F491147

General Info

Members Datasets Scaffolds Average Seq Length
1170 486 1139 256

Family's Representative Sequence

Representative Sequence 3300036459|Ga0372808_006082|Ga0372808_006082_157_1047
Length 296
Sequence MRQLSARASPTLIAPEVCCCRRASLFEPTIDNEEQAETTNMTDPKIPVTEDELHAFVDNELPAERRGDVEAWLAAHPEDAERVQSWRTMAEALHARYDAVANEPVPKRLEIERLMQQPRKWIYGMIAATLMAFVAGGGAGWLAHGAAVSPSMFKSFTVDALDAHRLYVVEVRHPVEVPGDERAHLQAWLTKRCGWDVQAPELDATGLKLVGGRLLPGPTGPASFLMYESASGERFTVYASKASAETTQMRYTTEDNDGALFWADHGVGYVVSGSSDRDRLTEVARLVYDQAEKSGG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
7 2643221651 Afipia sp. Root123D2 Isolate Unclassified
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2791355199
11 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
12 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
13 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
14 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
15 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
16 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
17 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
18 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
19 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
20 2906610324
21 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
22 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
23 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
24 2922425934
25 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
149 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
150 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
151 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
245 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
253 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
275 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
276 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
277 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
278 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
279 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
284 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
311 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
312 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
313 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
314 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
315 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
316 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
317 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
318 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
321 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
322 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
323 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
324 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
340 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
341 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
342 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
346 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
347 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
357 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
363 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
364 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
365 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
366 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
367 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
368 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
369 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
370 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
371 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
372 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
373 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
374 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
375 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
376 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
