 3300025916 | Bacteria | 2793 |
| 397 | Ga0207663_10046871 | 3300025916 | Bacteria | 2665 |
| 398 | Ga0207660_10026628 | 3300025917 | Bacteria | 3938 |
| 399 | Ga0207660_10127810 | 3300025917 | Bacteria | 1931 |
| 400 | Ga0207660_10201882 | 3300025917 | Bacteria | 1553 |
| 401 | Ga0207660_10292197 | 3300025917 | Bacteria | 1296 |
| 402 | Ga0207660_10400034 | 3300025917 | Unclassified | 1106 |
| 403 | Ga0207657_10002321 | 3300025919 | Bacteria | 20614 |
| 404 | Ga0207657_10036408 | 3300025919 | Bacteria | 4405 |
| 405 | Ga0207657_10120589 | 3300025919 | Bacteria | 2158 |
| 406 | Ga0207649_10019853 | 3300025920 | Bacteria | 3846 |
| 407 | Ga0207649_10552560 | 3300025920 | Bacteria | 881 |
| 408 | Ga0207652_10002982 | 3300025921 | Bacteria | 14138 |
| 409 | Ga0207652_10014050 | 3300025921 | Bacteria | 6481 |
| 410 | Ga0207652_10020676 | 3300025921 | Bacteria | 5424 |
| 411 | Ga0207652_10041013 | 3300025921 | Bacteria | 3933 |
| 412 | Ga0207652_10091653 | 3300025921 | Bacteria | 2673 |
| 413 | Ga0207652_10161430 | 3300025921 | Bacteria | 2009 |
| 414 | Ga0207652_10218318 | 3300025921 | Bacteria | 1718 |
| 415 | Ga0207652_10248296 | 3300025921 | Bacteria | 1605 |
| 416 | Ga0207652_10273737 | 3300025921 | Bacteria | 1523 |
| 417 | Ga0207681_10337810 | 3300025923 | Bacteria | 1202 |
| 418 | Ga0207694_10000120 | 3300025924 | Bacteria | 83624 |
| 419 | Ga0207694_10005198 | 3300025924 | Bacteria | 10050 |
| 420 | Ga0207694_10024012 | 3300025924 | Bacteria | 4630 |
| 421 | Ga0207694_10036032 | 3300025924 | Bacteria | 3795 |
| 422 | Ga0207694_10083458 | 3300025924 | Bacteria | 2512 |
| 423 | Ga0207650_10299343 | 3300025925 | Bacteria | 1313 |
| 424 | Ga0207659_10288701 | 3300025926 | Bacteria | 1343 |
| 425 | Ga0207687_10109032 | 3300025927 | Bacteria | 2051 |
| 426 | Ga0207687_10319657 | 3300025927 | Bacteria | 1256 |
| 427 | Ga0207700_10003910 | 3300025928 | Bacteria | 8701 |
| 428 | Ga0207700_10013470 | 3300025928 | Bacteria | 5324 |
| 429 | Ga0207700_10021957 | 3300025928 | Bacteria | 4371 |
| 430 | Ga0207700_10040335 | 3300025928 | Bacteria | 3407 |
| 431 | Ga0207700_10063044 | 3300025928 | Bacteria | 2818 |
| 432 | Ga0207700_10084230 | 3300025928 | Bacteria | 2491 |
| 433 | Ga0207664_10004837 | 3300025929 | Bacteria | 9154 |
| 434 | Ga0207664_10069877 | 3300025929 | Bacteria | 2824 |
| 435 | Ga0207664_10187324 | 3300025929 | Bacteria | 1780 |
| 436 | Ga0207664_10440078 | 3300025929 | Bacteria | 1163 |
| 437 | Ga0207664_10442830 | 3300025929 | Bacteria | 1159 |
| 438 | Ga0207664_10721955 | 3300025929 | Bacteria | 896 |
| 439 | Ga0207644_10078270 | 3300025931 | Bacteria | 2437 |
| 440 | Ga0207690_10015539 | 3300025932 | Bacteria | 4614 |
| 441 | Ga0207690_10243760 | 3300025932 | Bacteria | 1385 |
| 442 | Ga0207706_10230369 | 3300025933 | Bacteria | 1621 |
| 443 | Ga0207706_10232786 | 3300025933 | Bacteria | 1611 |
| 444 | Ga0207706_10453133 | 3300025933 | Bacteria | 1109 |
| 445 | Ga0207709_10049331 | 3300025935 | Bacteria | 2569 |
| 446 | Ga0207704_10014465 | 3300025938 | Bacteria | 3984 |
| 447 | Ga0207704_10201888 | 3300025938 | Bacteria | 1456 |
| 448 | Ga0207665_10000280 | 3300025939 | Bacteria | 35528 |
| 449 | Ga0207665_10022222 | 3300025939 | Bacteria | 4171 |
| 450 | Ga0207665_10041508 | 3300025939 | Bacteria | 3073 |
| 451 | Ga0207665_10092061 | 3300025939 | Bacteria | 2103 |
| 452 | Ga0207691_10071603 | 3300025940 | Bacteria | 3128 |
| 453 | Ga0207691_10237979 | 3300025940 | Bacteria | 1575 |
| 454 | Ga0207711_10192920 | 3300025941 | Bacteria | 1857 |
| 455 | Ga0207689_10405390 | 3300025942 | Bacteria | 1137 |
| 456 | Ga0207661_10002972 | 3300025944 | Bacteria | 11725 |
| 457 | Ga0207661_10018500 | 3300025944 | Bacteria | 5176 |
| 458 | Ga0207667_10001834 | 3300025949 | Bacteria | 26705 |
| 459 | Ga0207667_10007460 | 3300025949 | Bacteria | 13140 |
| 460 | Ga0207667_10032845 | 3300025949 | Bacteria | 5586 |
| 461 | Ga0207667_10098220 | 3300025949 | Bacteria | 3022 |
| 462 | Ga0207667_10152583 | 3300025949 | Bacteria | 2377 |
| 463 | Ga0207667_10187258 | 3300025949 | Bacteria | 2124 |
| 464 | Ga0207667_10437857 | 3300025949 | Bacteria | 1329 |
| 465 | Ga0207667_10562118 | 3300025949 | Bacteria | 1153 |
| 466 | Ga0207651_10246120 | 3300025960 | Bacteria | 1460 |
| 467 | Ga0207651_10287634 | 3300025960 | Bacteria | 1361 |
| 468 | Ga0207712_10219666 | 3300025961 | Bacteria | 1519 |
| 469 | Ga0207712_10608762 | 3300025961 | Bacteria | 946 |
| 470 | Ga0207712_10621311 | 3300025961 | Bacteria | 937 |
| 471 | Ga0207668_10071073 | 3300025972 | Bacteria | 2484 |
| 472 | Ga0207668_10139272 | 3300025972 | Bacteria | 1863 |
| 473 | Ga0207640_10071327 | 3300025981 | Bacteria | 2339 |
| 474 | Ga0207640_10145075 | 3300025981 | Bacteria | 1736 |
| 475 | Ga0207640_10519393 | 3300025981 | Bacteria | 995 |
| 476 | Ga0207658_10430999 | 3300025986 | Bacteria | 1164 |
| 477 | Ga0207703_10080853 | 3300026035 | Bacteria | 2707 |
| 478 | Ga0207703_10272724 | 3300026035 | Bacteria | 1533 |
| 479 | Ga0207703_10669911 | 3300026035 | Bacteria | 985 |
| 480 | Ga0207639_10003014 | 3300026041 | Bacteria | 11337 |
| 481 | Ga0207639_10031045 | 3300026041 | Bacteria | 3924 |
| 482 | Ga0207639_10081468 | 3300026041 | Bacteria | 2564 |
| 483 | Ga0207639_10379064 | 3300026041 | Bacteria | 1270 |
| 484 | Ga0207678_10006176 | 3300026067 | Bacteria | 10655 |
| 485 | Ga0207678_10014837 | 3300026067 | Bacteria | 6854 |
| 486 | Ga0207678_10044946 | 3300026067 | Bacteria | 3819 |
| 487 | Ga0207678_10054813 | 3300026067 | Bacteria | 3434 |
| 488 | Ga0207678_10067235 | 3300026067 | Bacteria | 3076 |
| 489 | Ga0207678_10076408 | 3300026067 | Bacteria | 2869 |
| 490 | Ga0207678_10284513 | 3300026067 | Bacteria | 1420 |
| 491 | Ga0207678_10491946 | 3300026067 | Bacteria | 1069 |
| 492 | Ga0207708_10153445 | 3300026075 | Bacteria | 1815 |
| 493 | Ga0207702_10000019 | 3300026078 | Bacteria | 211843 |
| 494 | Ga0207702_10000127 | 3300026078 | Bacteria | 89755 |
| 495 | Ga0207702_10017659 | 3300026078 | Bacteria | 5903 |
| 496 | Ga0207702_10063987 | 3300026078 | Bacteria | 3147 |
| 497 | Ga0207702_10112912 | 3300026078 | Bacteria | 2419 |
| 498 | Ga0207641_10193664 | 3300026088 | Bacteria | 1870 |
| 499 | Ga0207641_10320313 | 3300026088 | Bacteria | 1470 |
| 500 | Ga0207648_10035881 | 3300026089 | Bacteria | 4369 |
| 501 | Ga0207648_10390145 | 3300026089 | Bacteria | 1260 |
| 502 | Ga0207676_10150451 | 3300026095 | Bacteria | 2004 |
| 503 | Ga0207676_10242911 | 3300026095 | Bacteria | 1616 |
| 504 | Ga0207676_10315786 | 3300026095 | Bacteria | 1432 |
| 505 | Ga0207676_10342551 | 3300026095 | Bacteria | 1380 |
| 506 | Ga0207674_10004566 | 3300026116 | Bacteria | 16628 |
| 507 | Ga0207674_10008031 | 3300026116 | Bacteria | 12231 |
| 508 | Ga0207674_10020772 | 3300026116 | Bacteria | 7087 |
| 509 | Ga0207674_10271668 | 3300026116 | Bacteria | 1643 |
| 510 | Ga0207674_10476658 | 3300026116 | Bacteria | 1206 |
| 511 | Ga0207675_100453582 | 3300026118 | Bacteria | 1271 |
| 512 | Ga0207675_100505572 | 3300026118 | Bacteria | 1203 |
| 513 | Ga0207683_10013367 | 3300026121 | Bacteria | 7001 |
| 514 | Ga0207683_10028505 | 3300026121 | Bacteria | 4828 |
| 515 | Ga0207683_10096117 | 3300026121 | Bacteria | 2642 |
| 516 | Ga0207683_10097310 | 3300026121 | Bacteria | 2624 |
| 517 | Ga0207683_10177126 | 3300026121 | Bacteria | 1933 |
| 518 | Ga0207698_10105593 | 3300026142 | Bacteria | 2347 |
| 519 | Ga0207698_10181890 | 3300026142 | Bacteria | 1863 |
| 520 | Ga0207698_10233558 | 3300026142 | Bacteria | 1671 |
| 521 | Ga0207698_10310003 | 3300026142 | Bacteria | 1473 |
| 522 | Ga0207698_10648973 | 3300026142 | Bacteria | 1045 |
| 523 | Ga0209588_1024398 | 3300027671 | Bacteria | 1909 |
| 524 | Ga0265357_1001110 | 3300028023 | Bacteria | 1874 |
| 525 | Ga0268266_10133677 | 3300028379 | Bacteria | 2220 |
| 526 | Ga0268266_10175416 | 3300028379 | Bacteria | 1948 |
| 527 | Ga0268266_10370150 | 3300028379 | Bacteria | 1349 |
| 528 | Ga0268266_10496218 | 3300028379 | Bacteria | 1165 |
| 529 | Ga0268265_10023019 | 3300028380 | Bacteria | 4386 |
| 530 | Ga0268265_10585604 | 3300028380 | Bacteria | 1064 |
| 531 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 532 | Ga0268264_10400277 | 3300028381 | Bacteria | 1319 |
| 533 | Ga0268264_10460019 | 3300028381 | Bacteria | 1234 |
| 534 | Ga0265323_10011073 | 3300028653 | Bacteria | 3646 |
| 535 | Ga0265336_10000125 | 3300028666 | Bacteria | 57377 |
| 536 | Ga0307517_10000744 | 3300028786 | Bacteria | 56253 |
| 537 | Ga0307517_10116215 | 3300028786 | Bacteria | 2004 |
| 538 | Ga0307515_10084138 | 3300028794 | Bacteria | 4090 |
| 539 | Ga0307515_10304581 | 3300028794 | Bacteria | 1275 |
| 540 | Ga0265338_10000085 | 3300028800 | Bacteria | 175080 |
| 541 | Ga0265338_10044048 | 3300028800 | Bacteria | 4126 |
| 542 | Ga0265338_10047212 | 3300028800 | Bacteria | 3935 |
| 543 | Ga0265338_10348293 | 3300028800 | Bacteria | 1066 |
| 544 | Ga0265330_10009899 | 3300031235 | Bacteria | 4512 |
| 545 | Ga0265332_10006066 | 3300031238 | Bacteria | 5520 |
| 546 | Ga0265328_10012115 | 3300031239 | Bacteria | 3435 |
| 547 | Ga0265325_10048757 | 3300031241 | Bacteria | 2188 |
| 548 | Ga0265325_10082413 | 3300031241 | Unclassified | 1596 |
| 549 | Ga0265340_10061536 | 3300031247 | Bacteria | 1795 |
| 550 | Ga0265340_10102494 | 3300031247 | Bacteria | 1329 |
| 551 | Ga0265339_10000047 | 3300031249 | Bacteria | 110601 |
| 552 | Ga0265339_10038296 | 3300031249 | Bacteria | 2676 |
| 553 | Ga0265339_10047059 | 3300031249 | Bacteria | 2369 |
| 554 | Ga0265316_10089764 | 3300031344 | Bacteria | 2345 |
| 555 | Ga0265316_10381064 | 3300031344 | Bacteria | 1017 |
| 556 | Ga0307513_10345524 | 3300031456 | Bacteria | 1237 |
| 557 | Ga0307513_10389891 | 3300031456 | Bacteria | 1130 |
| 558 | Ga0307509_10249997 | 3300031507 | Bacteria | 1557 |
| 559 | Ga0307509_10347576 | 3300031507 | Bacteria | 1208 |
| 560 | Ga0265313_10000069 | 3300031595 | Bacteria | 100065 |
| 561 | Ga0265313_10024594 | 3300031595 | Bacteria | 3213 |
| 562 | Ga0307508_10000051 | 3300031616 | Bacteria | 134500 |
| 563 | Ga0307508_10346029 | 3300031616 | Bacteria | 1078 |
| 564 | Ga0265314_10015576 | 3300031711 | Bacteria | 6028 |
| 565 | Ga0265314_10084897 | 3300031711 | Bacteria | 2077 |
| 566 | Ga0265314_10102869 | 3300031711 | Bacteria | 1832 |
| 567 | Ga0265342_10000502 | 3300031712 | Bacteria | 41908 |
| 568 | Ga0265342_10007293 | 3300031712 | Bacteria | 8115 |
| 569 | Ga0265342_10018370 | 3300031712 | Bacteria | 4532 |
| 570 | Ga0265342_10065729 | 3300031712 | Bacteria | 2125 |
| 571 | Ga0265342_10087021 | 3300031712 | Bacteria | 1796 |
| 572 | Ga0307516_10015568 | 3300031730 | Bacteria | 7997 |
| 573 | Ga0307516_10112595 | 3300031730 | Bacteria | 2521 |
| 574 | Ga0307516_10186574 | 3300031730 | Bacteria | 1803 |
| 575 | Ga0307516_10317292 | 3300031730 | Bacteria | 1230 |
| 576 | Ga0307405_10136547 | 3300031731 | Bacteria | 1703 |
| 577 | Ga0307405_10137974 | 3300031731 | Bacteria | 1696 |
| 578 | Ga0307405_10251334 | 3300031731 | Bacteria | 1316 |
| 579 | Ga0307406_10296540 | 3300031901 | Bacteria | 1240 |
| 580 | Ga0307406_10535555 | 3300031901 | Bacteria | 955 |
| 581 | Ga0307407_10407133 | 3300031903 | Bacteria | 977 |
| 582 | Ga0307412_10309880 | 3300031911 | Bacteria | 1251 |
| 583 | Ga0307412_10332256 | 3300031911 | Bacteria | 1213 |
| 584 | Ga0307409_100151544 | 3300031995 | Bacteria | 2013 |
| 585 | Ga0307416_100054843 | 3300032002 | Bacteria | 3206 |
| 586 | Ga0307411_10119714 | 3300032005 | Bacteria | 1902 |
| 587 | Ga0307415_100169177 | 3300032126 | Bacteria | 1702 |
| 588 | Ga0307415_100458004 | 3300032126 | Bacteria | 1104 |
| 589 | Ga0307507_10007677 | 3300033179 | Bacteria | 15449 |
| 590 | Ga0307510_10005901 | 3300033180 | Bacteria | 14608 |
| 591 | Ga0307510_10071695 | 3300033180 | Bacteria | 3448 |
| 592 | Ga0373926_0128120 | 3300035083 | Bacteria | 960 |
| 593 | Ga0373923_0001064 | 3300035111 | Bacteria | 7518 |
| 594 | Ga0373923_0004092 | 3300035111 | Bacteria | 4794 |
| 595 | Ga0373923_0044311 | 3300035111 | Bacteria | 1844 |
| 596 | Ga0373936_0003661 | 3300035113 | Bacteria | 5768 |
| 597 | Ga0373936_0008030 | 3300035113 | Bacteria | 3966 |
| 598 | Ga0373936_0071436 | 3300035113 | Bacteria | 1431 |
| 599 | Ga0373945_0014404 | 3300035116 | Bacteria | 2649 |
| 600 | Ga0373953_0019853 | 3300035117 | Bacteria | 2505 |
| 601 | Ga0373953_0038072 | 3300035117 | Bacteria | 1901 |
| 602 | Ga0373954_0000418 | 3300035118 | Bacteria | 15854 |
| 603 | Ga0373954_0009743 | 3300035118 | Bacteria | 4231 |
| 604 | Ga0373956_0000845 | 3300035119 | Bacteria | 12743 |
| 605 | Ga0373956_0075896 | 3300035119 | Bacteria | 1537 |
| 606 | Ga0373957_0000695 | 3300035120 | Bacteria | 8699 |
| 607 | Ga0373957_0003864 | 3300035120 | Bacteria | 4491 |
| 608 | Ga0373957_0114384 | 3300035120 | Bacteria | 1089 |
| 609 | Ga0373943_0133020 | 3300035170 | Bacteria | 1333 |
| 610 | Ga0373943_0144993 | 3300035170 | Bacteria | 1282 |
| 611 | Ga0373946_0018140 | 3300035171 | Bacteria | 2698 |
| 612 | Ga0373946_0111972 | 3300035171 | Bacteria | 1236 |
| 613 | Ga0373955_0014293 | 3300035172 | Bacteria | 3858 |
| 614 | Ga0373955_0145390 | 3300035172 | Bacteria | 1392 |
| 615 | Ga0373924_0011574 | 3300035410 | Bacteria | 3279 |
| 616 | Ga0373924_0019764 | 3300035410 | Bacteria | 2612 |
| 617 | Ga0373924_0021465 | 3300035410 | Bacteria | 2519 |
| 618 | Ga0373931_0182961 | 3300035691 | Bacteria | 1242 |
| 619 | Ga0373935_0004409 | 3300035692 | Bacteria | 8264 |
| 620 | Ga0373935_0030931 | 3300035692 | Bacteria | 3318 |
| 621 | Ga0373927_0011920 | 3300035695 | Bacteria | 5786 |
| 622 | Ga0373927_0013700 | 3300035695 | Bacteria | 5384 |
| 623 | Ga0373927_0013723 | 3300035695 | Bacteria | 5379 |
| 624 | Ga0373927_0047822 | 3300035695 | Bacteria | 2767 |
| 625 | Ga0373927_0181775 | 3300035695 | Bacteria | 1379 |
| 626 | Ga0373933_0004721 | 3300035724 | Bacteria | 7452 |
| 627 | Ga0373933_0006387 | 3300035724 | Bacteria | 6416 |
| 628 | Ga0373933_0007858 | 3300035724 | Bacteria | 5825 |
| 629 | Ga0373933_0211092 | 3300035724 | Bacteria | 1244 |
| 630 | Ga0373933_0267515 | 3300035724 | Bacteria | 1103 |
| 631 | Ga0373947_0004935 | 3300035725 | Bacteria | 7803 |
| 632 | Ga0373947_0029427 | 3300035725 | Bacteria | 3223 |
| 633 | Ga0373937_0037050 | 3300036401 | Bacteria | 4444 |
| 634 | Ga0373937_0040658 | 3300036401 | Bacteria | 4239 |
| 635 | Ga0373937_0041120 | 3300036401 | Bacteria | 4217 |
| 636 | Ga0373937_0135194 | 3300036401 | Bacteria | 2305 |
| 637 | Ga0373937_0262002 | 3300036401 | Bacteria | 1630 |
| 638 | Ga0372808_006082 | 3300036459 | Bacteria | 1616 |
| 639 | Ga0373925_0004584 | 3300037068 | Bacteria | 10440 |
| 640 | Ga0373925_0013971 | 3300037068 | Bacteria | 5812 |
| 641 | Ga0373925_0068622 | 3300037068 | Bacteria | 2677 |
| 642 | Ga0395900_0533277 | 3300037418 | Bacteria | 1120 |
| 643 | Ga0395898_0100762 | 3300037466 | Bacteria | 2774 |
| 644 | Ga0395898_0232296 | 3300037466 | Bacteria | 1759 |
| 645 | Ga0395905_0190789 | 3300037471 | Bacteria | 1922 |
| 646 | Ga0436364_0767694 | 3300037853 | Bacteria | 5645 |
| 647 | Ga0436364_1169404 | 3300037853 | Bacteria | 992 |
| 648 | Ga0436364_1204997 | 3300037853 | Bacteria | 1445 |
| 649 | Ga0395901_0095869 | 3300038443 | Bacteria | 3109 |
| 650 | Ga0395901_0516617 | 3300038443 | Bacteria | 1214 |
| 651 | Ga0436365_0075269 | 3300039437 | Bacteria | 2385 |
| 652 | Ga0436365_0167764 | 3300039437 | Bacteria | 15121 |
| 653 | Ga0436365_0262407 | 3300039437 | Bacteria | 1495 |
| 654 | Ga0436365_0276616 | 3300039437 | Bacteria | 4975 |
| 655 | Ga0436365_0447222 | 3300039437 | Bacteria | 2191 |
| 656 | Ga0436365_0743040 | 3300039437 | Bacteria | 1928 |
| 657 | Ga0436365_1331117 | 3300039437 | Bacteria | 1468 |
| 658 | Ga0436365_1826002 | 3300039437 | Bacteria | 2445 |
| 659 | Ga0436360_0305024 | 3300039438 | Bacteria | 1029 |
| 660 | Ga0436361_1012338 | 3300039447 | Bacteria | 9605 |
| 661 | Ga0436363_1050788 | 3300039450 | Bacteria | 1270 |
| 662 | Ga0436363_1366818 | 3300039450 | Bacteria | 2134 |
| 663 | Ga0436362_0817319 | 3300039453 | Bacteria | 4121 |
| 664 | Ga0436362_0938097 | 3300039453 | Bacteria | 1960 |
| 665 | Ga0451795_0811766 | 3300041456 | Bacteria | 942 |
| 666 | Ga0451798_0501681 | 3300041458 | Bacteria | 2239 |
| 667 | Ga0451800_1202443 | 3300041459 | Bacteria | 771 |
| 668 | Ga0451853_1410466 | 3300041512 | Bacteria | 955 |
| 669 | Ga0466969_0059847 | 3300044656 | Bacteria | 1852 |
| 670 | Ga0466966_0105951 | 3300044684 | Bacteria | 1735 |
| 671 | Ga0466963_0134988 | 3300044694 | Bacteria | 1707 |