377 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
378 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
379 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
380 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
381 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
382 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
383 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
384 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
385 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
386 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
387 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
388 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
389 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
390 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
391 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
407 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
408 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
409 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
410 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
411 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
412 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
413 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
414 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
415 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
418 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
426 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
427 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
428 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
429 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
430 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
431 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
432 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
433 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
434 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
435 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
436 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
437 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
438 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
439 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
440 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
441 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
442 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
443 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
444 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
445 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
446 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
447 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
448 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
449 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
450 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
451 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
452 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
453 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
454 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
455 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
458 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
459 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
460 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
461 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
462 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
463 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
464 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
465 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
466 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
467 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
468 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
469 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
470 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
471 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
472 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
473 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
474 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
475 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
476 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
477 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
478 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
479 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
480 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
481 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
482 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
483 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
484 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
485 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
486 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0.69
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.6
Nodule 1.45
Rhizoplane 4.96
Rhizosphere 73.68
Stem 0
Stem Tuber 0
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006317 3300000549 Bacteria 1479
2 JGI24737J22298_10001768 3300001990 Bacteria 7736
3 JGI25153J46596_10003412 3300003215 Bacteria 8898
4 JGI25153J46596_10026735 3300003215 Bacteria 2037
5 Ga0006777J48905_1012525 3300003308 Bacteria 1316
6 rootH2_10115860 3300003320 Bacteria 1652
7 rootL2_10024455 3300003322 Bacteria 1568
8 rootH1_10044347 3300003323 Bacteria 2354
9 JGI25404J52841_10037718 3300003659 Bacteria 1027
10 Ga0055526_1031838 3300003771 Bacteria 1502
11 Ga0065165_1041708 3300005262 Bacteria 1360
12 Ga0070658_10019292 3300005327 Bacteria 5461
13 Ga0070658_10034116 3300005327 Bacteria 4094
14 Ga0070658_10271726 3300005327 Bacteria 1442
15 Ga0070683_100003303 3300005329 Bacteria 13041
16 Ga0070683_100040395 3300005329 Bacteria 4289
17 Ga0070683_100049222 3300005329 Bacteria 3897
18 Ga0070670_100184301 3300005331 Bacteria 1812
19 Ga0068869_100092114 3300005334 Bacteria 2281
20 Ga0070680_100030563 3300005336 Bacteria 4327
21 Ga0070680_100261526 3300005336 Bacteria 1464
22 Ga0070680_100417061 3300005336 Bacteria 1145
23 Ga0068868_100304927 3300005338 Bacteria 1353
24 Ga0070660_100001126 3300005339 Bacteria 18028
25 Ga0070660_100047104 3300005339 Bacteria 3307
26 Ga0070689_100652361 3300005340 Bacteria 915
27 Ga0070661_100013721 3300005344 Bacteria 5692
28 Ga0070668_100108941 3300005347 Bacteria 2203
29 Ga0070668_100118734 3300005347 Bacteria 2111
30 Ga0070668_100266734 3300005347 Bacteria 1425
31 Ga0070668_100277616 3300005347 Bacteria 1398
32 Ga0070668_100375144 3300005347 Bacteria 1209
33 Ga0070668_100406455 3300005347 Bacteria 1163
34 Ga0070675_100191642 3300005354 Bacteria 1771
35 Ga0070671_100034539 3300005355 Bacteria 4186
36 Ga0070671_100148618 3300005355 Bacteria 1978
37 Ga0070671_100148721 3300005355 Bacteria 1977
38 Ga0070674_100050181 3300005356 Bacteria 2872
39 Ga0070659_100010953 3300005366 Bacteria 6694
40 Ga0070659_100542944 3300005366 Bacteria 994
41 Ga0070667_100059884 3300005367 Bacteria 3222
42 Ga0070667_100100855 3300005367 Bacteria 2493
43 Ga0070667_100303982 3300005367 Bacteria 1437
44 Ga0070709_10018509 3300005434 Bacteria 4012
45 Ga0070709_10020362 3300005434 Bacteria 3848
46 Ga0070709_10075990 3300005434 Bacteria 2180
47 Ga0070709_10277985 3300005434 Bacteria 1216
48 Ga0070709_10362430 3300005434 Bacteria 1074
49 Ga0070714_100002134 3300005435 Bacteria 14537
50 Ga0070714_100022705 3300005435 Bacteria 5146
51 Ga0070714_100026305 3300005435 Bacteria 4808
52 Ga0070714_100084149 3300005435 Bacteria 2775
53 Ga0070714_100460661 3300005435 Bacteria 1209
54 Ga0070714_100563354 3300005435 Bacteria 1092
55 Ga0070714_100633225 3300005435 Bacteria 1029
56 Ga0070713_100024693 3300005436 Bacteria 4687
57 Ga0070713_100027055 3300005436 Bacteria 4512
58 Ga0070713_100053782 3300005436 Bacteria 3338
59 Ga0070713_100062854 3300005436 Bacteria 3111
60 Ga0070713_100097526 3300005436 Bacteria 2540
61 Ga0070713_100140124 3300005436 Bacteria 2141