| 672 | Ga0466964_0172850 | 3300044706 | Bacteria | 1019 |
| 673 | Ga0466971_0031970 | 3300044719 | Bacteria | 2358 |
| 674 | Ga0466957_0078893 | 3300044842 | Bacteria | 2048 |
| 675 | Ga0466958_0016143 | 3300045836 | Bacteria | 4296 |
| 676 | Ga0466958_0074489 | 3300045836 | Bacteria | 2081 |
| 677 | Ga0466967_0089395 | 3300045976 | Bacteria | 2797 |
| 678 | Ga0466967_0231875 | 3300045976 | Bacteria | 1758 |
| 679 | Ga0466967_0385944 | 3300045976 | Bacteria | 1360 |
| 680 | Ga0466967_0515596 | 3300045976 | Bacteria | 1174 |
| 681 | Ga0495617_020984 | 3300046452 | Bacteria | 2207 |
| 682 | Ga0495617_090626 | 3300046452 | Bacteria | 998 |
| 683 | Ga0495592_0032950 | 3300046454 | Bacteria | 3908 |
| 684 | Ga0495592_0079856 | 3300046454 | Bacteria | 2367 |
| 685 | Ga0495592_0107928 | 3300046454 | Bacteria | 1974 |
| 686 | Ga0495603_0000874 | 3300046455 | Bacteria | 17304 |
| 687 | Ga0495603_0015087 | 3300046455 | Bacteria | 4673 |
| 688 | Ga0495603_0015206 | 3300046455 | Bacteria | 4657 |
| 689 | Ga0495603_0016074 | 3300046455 | Bacteria | 4524 |
| 690 | Ga0495603_0075615 | 3300046455 | Bacteria | 1977 |
| 691 | Ga0495603_0079011 | 3300046455 | Bacteria | 1929 |
| 692 | Ga0495603_0244618 | 3300046455 | Bacteria | 1033 |
| 693 | Ga0495590_0024886 | 3300046457 | Bacteria | 2107 |
| 694 | Ga0495629_0000439 | 3300046459 | Bacteria | 34692 |
| 695 | Ga0495629_0000957 | 3300046459 | Bacteria | 23286 |
| 696 | Ga0495629_0041686 | 3300046459 | Bacteria | 3229 |
| 697 | Ga0495638_0007152 | 3300046460 | Bacteria | 8040 |
| 698 | Ga0495638_0069064 | 3300046460 | Bacteria | 2165 |
| 699 | Ga0495641_0003351 | 3300046461 | Bacteria | 12041 |
| 700 | Ga0495651_0003854 | 3300046462 | Bacteria | 11462 |
| 701 | Ga0495651_0063543 | 3300046462 | Bacteria | 2821 |
| 702 | Ga0495651_0121982 | 3300046462 | Bacteria | 1913 |
| 703 | Ga0495653_0003152 | 3300046463 | Bacteria | 13226 |
| 704 | Ga0495650_0074366 | 3300046471 | Bacteria | 1325 |
| 705 | Ga0495580_0006287 | 3300046472 | Bacteria | 9712 |
| 706 | Ga0495582_0002466 | 3300046473 | Bacteria | 10311 |
| 707 | Ga0495582_0009442 | 3300046473 | Bacteria | 5373 |
| 708 | Ga0495582_0099914 | 3300046473 | Bacteria | 1624 |
| 709 | Ga0495582_0468234 | 3300046473 | Bacteria | 728 |
| 710 | Ga0495605_0125840 | 3300046474 | Bacteria | 1159 |
| 711 | Ga0495639_0000913 | 3300046475 | Bacteria | 13331 |
| 712 | Ga0495639_0042792 | 3300046475 | Bacteria | 2044 |
| 713 | Ga0495664_0004313 | 3300046477 | Bacteria | 7769 |
| 714 | Ga0495664_0124565 | 3300046477 | Bacteria | 1559 |
| 715 | Ga0495664_0139742 | 3300046477 | Bacteria | 1468 |
| 716 | Ga0495664_0211886 | 3300046477 | Bacteria | 1173 |
| 717 | Ga0495664_0266269 | 3300046477 | Bacteria | 1036 |
| 718 | Ga0495594_0002715 | 3300046499 | Bacteria | 9180 |
| 719 | Ga0495594_0045208 | 3300046499 | Bacteria | 2417 |
| 720 | Ga0495594_0153818 | 3300046499 | Bacteria | 1306 |
| 721 | Ga0495594_0155953 | 3300046499 | Bacteria | 1297 |
| 722 | Ga0495594_0235883 | 3300046499 | Bacteria | 1043 |
| 723 | Ga0495583_0106677 | 3300046506 | Bacteria | 1190 |
| 724 | Ga0495606_0002132 | 3300046507 | Bacteria | 23896 |
| 725 | Ga0495606_0105866 | 3300046507 | Bacteria | 1704 |
| 726 | Ga0495606_0156169 | 3300046507 | Bacteria | 1334 |
| 727 | Ga0495606_0165118 | 3300046507 | Bacteria | 1289 |
| 728 | Ga0495608_0005973 | 3300046511 | Bacteria | 8658 |
| 729 | Ga0495608_0028994 | 3300046511 | Bacteria | 3759 |
| 730 | Ga0495610_0038842 | 3300046512 | Bacteria | 2412 |
| 731 | Ga0495616_0084746 | 3300046513 | Bacteria | 1510 |
| 732 | Ga0495618_0186705 | 3300046514 | Bacteria | 1316 |
| 733 | Ga0495620_0026171 | 3300046515 | Bacteria | 2746 |
| 734 | Ga0495628_0010152 | 3300046516 | Bacteria | 8008 |
| 735 | Ga0495628_0011453 | 3300046516 | Bacteria | 7499 |
| 736 | Ga0495628_0101177 | 3300046516 | Bacteria | 2224 |
| 737 | Ga0495628_0144821 | 3300046516 | Bacteria | 1812 |
| 738 | Ga0495630_0001220 | 3300046517 | Bacteria | 17769 |
| 739 | Ga0495630_0107226 | 3300046517 | Bacteria | 2116 |
| 740 | Ga0495631_0073046 | 3300046518 | Bacteria | 1481 |
| 741 | Ga0495632_0044890 | 3300046519 | Bacteria | 2204 |
| 742 | Ga0495632_0194523 | 3300046519 | Bacteria | 925 |
| 743 | Ga0495643_0099231 | 3300046522 | Bacteria | 1494 |
| 744 | Ga0495644_0097567 | 3300046523 | Bacteria | 1111 |
| 745 | Ga0495648_0001613 | 3300046524 | Bacteria | 21927 |
| 746 | Ga0495648_0055151 | 3300046524 | Bacteria | 2397 |
| 747 | Ga0495648_0068090 | 3300046524 | Bacteria | 2079 |
| 748 | Ga0495666_0021634 | 3300046526 | Bacteria | 3184 |
| 749 | Ga0495652_0005540 | 3300046529 | Bacteria | 11876 |
| 750 | Ga0495652_0011261 | 3300046529 | Bacteria | 8094 |
| 751 | Ga0495652_0021754 | 3300046529 | Bacteria | 5702 |
| 752 | Ga0495652_0153456 | 3300046529 | Bacteria | 1796 |
| 753 | Ga0495652_0330243 | 3300046529 | Bacteria | 1099 |
| 754 | Ga0495654_0106802 | 3300046530 | Bacteria | 1281 |
| 755 | Ga0495665_0000555 | 3300046531 | Bacteria | 18998 |
| 756 | Ga0495665_0004355 | 3300046531 | Bacteria | 7642 |
| 757 | Ga0495640_0001232 | 3300046533 | Bacteria | 20045 |
| 758 | Ga0495640_0009939 | 3300046533 | Bacteria | 7377 |
| 759 | Ga0495640_0063282 | 3300046533 | Bacteria | 2506 |
| 760 | Ga0495640_0065761 | 3300046533 | Bacteria | 2447 |
| 761 | Ga0495586_0071955 | 3300046535 | Bacteria | 1890 |
| 762 | Ga0495587_0013838 | 3300046536 | Bacteria | 5068 |
| 763 | Ga0495621_0067365 | 3300046539 | Bacteria | 1312 |
| 764 | Ga0495597_0111987 | 3300046542 | Bacteria | 1143 |
| 765 | Ga0495645_0011972 | 3300046543 | Bacteria | 6112 |
| 766 | Ga0495645_0013731 | 3300046543 | Bacteria | 5738 |
| 767 | Ga0495645_0018292 | 3300046543 | Bacteria | 5031 |
| 768 | Ga0495645_0165805 | 3300046543 | Bacteria | 1524 |
| 769 | Ga0495645_0297639 | 3300046543 | Bacteria | 1055 |
| 770 | Ga0495622_0003298 | 3300046557 | Bacteria | 7634 |
| 771 | Ga0495622_0088271 | 3300046557 | Bacteria | 1425 |
| 772 | Ga0495622_0133714 | 3300046557 | Bacteria | 1128 |
| 773 | Ga0495633_0048486 | 3300046558 | Bacteria | 2005 |
| 774 | Ga0495633_0184110 | 3300046558 | Bacteria | 961 |
| 775 | Ga0495667_0016918 | 3300046559 | Bacteria | 4924 |
| 776 | Ga0495656_0088988 | 3300046615 | Bacteria | 1408 |
| 777 | Ga0495656_0103490 | 3300046615 | Bacteria | 1320 |
| 778 | Ga0495668_0062733 | 3300046616 | Bacteria | 2047 |
| 779 | Ga0495634_0014564 | 3300046642 | Bacteria | 5667 |
| 780 | Ga0495634_0018636 | 3300046642 | Bacteria | 4938 |
| 781 | Ga0495634_0060761 | 3300046642 | Bacteria | 2514 |
| 782 | Ga0495611_0039800 | 3300046648 | Bacteria | 2094 |
| 783 | Ga0495611_0126302 | 3300046648 | Bacteria | 1193 |
| 784 | Ga0495611_0141212 | 3300046648 | Bacteria | 1124 |
| 785 | Ga0495625_0088904 | 3300046660 | Bacteria | 2139 |
| 786 | Ga0495625_0170061 | 3300046660 | Bacteria | 1456 |
| 787 | Ga0495635_0001430 | 3300046663 | Bacteria | 15944 |
| 788 | Ga0495635_0003515 | 3300046663 | Bacteria | 10840 |
| 789 | Ga0495635_0004600 | 3300046663 | Bacteria | 9571 |
| 790 | Ga0495635_0010771 | 3300046663 | Bacteria | 6406 |
| 791 | Ga0495635_0363371 | 3300046663 | Bacteria | 965 |
| 792 | Ga0495661_0081293 | 3300046665 | Bacteria | 1867 |
| 793 | Ga0495661_0176250 | 3300046665 | Bacteria | 1136 |
| 794 | Ga0495588_0005525 | 3300046674 | Bacteria | 5629 |
| 795 | Ga0495588_0129047 | 3300046674 | Bacteria | 1333 |
| 796 | Ga0495657_0020793 | 3300046675 | Bacteria | 4717 |
| 797 | Ga0495657_0140199 | 3300046675 | Bacteria | 1507 |
| 798 | Ga0495657_0217371 | 3300046675 | Bacteria | 1160 |
| 799 | Ga0495657_0233457 | 3300046675 | Bacteria | 1112 |
| 800 | Ga0495599_0007454 | 3300046678 | Bacteria | 6636 |
| 801 | Ga0495599_0156105 | 3300046678 | Bacteria | 1412 |
| 802 | Ga0495599_0184188 | 3300046678 | Bacteria | 1286 |
| 803 | Ga0495623_0010183 | 3300046679 | Bacteria | 6083 |
| 804 | Ga0495623_0019346 | 3300046679 | Bacteria | 4402 |
| 805 | Ga0495623_0090795 | 3300046679 | Bacteria | 1875 |
| 806 | Ga0495646_0003601 | 3300046680 | Bacteria | 9670 |
| 807 | Ga0495646_0072368 | 3300046680 | Bacteria | 2027 |
| 808 | Ga0495658_0065037 | 3300046683 | Bacteria | 2103 |
| 809 | Ga0495669_0008503 | 3300046684 | Bacteria | 4318 |
| 810 | Ga0495669_0136329 | 3300046684 | Bacteria | 1157 |
| 811 | Ga0495624_0001252 | 3300046690 | Bacteria | 20060 |
| 812 | Ga0495670_0007811 | 3300046691 | Bacteria | 5259 |
| 813 | Ga0495670_0021246 | 3300046691 | Bacteria | 3201 |
| 814 | Ga0495589_0054960 | 3300046794 | Bacteria | 1962 |
| 815 | Ga0495589_0080116 | 3300046794 | Bacteria | 1589 |
| 816 | Ga0495600_0001772 | 3300046809 | Bacteria | 12077 |
| 817 | Ga0495600_0040077 | 3300046809 | Bacteria | 3050 |
| 818 | Ga0495660_0088788 | 3300046810 | Bacteria | 1610 |
| 819 | Ga0495581_0000019 | 3300047315 | Bacteria | 57810 |
| 820 | Ga0495604_0007453 | 3300047317 | Bacteria | 8662 |
| 821 | Ga0495604_0061883 | 3300047317 | Bacteria | 2861 |
| 822 | Ga0495604_0313140 | 3300047317 | Bacteria | 1051 |
| 823 | Ga0495636_0036181 | 3300047318 | Bacteria | 2035 |
| 824 | Ga0495674_0000458 | 3300047319 | Bacteria | 36828 |
| 825 | Ga0495674_0008586 | 3300047319 | Bacteria | 9723 |
| 826 | Ga0495674_0039776 | 3300047319 | Bacteria | 4212 |
| 827 | Ga0495674_0162963 | 3300047319 | Bacteria | 1865 |
| 828 | Ga0495674_0254193 | 3300047319 | Bacteria | 1445 |
| 829 | Ga0495672_0045609 | 3300047320 | Bacteria | 2621 |
| 830 | Ga0495676_0065285 | 3300047321 | Bacteria | 2826 |
| 831 | Ga0495676_0091683 | 3300047321 | Bacteria | 2270 |
| 832 | Ga0495680_0006264 | 3300047322 | Bacteria | 11086 |
| 833 | Ga0495680_0006496 | 3300047322 | Bacteria | 10851 |
| 834 | Ga0495683_0124101 | 3300047323 | Bacteria | 1223 |
| 835 | Ga0495675_0021254 | 3300047444 | Bacteria | 4132 |
| 836 | Ga0495675_0049118 | 3300047444 | Bacteria | 2682 |
| 837 | Ga0495685_135996 | 3300047447 | Bacteria | 802 |
| 838 | Ga0495673_0077420 | 3300047469 | Bacteria | 1385 |
| 839 | Ga0495673_0091708 | 3300047469 | Bacteria | 1241 |
| 840 | Ga0495673_0103852 | 3300047469 | Bacteria | 1145 |
| 841 | Ga0495681_0092181 | 3300047470 | Bacteria | 1336 |
| 842 | Ga0495681_0104104 | 3300047470 | Bacteria | 1237 |
| 843 | Ga0495684_0012962 | 3300047471 | Bacteria | 6435 |
| 844 | Ga0495686_0017873 | 3300047472 | Bacteria | 4768 |
| 845 | Ga0495686_0043114 | 3300047472 | Bacteria | 2863 |
| 846 | Ga0495686_0092777 | 3300047472 | Bacteria | 1831 |
| 847 | Ga0495686_0172967 | 3300047472 | Bacteria | 1255 |
| 848 | Ga0495686_0212017 | 3300047472 | Bacteria | 1106 |
| 849 | Ga0495593_0001308 | 3300047673 | Bacteria | 14618 |
| 850 | Ga0495593_0008357 | 3300047673 | Bacteria | 6023 |
| 851 | Ga0495602_0023461 | 3300048088 | Bacteria | 6009 |
| 852 | Ga0495602_0025728 | 3300048088 | Bacteria | 5690 |
| 853 | Ga0495602_0043067 | 3300048088 | Bacteria | 4108 |
| 854 | Ga0495614_0108094 | 3300048089 | Bacteria | 1220 |
| 855 | Ga0495626_0017777 | 3300048091 | Bacteria | 3585 |
| 856 | Ga0496101_0007758 | 3300048904 | Bacteria | 6974 |
| 857 | Ga0496101_0106028 | 3300048904 | Bacteria | 2110 |
| 858 | Ga0496101_0722208 | 3300048904 | Bacteria | 786 |
| 859 | Ga0496102_0010309 | 3300048905 | Bacteria | 8035 |
| 860 | Ga0496102_0515596 | 3300048905 | Bacteria | 1118 |
| 861 | Ga0496102_0613084 | 3300048905 | Bacteria | 1011 |
| 862 | Ga0496103_0326749 | 3300048906 | Bacteria | 986 |
| 863 | Ga0496104_0009462 | 3300048907 | Bacteria | 8668 |
| 864 | Ga0496104_0071281 | 3300048907 | Bacteria | 3304 |
| 865 | Ga0496104_0114517 | 3300048907 | Bacteria | 2586 |
| 866 | Ga0496104_0471710 | 3300048907 | Bacteria | 1166 |
| 867 | Ga0496105_0029974 | 3300048908 | Bacteria | 4455 |
| 868 | Ga0496105_0052802 | 3300048908 | Bacteria | 3357 |
| 869 | Ga0496105_0390837 | 3300048908 | Bacteria | 1106 |
| 870 | Ga0496106_0002119 | 3300048909 | Bacteria | 14839 |
| 871 | Ga0496106_0028877 | 3300048909 | Bacteria | 4133 |
| 872 | Ga0496106_0028919 | 3300048909 | Bacteria | 4130 |
| 873 | Ga0496106_0122458 | 3300048909 | Bacteria | 2034 |
| 874 | Ga0496107_0003483 | 3300048910 | Bacteria | 10525 |
| 875 | Ga0496107_0022807 | 3300048910 | Bacteria | 4425 |
| 876 | Ga0496107_0215337 | 3300048910 | Bacteria | 1428 |
| 877 | Ga0496108_0000938 | 3300048911 | Bacteria | 22748 |
| 878 | Ga0496108_0012526 | 3300048911 | Bacteria | 6906 |
| 879 | Ga0496108_0061584 | 3300048911 | Bacteria | 3158 |
| 880 | Ga0496108_0119426 | 3300048911 | Bacteria | 2260 |
| 881 | Ga0496109_0000977 | 3300048912 | Bacteria | 23646 |
| 882 | Ga0496109_0068355 | 3300048912 | Bacteria | 3257 |
| 883 | Ga0496109_0091458 | 3300048912 | Bacteria | 2814 |
| 884 | Ga0496109_0174956 | 3300048912 | Bacteria | 2014 |
| 885 | Ga0496109_0410057 | 3300048912 | Bacteria | 1280 |
| 886 | Ga0496109_0430396 | 3300048912 | Bacteria | 1246 |
| 887 | Ga0496110_0049690 | 3300048913 | Bacteria | 3680 |
| 888 | Ga0496110_0063156 | 3300048913 | Bacteria | 3272 |
| 889 | Ga0496110_0100573 | 3300048913 | Bacteria | 2591 |
| 890 | Ga0496110_0212387 | 3300048913 | Bacteria | 1759 |
| 891 | Ga0496110_1129949 | 3300048913 | Bacteria | 692 |
| 892 | Ga0496111_0076850 | 3300048914 | Bacteria | 2434 |
| 893 | Ga0496111_0090159 | 3300048914 | Bacteria | 2246 |
| 894 | Ga0496112_0000045 | 3300048915 | Bacteria | 85873 |
| 895 | Ga0496112_0000590 | 3300048915 | Bacteria | 24921 |
| 896 | Ga0496112_0015545 | 3300048915 | Bacteria | 7108 |
| 897 | Ga0496112_0070107 | 3300048915 | Bacteria | 3464 |
| 898 | Ga0496112_0075203 | 3300048915 | Bacteria | 3340 |
| 899 | Ga0496112_0093111 | 3300048915 | Bacteria | 2983 |
| 900 | Ga0496112_0110069 | 3300048915 | Bacteria | 2725 |
| 901 | Ga0496112_0153212 | 3300048915 | Bacteria | 2272 |
| 902 | Ga0496113_0032399 | 3300048916 | Bacteria | 3799 |
| 903 | Ga0496114_0234352 | 3300048917 | Bacteria | 1613 |
| 904 | Ga0496115_0097205 | 3300048918 | Bacteria | 2411 |
| 905 | Ga0496115_0132424 | 3300048918 | Bacteria | 2055 |
| 906 | Ga0496115_0135353 | 3300048918 | Bacteria | 2031 |
| 907 | Ga0496115_0159319 | 3300048918 | Bacteria | 1865 |
| 908 | Ga0496115_0236424 | 3300048918 | Bacteria | 1506 |
| 909 | Ga0496115_0270746 | 3300048918 | Bacteria | 1395 |
| 910 | Ga0496116_0012386 | 3300048919 | Bacteria | 6973 |
| 911 | Ga0496117_0016137 | 3300048920 | Bacteria | 6318 |
| 912 | Ga0496117_0043048 | 3300048920 | Bacteria | 3288 |
| 913 | Ga0496117_0052104 | 3300048920 | Bacteria | 2886 |
| 914 | Ga0496117_0057914 | 3300048920 | Bacteria | 2687 |
| 915 | Ga0496117_0268075 | 3300048920 | Bacteria | 921 |
| 916 | Ga0496118_0018344 | 3300048921 | Bacteria | 6318 |
| 917 | Ga0496118_0022527 | 3300048921 | Bacteria | 5502 |
| 918 | Ga0496118_0031340 | 3300048921 | Bacteria | 4409 |
| 919 | Ga0496118_0433473 | 3300048921 | Bacteria | 672 |
| 920 | Ga0496119_0042013 | 3300048922 | Bacteria | 2904 |
| 921 | Ga0496119_0062235 | 3300048922 | Bacteria | 2225 |
| 922 | Ga0496119_0086948 | 3300048922 | Bacteria | 1785 |
| 923 | Ga0496121_0000379 | 3300048924 | Bacteria | 91131 |
| 924 | Ga0496121_0002555 | 3300048924 | Bacteria | 27565 |
| 925 | Ga0496121_0004013 | 3300048924 | Bacteria | 20280 |
| 926 | Ga0496121_0004472 | 3300048924 | Bacteria | 18782 |
| 927 | Ga0496121_0010261 | 3300048924 | Bacteria | 10600 |
| 928 | Ga0496121_0010612 | 3300048924 | Bacteria | 10350 |
| 929 | Ga0496121_0024775 | 3300048924 | Bacteria | 5723 |
| 930 | Ga0496121_0077052 | 3300048924 | Bacteria | 2656 |
| 931 | Ga0496121_0078720 | 3300048924 | Bacteria | 2619 |
| 932 | Ga0496121_0171025 | 3300048924 | Bacteria | 1578 |
| 933 | Ga0496121_0180289 | 3300048924 | Bacteria | 1525 |
| 934 | Ga0496121_0368773 | 3300048924 | Bacteria | 951 |
| 935 | Ga0496121_0416496 | 3300048924 | Bacteria | 875 |
| 936 | Ga0496122_0024591 | 3300048925 | Bacteria | 5265 |
| 937 | Ga0496122_0075943 | 3300048925 | Bacteria | 2367 |
| 938 | Ga0496122_0276291 | 3300048925 | Bacteria | 921 |
| 939 | Ga0496123_0017035 | 3300048926 | Bacteria | 5867 |
| 940 | Ga0496124_0001073 | 3300048927 | Bacteria | 43225 |
| 941 | Ga0496124_0056109 | 3300048927 | Bacteria | 3324 |
| 942 | Ga0496124_0257026 | 3300048927 | Bacteria | 1288 |
| 943 | Ga0496124_0283856 | 3300048927 | Bacteria | 1205 |
| 944 | Ga0496124_0289595 | 3300048927 | Bacteria | 1189 |
| 945 | Ga0496124_0498712 | 3300048927 | Bacteria | 817 |
| 946 | Ga0496125_0000252 | 3300048928 | Bacteria | 109988 |
| 947 | Ga0496125_0000629 | 3300048928 | Bacteria | 59181 |
| 948 | Ga0496125_0029288 | 3300048928 | Bacteria | 4951 |
| 949 | Ga0496125_0182105 | 3300048928 | Bacteria | 1398 |
| 950 | Ga0496126_0003114 | 3300048929 | Bacteria | 21387 |
| 951 | Ga0496126_0008548 | 3300048929 | Bacteria | 11032 |
| 952 | Ga0496126_0013956 | 3300048929 | Bacteria | 8147 |
| 953 | Ga0496126_0031521 | 3300048929 | Bacteria | 5007 |
| 954 | Ga0496126_0063374 | 3300048929 | Bacteria | 3314 |
| 955 | Ga0496126_0090707 | 3300048929 | Bacteria | 2688 |
| 956 | Ga0496126_0091348 | 3300048929 | Bacteria | 2677 |
| 957 | Ga0496126_0126229 | 3300048929 | Bacteria | 2214 |
| 958 | Ga0496126_0135055 | 3300048929 | Bacteria | 2129 |
| 959 | Ga0496126_0141426 | 3300048929 | Bacteria | 2071 |
| 960 | Ga0496126_0198282 | 3300048929 | Bacteria | 1696 |
| 961 | Ga0496126_0222573 | 3300048929 | Bacteria | 1584 |
| 962 | Ga0496126_0253163 | 3300048929 | Bacteria | 1467 |
| 963 | Ga0496126_0537838 | 3300048929 | Bacteria | 929 |
| 964 | Ga0496126_0629455 | 3300048929 | Bacteria | 842 |
| 965 | Ga0496126_0830996 | 3300048929 | Bacteria | 706 |
| 966 | Ga0501031_0000428 | 3300049568 | Bacteria | 24216 |
| 967 | Ga0501032_0001029 | 3300049569 | Bacteria | 22396 |
| 968 | Ga0501032_0127563 | 3300049569 | Bacteria | 1680 |
| 969 | Ga0501032_0154916 | 3300049569 | Bacteria | 1506 |
| 970 | Ga0501033_0000163 | 3300049570 | Bacteria | 63913 |
| 971 | Ga0501033_0126297 | 3300049570 | Bacteria | 1854 |
| 972 | Ga0501034_0000202 | 3300049571 | Bacteria | 112985 |
| 973 | Ga0501034_0013020 | 3300049571 | Bacteria | 8573 |
| 974 | Ga0501034_0119598 | 3300049571 | Bacteria | 2621 |
| 975 | Ga0501034_0664853 | 3300049571 | Bacteria | 942 |
| 976 | Ga0501036_0000042 | 3300049572 | Bacteria | 79876 |
| 977 | Ga0501036_0137765 | 3300049572 | Bacteria | 2060 |
| 978 | Ga0501037_0000100 | 3300049573 | Bacteria | 81013 |
| 979 | Ga0501037_0081418 | 3300049573 | Bacteria | 2347 |
| 980 | Ga0501038_0000226 | 3300049574 | Bacteria | 47831 |
| 981 | Ga0501038_0149058 | 3300049574 | Bacteria | 1908 |
| 982 | Ga0501039_0003287 | 3300049575 | Bacteria | 12087 |
| 983 | Ga0501041_0208115 | 3300049577 | Bacteria | 1227 |
| 984 | Ga0501043_0001024 | 3300049579 | Bacteria | 24571 |
| 985 | Ga0501046_0000619 | 3300049580 | Bacteria | 34959 |
| 986 | Ga0501046_0101211 | 3300049580 | Bacteria | 2210 |
| 987 | Ga0501047_0000159 | 3300049581 | Bacteria | 82106 |
| 988 | Ga0501047_0005748 | 3300049581 | Bacteria | 11674 |
| 989 | Ga0501047_0008010 | 3300049581 | Bacteria | 9965 |
| 990 | Ga0501047_0087590 | 3300049581 | Bacteria | 2991 |
| 991 | Ga0501047_0089744 | 3300049581 | Bacteria | 2951 |
| 992 | Ga0501048_0000050 | 3300049582 | Bacteria | 57921 |
| 993 | Ga0501048_0222865 | 3300049582 | Bacteria | 1338 |
| 994 | Ga0501067_0005945 | 3300049583 | Bacteria | 6764 |
| 995 | Ga0501067_0136782 | 3300049583 | Bacteria | 1364 |
| 996 | Ga0501067_0215665 | 3300049583 | Bacteria | 1069 |
| 997 | Ga0501068_0000430 | 3300049584 | Bacteria | 21319 |
| 998 | Ga0501068_0134498 | 3300049584 | Bacteria | 1547 |
| 999 | Ga0501070_0014472 | 3300049586 | Bacteria | 6640 |
| 1000 | Ga0501070_0053110 | 3300049586 | Bacteria | 3362 |
| 1001 | Ga0501070_0068451 | 3300049586 | Bacteria | 2939 |
| 1002 | Ga0501070_0106680 | 3300049586 | Bacteria | 2315 |
| 1003 | Ga0501070_0177345 | 3300049586 | Bacteria | 1754 |
| 1004 | Ga0501072_0068258 | 3300049588 | Bacteria | 2807 |
| 1005 | Ga0501073_0000329 | 3300049589 | Bacteria | 31824 |
| 1006 | Ga0501073_0185361 | 3300049589 | Bacteria | 1440 |
| 1007 | Ga0501074_0000414 | 3300049590 | Bacteria | 25493 |
| 1008 | Ga0501074_0007505 | 3300049590 | Bacteria | 7891 |
| 1009 | Ga0501074_0334316 | 3300049590 | Bacteria | 1075 |
| 1010 | Ga0501074_0476293 | 3300049590 | Bacteria | 885 |
| 1011 | Ga0501079_0003664 | 3300049741 | Bacteria | 11319 |
| 1012 | Ga0501079_0100317 | 3300049741 | Bacteria | 2245 |
| 1013 | Ga0501080_0000403 | 3300049742 | Bacteria | 33373 |
| 1014 | Ga0501080_0004615 | 3300049742 | Bacteria | 12271 |
| 1015 | Ga0501080_0088856 | 3300049742 | Bacteria | 2870 |
| 1016 | Ga0501080_0427689 | 3300049742 | Bacteria | 1189 |
| 1017 | Ga0501083_0006265 | 3300049744 | Bacteria | 8443 |
| 1018 | Ga0501035_0000120 | 3300049822 | Bacteria | 94532 |
| 1019 | Ga0501035_0135892 | 3300049822 | Bacteria | 2141 |
| 1020 | Ga0501035_0232759 | 3300049822 | Bacteria | 1570 |
| 1021 | Ga0501035_0301458 | 3300049822 | Bacteria | 1350 |
| 1022 | Ga0501044_0001777 | 3300049823 | Bacteria | 25225 |
| 1023 | Ga0501044_0042476 | 3300049823 | Bacteria | 4728 |
| 1024 | Ga0501044_0063727 | 3300049823 | Bacteria | 3764 |
| 1025 | Ga0501044_0164517 | 3300049823 | Bacteria | 2193 |
| 1026 | Ga0501044_0299840 | 3300049823 | Bacteria | 1536 |
| 1027 | Ga0501044_0603787 | 3300049823 | Bacteria | 990 |
| 1028 | Ga0501045_0003832 | 3300049824 | Bacteria | 10348 |
| 1029 | nmdc:mga03n38_10620_c1 | 3300050490 | Bacteria | 3397 |
| 1030 | nmdc:mga03n38_70407_c1 | 3300050490 | Bacteria | 1617 |
| 1031 | nmdc:mga00v17_91201_c1 | 3300050491 | Bacteria | 1914 |
| 1032 | nmdc:mga0yw44_24241_c1 | 3300050492 | Bacteria | 3431 |
| 1033 | nmdc:mga0yw44_42619_c1 | 3300050492 | Bacteria | 1701 |
| 1034 | nmdc:mga0yw44_83999_c1 | 3300050492 | Bacteria | 2001 |
| 1035 | nmdc:mga0k408_183635_c1 | 3300050493 | Bacteria | 950 |
| 1036 | nmdc:mga0k408_326403_c1 | 3300050493 | Bacteria | 916 |
| 1037 | nmdc:mga06z11_136998_c1 | 3300050494 | Bacteria | 1380 |
| 1038 | nmdc:mga07m45_132698_c1 | 3300050496 | Bacteria | 1441 |
| 1039 | nmdc:mga07m45_17418_c1 | 3300050496 | Bacteria | 3859 |
| 1040 | nmdc:mga07m45_53645_c1 | 3300050496 | Bacteria | 2278 |
| 1041 | nmdc:mga05p37_141932_c1 | 3300050507 | Bacteria | 2942 |
| 1042 | nmdc:mga0n895_123108_c1 | 3300050512 | Bacteria | 2615 |
| 1043 | nmdc:mga0n895_8527_c1 | 3300050512 | Bacteria | 8881 |
| 1044 | nmdc:mga0rr50_373004_c1 | 3300050513 | Bacteria | 1202 |
| 1045 | nmdc:mga0rr50_460277_c1 | 3300050513 | Bacteria | 1079 |
| 1046 | nmdc:mga0a205_112801_c1 | 3300050515 | Bacteria | 2617 |
| 1047 | nmdc:mga0sz30_28629_c1 | 3300050516 | Bacteria | 2294 |
| 1048 | Ga0495601_0037977 | 3300053077 | Bacteria | 3010 |
| 1049 | Ga0495601_0044379 | 3300053077 | Bacteria | 2794 |
| 1050 | Ga0495601_0091103 | 3300053077 | Bacteria | 1963 |
| 1051 | Ga0495612_0019273 | 3300053078 | Bacteria | 2733 |
| 1052 | Ga0495612_0119885 | 3300053078 | Bacteria | 1131 |
| 1053 | Ga0500635_0013844 | 3300053080 | Bacteria | 2351 |
| 1054 | Ga0500635_0020627 | 3300053080 | Bacteria | 2020 |
| 1055 | Ga0495595_0002284 | 3300053084 | Bacteria | 7462 |
| 1056 | Ga0495595_0043669 | 3300053084 | Bacteria | 2057 |
| 1057 | Ga0495619_0006156 | 3300053085 | Bacteria | 7601 |
| 1058 | Ga0495619_0206380 | 3300053085 | Bacteria | 1360 |
| 1059 | Ga0500644_0095771 | 3300053088 | Bacteria | 1119 |
| 1060 | Ga0500581_028462 | 3300053089 | Bacteria | 2849 |
| 1061 | Ga0500651_0001684 | 3300053093 | Bacteria | 11290 |
| 1062 | Ga0500651_0021035 | 3300053093 | Bacteria | 4065 |
| 1063 | Ga0500651_0130353 | 3300053093 | Bacteria | 1521 |
| 1064 | Ga0500651_0222539 | 3300053093 | Bacteria | 1106 |
| 1065 | Ga0500651_0236169 | 3300053093 | Bacteria | 1067 |
| 1066 | Ga0500566_0000046 | 3300053094 | Bacteria | 59187 |
| 1067 | Ga0500566_0015683 | 3300053094 | Bacteria | 4446 |
| 1068 | Ga0500640_000122 | 3300053095 | Bacteria | 14571 |
| 1069 | Ga0500641_0016700 | 3300053096 | Bacteria | 2735 |
| 1070 | Ga0500650_0050889 | 3300053098 | Bacteria | 1923 |
| 1071 | Ga0500554_001975 | 3300053102 | Bacteria | 3980 |
| 1072 | Ga0500554_005676 | 3300053102 | Bacteria | 2742 |
| 1073 | Ga0500554_068408 | 3300053102 | Bacteria | 1152 |
| 1074 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 1075 | Ga0500562_003130 | 3300053108 | Bacteria | 4131 |
| 1076 | Ga0500569_070535 | 3300053109 | Bacteria | 1098 |
| 1077 | Ga0500572_000277 | 3300053111 | Bacteria | 18643 |
| 1078 | Ga0500592_000602 | 3300053116 | Bacteria | 5900 |
| 1079 | Ga0500592_004767 | 3300053116 | Bacteria | 2153 |
| 1080 | Ga0500594_0003113 | 3300053118 | Bacteria | 3630 |
| 1081 | Ga0500594_0016522 | 3300053118 | Bacteria | 1794 |
| 1082 | Ga0500595_001435 | 3300053119 | Bacteria | 12781 |
| 1083 | Ga0500595_002523 | 3300053119 | Bacteria | 9027 |
| 1084 | Ga0500595_003315 | 3300053119 | Bacteria | 7571 |
| 1085 | Ga0500595_005416 | 3300053119 | Bacteria | 5575 |
| 1086 | Ga0500595_022337 | 3300053119 | Bacteria | 2242 |
| 1087 | Ga0500608_021992 | 3300053122 | Bacteria | 2953 |
| 1088 | Ga0500614_064242 | 3300053123 | Bacteria | 993 |
| 1089 | Ga0500618_006771 | 3300053125 | Bacteria | 3336 |
| 1090 | Ga0500642_0000015 | 3300053130 | Bacteria | 181424 |
| 1091 | Ga0500642_0012591 | 3300053130 | Bacteria | 3075 |
| 1092 | Ga0500652_000456 | 3300053131 | Bacteria | 14464 |
| 1093 | Ga0500658_0198572 | 3300053134 | Bacteria | 916 |
| 1094 | Ga0500559_0000301 | 3300053136 | Bacteria | 37742 |
| 1095 | Ga0500559_0001197 | 3300053136 | Bacteria | 15425 |
| 1096 | Ga0500559_0006509 | 3300053136 | Bacteria | 5271 |
| 1097 | Ga0500559_0084943 | 3300053136 | Bacteria | 1443 |
| 1098 | Ga0500568_0000334 | 3300053139 | Bacteria | 37071 |
| 1099 | Ga0500568_0004685 | 3300053139 | Bacteria | 7268 |
| 1100 | Ga0500573_0004365 | 3300053140 | Bacteria | 7439 |
| 1101 | Ga0500577_0000239 | 3300053142 | Bacteria | 14570 |
| 1102 | Ga0500586_000409 | 3300053145 | Bacteria | 8597 |
| 1103 | Ga0500588_0104321 | 3300053146 | Bacteria | 981 |
| 1104 | Ga0500589_094864 | 3300053147 | Bacteria | 1306 |
| 1105 | Ga0500589_134231 | 3300053147 | Bacteria | 1029 |
| 1106 | Ga0500590_036369 | 3300053148 | Bacteria | 2545 |
| 1107 | Ga0500590_081314 | 3300053148 | Bacteria | 1591 |
| 1108 | Ga0500603_001802 | 3300053150 | Bacteria | 4811 |
| 1109 | Ga0500603_002934 | 3300053150 | Bacteria | 3693 |
| 1110 | Ga0500603_059283 | 3300053150 | Bacteria | 1066 |
| 1111 | Ga0500603_068748 | 3300053150 | Bacteria | 1005 |
| 1112 | Ga0500604_0025305 | 3300053151 | Bacteria | 1705 |
| 1113 | Ga0500604_0127133 | 3300053151 | Bacteria | 855 |
| 1114 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 1115 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1116 | Ga0500622_0007863 | 3300053156 | Bacteria | 6006 |
| 1117 | Ga0500622_0012142 | 3300053156 | Bacteria | 4673 |
| 1118 | Ga0500627_0030694 | 3300053158 | Bacteria | 2252 |
| 1119 | Ga0500627_0163336 | 3300053158 | Bacteria | 1004 |
| 1120 | Ga0500630_001838 | 3300053159 | Bacteria | 10201 |
| 1121 | Ga0500633_0081565 | 3300053160 | Bacteria | 1171 |
| 1122 | Ga0500638_009710 | 3300053162 | Bacteria | 4177 |
| 1123 | Ga0500639_001285 | 3300053163 | Bacteria | 12720 |
| 1124 | Ga0500639_019202 | 3300053163 | Bacteria | 3606 |
| 1125 | Ga0500639_094416 | 3300053163 | Bacteria | 1484 |
| 1126 | Ga0500636_0001477 | 3300053177 | Bacteria | 12758 |
| 1127 | Ga0500636_0005231 | 3300053177 | Bacteria | 7387 |
| 1128 | Ga0500636_0045273 | 3300053177 | Bacteria | 2595 |
| 1129 | Ga0500637_0000262 | 3300053178 | Bacteria | 19711 |
| 1130 | Ga0500637_0017144 | 3300053178 | Bacteria | 3874 |
| 1131 | Ga0500637_0077191 | 3300053178 | Bacteria | 1921 |
| 1132 | Ga0500645_018874 | 3300053730 | Bacteria | 2149 |
| 1133 | Ga0500645_083462 | 3300053730 | Bacteria | 910 |
| 1134 | Ga0500656_008164 | 3300053732 | Bacteria | 1106 |
| 1135 | Ga0500596_002379 | 3300053735 | Bacteria | 3708 |
| 1136 | Ga0500596_011759 | 3300053735 | Bacteria | 1335 |
| 1137 | Ga0500601_010257 | 3300053737 | Bacteria | 1047 |
| 1138 | Ga0501084_0007843 | 3300054114 | Bacteria | 8784 |
| 1139 | Ga0500661_000172 | 3300055283 | Bacteria | 11274 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0134988 | Ga0466963_0134988_572_1348 | 198 |
| 2 | 3300041459 | Ga0451800_1202443 | Ga0451800_1202443_28_654 | 207 |
| 3 | 3300046473 | Ga0495582_0468234 | Ga0495582_0468234_67_696 | 207 |
| 4 | 3300046663 | Ga0495635_0363371 | Ga0495635_0363371_297_926 | 207 |
| 5 | 3300048913 | Ga0496110_1129949 | Ga0496110_1129949_41_670 | 207 |
| 6 | 3300037466 | Ga0395898_0232296 | Ga0395898_0232296_69_707 | 208 |
| 7 | 3300048921 | Ga0496118_0433473 | Ga0496118_0433473_18_647 | 208 |
| 8 | 3300048929 | Ga0496126_0830996 | Ga0496126_0830996_24_650 | 208 |
| 9 | 3300053730 | Ga0500645_083462 | Ga0500645_083462_13_642 | 208 |
| 10 | 3300041456 | Ga0451795_0811766 | Ga0451795_0811766_273_926 | 211 |
| 11 | 3300028800 | Ga0265338_10348293 | Ga0265338_103482931 | 221 |
| 12 | 3300005435 | Ga0070714_100563354 | Ga0070714_1005633541 | 226 |
| 13 | 3300025929 | Ga0207664_10442830 | Ga0207664_104428302 | 226 |
| 14 | 3300005327 | Ga0070658_10034116 | Ga0070658_100341165 | 227 |
| 15 | 3300005458 | Ga0070681_10057834 | Ga0070681_100578344 | 227 |
| 16 | 3300005616 | Ga0068852_100394018 | Ga0068852_1003940181 | 227 |
| 17 | 3300013102 | Ga0157371_10304228 | Ga0157371_103042282 | 227 |
| 18 | 3300013104 | Ga0157370_10423169 | Ga0157370_104231692 | 227 |
| 19 | 3300025909 | Ga0207705_10012927 | Ga0207705_100129277 | 227 |
| 20 | 3300025917 | Ga0207660_10201882 | Ga0207660_102018821 | 227 |
| 21 | 3300025921 | Ga0207652_10020676 | Ga0207652_100206762 | 227 |
| 22 | 3300026142 | Ga0207698_10310003 | Ga0207698_103100031 | 227 |
| 23 | 3300031595 | Ga0265313_10024594 | Ga0265313_100245944 | 227 |
| 24 | 3300031711 | Ga0265314_10084897 | Ga0265314_100848972 | 227 |
| 25 | 3300031712 | Ga0265342_10000502 | Ga0265342_1000050237 | 227 |
| 26 | 3300049581 | Ga0501047_0087590 | Ga0501047_0087590_1542_2342 | 227 |
| 27 | 3300049590 | Ga0501074_0334316 | Ga0501074_0334316_76_876 | 227 |
| 28 | 3300049823 | Ga0501044_0042476 | Ga0501044_0042476_940_1740 | 227 |
| 29 | 3300005434 | Ga0070709_10362430 | Ga0070709_103624302 | 228 |
| 30 | 3300005437 | Ga0070710_10076678 | Ga0070710_100766782 | 228 |
| 31 | 3300028800 | Ga0265338_10047212 | Ga0265338_100472123 | 231 |
| 32 | 3300031249 | Ga0265339_10047059 | Ga0265339_100470592 | 231 |
| 33 | 3300031712 | Ga0265342_10018370 | Ga0265342_100183702 | 231 |
| 34 | 3300024225 | Ga0224572_1007287 | Ga0224572_10072872 | 232 |
| 35 | 3300024227 | Ga0228598_1008279 | Ga0228598_10082792 | 232 |
| 36 | 3300044842 | Ga0466957_0078893 | Ga0466957_0078893_438_1247 | 233 |
| 37 | 3300045836 | Ga0466958_0016143 | Ga0466958_0016143_1497_2306 | 233 |
| 38 | 3300005355 | Ga0070671_100148618 | Ga0070671_1001486181 | 235 |
| 39 | 3300005367 | Ga0070667_100059884 | Ga0070667_1000598842 | 235 |
| 40 | 3300025986 | Ga0207658_10430999 | Ga0207658_104309991 | 235 |
| 41 | 3300026041 | Ga0207639_10379064 | Ga0207639_103790641 | 235 |
| 42 | 3300031247 | Ga0265340_10102494 | Ga0265340_101024942 | 235 |
| 43 | 3300006038 | Ga0075365_10293690 | Ga0075365_102936902 | 236 |
| 44 | 3300039437 | Ga0436365_0447222 | Ga0436365_0447222_593_1378 | 236 |
| 45 | 3300039437 | Ga0436365_0262407 | Ga0436365_0262407_168_881 | 237 |
| 46 | 3300003322 | rootL2_10024455 | rootL2_100244551 | 239 |
| 47 | 3300005336 | Ga0070680_100417061 | Ga0070680_1004170612 | 239 |
| 48 | 3300005458 | Ga0070681_10109584 | Ga0070681_101095843 | 239 |
| 49 | 3300005530 | Ga0070679_100060424 | Ga0070679_1000604243 | 239 |
| 50 | 3300025912 | Ga0207707_10116020 | Ga0207707_101160202 | 239 |
| 51 | 3300025917 | Ga0207660_10400034 | Ga0207660_104000342 | 239 |
| 52 | 3300025921 | Ga0207652_10218318 | Ga0207652_102183181 | 239 |
| 53 | 3300005435 | Ga0070714_100460661 | Ga0070714_1004606612 | 243 |
| 54 | 3300005530 | Ga0070679_100146533 | Ga0070679_1001465333 | 243 |
| 55 | 3300005616 | Ga0068852_100011300 | Ga0068852_1000113004 | 243 |
| 56 | 3300025921 | Ga0207652_10248296 | Ga0207652_102482962 | 243 |
| 57 | 3300025929 | Ga0207664_10440078 | Ga0207664_104400782 | 243 |
| 58 | 3300025949 | Ga0207667_10152583 | Ga0207667_101525833 | 243 |
| 59 | 3300026142 | Ga0207698_10233558 | Ga0207698_102335582 | 243 |
| 60 | 3300013297 | Ga0157378_10324120 | Ga0157378_103241202 | 244 |
| 61 | 3300048929 | Ga0496126_0537838 | Ga0496126_0537838_41_808 | 244 |
| 62 | 3300005535 | Ga0070684_100243608 | Ga0070684_1002436082 | 245 |
| 63 | 3300009551 | Ga0105238_10094377 | Ga0105238_100943771 | 245 |
| 64 | 3300025924 | Ga0207694_10083458 | Ga0207694_100834583 | 245 |
| 65 | 3300025949 | Ga0207667_10437857 | Ga0207667_104378572 | 245 |
| 66 | 3300005439 | Ga0070711_100253020 | Ga0070711_1002530202 | 247 |
| 67 | 3300006173 | Ga0070716_100130543 | Ga0070716_1001305431 | 247 |
| 68 | 3300025939 | Ga0207665_10041508 | Ga0207665_100415082 | 247 |
| 69 | 3300028653 | Ga0265323_10011073 | Ga0265323_100110731 | 247 |
| 70 | 3300028666 | Ga0265336_10000125 | Ga0265336_100001254 | 247 |
| 71 | 3300028800 | Ga0265338_10000085 | Ga0265338_1000008530 | 247 |