62 Ga0070713_100464401 3300005436 Bacteria 1191
63 Ga0070710_10000869 3300005437 Bacteria 14456
64 Ga0070710_10002054 3300005437 Bacteria 9536
65 Ga0070710_10034900 3300005437 Bacteria 2738
66 Ga0070710_10076678 3300005437 Bacteria 1941
67 Ga0070710_10481898 3300005437 Bacteria 846
68 Ga0070701_10175276 3300005438 Bacteria 1251
69 Ga0070711_100001638 3300005439 Bacteria 12376
70 Ga0070711_100002128 3300005439 Bacteria 11223
71 Ga0070711_100010247 3300005439 Bacteria 5797
72 Ga0070711_100013567 3300005439 Bacteria 5117
73 Ga0070711_100023165 3300005439 Bacteria 4034
74 Ga0070711_100233615 3300005439 Bacteria 1435
75 Ga0070711_100253020 3300005439 Bacteria 1383
76 Ga0070711_100509365 3300005439 Bacteria 993
77 Ga0070663_100024391 3300005455 Bacteria 4071
78 Ga0070663_100030275 3300005455 Bacteria 3707
79 Ga0070663_100078737 3300005455 Bacteria 2417
80 Ga0070663_100162182 3300005455 Bacteria 1721
81 Ga0070678_100056469 3300005456 Bacteria 2872
82 Ga0070678_100066749 3300005456 Bacteria 2675
83 Ga0070678_100098709 3300005456 Bacteria 2258
84 Ga0070678_100158637 3300005456 Bacteria 1830
85 Ga0070662_100024079 3300005457 Bacteria 4190
86 Ga0070681_10019518 3300005458 Bacteria 6787
87 Ga0070681_10057834 3300005458 Bacteria 3858
88 Ga0070681_10058646 3300005458 Bacteria 3829
89 Ga0070681_10109584 3300005458 Bacteria 2701
90 Ga0070681_10273678 3300005458 Bacteria 1600
91 Ga0068867_100008066 3300005459 Bacteria 7440
92 Ga0070698_100077919 3300005471 Bacteria 3313
93 Ga0070699_100497984 3300005518 Bacteria 1107
94 Ga0070679_100013683 3300005530 Bacteria 7770
95 Ga0070679_100030393 3300005530 Bacteria 5333
96 Ga0070679_100060424 3300005530 Bacteria 3777
97 Ga0070679_100092886 3300005530 Bacteria 3005
98 Ga0070679_100146533 3300005530 Bacteria 2338
99 Ga0070679_100197687 3300005530 Bacteria 1977
100 Ga0070684_100030375 3300005535 Bacteria 4589
101 Ga0070684_100096932 3300005535 Bacteria 2629
102 Ga0070684_100115400 3300005535 Bacteria 2411
103 Ga0070684_100243608 3300005535 Bacteria 1643
104 Ga0070684_100246669 3300005535 Bacteria 1632
105 Ga0070684_100807973 3300005535 Bacteria 877
106 Ga0070697_100040365 3300005536 Bacteria 3776
107 Ga0068853_100002631 3300005539 Bacteria 13517
108 Ga0068853_100034375 3300005539 Bacteria 4302
109 Ga0068853_100038437 3300005539 Bacteria 4076
110 Ga0068853_100247085 3300005539 Bacteria 1636
111 Ga0068853_100695666 3300005539 Unclassified 969
112 Ga0070672_100069702 3300005543 Bacteria 2793
113 Ga0070672_100230303 3300005543 Bacteria 1556
114 Ga0070672_100250509 3300005543 Bacteria 1491
115 Ga0070686_100090732 3300005544 Bacteria 2043
116 Ga0070695_100395401 3300005545 Bacteria 1046
117 Ga0070696_100272168 3300005546 Bacteria 1288
118 Ga0070665_100054477 3300005548 Bacteria 4011
119 Ga0070665_100063343 3300005548 Bacteria 3707
120 Ga0070665_100103479 3300005548 Bacteria 2850
121 Ga0070665_100155974 3300005548 Bacteria 2285
122 Ga0070665_100246669 3300005548 Bacteria 1786
123 Ga0070665_100375196 3300005548 Bacteria 1429
124 Ga0068855_100009152 3300005563 Bacteria 11961
125 Ga0068855_100012743 3300005563 Bacteria 10140
126 Ga0068855_100029305 3300005563 Bacteria 6582
127 Ga0068855_100107428 3300005563 Bacteria 3206
128 Ga0068855_100108093 3300005563 Bacteria 3195
129 Ga0068855_100233987 3300005563 Bacteria 2055
130 Ga0068855_100350593 3300005563 Bacteria 1626
131 Ga0068855_100477272 3300005563 Bacteria 1358
132 Ga0068855_100870260 3300005563 Bacteria 953
133 Ga0070664_100173417 3300005564 Bacteria 1914
134 Ga0068857_100010916 3300005577 Bacteria 7907
135 Ga0068857_100111646 3300005577 Bacteria 2458
136 Ga0068857_100449801 3300005577 Bacteria 1204
137 Ga0068854_100046207 3300005578 Bacteria 3099
138 Ga0068854_100135231 3300005578 Bacteria 1886
139 Ga0068854_100142231 3300005578 Bacteria 1842
140 Ga0068854_100404860 3300005578 Bacteria 1130
141 Ga0068854_100470440 3300005578 Bacteria 1053
142 Ga0068856_100000505 3300005614 Bacteria 43297
143 Ga0068856_100003706 3300005614 Bacteria 15331