| 72 | 3300007076 | Ga0075435_100123099 | Ga0075435_1001230992 | 248 |
| 73 | 3300050512 | nmdc:mga0n895_123108_c1 | nmdc:mga0n895_123108_c1_1541_2311 | 248 |
| 74 | 3300050513 | nmdc:mga0rr50_460277_c1 | nmdc:mga0rr50_460277_c1_33_803 | 248 |
| 75 | 3300053134 | Ga0500658_0198572 | Ga0500658_0198572_21_773 | 249 |
| 76 | 3300009174 | Ga0105241_10202834 | Ga0105241_102028342 | 250 |
| 77 | 3300013297 | Ga0157378_10641265 | Ga0157378_106412651 | 250 |
| 78 | 3300014325 | Ga0163163_10142805 | Ga0163163_101428051 | 250 |
| 79 | 3300014968 | Ga0157379_10162954 | Ga0157379_101629542 | 250 |
| 80 | 3300035691 | Ga0373931_0182961 | Ga0373931_0182961_185_937 | 250 |
| 81 | 3300048904 | Ga0496101_0722208 | Ga0496101_0722208_16_768 | 250 |
| 82 | 3300048908 | Ga0496105_0052802 | Ga0496105_0052802_1704_2456 | 250 |
| 83 | 3300048911 | Ga0496108_0061584 | Ga0496108_0061584_1079_1831 | 250 |
| 84 | 3300048912 | Ga0496109_0068355 | Ga0496109_0068355_1399_2151 | 250 |
| 85 | 3300048913 | Ga0496110_0100573 | Ga0496110_0100573_28_780 | 250 |
| 86 | 3300048914 | Ga0496111_0090159 | Ga0496111_0090159_419_1171 | 250 |
| 87 | 3300048915 | Ga0496112_0015545 | Ga0496112_0015545_612_1364 | 250 |
| 88 | iso_pu_bacteria | 2791355197 | 2793066354 | 250 |
| 89 | iso_pu_bacteria | 2885374607 | 2885377318 | 250 |
| 90 | iso_pu_bacteria | 2906610324 | 2906616197 | 250 |
| 91 | iso_pu_bacteria | 2908739725 | 2908741264 | 250 |
| 92 | iso_pu_bacteria | 2922425934 | 2922431827 | 250 |
| 93 | iso_pu_bacteria | 8019555841 | 8019559945 | 250 |
| 94 | iso_pu_bacteria | 8019565922 | 8019570048 | 250 |
| 95 | 3300003215 | JGI25153J46596_10026735 | JGI25153J46596_100267351 | 251 |
| 96 | 3300025297 | Ga0209758_1000720 | Ga0209758_100072035 | 251 |
| 97 | 3300048928 | Ga0496125_0000252 | Ga0496125_0000252_109102_109857 | 251 |
| 98 | iso_pu_bacteria | 2508501128 | 2509151040 | 251 |
| 99 | iso_pu_bacteria | 2513237101 | 2513693063 | 251 |
| 100 | iso_pu_bacteria | 2513237141 | 2513887313 | 251 |
| 101 | iso_pu_bacteria | 2721755755 | 2723843301 | 251 |
| 102 | iso_pu_bacteria | 2874604998 | 2874611808 | 251 |
| 103 | iso_pu_bacteria | 2876808645 | 2876809628 | 251 |
| 104 | iso_pu_bacteria | 2879110137 | 2879110866 | 251 |
| 105 | iso_pu_bacteria | 2922386360 | 2922387206 | 251 |
| 106 | iso_pu_bacteria | 8006984368 | 8006985047 | 251 |
| 107 | iso_pu_bacteria | 8006994254 | 8006999760 | 251 |
| 108 | iso_pu_bacteria | 8056673599 | 8056677611 | 251 |
| 109 | iso_pu_bacteria | 2513237098 | 2513678776 | 252 |
| 110 | iso_pu_bacteria | 2524023210 | 2524464966 | 252 |
| 111 | iso_pu_bacteria | 2602042107 | 2603860123 | 252 |
| 112 | iso_pu_bacteria | 2643221651 | 2644289352 | 252 |
| 113 | iso_pu_bacteria | 2791355199 | 2793080707 | 252 |
| 114 | iso_pu_bacteria | 2857524615 | 2857525106 | 252 |
| 115 | iso_pu_bacteria | 2885383462 | 2885390085 | 252 |
| 116 | iso_pu_bacteria | 2889033259 | 2889037619 | 252 |
| 117 | iso_pu_bacteria | 2893066018 | 2893069690 | 252 |
| 118 | iso_pu_bacteria | 2903768456 | 2903773185 | 252 |
| 119 | iso_pu_bacteria | 2919073203 | 2919078995 | 252 |
| 120 | iso_pu_bacteria | 8006964411 | 8006968082 | 252 |
| 121 | iso_pu_bacteria | 8056681323 | 8056687830 | 252 |
| 122 | 3300020069 | Ga0197907_10288381 | Ga0197907_102883812 | 253 |
| 123 | 3300025949 | Ga0207667_10187258 | Ga0207667_101872582 | 253 |
| 124 | 3300026067 | Ga0207678_10014837 | Ga0207678_100148374 | 253 |
| 125 | 3300045976 | Ga0466967_0089395 | Ga0466967_0089395_1096_1860 | 253 |
| 126 | 3300049571 | Ga0501034_0013020 | Ga0501034_0013020_2540_3316 | 253 |
| 127 | 3300049586 | Ga0501070_0068451 | Ga0501070_0068451_155_931 | 253 |
| 128 | 3300005434 | Ga0070709_10020362 | Ga0070709_100203624 | 254 |
| 129 | 3300005436 | Ga0070713_100140124 | Ga0070713_1001401242 | 254 |
| 130 | 3300005439 | Ga0070711_100010247 | Ga0070711_1000102473 | 254 |
| 131 | 3300005456 | Ga0070678_100056469 | Ga0070678_1000564692 | 254 |
| 132 | 3300005543 | Ga0070672_100069702 | Ga0070672_1000697022 | 254 |
| 133 | 3300005614 | Ga0068856_100122875 | Ga0068856_1001228752 | 254 |
| 134 | 3300006163 | Ga0070715_10012186 | Ga0070715_100121862 | 254 |
| 135 | 3300006173 | Ga0070716_100219623 | Ga0070716_1002196232 | 254 |
| 136 | 3300014969 | Ga0157376_10187389 | Ga0157376_101873892 | 254 |
| 137 | 3300025261 | Ga0209233_1004699 | Ga0209233_10046992 | 254 |
| 138 | 3300025906 | Ga0207699_10040953 | Ga0207699_100409531 | 254 |
| 139 | 3300025916 | Ga0207663_10041918 | Ga0207663_100419182 | 254 |
| 140 | 3300025928 | Ga0207700_10084230 | Ga0207700_100842302 | 254 |
| 141 | 3300025940 | Ga0207691_10071603 | Ga0207691_100716032 | 254 |
| 142 | 3300026121 | Ga0207683_10028505 | Ga0207683_100285055 | 254 |
| 143 | 3300048929 | Ga0496126_0031521 | Ga0496126_0031521_3419_4204 | 254 |
| 144 | 3300048929 | Ga0496126_0091348 | Ga0496126_0091348_456_1223 | 254 |
| 145 | 3300001990 | JGI24737J22298_10001768 | JGI24737J22298_100017686 | 255 |
| 146 | 3300003308 | Ga0006777J48905_1012525 | Ga0006777J48905_10125251 | 255 |
| 147 | 3300003320 | rootH2_10115860 | rootH2_101158602 | 255 |
| 148 | 3300003771 | Ga0055526_1031838 | Ga0055526_10318382 | 255 |
| 149 | 3300005262 | Ga0065165_1041708 | Ga0065165_10417082 | 255 |
| 150 | 3300005334 | Ga0068869_100092114 | Ga0068869_1000921143 | 255 |
| 151 | 3300005338 | Ga0068868_100304927 | Ga0068868_1003049272 | 255 |
| 152 | 3300005340 | Ga0070689_100652361 | Ga0070689_1006523611 | 255 |
| 153 | 3300005347 | Ga0070668_100266734 | Ga0070668_1002667342 | 255 |
| 154 | 3300005347 | Ga0070668_100277616 | Ga0070668_1002776162 | 255 |
| 155 | 3300005347 | Ga0070668_100375144 | Ga0070668_1003751441 | 255 |
| 156 | 3300005347 | Ga0070668_100406455 | Ga0070668_1004064551 | 255 |
| 157 | 3300005354 | Ga0070675_100191642 | Ga0070675_1001916422 | 255 |
| 158 | 3300005355 | Ga0070671_100148721 | Ga0070671_1001487211 | 255 |
| 159 | 3300005367 | Ga0070667_100100855 | Ga0070667_1001008553 | 255 |
| 160 | 3300005367 | Ga0070667_100303982 | Ga0070667_1003039822 | 255 |
| 161 | 3300005434 | Ga0070709_10018509 | Ga0070709_100185092 | 255 |
| 162 | 3300005434 | Ga0070709_10075990 | Ga0070709_100759901 | 255 |
| 163 | 3300005435 | Ga0070714_100002134 | Ga0070714_10000213411 | 255 |
| 164 | 3300005435 | Ga0070714_100084149 | Ga0070714_1000841494 | 255 |
| 165 | 3300005436 | Ga0070713_100053782 | Ga0070713_1000537821 | 255 |
| 166 | 3300005436 | Ga0070713_100097526 | Ga0070713_1000975263 | 255 |
| 167 | 3300005437 | Ga0070710_10002054 | Ga0070710_100020546 | 255 |
| 168 | 3300005437 | Ga0070710_10034900 | Ga0070710_100349002 | 255 |
| 169 | 3300005439 | Ga0070711_100002128 | Ga0070711_1000021283 | 255 |
| 170 | 3300005439 | Ga0070711_100023165 | Ga0070711_1000231653 | 255 |
| 171 | 3300005455 | Ga0070663_100162182 | Ga0070663_1001621821 | 255 |
| 172 | 3300005456 | Ga0070678_100158637 | Ga0070678_1001586372 | 255 |
| 173 | 3300005457 | Ga0070662_100024079 | Ga0070662_1000240792 | 255 |
| 174 | 3300005518 | Ga0070699_100497984 | Ga0070699_1004979842 | 255 |
| 175 | 3300005539 | Ga0068853_100038437 | Ga0068853_1000384374 | 255 |
| 176 | 3300005539 | Ga0068853_100695666 | Ga0068853_1006956661 | 255 |
| 177 | 3300005543 | Ga0070672_100250509 | Ga0070672_1002505092 | 255 |
| 178 | 3300005545 | Ga0070695_100395401 | Ga0070695_1003954011 | 255 |
| 179 | 3300005548 | Ga0070665_100246669 | Ga0070665_1002466693 | 255 |
| 180 | 3300005548 | Ga0070665_100375196 | Ga0070665_1003751961 | 255 |
| 181 | 3300005563 | Ga0068855_100012743 | Ga0068855_1000127433 | 255 |
| 182 | 3300005563 | Ga0068855_100029305 | Ga0068855_1000293054 | 255 |
| 183 | 3300005563 | Ga0068855_100870260 | Ga0068855_1008702601 | 255 |
| 184 | 3300005577 | Ga0068857_100010916 | Ga0068857_1000109165 | 255 |
| 185 | 3300005578 | Ga0068854_100046207 | Ga0068854_1000462073 | 255 |
| 186 | 3300005578 | Ga0068854_100142231 | Ga0068854_1001422313 | 255 |
| 187 | 3300005614 | Ga0068856_100003706 | Ga0068856_10000370615 | 255 |
| 188 | 3300005614 | Ga0068856_100005176 | Ga0068856_10000517610 | 255 |
| 189 | 3300005614 | Ga0068856_100013224 | Ga0068856_1000132247 | 255 |
| 190 | 3300005616 | Ga0068852_100006419 | Ga0068852_1000064198 | 255 |
| 191 | 3300005616 | Ga0068852_100129445 | Ga0068852_1001294453 | 255 |
| 192 | 3300005616 | Ga0068852_100292315 | Ga0068852_1002923152 | 255 |
| 193 | 3300005618 | Ga0068864_100223959 | Ga0068864_1002239591 | 255 |
| 194 | 3300005719 | Ga0068861_100161939 | Ga0068861_1001619393 | 255 |
| 195 | 3300005719 | Ga0068861_100324686 | Ga0068861_1003246861 | 255 |
| 196 | 3300005834 | Ga0068851_10001156 | Ga0068851_1000115610 | 255 |
| 197 | 3300005841 | Ga0068863_100273194 | Ga0068863_1002731942 | 255 |
| 198 | 3300005842 | Ga0068858_100307433 | Ga0068858_1003074332 | 255 |
| 199 | 3300005843 | Ga0068860_100515333 | Ga0068860_1005153332 | 255 |
| 200 | 3300005844 | Ga0068862_100193470 | Ga0068862_1001934701 | 255 |
| 201 | 3300005844 | Ga0068862_100463610 | Ga0068862_1004636102 | 255 |
| 202 | 3300005983 | Ga0081540_1003852 | Ga0081540_100385216 | 255 |
| 203 | 3300006028 | Ga0070717_10050603 | Ga0070717_100506032 | 255 |
| 204 | 3300006038 | Ga0075365_10034155 | Ga0075365_100341552 | 255 |
| 205 | 3300006048 | Ga0075363_100059406 | Ga0075363_1000594062 | 255 |
| 206 | 3300006051 | Ga0075364_10334752 | Ga0075364_103347522 | 255 |
| 207 | 3300006163 | Ga0070715_10000097 | Ga0070715_1000009717 | 255 |
| 208 | 3300006173 | Ga0070716_100036969 | Ga0070716_1000369692 | 255 |
| 209 | 3300006173 | Ga0070716_100088225 | Ga0070716_1000882252 | 255 |
| 210 | 3300006175 | Ga0070712_100008651 | Ga0070712_1000086515 | 255 |
| 211 | 3300006178 | Ga0075367_10090351 | Ga0075367_100903512 | 255 |
| 212 | 3300006178 | Ga0075367_10238426 | Ga0075367_102384262 | 255 |
| 213 | 3300006353 | Ga0075370_10015658 | Ga0075370_100156581 | 255 |
| 214 | 3300006358 | Ga0068871_100381292 | Ga0068871_1003812922 | 255 |
| 215 | 3300009092 | Ga0105250_10028114 | Ga0105250_100281143 | 255 |
| 216 | 3300009093 | Ga0105240_10004584 | Ga0105240_1000458422 | 255 |
| 217 | 3300009093 | Ga0105240_10008073 | Ga0105240_100080739 | 255 |
| 218 | 3300009093 | Ga0105240_10014611 | Ga0105240_100146114 | 255 |
| 219 | 3300009101 | Ga0105247_10047230 | Ga0105247_100472304 | 255 |
| 220 | 3300009174 | Ga0105241_10006953 | Ga0105241_100069534 | 255 |
| 221 | 3300009545 | Ga0105237_10059625 | Ga0105237_100596254 | 255 |
| 222 | 3300009545 | Ga0105237_10084203 | Ga0105237_100842033 | 255 |
| 223 | 3300009551 | Ga0105238_10000514 | Ga0105238_1000051431 | 255 |
| 224 | 3300009551 | Ga0105238_10005508 | Ga0105238_1000550811 | 255 |
| 225 | 3300010375 | Ga0105239_10005274 | Ga0105239_1000527414 | 255 |
| 226 | 3300010375 | Ga0105239_10006195 | Ga0105239_1000619511 | 255 |
| 227 | 3300010375 | Ga0105239_10098984 | Ga0105239_100989842 | 255 |
| 228 | 3300010375 | Ga0105239_10489518 | Ga0105239_104895182 | 255 |
| 229 | 3300010375 | Ga0105239_10709170 | Ga0105239_107091701 | 255 |
| 230 | 3300013102 | Ga0157371_10010534 | Ga0157371_100105344 | 255 |
| 231 | 3300013104 | Ga0157370_10043547 | Ga0157370_100435473 | 255 |
| 232 | 3300013296 | Ga0157374_10505326 | Ga0157374_105053262 | 255 |
| 233 | 3300013297 | Ga0157378_10230816 | Ga0157378_102308162 | 255 |
| 234 | 3300014745 | Ga0157377_10082353 | Ga0157377_100823533 | 255 |
| 235 | 3300014968 | Ga0157379_10156684 | Ga0157379_101566841 | 255 |
| 236 | 3300014969 | Ga0157376_10119674 | Ga0157376_101196741 | 255 |
| 237 | 3300014969 | Ga0157376_10535805 | Ga0157376_105358052 | 255 |
| 238 | 3300021441 | Ga0213871_10005850 | Ga0213871_100058502 | 255 |
| 239 | 3300024225 | Ga0224572_1001489 | Ga0224572_10014895 | 255 |
| 240 | 3300025295 | Ga0209564_1002116 | Ga0209564_10021164 | 255 |
| 241 | 3300025321 | Ga0207656_10141760 | Ga0207656_101417601 | 255 |
| 242 | 3300025885 | Ga0207653_10043061 | Ga0207653_100430611 | 255 |
| 243 | 3300025898 | Ga0207692_10002157 | Ga0207692_100021575 | 255 |
| 244 | 3300025905 | Ga0207685_10000990 | Ga0207685_100009904 | 255 |
| 245 | 3300025905 | Ga0207685_10046986 | Ga0207685_100469862 | 255 |
| 246 | 3300025906 | Ga0207699_10004697 | Ga0207699_100046972 | 255 |
| 247 | 3300025906 | Ga0207699_10189381 | Ga0207699_101893811 | 255 |
| 248 | 3300025911 | Ga0207654_10000526 | Ga0207654_1000052618 | 255 |
| 249 | 3300025911 | Ga0207654_10014836 | Ga0207654_100148364 | 255 |
| 250 | 3300025913 | Ga0207695_10000163 | Ga0207695_1000016380 | 255 |
| 251 | 3300025913 | Ga0207695_10000286 | Ga0207695_1000028683 | 255 |
| 252 | 3300025913 | Ga0207695_10019088 | Ga0207695_100190887 | 255 |
| 253 | 3300025914 | Ga0207671_10026189 | Ga0207671_100261891 | 255 |
| 254 | 3300025914 | Ga0207671_10165071 | Ga0207671_101650712 | 255 |
| 255 | 3300025915 | Ga0207693_10000541 | Ga0207693_1000054129 | 255 |
| 256 | 3300025915 | Ga0207693_10282442 | Ga0207693_102824422 | 255 |
| 257 | 3300025916 | Ga0207663_10000261 | Ga0207663_1000026117 | 255 |
| 258 | 3300025923 | Ga0207681_10337810 | Ga0207681_103378102 | 255 |
| 259 | 3300025924 | Ga0207694_10000120 | Ga0207694_1000012027 | 255 |
| 260 | 3300025924 | Ga0207694_10024012 | Ga0207694_100240122 | 255 |
| 261 | 3300025924 | Ga0207694_10036032 | Ga0207694_100360325 | 255 |
| 262 | 3300025925 | Ga0207650_10299343 | Ga0207650_102993431 | 255 |
| 263 | 3300025926 | Ga0207659_10288701 | Ga0207659_102887012 | 255 |
| 264 | 3300025927 | Ga0207687_10109032 | Ga0207687_101090322 | 255 |
| 265 | 3300025928 | Ga0207700_10003910 | Ga0207700_100039105 | 255 |
| 266 | 3300025929 | Ga0207664_10004837 | Ga0207664_100048375 | 255 |
| 267 | 3300025929 | Ga0207664_10069877 | Ga0207664_100698772 | 255 |
| 268 | 3300025931 | Ga0207644_10078270 | Ga0207644_100782702 | 255 |
| 269 | 3300025933 | Ga0207706_10230369 | Ga0207706_102303692 | 255 |
| 270 | 3300025933 | Ga0207706_10232786 | Ga0207706_102327862 | 255 |
| 271 | 3300025939 | Ga0207665_10000280 | Ga0207665_1000028020 | 255 |
| 272 | 3300025939 | Ga0207665_10022222 | Ga0207665_100222222 | 255 |
| 273 | 3300025940 | Ga0207691_10237979 | Ga0207691_102379792 | 255 |
| 274 | 3300025942 | Ga0207689_10405390 | Ga0207689_104053901 | 255 |
| 275 | 3300025949 | Ga0207667_10001834 | Ga0207667_1000183414 | 255 |
| 276 | 3300025949 | Ga0207667_10032845 | Ga0207667_100328453 | 255 |
| 277 | 3300025960 | Ga0207651_10246120 | Ga0207651_102461202 | 255 |
| 278 | 3300025960 | Ga0207651_10287634 | Ga0207651_102876342 | 255 |
| 279 | 3300025961 | Ga0207712_10219666 | Ga0207712_102196661 | 255 |
| 280 | 3300025961 | Ga0207712_10608762 | Ga0207712_106087621 | 255 |
| 281 | 3300025972 | Ga0207668_10071073 | Ga0207668_100710731 | 255 |
| 282 | 3300025981 | Ga0207640_10145075 | Ga0207640_101450751 | 255 |
| 283 | 3300026035 | Ga0207703_10080853 | Ga0207703_100808532 | 255 |
| 284 | 3300026035 | Ga0207703_10272724 | Ga0207703_102727242 | 255 |
| 285 | 3300026041 | Ga0207639_10003014 | Ga0207639_100030143 | 255 |
| 286 | 3300026067 | Ga0207678_10054813 | Ga0207678_100548134 | 255 |
| 287 | 3300026067 | Ga0207678_10284513 | Ga0207678_102845132 | 255 |
| 288 | 3300026078 | Ga0207702_10000019 | Ga0207702_10000019119 | 255 |
| 289 | 3300026078 | Ga0207702_10017659 | Ga0207702_100176595 | 255 |
| 290 | 3300026078 | Ga0207702_10063987 | Ga0207702_100639873 | 255 |
| 291 | 3300026088 | Ga0207641_10193664 | Ga0207641_101936642 | 255 |
| 292 | 3300026089 | Ga0207648_10390145 | Ga0207648_103901452 | 255 |
| 293 | 3300026095 | Ga0207676_10150451 | Ga0207676_101504512 | 255 |
| 294 | 3300026095 | Ga0207676_10315786 | Ga0207676_103157861 | 255 |
| 295 | 3300026116 | Ga0207674_10004566 | Ga0207674_100045665 | 255 |
| 296 | 3300026116 | Ga0207674_10008031 | Ga0207674_1000803110 | 255 |
| 297 | 3300026118 | Ga0207675_100453582 | Ga0207675_1004535822 | 255 |
| 298 | 3300026118 | Ga0207675_100505572 | Ga0207675_1005055722 | 255 |
| 299 | 3300026142 | Ga0207698_10105593 | Ga0207698_101055931 | 255 |
| 300 | 3300028023 | Ga0265357_1001110 | Ga0265357_10011102 | 255 |
| 301 | 3300028379 | Ga0268266_10133677 | Ga0268266_101336771 | 255 |
| 302 | 3300028380 | Ga0268265_10023019 | Ga0268265_100230194 | 255 |
| 303 | 3300028381 | Ga0268264_10460019 | Ga0268264_104600192 | 255 |
| 304 | 3300028786 | Ga0307517_10116215 | Ga0307517_101162151 | 255 |
| 305 | 3300028794 | Ga0307515_10304581 | Ga0307515_103045812 | 255 |
| 306 | 3300031456 | Ga0307513_10345524 | Ga0307513_103455241 | 255 |
| 307 | 3300031507 | Ga0307509_10347576 | Ga0307509_103475761 | 255 |
| 308 | 3300031712 | Ga0265342_10007293 | Ga0265342_100072934 | 255 |