144 Ga0068856_100005176 3300005614 Bacteria 12875
145 Ga0068856_100013224 3300005614 Bacteria 7992
146 Ga0068856_100122875 3300005614 Bacteria 2599
147 Ga0068856_100343639 3300005614 Bacteria 1511
148 Ga0070702_100182398 3300005615 Bacteria 1375
149 Ga0070702_100348618 3300005615 Bacteria 1042
150 Ga0068852_100006419 3300005616 Bacteria 8497
151 Ga0068852_100011300 3300005616 Bacteria 6716
152 Ga0068852_100057367 3300005616 Bacteria 3369
153 Ga0068852_100081648 3300005616 Bacteria 2870
154 Ga0068852_100129445 3300005616 Bacteria 2322
155 Ga0068852_100292315 3300005616 Bacteria 1574
156 Ga0068852_100394018 3300005616 Bacteria 1361
157 Ga0068859_100169985 3300005617 Bacteria 2261
158 Ga0068864_100023598 3300005618 Bacteria 5168
159 Ga0068864_100223959 3300005618 Bacteria 1736
160 Ga0068866_10017775 3300005718 Bacteria 3203
161 Ga0068861_100135350 3300005719 Bacteria 2004
162 Ga0068861_100161939 3300005719 Bacteria 1846
163 Ga0068861_100210584 3300005719 Bacteria 1637
164 Ga0068861_100324686 3300005719 Bacteria 1341
165 Ga0068851_10001156 3300005834 Bacteria 11450
166 Ga0068851_10011174 3300005834 Bacteria 4205
167 Ga0068851_10193561 3300005834 Bacteria 1131
168 Ga0068870_10141997 3300005840 Bacteria 1406
169 Ga0068863_100238926 3300005841 Bacteria 1753
170 Ga0068863_100273194 3300005841 Bacteria 1636
171 Ga0068858_100307433 3300005842 Bacteria 1513
172 Ga0068860_100001118 3300005843 Bacteria 29537
173 Ga0068860_100149647 3300005843 Bacteria 2247
174 Ga0068860_100515333 3300005843 Bacteria 1195
175 Ga0068862_100193470 3300005844 Bacteria 1831
176 Ga0068862_100463610 3300005844 Bacteria 1196
177 Ga0068862_100798318 3300005844 Bacteria 921
178 Ga0081455_10026711 3300005937 Bacteria 5301
179 Ga0081455_10054044 3300005937 Bacteria 3426
180 Ga0081455_10067184 3300005937 Bacteria 2989
181 Ga0081455_10085022 3300005937 Bacteria 2581
182 Ga0081455_10330485 3300005937 Bacteria 1082
183 Ga0081540_1003833 3300005983 Bacteria 11767
184 Ga0081540_1003852 3300005983 Bacteria 11717
185 Ga0081540_1014162 3300005983 Bacteria 5131
186 Ga0081540_1053246 3300005983 Bacteria 1986
187 Ga0081540_1097116 3300005983 Bacteria 1280
188 Ga0081540_1121082 3300005983 Bacteria 1086
189 Ga0081540_1128391 3300005983 Bacteria 1040
190 Ga0081539_10000003 3300005985 Bacteria 594833
191 Ga0081539_10000199 3300005985 Bacteria 139305
192 Ga0081539_10011226 3300005985 Bacteria 7124
193 Ga0081539_10091375 3300005985 Bacteria 1573
194 Ga0070717_10000877 3300006028 Bacteria 19877
195 Ga0070717_10050603 3300006028 Bacteria 3416
196 Ga0070717_10052422 3300006028 Bacteria 3360
197 Ga0070717_10259682 3300006028 Bacteria 1537
198 Ga0070717_10276491 3300006028 Bacteria 1488
199 Ga0075365_10034155 3300006038 Bacteria 3283
200 Ga0075365_10074211 3300006038 Bacteria 2294
201 Ga0075365_10135542 3300006038 Bacteria 1706
202 Ga0075365_10254275 3300006038 Bacteria 1235
203 Ga0075365_10293690 3300006038 Bacteria 1143
204 Ga0075363_100000869 3300006048 Bacteria 10595
205 Ga0075363_100059406 3300006048 Bacteria 2056
206 Ga0075363_100205554 3300006048 Bacteria 1126
207 Ga0075364_10041151 3300006051 Bacteria 2999
208 Ga0075364_10289562 3300006051 Bacteria 1114
209 Ga0075364_10334752 3300006051 Bacteria 1031
210 Ga0070715_10000097 3300006163 Bacteria 21581
211 Ga0070715_10012186 3300006163 Bacteria 3121
212 Ga0070716_100036969 3300006173 Bacteria 2695
213 Ga0070716_100088225 3300006173 Bacteria 1870
214 Ga0070716_100130543 3300006173 Bacteria 1587
215 Ga0070716_100219623 3300006173 Bacteria 1276
216 Ga0070716_100533039 3300006173 Bacteria 872
217 Ga0070712_100008651 3300006175 Bacteria 6410
218 Ga0070712_100031048 3300006175 Bacteria 3596
219 Ga0070712_100043775 3300006175 Bacteria 3084
220 Ga0070712_100072270 3300006175 Bacteria 2470
221 Ga0070712_100432392 3300006175 Bacteria 1093
222 Ga0075362_10049030 3300006177 Bacteria 1885
223 Ga0075367_10090351 3300006178 Bacteria 1862
224 Ga0075367_10238426 3300006178 Bacteria 1139
225 Ga0075369_10037853 3300006186 Bacteria 2056