| 309 | 3300031730 | Ga0307516_10317292 | Ga0307516_103172921 | 255 |
| 310 | 3300031731 | Ga0307405_10136547 | Ga0307405_101365472 | 255 |
| 311 | 3300031901 | Ga0307406_10535555 | Ga0307406_105355551 | 255 |
| 312 | 3300031903 | Ga0307407_10407133 | Ga0307407_104071331 | 255 |
| 313 | 3300031995 | Ga0307409_100151544 | Ga0307409_1001515443 | 255 |
| 314 | 3300032002 | Ga0307416_100054843 | Ga0307416_1000548435 | 255 |
| 315 | 3300032005 | Ga0307411_10119714 | Ga0307411_101197141 | 255 |
| 316 | 3300032126 | Ga0307415_100169177 | Ga0307415_1001691773 | 255 |
| 317 | 3300032126 | Ga0307415_100458004 | Ga0307415_1004580041 | 255 |
| 318 | 3300033180 | Ga0307510_10005901 | Ga0307510_100059015 | 255 |
| 319 | 3300036401 | Ga0373937_0135194 | Ga0373937_0135194_275_1042 | 255 |
| 320 | 3300039447 | Ga0436361_1012338 | Ga0436361_1012338_4454_5230 | 255 |
| 321 | 3300039450 | Ga0436363_1050788 | Ga0436363_1050788_346_1116 | 255 |
| 322 | 3300039453 | Ga0436362_0938097 | Ga0436362_0938097_306_1082 | 255 |
| 323 | 3300041458 | Ga0451798_0501681 | Ga0451798_0501681_596_1366 | 255 |
| 324 | 3300044656 | Ga0466969_0059847 | Ga0466969_0059847_488_1255 | 255 |
| 325 | 3300044684 | Ga0466966_0105951 | Ga0466966_0105951_189_956 | 255 |
| 326 | 3300044706 | Ga0466964_0172850 | Ga0466964_0172850_19_801 | 255 |
| 327 | 3300046455 | Ga0495603_0015087 | Ga0495603_0015087_1701_2471 | 255 |
| 328 | 3300046455 | Ga0495603_0016074 | Ga0495603_0016074_2537_3304 | 255 |
| 329 | 3300046457 | Ga0495590_0024886 | Ga0495590_0024886_1277_2047 | 255 |
| 330 | 3300046471 | Ga0495650_0074366 | Ga0495650_0074366_353_1126 | 255 |
| 331 | 3300046475 | Ga0495639_0042792 | Ga0495639_0042792_1101_1868 | 255 |
| 332 | 3300046499 | Ga0495594_0045208 | Ga0495594_0045208_584_1354 | 255 |
| 333 | 3300046506 | Ga0495583_0106677 | Ga0495583_0106677_248_1018 | 255 |
| 334 | 3300046507 | Ga0495606_0156169 | Ga0495606_0156169_536_1306 | 255 |
| 335 | 3300046512 | Ga0495610_0038842 | Ga0495610_0038842_643_1413 | 255 |
| 336 | 3300046513 | Ga0495616_0084746 | Ga0495616_0084746_343_1116 | 255 |
| 337 | 3300046518 | Ga0495631_0073046 | Ga0495631_0073046_151_921 | 255 |
| 338 | 3300046519 | Ga0495632_0194523 | Ga0495632_0194523_115_885 | 255 |
| 339 | 3300046523 | Ga0495644_0097567 | Ga0495644_0097567_317_1087 | 255 |
| 340 | 3300046524 | Ga0495648_0068090 | Ga0495648_0068090_895_1665 | 255 |
| 341 | 3300046542 | Ga0495597_0111987 | Ga0495597_0111987_49_819 | 255 |
| 342 | 3300046557 | Ga0495622_0088271 | Ga0495622_0088271_301_1071 | 255 |
| 343 | 3300046558 | Ga0495633_0184110 | Ga0495633_0184110_91_864 | 255 |
| 344 | 3300046615 | Ga0495656_0088988 | Ga0495656_0088988_252_1022 | 255 |
| 345 | 3300046648 | Ga0495611_0141212 | Ga0495611_0141212_267_1037 | 255 |
| 346 | 3300046665 | Ga0495661_0176250 | Ga0495661_0176250_328_1098 | 255 |
| 347 | 3300046675 | Ga0495657_0233457 | Ga0495657_0233457_298_1065 | 255 |
| 348 | 3300046691 | Ga0495670_0021246 | Ga0495670_0021246_969_1739 | 255 |
| 349 | 3300046794 | Ga0495589_0054960 | Ga0495589_0054960_715_1485 | 255 |
| 350 | 3300047317 | Ga0495604_0313140 | Ga0495604_0313140_39_806 | 255 |
| 351 | 3300047318 | Ga0495636_0036181 | Ga0495636_0036181_1116_1886 | 255 |
| 352 | 3300047323 | Ga0495683_0124101 | Ga0495683_0124101_60_830 | 255 |
| 353 | 3300047469 | Ga0495673_0077420 | Ga0495673_0077420_201_971 | 255 |
| 354 | 3300047472 | Ga0495686_0043114 | Ga0495686_0043114_845_1618 | 255 |
| 355 | 3300047472 | Ga0495686_0092777 | Ga0495686_0092777_324_1094 | 255 |
| 356 | 3300048908 | Ga0496105_0390837 | Ga0496105_0390837_183_956 | 255 |
| 357 | 3300048911 | Ga0496108_0119426 | Ga0496108_0119426_692_1462 | 255 |
| 358 | 3300048912 | Ga0496109_0091458 | Ga0496109_0091458_655_1425 | 255 |
| 359 | 3300048912 | Ga0496109_0410057 | Ga0496109_0410057_212_985 | 255 |
| 360 | 3300048915 | Ga0496112_0153212 | Ga0496112_0153212_1313_2083 | 255 |
| 361 | 3300048924 | Ga0496121_0077052 | Ga0496121_0077052_1484_2254 | 255 |
| 362 | 3300048924 | Ga0496121_0171025 | Ga0496121_0171025_216_986 | 255 |
| 363 | 3300048924 | Ga0496121_0368773 | Ga0496121_0368773_129_905 | 255 |
| 364 | 3300048924 | Ga0496121_0416496 | Ga0496121_0416496_13_783 | 255 |
| 365 | 3300048925 | Ga0496122_0276291 | Ga0496122_0276291_19_795 | 255 |
| 366 | 3300048927 | Ga0496124_0056109 | Ga0496124_0056109_1213_1983 | 255 |
| 367 | 3300048927 | Ga0496124_0289595 | Ga0496124_0289595_171_941 | 255 |
| 368 | 3300048927 | Ga0496124_0498712 | Ga0496124_0498712_32_802 | 255 |
| 369 | 3300048929 | Ga0496126_0008548 | Ga0496126_0008548_2014_2784 | 255 |
| 370 | 3300048929 | Ga0496126_0090707 | Ga0496126_0090707_914_1684 | 255 |
| 371 | 3300049568 | Ga0501031_0000428 | Ga0501031_0000428_23370_24143 | 255 |
| 372 | 3300049569 | Ga0501032_0001029 | Ga0501032_0001029_13622_14395 | 255 |
| 373 | 3300049570 | Ga0501033_0000163 | Ga0501033_0000163_58167_58940 | 255 |
| 374 | 3300049571 | Ga0501034_0000202 | Ga0501034_0000202_36320_37093 | 255 |
| 375 | 3300049572 | Ga0501036_0000042 | Ga0501036_0000042_3236_4009 | 255 |
| 376 | 3300049573 | Ga0501037_0000100 | Ga0501037_0000100_72_845 | 255 |
| 377 | 3300049574 | Ga0501038_0000226 | Ga0501038_0000226_32681_33454 | 255 |
| 378 | 3300049575 | Ga0501039_0003287 | Ga0501039_0003287_11183_11956 | 255 |
| 379 | 3300049579 | Ga0501043_0001024 | Ga0501043_0001024_447_1220 | 255 |
| 380 | 3300049580 | Ga0501046_0000619 | Ga0501046_0000619_31994_32767 | 255 |
| 381 | 3300049581 | Ga0501047_0000159 | Ga0501047_0000159_77819_78592 | 255 |
| 382 | 3300049582 | Ga0501048_0000050 | Ga0501048_0000050_37034_37807 | 255 |
| 383 | 3300049583 | Ga0501067_0005945 | Ga0501067_0005945_1660_2433 | 255 |
| 384 | 3300049584 | Ga0501068_0000430 | Ga0501068_0000430_15608_16381 | 255 |
| 385 | 3300049586 | Ga0501070_0053110 | Ga0501070_0053110_667_1440 | 255 |
| 386 | 3300049586 | Ga0501070_0177345 | Ga0501070_0177345_18_791 | 255 |
| 387 | 3300049589 | Ga0501073_0000329 | Ga0501073_0000329_6069_6842 | 255 |
| 388 | 3300049590 | Ga0501074_0000414 | Ga0501074_0000414_21658_22431 | 255 |
| 389 | 3300049741 | Ga0501079_0003664 | Ga0501079_0003664_145_918 | 255 |
| 390 | 3300049742 | Ga0501080_0000403 | Ga0501080_0000403_24466_25239 | 255 |
| 391 | 3300049744 | Ga0501083_0006265 | Ga0501083_0006265_783_1556 | 255 |
| 392 | 3300049822 | Ga0501035_0000120 | Ga0501035_0000120_32807_33580 | 255 |
| 393 | 3300049822 | Ga0501035_0232759 | Ga0501035_0232759_601_1374 | 255 |
| 394 | 3300049823 | Ga0501044_0001777 | Ga0501044_0001777_15608_16381 | 255 |
| 395 | 3300049824 | Ga0501045_0003832 | Ga0501045_0003832_3434_4207 | 255 |
| 396 | 3300050492 | nmdc:mga0yw44_42619_c1 | nmdc:mga0yw44_42619_c1_589_1359 | 255 |
| 397 | 3300050493 | nmdc:mga0k408_326403_c1 | nmdc:mga0k408_326403_c1_108_878 | 255 |
| 398 | 3300050494 | nmdc:mga06z11_136998_c1 | nmdc:mga06z11_136998_c1_388_1158 | 255 |
| 399 | 3300050496 | nmdc:mga07m45_132698_c1 | nmdc:mga07m45_132698_c1_643_1413 | 255 |
| 400 | 3300050496 | nmdc:mga07m45_17418_c1 | nmdc:mga07m45_17418_c1_2781_3551 | 255 |
| 401 | 3300050496 | nmdc:mga07m45_53645_c1 | nmdc:mga07m45_53645_c1_1103_1873 | 255 |
| 402 | 3300050513 | nmdc:mga0rr50_373004_c1 | nmdc:mga0rr50_373004_c1_168_938 | 255 |
| 403 | 3300050515 | nmdc:mga0a205_112801_c1 | nmdc:mga0a205_112801_c1_1804_2574 | 255 |
| 404 | 3300053093 | Ga0500651_0236169 | Ga0500651_0236169_132_902 | 255 |
| 405 | 3300053096 | Ga0500641_0016700 | Ga0500641_0016700_29_799 | 255 |
| 406 | 3300053108 | Ga0500562_003130 | Ga0500562_003130_2315_3085 | 255 |
| 407 | 3300053119 | Ga0500595_001435 | Ga0500595_001435_3528_4298 | 255 |
| 408 | 3300053147 | Ga0500589_094864 | Ga0500589_094864_272_1042 | 255 |
| 409 | 3300053147 | Ga0500589_134231 | Ga0500589_134231_166_936 | 255 |
| 410 | 3300053150 | Ga0500603_068748 | Ga0500603_068748_181_948 | 255 |
| 411 | 3300053151 | Ga0500604_0127133 | Ga0500604_0127133_30_800 | 255 |
| 412 | 3300053158 | Ga0500627_0163336 | Ga0500627_0163336_222_992 | 255 |
| 413 | 3300053732 | Ga0500656_008164 | Ga0500656_008164_299_1069 | 255 |
| 414 | 3300054114 | Ga0501084_0007843 | Ga0501084_0007843_1703_2476 | 255 |
| 415 | 3300000549 | LJQas_1006317 | LJQas_10063172 | 256 |
| 416 | 3300003215 | JGI25153J46596_10003412 | JGI25153J46596_100034122 | 256 |
| 417 | 3300003323 | rootH1_10044347 | rootH1_100443472 | 256 |
| 418 | 3300003659 | JGI25404J52841_10037718 | JGI25404J52841_100377181 | 256 |
| 419 | 3300005327 | Ga0070658_10019292 | Ga0070658_100192923 | 256 |
| 420 | 3300005327 | Ga0070658_10271726 | Ga0070658_102717262 | 256 |
| 421 | 3300005329 | Ga0070683_100003303 | Ga0070683_10000330310 | 256 |
| 422 | 3300005329 | Ga0070683_100040395 | Ga0070683_1000403954 | 256 |
| 423 | 3300005329 | Ga0070683_100049222 | Ga0070683_1000492222 | 256 |
| 424 | 3300005331 | Ga0070670_100184301 | Ga0070670_1001843013 | 256 |
| 425 | 3300005336 | Ga0070680_100030563 | Ga0070680_1000305634 | 256 |
| 426 | 3300005336 | Ga0070680_100261526 | Ga0070680_1002615261 | 256 |
| 427 | 3300005339 | Ga0070660_100001126 | Ga0070660_10000112613 | 256 |
| 428 | 3300005339 | Ga0070660_100047104 | Ga0070660_1000471044 | 256 |
| 429 | 3300005344 | Ga0070661_100013721 | Ga0070661_1000137214 | 256 |
| 430 | 3300005347 | Ga0070668_100108941 | Ga0070668_1001089413 | 256 |
| 431 | 3300005347 | Ga0070668_100118734 | Ga0070668_1001187342 | 256 |
| 432 | 3300005355 | Ga0070671_100034539 | Ga0070671_1000345392 | 256 |
| 433 | 3300005356 | Ga0070674_100050181 | Ga0070674_1000501813 | 256 |
| 434 | 3300005366 | Ga0070659_100010953 | Ga0070659_1000109534 | 256 |
| 435 | 3300005366 | Ga0070659_100542944 | Ga0070659_1005429441 | 256 |
| 436 | 3300005434 | Ga0070709_10277985 | Ga0070709_102779851 | 256 |
| 437 | 3300005435 | Ga0070714_100022705 | Ga0070714_1000227055 | 256 |
| 438 | 3300005435 | Ga0070714_100026305 | Ga0070714_1000263055 | 256 |
| 439 | 3300005435 | Ga0070714_100633225 | Ga0070714_1006332251 | 256 |
| 440 | 3300005436 | Ga0070713_100024693 | Ga0070713_1000246935 | 256 |
| 441 | 3300005436 | Ga0070713_100027055 | Ga0070713_1000270556 | 256 |
| 442 | 3300005436 | Ga0070713_100062854 | Ga0070713_1000628543 | 256 |
| 443 | 3300005436 | Ga0070713_100464401 | Ga0070713_1004644011 | 256 |
| 444 | 3300005437 | Ga0070710_10000869 | Ga0070710_100008691 | 256 |
| 445 | 3300005437 | Ga0070710_10481898 | Ga0070710_104818981 | 256 |
| 446 | 3300005438 | Ga0070701_10175276 | Ga0070701_101752762 | 256 |
| 447 | 3300005439 | Ga0070711_100001638 | Ga0070711_1000016381 | 256 |
| 448 | 3300005439 | Ga0070711_100013567 | Ga0070711_1000135672 | 256 |
| 449 | 3300005439 | Ga0070711_100233615 | Ga0070711_1002336152 | 256 |
| 450 | 3300005439 | Ga0070711_100509365 | Ga0070711_1005093651 | 256 |
| 451 | 3300005455 | Ga0070663_100024391 | Ga0070663_1000243913 | 256 |
| 452 | 3300005455 | Ga0070663_100030275 | Ga0070663_1000302752 | 256 |
| 453 | 3300005455 | Ga0070663_100078737 | Ga0070663_1000787371 | 256 |
| 454 | 3300005456 | Ga0070678_100066749 | Ga0070678_1000667492 | 256 |
| 455 | 3300005456 | Ga0070678_100098709 | Ga0070678_1000987092 | 256 |
| 456 | 3300005458 | Ga0070681_10019518 | Ga0070681_100195185 | 256 |
| 457 | 3300005458 | Ga0070681_10058646 | Ga0070681_100586462 | 256 |
| 458 | 3300005458 | Ga0070681_10273678 | Ga0070681_102736781 | 256 |
| 459 | 3300005459 | Ga0068867_100008066 | Ga0068867_1000080665 | 256 |
| 460 | 3300005471 | Ga0070698_100077919 | Ga0070698_1000779193 | 256 |
| 461 | 3300005530 | Ga0070679_100013683 | Ga0070679_1000136832 | 256 |
| 462 | 3300005530 | Ga0070679_100030393 | Ga0070679_1000303931 | 256 |
| 463 | 3300005530 | Ga0070679_100092886 | Ga0070679_1000928861 | 256 |
| 464 | 3300005530 | Ga0070679_100197687 | Ga0070679_1001976872 | 256 |
| 465 | 3300005535 | Ga0070684_100030375 | Ga0070684_1000303755 | 256 |
| 466 | 3300005535 | Ga0070684_100096932 | Ga0070684_1000969321 | 256 |
| 467 | 3300005535 | Ga0070684_100115400 | Ga0070684_1001154002 | 256 |
| 468 | 3300005535 | Ga0070684_100246669 | Ga0070684_1002466692 | 256 |
| 469 | 3300005535 | Ga0070684_100807973 | Ga0070684_1008079731 | 256 |
| 470 | 3300005536 | Ga0070697_100040365 | Ga0070697_1000403653 | 256 |
| 471 | 3300005539 | Ga0068853_100002631 | Ga0068853_1000026317 | 256 |
| 472 | 3300005539 | Ga0068853_100034375 | Ga0068853_1000343755 | 256 |
| 473 | 3300005539 | Ga0068853_100247085 | Ga0068853_1002470852 | 256 |
| 474 | 3300005543 | Ga0070672_100230303 | Ga0070672_1002303032 | 256 |
| 475 | 3300005544 | Ga0070686_100090732 | Ga0070686_1000907322 | 256 |
| 476 | 3300005546 | Ga0070696_100272168 | Ga0070696_1002721682 | 256 |
| 477 | 3300005548 | Ga0070665_100054477 | Ga0070665_1000544774 | 256 |
| 478 | 3300005548 | Ga0070665_100063343 | Ga0070665_1000633432 | 256 |
| 479 | 3300005548 | Ga0070665_100103479 | Ga0070665_1001034793 | 256 |
| 480 | 3300005548 | Ga0070665_100155974 | Ga0070665_1001559743 | 256 |
| 481 | 3300005563 | Ga0068855_100009152 | Ga0068855_10000915211 | 256 |
| 482 | 3300005563 | Ga0068855_100107428 | Ga0068855_1001074281 | 256 |
| 483 | 3300005563 | Ga0068855_100108093 | Ga0068855_1001080935 | 256 |
| 484 | 3300005563 | Ga0068855_100233987 | Ga0068855_1002339872 | 256 |
| 485 | 3300005563 | Ga0068855_100350593 | Ga0068855_1003505932 | 256 |
| 486 | 3300005563 | Ga0068855_100477272 | Ga0068855_1004772721 | 256 |
| 487 | 3300005564 | Ga0070664_100173417 | Ga0070664_1001734173 | 256 |
| 488 | 3300005577 | Ga0068857_100111646 | Ga0068857_1001116462 | 256 |
| 489 | 3300005577 | Ga0068857_100449801 | Ga0068857_1004498011 | 256 |
| 490 | 3300005578 | Ga0068854_100135231 | Ga0068854_1001352312 | 256 |
| 491 | 3300005578 | Ga0068854_100404860 | Ga0068854_1004048602 | 256 |
| 492 | 3300005578 | Ga0068854_100470440 | Ga0068854_1004704401 | 256 |
| 493 | 3300005614 | Ga0068856_100000505 | Ga0068856_1000005058 | 256 |
| 494 | 3300005614 | Ga0068856_100343639 | Ga0068856_1003436392 | 256 |
| 495 | 3300005615 | Ga0070702_100182398 | Ga0070702_1001823982 | 256 |
| 496 | 3300005615 | Ga0070702_100348618 | Ga0070702_1003486181 | 256 |
| 497 | 3300005616 | Ga0068852_100057367 | Ga0068852_1000573672 | 256 |
| 498 | 3300005616 | Ga0068852_100081648 | Ga0068852_1000816482 | 256 |
| 499 | 3300005617 | Ga0068859_100169985 | Ga0068859_1001699851 | 256 |
| 500 | 3300005618 | Ga0068864_100023598 | Ga0068864_1000235983 | 256 |
| 501 | 3300005718 | Ga0068866_10017775 | Ga0068866_100177753 | 256 |
| 502 | 3300005719 | Ga0068861_100135350 | Ga0068861_1001353502 | 256 |
| 503 | 3300005719 | Ga0068861_100210584 | Ga0068861_1002105842 | 256 |
| 504 | 3300005834 | Ga0068851_10011174 | Ga0068851_100111744 | 256 |
| 505 | 3300005834 | Ga0068851_10193561 | Ga0068851_101935611 | 256 |
| 506 | 3300005840 | Ga0068870_10141997 | Ga0068870_101419972 | 256 |
| 507 | 3300005841 | Ga0068863_100238926 | Ga0068863_1002389262 | 256 |
| 508 | 3300005843 | Ga0068860_100001118 | Ga0068860_10000111826 | 256 |
| 509 | 3300005843 | Ga0068860_100149647 | Ga0068860_1001496472 | 256 |
| 510 | 3300005844 | Ga0068862_100798318 | Ga0068862_1007983181 | 256 |
| 511 | 3300005937 | Ga0081455_10026711 | Ga0081455_100267112 | 256 |
| 512 | 3300005937 | Ga0081455_10054044 | Ga0081455_100540441 | 256 |
| 513 | 3300005937 | Ga0081455_10067184 | Ga0081455_100671841 | 256 |
| 514 | 3300005937 | Ga0081455_10085022 | Ga0081455_100850222 | 256 |
| 515 | 3300005937 | Ga0081455_10330485 | Ga0081455_103304852 | 256 |
| 516 | 3300005983 | Ga0081540_1003833 | Ga0081540_10038332 | 256 |
| 517 | 3300005983 | Ga0081540_1014162 | Ga0081540_10141627 | 256 |
| 518 | 3300005983 | Ga0081540_1053246 | Ga0081540_10532462 | 256 |
| 519 | 3300005983 | Ga0081540_1097116 | Ga0081540_10971161 | 256 |
| 520 | 3300005983 | Ga0081540_1121082 | Ga0081540_11210821 | 256 |
| 521 | 3300005983 | Ga0081540_1128391 | Ga0081540_11283911 | 256 |
| 522 | 3300005985 | Ga0081539_10000003 | Ga0081539_10000003389 | 256 |
| 523 | 3300005985 | Ga0081539_10000199 | Ga0081539_1000019978 | 256 |
| 524 | 3300005985 | Ga0081539_10011226 | Ga0081539_100112266 | 256 |
| 525 | 3300005985 | Ga0081539_10091375 | Ga0081539_100913752 | 256 |
| 526 | 3300006028 | Ga0070717_10000877 | Ga0070717_100008777 | 256 |
| 527 | 3300006028 | Ga0070717_10052422 | Ga0070717_100524222 | 256 |
| 528 | 3300006028 | Ga0070717_10259682 | Ga0070717_102596822 | 256 |
| 529 | 3300006028 | Ga0070717_10276491 | Ga0070717_102764912 | 256 |
| 530 | 3300006038 | Ga0075365_10074211 | Ga0075365_100742112 | 256 |
| 531 | 3300006038 | Ga0075365_10135542 | Ga0075365_101355422 | 256 |
| 532 | 3300006038 | Ga0075365_10254275 | Ga0075365_102542752 | 256 |
| 533 | 3300006048 | Ga0075363_100000869 | Ga0075363_10000086911 | 256 |
| 534 | 3300006048 | Ga0075363_100205554 | Ga0075363_1002055542 | 256 |
| 535 | 3300006051 | Ga0075364_10041151 | Ga0075364_100411513 | 256 |
| 536 | 3300006051 | Ga0075364_10289562 | Ga0075364_102895622 | 256 |
| 537 | 3300006173 | Ga0070716_100533039 | Ga0070716_1005330391 | 256 |
| 538 | 3300006175 | Ga0070712_100031048 | Ga0070712_1000310483 | 256 |
| 539 | 3300006175 | Ga0070712_100043775 | Ga0070712_1000437752 | 256 |
| 540 | 3300006175 | Ga0070712_100072270 | Ga0070712_1000722701 | 256 |
| 541 | 3300006175 | Ga0070712_100432392 | Ga0070712_1004323921 | 256 |
| 542 | 3300006177 | Ga0075362_10049030 | Ga0075362_100490302 | 256 |
| 543 | 3300006186 | Ga0075369_10037853 | Ga0075369_100378531 | 256 |
| 544 | 3300006195 | Ga0075366_10158205 | Ga0075366_101582052 | 256 |
| 545 | 3300006237 | Ga0097621_100158115 | Ga0097621_1001581152 | 256 |
| 546 | 3300006237 | Ga0097621_100207232 | Ga0097621_1002072322 | 256 |
| 547 | 3300006358 | Ga0068871_100177603 | Ga0068871_1001776032 | 256 |
| 548 | 3300006844 | Ga0075428_100109348 | Ga0075428_1001093481 | 256 |
| 549 | 3300006844 | Ga0075428_100222393 | Ga0075428_1002223932 | 256 |
| 550 | 3300006871 | Ga0075434_100051816 | Ga0075434_1000518163 | 256 |
| 551 | 3300006931 | Ga0097620_100169978 | Ga0097620_1001699781 | 256 |
| 552 | 3300007265 | Ga0099794_10007546 | Ga0099794_100075462 | 256 |
| 553 | 3300007265 | Ga0099794_10056404 | Ga0099794_100564042 | 256 |
| 554 | 3300007788 | Ga0099795_10022059 | Ga0099795_100220592 | 256 |
| 555 | 3300007788 | Ga0099795_10062412 | Ga0099795_100624122 | 256 |
| 556 | 3300009093 | Ga0105240_10027790 | Ga0105240_100277907 | 256 |
| 557 | 3300009093 | Ga0105240_10190656 | Ga0105240_101906563 | 256 |
| 558 | 3300009093 | Ga0105240_10371331 | Ga0105240_103713312 | 256 |
| 559 | 3300009098 | Ga0105245_10074181 | Ga0105245_100741813 | 256 |
| 560 | 3300009098 | Ga0105245_10256732 | Ga0105245_102567322 | 256 |
| 561 | 3300009098 | Ga0105245_10392154 | Ga0105245_103921541 | 256 |
| 562 | 3300009098 | Ga0105245_11014968 | Ga0105245_110149681 | 256 |
| 563 | 3300009101 | Ga0105247_10221319 | Ga0105247_102213191 | 256 |
| 564 | 3300009101 | Ga0105247_10307748 | Ga0105247_103077481 | 256 |
| 565 | 3300009147 | Ga0114129_10029983 | Ga0114129_100299837 | 256 |
| 566 | 3300009148 | Ga0105243_10013895 | Ga0105243_100138955 | 256 |
| 567 | 3300009176 | Ga0105242_10046792 | Ga0105242_100467921 | 256 |
| 568 | 3300009177 | Ga0105248_10104039 | Ga0105248_101040394 | 256 |
| 569 | 3300009177 | Ga0105248_10232662 | Ga0105248_102326622 | 256 |
| 570 | 3300009545 | Ga0105237_10068507 | Ga0105237_100685075 | 256 |
| 571 | 3300009545 | Ga0105237_10111604 | Ga0105237_101116042 | 256 |
| 572 | 3300009545 | Ga0105237_10359508 | Ga0105237_103595082 | 256 |
| 573 | 3300009545 | Ga0105237_10370604 | Ga0105237_103706042 | 256 |
| 574 | 3300009545 | Ga0105237_10540123 | Ga0105237_105401232 | 256 |
| 575 | 3300009551 | Ga0105238_10003122 | Ga0105238_100031227 | 256 |
| 576 | 3300009551 | Ga0105238_10052584 | Ga0105238_100525843 | 256 |
| 577 | 3300009551 | Ga0105238_10387041 | Ga0105238_103870412 | 256 |
| 578 | 3300009551 | Ga0105238_10494024 | Ga0105238_104940242 | 256 |
| 579 | 3300009553 | Ga0105249_10133967 | Ga0105249_101339672 | 256 |
| 580 | 3300009553 | Ga0105249_10198083 | Ga0105249_101980833 | 256 |
| 581 | 3300010159 | Ga0099796_10012565 | Ga0099796_100125653 | 256 |
| 582 | 3300010375 | Ga0105239_10154485 | Ga0105239_101544852 | 256 |
| 583 | 3300010375 | Ga0105239_10203170 | Ga0105239_102031703 | 256 |
| 584 | 3300010375 | Ga0105239_10688720 | Ga0105239_106887201 | 256 |
| 585 | 3300013100 | Ga0157373_10078661 | Ga0157373_100786612 | 256 |
| 586 | 3300013104 | Ga0157370_10085199 | Ga0157370_100851993 | 256 |
| 587 | 3300013105 | Ga0157369_10013290 | Ga0157369_100132909 | 256 |
| 588 | 3300013105 | Ga0157369_10042781 | Ga0157369_100427815 | 256 |
| 589 | 3300013105 | Ga0157369_10045117 | Ga0157369_100451172 | 256 |
| 590 | 3300013105 | Ga0157369_10249624 | Ga0157369_102496242 | 256 |
| 591 | 3300013296 | Ga0157374_10071052 | Ga0157374_100710522 | 256 |
| 592 | 3300013296 | Ga0157374_10094370 | Ga0157374_100943702 | 256 |
| 593 | 3300013306 | Ga0163162_10013124 | Ga0163162_100131242 | 256 |
| 594 | 3300013306 | Ga0163162_10062945 | Ga0163162_100629453 | 256 |
| 595 | 3300013306 | Ga0163162_10308505 | Ga0163162_103085052 | 256 |
| 596 | 3300013307 | Ga0157372_10045190 | Ga0157372_100451903 | 256 |
| 597 | 3300013308 | Ga0157375_10004177 | Ga0157375_100041773 | 256 |
| 598 | 3300014325 | Ga0163163_10094162 | Ga0163163_100941624 | 256 |
| 599 | 3300014325 | Ga0163163_10115161 | Ga0163163_101151611 | 256 |
| 600 | 3300014325 | Ga0163163_10277211 | Ga0163163_102772111 | 256 |
| 601 | 3300014325 | Ga0163163_10600751 | Ga0163163_106007512 | 256 |
| 602 | 3300014326 | Ga0157380_10506138 | Ga0157380_105061382 | 256 |
| 603 | 3300014968 | Ga0157379_10120583 | Ga0157379_101205832 | 256 |
| 604 | 3300017792 | Ga0163161_10066771 | Ga0163161_100667712 | 256 |
| 605 | 3300020069 | Ga0197907_10522121 | Ga0197907_105221213 | 256 |
| 606 | 3300020070 | Ga0206356_11303995 | Ga0206356_113039951 | 256 |
| 607 | 3300020070 | Ga0206356_11334192 | Ga0206356_113341922 | 256 |
| 608 | 3300020080 | Ga0206350_10556797 | Ga0206350_105567971 | 256 |
| 609 | 3300020082 | Ga0206353_10940261 | Ga0206353_109402612 | 256 |
| 610 | 3300021377 | Ga0213874_10031886 | Ga0213874_100318862 | 256 |
| 611 | 3300021384 | Ga0213876_10010932 | Ga0213876_100109322 | 256 |
| 612 | 3300021384 | Ga0213876_10085289 | Ga0213876_100852891 | 256 |
| 613 | 3300021384 | Ga0213876_10190284 | Ga0213876_101902841 | 256 |
| 614 | 3300021388 | Ga0213875_10155114 | Ga0213875_101551141 | 256 |
| 615 | 3300025253 | Ga0209677_100241 | Ga0209677_1002417 | 256 |
| 616 | 3300025254 | Ga0209148_1004574 | Ga0209148_10045743 | 256 |
| 617 | 3300025261 | Ga0209233_1004313 | Ga0209233_10043135 | 256 |
| 618 | 3300025272 | Ga0209455_1001933 | Ga0209455_10019337 | 256 |
| 619 | 3300025297 | Ga0209758_1002070 | Ga0209758_100207016 | 256 |
| 620 | 3300025321 | Ga0207656_10002763 | Ga0207656_100027634 | 256 |
| 621 | 3300025893 | Ga0207682_10075127 | Ga0207682_100751271 | 256 |
| 622 | 3300025898 | Ga0207692_10001993 | Ga0207692_100019934 | 256 |
| 623 | 3300025899 | Ga0207642_10020500 | Ga0207642_100205002 | 256 |
| 624 | 3300025900 | Ga0207710_10117487 | Ga0207710_101174872 | 256 |
| 625 | 3300025904 | Ga0207647_10054116 | Ga0207647_100541163 | 256 |
| 626 | 3300025906 | Ga0207699_10000253 | Ga0207699_1000025310 | 256 |
| 627 | 3300025906 | Ga0207699_10015823 | Ga0207699_100158233 | 256 |
| 628 | 3300025906 | Ga0207699_10111963 | Ga0207699_101119632 | 256 |
| 629 | 3300025906 | Ga0207699_10205930 | Ga0207699_102059302 | 256 |
| 630 | 3300025909 | Ga0207705_10032892 | Ga0207705_100328922 | 256 |
| 631 | 3300025909 | Ga0207705_10064461 | Ga0207705_100644612 | 256 |
| 632 | 3300025909 | Ga0207705_10154377 | Ga0207705_101543771 | 256 |
| 633 | 3300025912 | Ga0207707_10001093 | Ga0207707_100010939 | 256 |
| 634 | 3300025912 | Ga0207707_10006358 | Ga0207707_100063588 | 256 |
| 635 | 3300025912 | Ga0207707_10049372 | Ga0207707_100493721 | 256 |
| 636 | 3300025912 | Ga0207707_10054162 | Ga0207707_100541625 | 256 |
| 637 | 3300025912 | Ga0207707_10091475 | Ga0207707_100914751 | 256 |
| 638 | 3300025912 | Ga0207707_10187798 | Ga0207707_101877981 | 256 |
| 639 | 3300025912 | Ga0207707_10479515 | Ga0207707_104795152 | 256 |
| 640 | 3300025913 | Ga0207695_10022532 | Ga0207695_100225322 | 256 |
| 641 | 3300025913 | Ga0207695_10089735 | Ga0207695_100897352 | 256 |
| 642 | 3300025913 | Ga0207695_10438549 | Ga0207695_104385491 | 256 |
| 643 | 3300025914 | Ga0207671_10015168 | Ga0207671_100151685 | 256 |
| 644 | 3300025914 | Ga0207671_10029468 | Ga0207671_100294681 | 256 |
| 645 | 3300025914 | Ga0207671_10247068 | Ga0207671_102470682 | 256 |
| 646 | 3300025914 | Ga0207671_10248510 | Ga0207671_102485102 | 256 |
| 647 | 3300025914 | Ga0207671_10270796 | Ga0207671_102707962 | 256 |
| 648 | 3300025915 | Ga0207693_10024218 | Ga0207693_100242185 | 256 |
| 649 | 3300025915 | Ga0207693_10036490 | Ga0207693_100364902 | 256 |
| 650 | 3300025915 | Ga0207693_10069864 | Ga0207693_100698641 | 256 |
| 651 | 3300025916 | Ga0207663_10046871 | Ga0207663_100468712 | 256 |
| 652 | 3300025917 | Ga0207660_10026628 | Ga0207660_100266282 | 256 |
| 653 | 3300025917 | Ga0207660_10127810 | Ga0207660_101278102 | 256 |
| 654 | 3300025917 | Ga0207660_10292197 | Ga0207660_102921972 | 256 |
| 655 | 3300025919 | Ga0207657_10002321 | Ga0207657_1000232111 | 256 |
| 656 | 3300025919 | Ga0207657_10036408 | Ga0207657_100364084 | 256 |
| 657 | 3300025919 | Ga0207657_10120589 | Ga0207657_101205892 | 256 |
| 658 | 3300025920 | Ga0207649_10019853 | Ga0207649_100198533 | 256 |
| 659 | 3300025920 | Ga0207649_10552560 | Ga0207649_105525601 | 256 |
| 660 | 3300025921 | Ga0207652_10002982 | Ga0207652_1000298211 | 256 |
| 661 | 3300025921 | Ga0207652_10014050 | Ga0207652_100140506 | 256 |
| 662 | 3300025921 | Ga0207652_10041013 | Ga0207652_100410132 | 256 |
| 663 | 3300025921 | Ga0207652_10091653 | Ga0207652_100916533 | 256 |
| 664 | 3300025921 | Ga0207652_10161430 | Ga0207652_101614302 | 256 |
| 665 | 3300025921 | Ga0207652_10273737 | Ga0207652_102737372 | 256 |
| 666 | 3300025924 | Ga0207694_10005198 | Ga0207694_100051983 | 256 |
| 667 | 3300025927 | Ga0207687_10319657 | Ga0207687_103196572 | 256 |
| 668 | 3300025928 | Ga0207700_10013470 | Ga0207700_100134705 | 256 |
| 669 | 3300025928 | Ga0207700_10021957 | Ga0207700_100219576 | 256 |
| 670 | 3300025928 | Ga0207700_10040335 | Ga0207700_100403354 | 256 |
| 671 | 3300025928 | Ga0207700_10063044 | Ga0207700_100630443 | 256 |
| 672 | 3300025929 | Ga0207664_10187324 | Ga0207664_101873241 | 256 |
| 673 | 3300025929 | Ga0207664_10721955 | Ga0207664_107219551 | 256 |
| 674 | 3300025932 | Ga0207690_10015539 | Ga0207690_100155393 | 256 |
| 675 | 3300025932 | Ga0207690_10243760 | Ga0207690_102437602 | 256 |
| 676 | 3300025933 | Ga0207706_10453133 | Ga0207706_104531331 | 256 |
| 677 | 3300025935 | Ga0207709_10049331 | Ga0207709_100493312 | 256 |
| 678 | 3300025938 | Ga0207704_10014465 | Ga0207704_100144655 | 256 |
| 679 | 3300025938 | Ga0207704_10201888 | Ga0207704_102018881 | 256 |
| 680 | 3300025939 | Ga0207665_10092061 | Ga0207665_100920613 | 256 |
| 681 | 3300025941 | Ga0207711_10192920 | Ga0207711_101929201 | 256 |
| 682 | 3300025944 | Ga0207661_10002972 | Ga0207661_1000297210 | 256 |
| 683 | 3300025944 | Ga0207661_10018500 | Ga0207661_100185004 | 256 |
| 684 | 3300025949 | Ga0207667_10007460 | Ga0207667_100074604 | 256 |
| 685 | 3300025949 | Ga0207667_10098220 | Ga0207667_100982203 | 256 |
| 686 | 3300025949 | Ga0207667_10562118 | Ga0207667_105621182 | 256 |
| 687 | 3300025961 | Ga0207712_10621311 | Ga0207712_106213111 | 256 |
| 688 | 3300025972 | Ga0207668_10139272 | Ga0207668_101392722 | 256 |
| 689 | 3300025981 | Ga0207640_10071327 | Ga0207640_100713272 | 256 |
| 690 | 3300025981 | Ga0207640_10519393 | Ga0207640_105193931 | 256 |
| 691 | 3300026035 | Ga0207703_10669911 | Ga0207703_106699111 | 256 |
| 692 | 3300026041 | Ga0207639_10031045 | Ga0207639_100310453 | 256 |
| 693 | 3300026041 | Ga0207639_10081468 | Ga0207639_100814681 | 256 |
| 694 | 3300026067 | Ga0207678_10006176 | Ga0207678_100061762 | 256 |
| 695 | 3300026067 | Ga0207678_10044946 | Ga0207678_100449463 | 256 |
| 696 | 3300026067 | Ga0207678_10067235 | Ga0207678_100672351 | 256 |
| 697 | 3300026067 | Ga0207678_10076408 | Ga0207678_100764081 | 256 |
| 698 | 3300026067 | Ga0207678_10491946 | Ga0207678_104919461 | 256 |
| 699 | 3300026075 | Ga0207708_10153445 | Ga0207708_101534452 | 256 |
| 700 | 3300026078 | Ga0207702_10000127 | Ga0207702_1000012760 | 256 |
| 701 | 3300026078 | Ga0207702_10112912 | Ga0207702_101129121 | 256 |
| 702 | 3300026088 | Ga0207641_10320313 | Ga0207641_103203132 | 256 |
| 703 | 3300026089 | Ga0207648_10035881 | Ga0207648_100358814 | 256 |
| 704 | 3300026095 | Ga0207676_10242911 | Ga0207676_102429112 | 256 |
| 705 | 3300026095 | Ga0207676_10342551 | Ga0207676_103425511 | 256 |
| 706 | 3300026116 | Ga0207674_10020772 | Ga0207674_100207724 | 256 |
| 707 | 3300026116 | Ga0207674_10271668 | Ga0207674_102716681 | 256 |
| 708 | 3300026116 | Ga0207674_10476658 | Ga0207674_104766581 | 256 |
| 709 | 3300026121 | Ga0207683_10013367 | Ga0207683_100133674 | 256 |
| 710 | 3300026121 | Ga0207683_10096117 | Ga0207683_100961173 | 256 |
| 711 | 3300026121 | Ga0207683_10097310 | Ga0207683_100973102 | 256 |
| 712 | 3300026121 | Ga0207683_10177126 | Ga0207683_101771261 | 256 |
| 713 | 3300026142 | Ga0207698_10181890 | Ga0207698_101818901 | 256 |
| 714 | 3300026142 | Ga0207698_10648973 | Ga0207698_106489731 | 256 |
| 715 | 3300027671 | Ga0209588_1024398 | Ga0209588_10243982 | 256 |
| 716 | 3300028379 | Ga0268266_10175416 | Ga0268266_101754162 | 256 |
| 717 | 3300028379 | Ga0268266_10370150 | Ga0268266_103701501 | 256 |
| 718 | 3300028379 | Ga0268266_10496218 | Ga0268266_104962181 | 256 |
| 719 | 3300028380 | Ga0268265_10585604 | Ga0268265_105856042 | 256 |
| 720 | 3300028381 | Ga0268264_10000030 | Ga0268264_1000003091 | 256 |
| 721 | 3300028381 | Ga0268264_10400277 | Ga0268264_104002772 | 256 |
| 722 | 3300028786 | Ga0307517_10000744 | Ga0307517_1000074421 | 256 |
| 723 | 3300028794 | Ga0307515_10084138 | Ga0307515_100841383 | 256 |
| 724 | 3300028800 | Ga0265338_10044048 | Ga0265338_100440483 | 256 |
| 725 | 3300031235 | Ga0265330_10009899 | Ga0265330_100098994 | 256 |
| 726 | 3300031238 | Ga0265332_10006066 | Ga0265332_100060663 | 256 |
| 727 | 3300031239 | Ga0265328_10012115 | Ga0265328_100121154 | 256 |
| 728 | 3300031241 | Ga0265325_10048757 | Ga0265325_100487571 | 256 |
| 729 | 3300031241 | Ga0265325_10082413 | Ga0265325_100824132 | 256 |
| 730 | 3300031247 | Ga0265340_10061536 | Ga0265340_100615362 | 256 |
| 731 | 3300031249 | Ga0265339_10000047 | Ga0265339_1000004754 | 256 |
| 732 | 3300031249 | Ga0265339_10038296 | Ga0265339_100382962 | 256 |
| 733 | 3300031344 | Ga0265316_10089764 | Ga0265316_100897642 | 256 |
| 734 | 3300031344 | Ga0265316_10381064 | Ga0265316_103810641 | 256 |
| 735 | 3300031456 | Ga0307513_10389891 | Ga0307513_103898912 | 256 |
| 736 | 3300031507 | Ga0307509_10249997 | Ga0307509_102499972 | 256 |
| 737 | 3300031595 | Ga0265313_10000069 | Ga0265313_1000006939 | 256 |
| 738 | 3300031616 | Ga0307508_10000051 | Ga0307508_1000005156 | 256 |
| 739 | 3300031616 | Ga0307508_10346029 | Ga0307508_103460291 | 256 |
| 740 | 3300031711 | Ga0265314_10015576 | Ga0265314_100155762 | 256 |
| 741 | 3300031711 | Ga0265314_10102869 | Ga0265314_101028692 | 256 |
| 742 | 3300031712 | Ga0265342_10065729 | Ga0265342_100657291 | 256 |
| 743 | 3300031712 | Ga0265342_10087021 | Ga0265342_100870212 | 256 |
| 744 | 3300031730 | Ga0307516_10015568 | Ga0307516_100155687 | 256 |
| 745 | 3300031730 | Ga0307516_10112595 | Ga0307516_101125952 | 256 |
| 746 | 3300031730 | Ga0307516_10186574 | Ga0307516_101865742 | 256 |
| 747 | 3300031731 | Ga0307405_10137974 | Ga0307405_101379741 | 256 |
| 748 | 3300031731 | Ga0307405_10251334 | Ga0307405_102513342 | 256 |
| 749 | 3300031901 | Ga0307406_10296540 | Ga0307406_102965401 | 256 |
| 750 | 3300031911 | Ga0307412_10309880 | Ga0307412_103098802 | 256 |
| 751 | 3300031911 | Ga0307412_10332256 | Ga0307412_103322562 | 256 |
| 752 | 3300033179 | Ga0307507_10007677 | Ga0307507_100076772 | 256 |
| 753 | 3300033180 | Ga0307510_10071695 | Ga0307510_100716953 | 256 |
| 754 | 3300035083 | Ga0373926_0128120 | Ga0373926_0128120_167_949 | 256 |
| 755 | 3300035111 | Ga0373923_0001064 | Ga0373923_0001064_2356_3138 | 256 |
| 756 | 3300035111 | Ga0373923_0004092 | Ga0373923_0004092_3222_3992 | 256 |
| 757 | 3300035111 | Ga0373923_0044311 | Ga0373923_0044311_819_1598 | 256 |
| 758 | 3300035113 | Ga0373936_0003661 | Ga0373936_0003661_1835_2605 | 256 |
| 759 | 3300035113 | Ga0373936_0008030 | Ga0373936_0008030_2885_3667 | 256 |
| 760 | 3300035113 | Ga0373936_0071436 | Ga0373936_0071436_536_1306 | 256 |
| 761 | 3300035116 | Ga0373945_0014404 | Ga0373945_0014404_212_982 | 256 |
| 762 | 3300035117 | Ga0373953_0019853 | Ga0373953_0019853_1108_1887 | 256 |
| 763 | 3300035117 | Ga0373953_0038072 | Ga0373953_0038072_616_1398 | 256 |
| 764 | 3300035118 | Ga0373954_0000418 | Ga0373954_0000418_9679_10449 | 256 |
| 765 | 3300035118 | Ga0373954_0009743 | Ga0373954_0009743_3424_4206 | 256 |