226 Ga0075366_10158205 3300006195 Bacteria 1372
227 Ga0097621_100158115 3300006237 Bacteria 1946
228 Ga0097621_100207232 3300006237 Bacteria 1704
229 Ga0075370_10015658 3300006353 Bacteria 4065
230 Ga0068871_100177603 3300006358 Bacteria 1828
231 Ga0068871_100381292 3300006358 Bacteria 1252
232 Ga0075428_100109348 3300006844 Bacteria 3012
233 Ga0075428_100222393 3300006844 Bacteria 2038
234 Ga0075434_100051816 3300006871 Bacteria 4078
235 Ga0097620_100169978 3300006931 Bacteria 2261
236 Ga0075435_100123099 3300007076 Bacteria 2165
237 Ga0099794_10007546 3300007265 Bacteria 4474
238 Ga0099794_10056404 3300007265 Bacteria 1901
239 Ga0099795_10022059 3300007788 Bacteria 2097
240 Ga0099795_10062412 3300007788 Bacteria 1386
241 Ga0105250_10028114 3300009092 Bacteria 2265
242 Ga0105240_10004584 3300009093 Bacteria 20953
243 Ga0105240_10008073 3300009093 Bacteria 15126
244 Ga0105240_10014611 3300009093 Bacteria 10714
245 Ga0105240_10027790 3300009093 Bacteria 7402
246 Ga0105240_10190656 3300009093 Bacteria 2411
247 Ga0105240_10371331 3300009093 Bacteria 1617
248 Ga0105245_10074181 3300009098 Bacteria 3095
249 Ga0105245_10256732 3300009098 Bacteria 1700
250 Ga0105245_10392154 3300009098 Bacteria 1386
251 Ga0105245_11014968 3300009098 Bacteria 874
252 Ga0105247_10047230 3300009101 Bacteria 2643
253 Ga0105247_10221319 3300009101 Bacteria 1281
254 Ga0105247_10307748 3300009101 Bacteria 1101
255 Ga0114129_10029983 3300009147 Bacteria 7703
256 Ga0105243_10013895 3300009148 Bacteria 6094
257 Ga0105241_10006953 3300009174 Bacteria 8326
258 Ga0105241_10202834 3300009174 Bacteria 1658
259 Ga0105242_10046792 3300009176 Bacteria 3511
260 Ga0105248_10104039 3300009177 Bacteria 3200
261 Ga0105248_10232662 3300009177 Bacteria 2074
262 Ga0105237_10059625 3300009545 Bacteria 3817
263 Ga0105237_10068507 3300009545 Bacteria 3542
264 Ga0105237_10084203 3300009545 Bacteria 3171
265 Ga0105237_10111604 3300009545 Bacteria 2726
266 Ga0105237_10359508 3300009545 Bacteria 1460
267 Ga0105237_10370604 3300009545 Bacteria 1437
268 Ga0105237_10540123 3300009545 Bacteria 1172
269 Ga0105238_10000514 3300009551 Bacteria 40634
270 Ga0105238_10003122 3300009551 Bacteria 16527
271 Ga0105238_10005508 3300009551 Bacteria 12502
272 Ga0105238_10052584 3300009551 Bacteria 4095
273 Ga0105238_10094377 3300009551 Bacteria 2979
274 Ga0105238_10387041 3300009551 Bacteria 1390
275 Ga0105238_10494024 3300009551 Bacteria 1224
276 Ga0105249_10133967 3300009553 Bacteria 2369
277 Ga0105249_10198083 3300009553 Bacteria 1964
278 Ga0099796_10012565 3300010159 Bacteria 2395
279 Ga0105239_10005274 3300010375 Bacteria 15193
280 Ga0105239_10006195 3300010375 Bacteria 13920
281 Ga0105239_10098984 3300010375 Bacteria 3224
282 Ga0105239_10154485 3300010375 Bacteria 2562
283 Ga0105239_10203170 3300010375 Bacteria 2220
284 Ga0105239_10489518 3300010375 Bacteria 1398
285 Ga0105239_10688720 3300010375 Bacteria 1168
286 Ga0105239_10709170 3300010375 Bacteria 1151
287 Ga0157373_10078661 3300013100 Bacteria 2325
288 Ga0157371_10010534 3300013102 Bacteria 7190
289 Ga0157371_10304228 3300013102 Unclassified 1155
290 Ga0157370_10043547 3300013104 Bacteria 4318
291 Ga0157370_10085199 3300013104 Bacteria 2968
292 Ga0157370_10423169 3300013104 Bacteria 1225
293 Ga0157369_10013290 3300013105 Bacteria 9315
294 Ga0157369_10042781 3300013105 Bacteria 4942
295 Ga0157369_10045117 3300013105 Bacteria 4796
296 Ga0157369_10249624 3300013105 Bacteria 1852
297 Ga0157374_10071052 3300013296 Bacteria 3281
298 Ga0157374_10094370 3300013296 Bacteria 2859
299 Ga0157374_10505326 3300013296 Bacteria 1214
300 Ga0157378_10230816 3300013297 Bacteria 1763
301 Ga0157378_10324120 3300013297 Bacteria 1497
302 Ga0157378_10641265 3300013297 Bacteria 1077
303 Ga0163162_10013124 3300013306 Bacteria 8088
304 Ga0163162_10062945 3300013306 Bacteria 3751
305 Ga0163162_10308505 3300013306 Bacteria 1715
306 Ga0157372_10045190 3300013307 Bacteria 4884
307 Ga0157375_10004177 3300013308 Bacteria 