| 766 | 3300035119 | Ga0373956_0000845 | Ga0373956_0000845_4183_4953 | 256 |
| 767 | 3300035119 | Ga0373956_0075896 | Ga0373956_0075896_546_1325 | 256 |
| 768 | 3300035120 | Ga0373957_0000695 | Ga0373957_0000695_3839_4609 | 256 |
| 769 | 3300035120 | Ga0373957_0003864 | Ga0373957_0003864_475_1257 | 256 |
| 770 | 3300035120 | Ga0373957_0114384 | Ga0373957_0114384_89_859 | 256 |
| 771 | 3300035170 | Ga0373943_0133020 | Ga0373943_0133020_496_1269 | 256 |
| 772 | 3300035170 | Ga0373943_0144993 | Ga0373943_0144993_206_976 | 256 |
| 773 | 3300035171 | Ga0373946_0018140 | Ga0373946_0018140_827_1597 | 256 |
| 774 | 3300035171 | Ga0373946_0111972 | Ga0373946_0111972_66_848 | 256 |
| 775 | 3300035172 | Ga0373955_0014293 | Ga0373955_0014293_3019_3801 | 256 |
| 776 | 3300035172 | Ga0373955_0145390 | Ga0373955_0145390_282_1052 | 256 |
| 777 | 3300035410 | Ga0373924_0011574 | Ga0373924_0011574_1584_2366 | 256 |
| 778 | 3300035410 | Ga0373924_0019764 | Ga0373924_0019764_1648_2475 | 256 |
| 779 | 3300035410 | Ga0373924_0021465 | Ga0373924_0021465_82_852 | 256 |
| 780 | 3300035692 | Ga0373935_0004409 | Ga0373935_0004409_2450_3220 | 256 |
| 781 | 3300035692 | Ga0373935_0030931 | Ga0373935_0030931_1037_1819 | 256 |
| 782 | 3300035695 | Ga0373927_0011920 | Ga0373927_0011920_4462_5232 | 256 |
| 783 | 3300035695 | Ga0373927_0013700 | Ga0373927_0013700_2100_2870 | 256 |
| 784 | 3300035695 | Ga0373927_0013723 | Ga0373927_0013723_2734_3504 | 256 |
| 785 | 3300035695 | Ga0373927_0047822 | Ga0373927_0047822_284_1054 | 256 |
| 786 | 3300035695 | Ga0373927_0181775 | Ga0373927_0181775_416_1186 | 256 |
| 787 | 3300035724 | Ga0373933_0004721 | Ga0373933_0004721_6411_7181 | 256 |
| 788 | 3300035724 | Ga0373933_0006387 | Ga0373933_0006387_2336_3118 | 256 |
| 789 | 3300035724 | Ga0373933_0007858 | Ga0373933_0007858_28_807 | 256 |
| 790 | 3300035724 | Ga0373933_0211092 | Ga0373933_0211092_201_971 | 256 |
| 791 | 3300035724 | Ga0373933_0267515 | Ga0373933_0267515_135_905 | 256 |
| 792 | 3300035725 | Ga0373947_0004935 | Ga0373947_0004935_4568_5338 | 256 |
| 793 | 3300035725 | Ga0373947_0029427 | Ga0373947_0029427_735_1517 | 256 |
| 794 | 3300036401 | Ga0373937_0037050 | Ga0373937_0037050_1602_2372 | 256 |
| 795 | 3300036401 | Ga0373937_0040658 | Ga0373937_0040658_1020_1817 | 256 |
| 796 | 3300036401 | Ga0373937_0041120 | Ga0373937_0041120_1892_2662 | 256 |
| 797 | 3300036401 | Ga0373937_0262002 | Ga0373937_0262002_156_938 | 256 |
| 798 | 3300036459 | Ga0372808_006082 | Ga0372808_006082_157_1047 | 256 |
| 799 | 3300037068 | Ga0373925_0004584 | Ga0373925_0004584_8552_9334 | 256 |
| 800 | 3300037068 | Ga0373925_0013971 | Ga0373925_0013971_1916_2686 | 256 |
| 801 | 3300037068 | Ga0373925_0068622 | Ga0373925_0068622_484_1254 | 256 |
| 802 | 3300037418 | Ga0395900_0533277 | Ga0395900_0533277_332_1102 | 256 |
| 803 | 3300037466 | Ga0395898_0100762 | Ga0395898_0100762_643_1413 | 256 |
| 804 | 3300037471 | Ga0395905_0190789 | Ga0395905_0190789_308_1081 | 256 |
| 805 | 3300037853 | Ga0436364_0767694 | Ga0436364_0767694_3648_4433 | 256 |
| 806 | 3300037853 | Ga0436364_1169404 | Ga0436364_1169404_116_886 | 256 |
| 807 | 3300037853 | Ga0436364_1204997 | Ga0436364_1204997_544_1329 | 256 |
| 808 | 3300038443 | Ga0395901_0095869 | Ga0395901_0095869_1206_1988 | 256 |
| 809 | 3300038443 | Ga0395901_0516617 | Ga0395901_0516617_22_792 | 256 |
| 810 | 3300039437 | Ga0436365_0075269 | Ga0436365_0075269_845_1615 | 256 |
| 811 | 3300039437 | Ga0436365_0167764 | Ga0436365_0167764_13801_14571 | 256 |
| 812 | 3300039437 | Ga0436365_0276616 | Ga0436365_0276616_294_1064 | 256 |
| 813 | 3300039437 | Ga0436365_0743040 | Ga0436365_0743040_263_1036 | 256 |
| 814 | 3300039437 | Ga0436365_1331117 | Ga0436365_1331117_467_1249 | 256 |
| 815 | 3300039437 | Ga0436365_1826002 | Ga0436365_1826002_1374_2144 | 256 |
| 816 | 3300039438 | Ga0436360_0305024 | Ga0436360_0305024_136_906 | 256 |
| 817 | 3300039450 | Ga0436363_1366818 | Ga0436363_1366818_1284_2054 | 256 |
| 818 | 3300039453 | Ga0436362_0817319 | Ga0436362_0817319_1991_2761 | 256 |
| 819 | 3300041512 | Ga0451853_1410466 | Ga0451853_1410466_52_822 | 256 |
| 820 | 3300044719 | Ga0466971_0031970 | Ga0466971_0031970_868_1650 | 256 |
| 821 | 3300045836 | Ga0466958_0074489 | Ga0466958_0074489_992_1774 | 256 |
| 822 | 3300045976 | Ga0466967_0231875 | Ga0466967_0231875_179_949 | 256 |
| 823 | 3300045976 | Ga0466967_0385944 | Ga0466967_0385944_437_1219 | 256 |
| 824 | 3300045976 | Ga0466967_0515596 | Ga0466967_0515596_98_880 | 256 |
| 825 | 3300046452 | Ga0495617_020984 | Ga0495617_020984_912_1682 | 256 |
| 826 | 3300046452 | Ga0495617_090626 | Ga0495617_090626_29_799 | 256 |
| 827 | 3300046454 | Ga0495592_0032950 | Ga0495592_0032950_2508_3278 | 256 |
| 828 | 3300046454 | Ga0495592_0079856 | Ga0495592_0079856_828_1610 | 256 |
| 829 | 3300046454 | Ga0495592_0107928 | Ga0495592_0107928_503_1273 | 256 |
| 830 | 3300046455 | Ga0495603_0000874 | Ga0495603_0000874_7702_8472 | 256 |
| 831 | 3300046455 | Ga0495603_0015206 | Ga0495603_0015206_1618_2388 | 256 |
| 832 | 3300046455 | Ga0495603_0075615 | Ga0495603_0075615_871_1653 | 256 |
| 833 | 3300046455 | Ga0495603_0079011 | Ga0495603_0079011_997_1770 | 256 |
| 834 | 3300046455 | Ga0495603_0244618 | Ga0495603_0244618_231_1010 | 256 |
| 835 | 3300046459 | Ga0495629_0000439 | Ga0495629_0000439_10668_11438 | 256 |
| 836 | 3300046459 | Ga0495629_0000957 | Ga0495629_0000957_5485_6255 | 256 |
| 837 | 3300046459 | Ga0495629_0041686 | Ga0495629_0041686_1673_2455 | 256 |
| 838 | 3300046460 | Ga0495638_0007152 | Ga0495638_0007152_6755_7528 | 256 |
| 839 | 3300046460 | Ga0495638_0069064 | Ga0495638_0069064_54_827 | 256 |
| 840 | 3300046461 | Ga0495641_0003351 | Ga0495641_0003351_8747_9517 | 256 |
| 841 | 3300046462 | Ga0495651_0003854 | Ga0495651_0003854_2683_3510 | 256 |
| 842 | 3300046462 | Ga0495651_0063543 | Ga0495651_0063543_170_940 | 256 |
| 843 | 3300046462 | Ga0495651_0121982 | Ga0495651_0121982_804_1574 | 256 |
| 844 | 3300046463 | Ga0495653_0003152 | Ga0495653_0003152_4801_5571 | 256 |
| 845 | 3300046472 | Ga0495580_0006287 | Ga0495580_0006287_3952_4722 | 256 |
| 846 | 3300046473 | Ga0495582_0002466 | Ga0495582_0002466_4057_4827 | 256 |
| 847 | 3300046473 | Ga0495582_0009442 | Ga0495582_0009442_3436_4218 | 256 |
| 848 | 3300046473 | Ga0495582_0099914 | Ga0495582_0099914_35_805 | 256 |
| 849 | 3300046474 | Ga0495605_0125840 | Ga0495605_0125840_307_1080 | 256 |
| 850 | 3300046475 | Ga0495639_0000913 | Ga0495639_0000913_6367_7137 | 256 |
| 851 | 3300046477 | Ga0495664_0004313 | Ga0495664_0004313_4761_5531 | 256 |
| 852 | 3300046477 | Ga0495664_0124565 | Ga0495664_0124565_423_1193 | 256 |
| 853 | 3300046477 | Ga0495664_0139742 | Ga0495664_0139742_404_1183 | 256 |
| 854 | 3300046477 | Ga0495664_0211886 | Ga0495664_0211886_164_934 | 256 |
| 855 | 3300046477 | Ga0495664_0266269 | Ga0495664_0266269_44_814 | 256 |
| 856 | 3300046499 | Ga0495594_0002715 | Ga0495594_0002715_2044_2814 | 256 |
| 857 | 3300046499 | Ga0495594_0153818 | Ga0495594_0153818_51_833 | 256 |
| 858 | 3300046499 | Ga0495594_0155953 | Ga0495594_0155953_224_994 | 256 |
| 859 | 3300046499 | Ga0495594_0235883 | Ga0495594_0235883_240_1013 | 256 |
| 860 | 3300046507 | Ga0495606_0002132 | Ga0495606_0002132_18863_19633 | 256 |
| 861 | 3300046507 | Ga0495606_0105866 | Ga0495606_0105866_335_1105 | 256 |
| 862 | 3300046507 | Ga0495606_0165118 | Ga0495606_0165118_170_940 | 256 |
| 863 | 3300046511 | Ga0495608_0005973 | Ga0495608_0005973_5847_6626 | 256 |
| 864 | 3300046511 | Ga0495608_0028994 | Ga0495608_0028994_1521_2291 | 256 |
| 865 | 3300046514 | Ga0495618_0186705 | Ga0495618_0186705_456_1226 | 256 |
| 866 | 3300046515 | Ga0495620_0026171 | Ga0495620_0026171_757_1530 | 256 |
| 867 | 3300046516 | Ga0495628_0010152 | Ga0495628_0010152_6051_6821 | 256 |
| 868 | 3300046516 | Ga0495628_0011453 | Ga0495628_0011453_5676_6503 | 256 |
| 869 | 3300046516 | Ga0495628_0101177 | Ga0495628_0101177_1354_2136 | 256 |
| 870 | 3300046516 | Ga0495628_0144821 | Ga0495628_0144821_98_868 | 256 |
| 871 | 3300046517 | Ga0495630_0001220 | Ga0495630_0001220_15960_16730 | 256 |
| 872 | 3300046517 | Ga0495630_0107226 | Ga0495630_0107226_443_1270 | 256 |
| 873 | 3300046519 | Ga0495632_0044890 | Ga0495632_0044890_913_1686 | 256 |
| 874 | 3300046522 | Ga0495643_0099231 | Ga0495643_0099231_545_1318 | 256 |
| 875 | 3300046524 | Ga0495648_0001613 | Ga0495648_0001613_12343_13113 | 256 |
| 876 | 3300046524 | Ga0495648_0055151 | Ga0495648_0055151_1174_1944 | 256 |
| 877 | 3300046526 | Ga0495666_0021634 | Ga0495666_0021634_2362_3144 | 256 |
| 878 | 3300046529 | Ga0495652_0005540 | Ga0495652_0005540_3172_3951 | 256 |
| 879 | 3300046529 | Ga0495652_0011261 | Ga0495652_0011261_6411_7181 | 256 |
| 880 | 3300046529 | Ga0495652_0021754 | Ga0495652_0021754_1270_2040 | 256 |
| 881 | 3300046529 | Ga0495652_0153456 | Ga0495652_0153456_627_1409 | 256 |
| 882 | 3300046529 | Ga0495652_0330243 | Ga0495652_0330243_85_855 | 256 |
| 883 | 3300046530 | Ga0495654_0106802 | Ga0495654_0106802_168_941 | 256 |
| 884 | 3300046531 | Ga0495665_0000555 | Ga0495665_0000555_10760_11530 | 256 |
| 885 | 3300046531 | Ga0495665_0004355 | Ga0495665_0004355_4290_5072 | 256 |
| 886 | 3300046533 | Ga0495640_0001232 | Ga0495640_0001232_16236_17006 | 256 |
| 887 | 3300046533 | Ga0495640_0009939 | Ga0495640_0009939_2592_3374 | 256 |
| 888 | 3300046533 | Ga0495640_0063282 | Ga0495640_0063282_337_1116 | 256 |
| 889 | 3300046533 | Ga0495640_0065761 | Ga0495640_0065761_82_852 | 256 |
| 890 | 3300046535 | Ga0495586_0071955 | Ga0495586_0071955_310_1089 | 256 |
| 891 | 3300046536 | Ga0495587_0013838 | Ga0495587_0013838_427_1197 | 256 |
| 892 | 3300046539 | Ga0495621_0067365 | Ga0495621_0067365_328_1101 | 256 |
| 893 | 3300046543 | Ga0495645_0011972 | Ga0495645_0011972_3420_4202 | 256 |
| 894 | 3300046543 | Ga0495645_0013731 | Ga0495645_0013731_1890_2717 | 256 |
| 895 | 3300046543 | Ga0495645_0018292 | Ga0495645_0018292_1995_2765 | 256 |
| 896 | 3300046543 | Ga0495645_0165805 | Ga0495645_0165805_696_1478 | 256 |
| 897 | 3300046543 | Ga0495645_0297639 | Ga0495645_0297639_93_863 | 256 |
| 898 | 3300046557 | Ga0495622_0003298 | Ga0495622_0003298_3640_4410 | 256 |
| 899 | 3300046557 | Ga0495622_0133714 | Ga0495622_0133714_302_1075 | 256 |
| 900 | 3300046558 | Ga0495633_0048486 | Ga0495633_0048486_247_1020 | 256 |
| 901 | 3300046559 | Ga0495667_0016918 | Ga0495667_0016918_468_1238 | 256 |
| 902 | 3300046615 | Ga0495656_0103490 | Ga0495656_0103490_96_869 | 256 |
| 903 | 3300046616 | Ga0495668_0062733 | Ga0495668_0062733_940_1710 | 256 |
| 904 | 3300046642 | Ga0495634_0014564 | Ga0495634_0014564_4372_5142 | 256 |
| 905 | 3300046642 | Ga0495634_0018636 | Ga0495634_0018636_2286_3065 | 256 |
| 906 | 3300046642 | Ga0495634_0060761 | Ga0495634_0060761_1576_2346 | 256 |
| 907 | 3300046648 | Ga0495611_0039800 | Ga0495611_0039800_724_1494 | 256 |
| 908 | 3300046648 | Ga0495611_0126302 | Ga0495611_0126302_135_908 | 256 |
| 909 | 3300046660 | Ga0495625_0088904 | Ga0495625_0088904_347_1120 | 256 |
| 910 | 3300046660 | Ga0495625_0170061 | Ga0495625_0170061_415_1185 | 256 |
| 911 | 3300046663 | Ga0495635_0001430 | Ga0495635_0001430_6299_7069 | 256 |
| 912 | 3300046663 | Ga0495635_0003515 | Ga0495635_0003515_52_822 | 256 |
| 913 | 3300046663 | Ga0495635_0004600 | Ga0495635_0004600_8302_9081 | 256 |
| 914 | 3300046663 | Ga0495635_0010771 | Ga0495635_0010771_4219_5001 | 256 |
| 915 | 3300046665 | Ga0495661_0081293 | Ga0495661_0081293_75_848 | 256 |
| 916 | 3300046674 | Ga0495588_0005525 | Ga0495588_0005525_4756_5526 | 256 |
| 917 | 3300046674 | Ga0495588_0129047 | Ga0495588_0129047_483_1256 | 256 |
| 918 | 3300046675 | Ga0495657_0020793 | Ga0495657_0020793_3521_4291 | 256 |
| 919 | 3300046675 | Ga0495657_0140199 | Ga0495657_0140199_235_1062 | 256 |
| 920 | 3300046675 | Ga0495657_0217371 | Ga0495657_0217371_88_858 | 256 |
| 921 | 3300046678 | Ga0495599_0007454 | Ga0495599_0007454_981_1751 | 256 |
| 922 | 3300046678 | Ga0495599_0156105 | Ga0495599_0156105_132_902 | 256 |
| 923 | 3300046678 | Ga0495599_0184188 | Ga0495599_0184188_277_1056 | 256 |
| 924 | 3300046679 | Ga0495623_0010183 | Ga0495623_0010183_427_1197 | 256 |
| 925 | 3300046679 | Ga0495623_0019346 | Ga0495623_0019346_1781_2560 | 256 |
| 926 | 3300046679 | Ga0495623_0090795 | Ga0495623_0090795_19_801 | 256 |
| 927 | 3300046680 | Ga0495646_0003601 | Ga0495646_0003601_7523_8293 | 256 |
| 928 | 3300046680 | Ga0495646_0072368 | Ga0495646_0072368_930_1700 | 256 |
| 929 | 3300046683 | Ga0495658_0065037 | Ga0495658_0065037_48_818 | 256 |
| 930 | 3300046684 | Ga0495669_0008503 | Ga0495669_0008503_857_1630 | 256 |
| 931 | 3300046684 | Ga0495669_0136329 | Ga0495669_0136329_130_900 | 256 |
| 932 | 3300046690 | Ga0495624_0001252 | Ga0495624_0001252_15445_16215 | 256 |
| 933 | 3300046691 | Ga0495670_0007811 | Ga0495670_0007811_3805_4578 | 256 |
| 934 | 3300046794 | Ga0495589_0080116 | Ga0495589_0080116_278_1051 | 256 |
| 935 | 3300046809 | Ga0495600_0001772 | Ga0495600_0001772_5822_6601 | 256 |
| 936 | 3300046809 | Ga0495600_0040077 | Ga0495600_0040077_1650_2420 | 256 |
| 937 | 3300046810 | Ga0495660_0088788 | Ga0495660_0088788_489_1262 | 256 |
| 938 | 3300047315 | Ga0495581_0000019 | Ga0495581_0000019_16367_17137 | 256 |
| 939 | 3300047317 | Ga0495604_0007453 | Ga0495604_0007453_1866_2636 | 256 |
| 940 | 3300047317 | Ga0495604_0061883 | Ga0495604_0061883_1123_1902 | 256 |
| 941 | 3300047319 | Ga0495674_0000458 | Ga0495674_0000458_24730_25500 | 256 |
| 942 | 3300047319 | Ga0495674_0008586 | Ga0495674_0008586_317_1096 | 256 |
| 943 | 3300047319 | Ga0495674_0039776 | Ga0495674_0039776_2309_3079 | 256 |
| 944 | 3300047319 | Ga0495674_0162963 | Ga0495674_0162963_400_1170 | 256 |
| 945 | 3300047319 | Ga0495674_0254193 | Ga0495674_0254193_628_1410 | 256 |
| 946 | 3300047320 | Ga0495672_0045609 | Ga0495672_0045609_1813_2595 | 256 |
| 947 | 3300047321 | Ga0495676_0065285 | Ga0495676_0065285_1389_2171 | 256 |
| 948 | 3300047321 | Ga0495676_0091683 | Ga0495676_0091683_1024_1794 | 256 |
| 949 | 3300047322 | Ga0495680_0006264 | Ga0495680_0006264_1650_2420 | 256 |
| 950 | 3300047322 | Ga0495680_0006496 | Ga0495680_0006496_6491_7318 | 256 |
| 951 | 3300047444 | Ga0495675_0021254 | Ga0495675_0021254_2759_3538 | 256 |
| 952 | 3300047444 | Ga0495675_0049118 | Ga0495675_0049118_1282_2052 | 256 |
| 953 | 3300047447 | Ga0495685_135996 | Ga0495685_135996_17_787 | 256 |
| 954 | 3300047469 | Ga0495673_0091708 | Ga0495673_0091708_317_1090 | 256 |
| 955 | 3300047469 | Ga0495673_0103852 | Ga0495673_0103852_231_1004 | 256 |
| 956 | 3300047470 | Ga0495681_0092181 | Ga0495681_0092181_76_849 | 256 |
| 957 | 3300047470 | Ga0495681_0104104 | Ga0495681_0104104_128_901 | 256 |
| 958 | 3300047471 | Ga0495684_0012962 | Ga0495684_0012962_4267_5037 | 256 |
| 959 | 3300047472 | Ga0495686_0017873 | Ga0495686_0017873_3029_3802 | 256 |
| 960 | 3300047472 | Ga0495686_0172967 | Ga0495686_0172967_225_995 | 256 |
| 961 | 3300047472 | Ga0495686_0212017 | Ga0495686_0212017_210_980 | 256 |
| 962 | 3300047673 | Ga0495593_0001308 | Ga0495593_0001308_1157_1927 | 256 |
| 963 | 3300047673 | Ga0495593_0008357 | Ga0495593_0008357_3983_4753 | 256 |
| 964 | 3300048088 | Ga0495602_0023461 | Ga0495602_0023461_1952_2779 | 256 |
| 965 | 3300048088 | Ga0495602_0025728 | Ga0495602_0025728_4117_4887 | 256 |
| 966 | 3300048088 | Ga0495602_0043067 | Ga0495602_0043067_1802_2572 | 256 |
| 967 | 3300048089 | Ga0495614_0108094 | Ga0495614_0108094_425_1195 | 256 |
| 968 | 3300048091 | Ga0495626_0017777 | Ga0495626_0017777_342_1115 | 256 |
| 969 | 3300048904 | Ga0496101_0007758 | Ga0496101_0007758_825_1595 | 256 |
| 970 | 3300048904 | Ga0496101_0106028 | Ga0496101_0106028_524_1294 | 256 |
| 971 | 3300048905 | Ga0496102_0010309 | Ga0496102_0010309_1358_2128 | 256 |
| 972 | 3300048905 | Ga0496102_0515596 | Ga0496102_0515596_158_931 | 256 |
| 973 | 3300048905 | Ga0496102_0613084 | Ga0496102_0613084_41_814 | 256 |
| 974 | 3300048906 | Ga0496103_0326749 | Ga0496103_0326749_101_871 | 256 |
| 975 | 3300048907 | Ga0496104_0009462 | Ga0496104_0009462_2742_3512 | 256 |
| 976 | 3300048907 | Ga0496104_0071281 | Ga0496104_0071281_387_1160 | 256 |
| 977 | 3300048907 | Ga0496104_0114517 | Ga0496104_0114517_1610_2380 | 256 |
| 978 | 3300048907 | Ga0496104_0471710 | Ga0496104_0471710_233_1003 | 256 |
| 979 | 3300048908 | Ga0496105_0029974 | Ga0496105_0029974_3082_3852 | 256 |
| 980 | 3300048909 | Ga0496106_0002119 | Ga0496106_0002119_8060_8830 | 256 |
| 981 | 3300048909 | Ga0496106_0028877 | Ga0496106_0028877_283_1053 | 256 |
| 982 | 3300048909 | Ga0496106_0028919 | Ga0496106_0028919_2695_3465 | 256 |
| 983 | 3300048909 | Ga0496106_0122458 | Ga0496106_0122458_1233_2006 | 256 |
| 984 | 3300048910 | Ga0496107_0003483 | Ga0496107_0003483_9572_10342 | 256 |
| 985 | 3300048910 | Ga0496107_0022807 | Ga0496107_0022807_784_1554 | 256 |
| 986 | 3300048910 | Ga0496107_0215337 | Ga0496107_0215337_459_1232 | 256 |
| 987 | 3300048911 | Ga0496108_0000938 | Ga0496108_0000938_20546_21316 | 256 |
| 988 | 3300048911 | Ga0496108_0012526 | Ga0496108_0012526_3752_4522 | 256 |
| 989 | 3300048912 | Ga0496109_0000977 | Ga0496109_0000977_10170_10940 | 256 |
| 990 | 3300048912 | Ga0496109_0174956 | Ga0496109_0174956_804_1574 | 256 |
| 991 | 3300048912 | Ga0496109_0430396 | Ga0496109_0430396_105_875 | 256 |
| 992 | 3300048913 | Ga0496110_0049690 | Ga0496110_0049690_1923_2693 | 256 |
| 993 | 3300048913 | Ga0496110_0063156 | Ga0496110_0063156_2243_3013 | 256 |
| 994 | 3300048913 | Ga0496110_0212387 | Ga0496110_0212387_228_998 | 256 |
| 995 | 3300048914 | Ga0496111_0076850 | Ga0496111_0076850_351_1121 | 256 |
| 996 | 3300048915 | Ga0496112_0000045 | Ga0496112_0000045_66220_66990 | 256 |
| 997 | 3300048915 | Ga0496112_0000590 | Ga0496112_0000590_14352_15122 | 256 |
| 998 | 3300048915 | Ga0496112_0070107 | Ga0496112_0070107_111_881 | 256 |
| 999 | 3300048915 | Ga0496112_0075203 | Ga0496112_0075203_1786_2556 | 256 |
| 1000 | 3300048915 | Ga0496112_0093111 | Ga0496112_0093111_1369_2139 | 256 |
| 1001 | 3300048915 | Ga0496112_0110069 | Ga0496112_0110069_470_1249 | 256 |
| 1002 | 3300048916 | Ga0496113_0032399 | Ga0496113_0032399_942_1712 | 256 |
| 1003 | 3300048917 | Ga0496114_0234352 | Ga0496114_0234352_444_1217 | 256 |
| 1004 | 3300048918 | Ga0496115_0097205 | Ga0496115_0097205_925_1698 | 256 |
| 1005 | 3300048918 | Ga0496115_0132424 | Ga0496115_0132424_129_899 | 256 |
| 1006 | 3300048918 | Ga0496115_0135353 | Ga0496115_0135353_73_843 | 256 |
| 1007 | 3300048918 | Ga0496115_0159319 | Ga0496115_0159319_774_1544 | 256 |
| 1008 | 3300048918 | Ga0496115_0236424 | Ga0496115_0236424_225_995 | 256 |
| 1009 | 3300048918 | Ga0496115_0270746 | Ga0496115_0270746_202_975 | 256 |
| 1010 | 3300048919 | Ga0496116_0012386 | Ga0496116_0012386_5189_5962 | 256 |
| 1011 | 3300048920 | Ga0496117_0016137 | Ga0496117_0016137_3896_4669 | 256 |
| 1012 | 3300048920 | Ga0496117_0043048 | Ga0496117_0043048_441_1214 | 256 |
| 1013 | 3300048920 | Ga0496117_0052104 | Ga0496117_0052104_373_1143 | 256 |
| 1014 | 3300048920 | Ga0496117_0057914 | Ga0496117_0057914_1304_2074 | 256 |
| 1015 | 3300048920 | Ga0496117_0268075 | Ga0496117_0268075_94_864 | 256 |
| 1016 | 3300048921 | Ga0496118_0018344 | Ga0496118_0018344_5403_6173 | 256 |
| 1017 | 3300048921 | Ga0496118_0022527 | Ga0496118_0022527_1207_1977 | 256 |
| 1018 | 3300048921 | Ga0496118_0031340 | Ga0496118_0031340_2498_3271 | 256 |
| 1019 | 3300048922 | Ga0496119_0042013 | Ga0496119_0042013_702_1472 | 256 |
| 1020 | 3300048922 | Ga0496119_0062235 | Ga0496119_0062235_1012_1782 | 256 |
| 1021 | 3300048922 | Ga0496119_0086948 | Ga0496119_0086948_277_1050 | 256 |
| 1022 | 3300048924 | Ga0496121_0000379 | Ga0496121_0000379_69233_70003 | 256 |
| 1023 | 3300048924 | Ga0496121_0002555 | Ga0496121_0002555_25934_26719 | 256 |
| 1024 | 3300048924 | Ga0496121_0004013 | Ga0496121_0004013_14097_14867 | 256 |
| 1025 | 3300048924 | Ga0496121_0004472 | Ga0496121_0004472_16127_16900 | 256 |
| 1026 | 3300048924 | Ga0496121_0010261 | Ga0496121_0010261_104_874 | 256 |
| 1027 | 3300048924 | Ga0496121_0010612 | Ga0496121_0010612_1107_1889 | 256 |
| 1028 | 3300048924 | Ga0496121_0024775 | Ga0496121_0024775_4876_5646 | 256 |
| 1029 | 3300048924 | Ga0496121_0078720 | Ga0496121_0078720_1412_2182 | 256 |
| 1030 | 3300048924 | Ga0496121_0180289 | Ga0496121_0180289_187_957 | 256 |
| 1031 | 3300048925 | Ga0496122_0024591 | Ga0496122_0024591_673_1446 | 256 |
| 1032 | 3300048925 | Ga0496122_0075943 | Ga0496122_0075943_426_1199 | 256 |
| 1033 | 3300048926 | Ga0496123_0017035 | Ga0496123_0017035_3838_4611 | 256 |
| 1034 | 3300048927 | Ga0496124_0001073 | Ga0496124_0001073_28095_28865 | 256 |
| 1035 | 3300048927 | Ga0496124_0257026 | Ga0496124_0257026_275_1045 | 256 |
| 1036 | 3300048927 | Ga0496124_0283856 | Ga0496124_0283856_284_1057 | 256 |
| 1037 | 3300048928 | Ga0496125_0000629 | Ga0496125_0000629_9840_10610 | 256 |
| 1038 | 3300048928 | Ga0496125_0029288 | Ga0496125_0029288_1484_2257 | 256 |
| 1039 | 3300048928 | Ga0496125_0182105 | Ga0496125_0182105_53_823 | 256 |
| 1040 | 3300048929 | Ga0496126_0003114 | Ga0496126_0003114_12738_13511 | 256 |
| 1041 | 3300048929 | Ga0496126_0013956 | Ga0496126_0013956_6051_6821 | 256 |
| 1042 | 3300048929 | Ga0496126_0063374 | Ga0496126_0063374_1217_1987 | 256 |
| 1043 | 3300048929 | Ga0496126_0126229 | Ga0496126_0126229_1219_2001 | 256 |
| 1044 | 3300048929 | Ga0496126_0135055 | Ga0496126_0135055_775_1545 | 256 |
| 1045 | 3300048929 | Ga0496126_0141426 | Ga0496126_0141426_622_1392 | 256 |
| 1046 | 3300048929 | Ga0496126_0198282 | Ga0496126_0198282_276_1049 | 256 |
| 1047 | 3300048929 | Ga0496126_0222573 | Ga0496126_0222573_453_1226 | 256 |
| 1048 | 3300048929 | Ga0496126_0253163 | Ga0496126_0253163_354_1124 | 256 |
| 1049 | 3300048929 | Ga0496126_0629455 | Ga0496126_0629455_40_810 | 256 |
| 1050 | 3300049569 | Ga0501032_0127563 | Ga0501032_0127563_381_1154 | 256 |
| 1051 | 3300049569 | Ga0501032_0154916 | Ga0501032_0154916_129_899 | 256 |
| 1052 | 3300049570 | Ga0501033_0126297 | Ga0501033_0126297_904_1677 | 256 |
| 1053 | 3300049571 | Ga0501034_0119598 | Ga0501034_0119598_1206_1979 | 256 |
| 1054 | 3300049571 | Ga0501034_0664853 | Ga0501034_0664853_118_888 | 256 |
| 1055 | 3300049572 | Ga0501036_0137765 | Ga0501036_0137765_1078_1851 | 256 |
| 1056 | 3300049573 | Ga0501037_0081418 | Ga0501037_0081418_1312_2085 | 256 |
| 1057 | 3300049574 | Ga0501038_0149058 | Ga0501038_0149058_735_1505 | 256 |
| 1058 | 3300049577 | Ga0501041_0208115 | Ga0501041_0208115_231_1004 | 256 |
| 1059 | 3300049580 | Ga0501046_0101211 | Ga0501046_0101211_904_1674 | 256 |
| 1060 | 3300049581 | Ga0501047_0005748 | Ga0501047_0005748_9236_10006 | 256 |
| 1061 | 3300049581 | Ga0501047_0008010 | Ga0501047_0008010_3340_4110 | 256 |
| 1062 | 3300049581 | Ga0501047_0089744 | Ga0501047_0089744_1295_2068 | 256 |
| 1063 | 3300049582 | Ga0501048_0222865 | Ga0501048_0222865_250_1023 | 256 |
| 1064 | 3300049583 | Ga0501067_0136782 | Ga0501067_0136782_510_1280 | 256 |
| 1065 | 3300049583 | Ga0501067_0215665 | Ga0501067_0215665_129_902 | 256 |
| 1066 | 3300049584 | Ga0501068_0134498 | Ga0501068_0134498_156_929 | 256 |
| 1067 | 3300049586 | Ga0501070_0014472 | Ga0501070_0014472_648_1418 | 256 |
| 1068 | 3300049586 | Ga0501070_0106680 | Ga0501070_0106680_735_1505 | 256 |
| 1069 | 3300049588 | Ga0501072_0068258 | Ga0501072_0068258_1226_1999 | 256 |
| 1070 | 3300049589 | Ga0501073_0185361 | Ga0501073_0185361_90_860 | 256 |
| 1071 | 3300049590 | Ga0501074_0007505 | Ga0501074_0007505_7098_7868 | 256 |
| 1072 | 3300049590 | Ga0501074_0476293 | Ga0501074_0476293_93_863 | 256 |
| 1073 | 3300049741 | Ga0501079_0100317 | Ga0501079_0100317_242_1015 | 256 |
| 1074 | 3300049742 | Ga0501080_0004615 | Ga0501080_0004615_2581_3351 | 256 |
| 1075 | 3300049742 | Ga0501080_0088856 | Ga0501080_0088856_1811_2584 | 256 |
| 1076 | 3300049742 | Ga0501080_0427689 | Ga0501080_0427689_11_784 | 256 |
| 1077 | 3300049822 | Ga0501035_0135892 | Ga0501035_0135892_1220_1993 | 256 |
| 1078 | 3300049822 | Ga0501035_0301458 | Ga0501035_0301458_223_993 | 256 |
| 1079 | 3300049823 | Ga0501044_0063727 | Ga0501044_0063727_209_979 | 256 |
| 1080 | 3300049823 | Ga0501044_0164517 | Ga0501044_0164517_46_906 | 256 |
| 1081 | 3300049823 | Ga0501044_0299840 | Ga0501044_0299840_751_1521 | 256 |
| 1082 | 3300049823 | Ga0501044_0603787 | Ga0501044_0603787_79_852 | 256 |
| 1083 | 3300050490 | nmdc:mga03n38_10620_c1 | nmdc:mga03n38_10620_c1_2029_2802 | 256 |
| 1084 | 3300050490 | nmdc:mga03n38_70407_c1 | nmdc:mga03n38_70407_c1_756_1541 | 256 |
| 1085 | 3300050491 | nmdc:mga00v17_91201_c1 | nmdc:mga00v17_91201_c1_226_999 | 256 |
| 1086 | 3300050492 | nmdc:mga0yw44_24241_c1 | nmdc:mga0yw44_24241_c1_797_1570 | 256 |
| 1087 | 3300050492 | nmdc:mga0yw44_83999_c1 | nmdc:mga0yw44_83999_c1_1047_1820 | 256 |
| 1088 | 3300050493 | nmdc:mga0k408_183635_c1 | nmdc:mga0k408_183635_c1_32_805 | 256 |
| 1089 | 3300050507 | nmdc:mga05p37_141932_c1 | nmdc:mga05p37_141932_c1_1852_2625 | 256 |
| 1090 | 3300050512 | nmdc:mga0n895_8527_c1 | nmdc:mga0n895_8527_c1_3309_4079 | 256 |
| 1091 | 3300050516 | nmdc:mga0sz30_28629_c1 | nmdc:mga0sz30_28629_c1_313_1086 | 256 |
| 1092 | 3300053077 | Ga0495601_0037977 | Ga0495601_0037977_1467_2249 | 256 |
| 1093 | 3300053077 | Ga0495601_0044379 | Ga0495601_0044379_1831_2601 | 256 |
| 1094 | 3300053077 | Ga0495601_0091103 | Ga0495601_0091103_302_1072 | 256 |
| 1095 | 3300053078 | Ga0495612_0019273 | Ga0495612_0019273_1583_2365 | 256 |
| 1096 | 3300053078 | Ga0495612_0119885 | Ga0495612_0119885_285_1055 | 256 |
| 1097 | 3300053080 | Ga0500635_0013844 | Ga0500635_0013844_1208_1978 | 256 |
| 1098 | 3300053080 | Ga0500635_0020627 | Ga0500635_0020627_26_796 | 256 |
| 1099 | 3300053084 | Ga0495595_0002284 | Ga0495595_0002284_426_1196 | 256 |
| 1100 | 3300053084 | Ga0495595_0043669 | Ga0495595_0043669_386_1156 | 256 |
| 1101 | 3300053085 | Ga0495619_0006156 | Ga0495619_0006156_6028_6798 | 256 |
| 1102 | 3300053085 | Ga0495619_0206380 | Ga0495619_0206380_208_978 | 256 |
| 1103 | 3300053088 | Ga0500644_0095771 | Ga0500644_0095771_60_833 | 256 |
| 1104 | 3300053089 | Ga0500581_028462 | Ga0500581_028462_325_1098 | 256 |
| 1105 | 3300053093 | Ga0500651_0001684 | Ga0500651_0001684_3308_4078 | 256 |
| 1106 | 3300053093 | Ga0500651_0021035 | Ga0500651_0021035_727_1500 | 256 |
| 1107 | 3300053093 | Ga0500651_0130353 | Ga0500651_0130353_319_1092 | 256 |
| 1108 | 3300053093 | Ga0500651_0222539 | Ga0500651_0222539_178_951 | 256 |
| 1109 | 3300053094 | Ga0500566_0000046 | Ga0500566_0000046_52733_53503 | 256 |
| 1110 | 3300053094 | Ga0500566_0015683 | Ga0500566_0015683_1171_1944 | 256 |
| 1111 | 3300053095 | Ga0500640_000122 | Ga0500640_000122_10980_11750 | 256 |
| 1112 | 3300053098 | Ga0500650_0050889 | Ga0500650_0050889_325_1098 | 256 |
| 1113 | 3300053102 | Ga0500554_001975 | Ga0500554_001975_1465_2235 | 256 |
| 1114 | 3300053102 | Ga0500554_005676 | Ga0500554_005676_796_1566 | 256 |
| 1115 | 3300053102 | Ga0500554_068408 | Ga0500554_068408_292_1062 | 256 |
| 1116 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_335120_335893 | 256 |
| 1117 | 3300053109 | Ga0500569_070535 | Ga0500569_070535_60_833 | 256 |
| 1118 | 3300053111 | Ga0500572_000277 | Ga0500572_000277_7241_8011 | 256 |
| 1119 | 3300053116 | Ga0500592_000602 | Ga0500592_000602_3819_4592 | 256 |
| 1120 | 3300053116 | Ga0500592_004767 | Ga0500592_004767_950_1720 | 256 |
| 1121 | 3300053118 | Ga0500594_0003113 | Ga0500594_0003113_2580_3353 | 256 |
| 1122 | 3300053118 | Ga0500594_0016522 | Ga0500594_0016522_373_1143 | 256 |
| 1123 | 3300053119 | Ga0500595_002523 | Ga0500595_002523_2972_3742 | 256 |
| 1124 | 3300053119 | Ga0500595_003315 | Ga0500595_003315_1672_2442 | 256 |
| 1125 | 3300053119 | Ga0500595_005416 | Ga0500595_005416_596_1366 | 256 |
| 1126 | 3300053119 | Ga0500595_022337 | Ga0500595_022337_1222_1992 | 256 |
| 1127 | 3300053122 | Ga0500608_021992 | Ga0500608_021992_507_1280 | 256 |
| 1128 | 3300053123 | Ga0500614_064242 | Ga0500614_064242_73_843 | 256 |
| 1129 | 3300053125 | Ga0500618_006771 | Ga0500618_006771_1294_2067 | 256 |
| 1130 | 3300053130 | Ga0500642_0000015 | Ga0500642_0000015_176783_177556 | 256 |
| 1131 | 3300053130 | Ga0500642_0012591 | Ga0500642_0012591_378_1148 | 256 |
| 1132 | 3300053131 | Ga0500652_000456 | Ga0500652_000456_3409_4182 | 256 |
| 1133 | 3300053136 | Ga0500559_0000301 | Ga0500559_0000301_5550_6326 | 256 |
| 1134 | 3300053136 | Ga0500559_0001197 | Ga0500559_0001197_3547_4320 | 256 |
| 1135 | 3300053136 | Ga0500559_0006509 | Ga0500559_0006509_2796_3566 | 256 |
| 1136 | 3300053136 | Ga0500559_0084943 | Ga0500559_0084943_449_1219 | 256 |
| 1137 | 3300053139 | Ga0500568_0000334 | Ga0500568_0000334_22634_23407 | 256 |
| 1138 | 3300053139 | Ga0500568_0004685 | Ga0500568_0004685_2359_3129 | 256 |
| 1139 | 3300053140 | Ga0500573_0004365 | Ga0500573_0004365_5092_5862 | 256 |
| 1140 | 3300053142 | Ga0500577_0000239 | Ga0500577_0000239_9963_10733 | 256 |
| 1141 | 3300053145 | Ga0500586_000409 | Ga0500586_000409_4412_5185 | 256 |
| 1142 | 3300053146 | Ga0500588_0104321 | Ga0500588_0104321_154_927 | 256 |
| 1143 | 3300053148 | Ga0500590_036369 | Ga0500590_036369_402_1175 | 256 |
| 1144 | 3300053148 | Ga0500590_081314 | Ga0500590_081314_489_1259 | 256 |
| 1145 | 3300053150 | Ga0500603_001802 | Ga0500603_001802_2766_3536 | 256 |
| 1146 | 3300053150 | Ga0500603_002934 | Ga0500603_002934_55_825 | 256 |
| 1147 | 3300053150 | Ga0500603_059283 | Ga0500603_059283_136_906 | 256 |
| 1148 | 3300053151 | Ga0500604_0025305 | Ga0500604_0025305_650_1423 | 256 |
| 1149 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_239802_240572 | 256 |
| 1150 | 3300053153 | Ga0500616_0000033 | Ga0500616_0000033_130257_131030 | 256 |
| 1151 | 3300053156 | Ga0500622_0007863 | Ga0500622_0007863_25_798 | 256 |
| 1152 | 3300053156 | Ga0500622_0012142 | Ga0500622_0012142_3866_4639 | 256 |
| 1153 | 3300053158 | Ga0500627_0030694 | Ga0500627_0030694_133_903 | 256 |
| 1154 | 3300053159 | Ga0500630_001838 | Ga0500630_001838_3269_4039 | 256 |
| 1155 | 3300053160 | Ga0500633_0081565 | Ga0500633_0081565_277_1050 | 256 |
| 1156 | 3300053162 | Ga0500638_009710 | Ga0500638_009710_2035_2805 | 256 |
| 1157 | 3300053163 | Ga0500639_001285 | Ga0500639_001285_5889_6659 | 256 |
| 1158 | 3300053163 | Ga0500639_019202 | Ga0500639_019202_1117_1893 | 256 |
| 1159 | 3300053163 | Ga0500639_094416 | Ga0500639_094416_414_1184 | 256 |
| 1160 | 3300053177 | Ga0500636_0001477 | Ga0500636_0001477_11259_12032 | 256 |
| 1161 | 3300053177 | Ga0500636_0005231 | Ga0500636_0005231_6370_7140 | 256 |
| 1162 | 3300053177 | Ga0500636_0045273 | Ga0500636_0045273_929_1699 | 256 |
| 1163 | 3300053178 | Ga0500637_0000262 | Ga0500637_0000262_15177_15947 | 256 |
| 1164 | 3300053178 | Ga0500637_0017144 | Ga0500637_0017144_1275_2045 | 256 |
| 1165 | 3300053178 | Ga0500637_0077191 | Ga0500637_0077191_699_1469 | 256 |
| 1166 | 3300053730 | Ga0500645_018874 | Ga0500645_018874_671_1444 | 256 |
| 1167 | 3300053735 | Ga0500596_002379 | Ga0500596_002379_974_1744 | 256 |
| 1168 | 3300053735 | Ga0500596_011759 | Ga0500596_011759_180_953 | 256 |
| 1169 | 3300053737 | Ga0500601_010257 | Ga0500601_010257_55_825 | 256 |
| 1170 | 3300055283 | Ga0500661_000172 | Ga0500661_000172_1298_2068 | 256 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6saw-assembly2.cif.gz_E-2 | chromophore binding domain of bacteriophytochrome linked diguanylyl cyclase from idiomarina species a28l (dimeric pfr-like state). | 0.8036 | 202 | 234 |
| 5lly-assembly1.cif.gz_C | photosensory module of bacteriophytochrome linked diguanylyl cyclase from idiomarina species a28l | 0.792 | 202 | 232 |
| 5llw-assembly1.cif.gz_B | bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l | 0.7896 | 202 | 232 |
| 5llx-assembly1.cif.gz_A | bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l with gtp bound | 0.7873 | 202 | 232 |
| 5llx-assembly1.cif.gz_B | bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l with gtp bound | 0.7858 | 202 | 232 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54DY3_12_87_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.8165 | 207 | 232 | 3.30.450.30 |
| af_Q4CS17_13_234_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8143 | 209 | 234 | 3.50.50.60 |
| af_Q8I1T3_1_178_3.30.450.60 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8097 | 208 | 248 | 3.30.450.60 |
| af_C0HLF1_1_152_3.30.450.60 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8061 | 209 | 243 | 3.30.450.60 |
| af_Q8H1F4_3_152_3.30.450.60 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.794 | 207 | 236 | 3.30.450.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1Y302-F1-model_v4 | Anti-sigma factor | 0.951 | 112 | 252 |
|
| AF-A0A843SLT0-F1-model_v4 | Anti-sigma factor | 0.9509 | 111 | 250 |
GO:0006508
GO:0008237 |
| AF-A0A7C5GCF1-F1-model_v4 | Anti-sigma factor | 0.9466 | 122 | 250 |
|
| AF-A0A6J5BR83-F1-model_v4 | Anti-sigma factor | 0.9453 | 133 | 250 |
|
| AF-A0A349QGV3-F1-model_v4 | deleted | 0.9451 | 144 | 250 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar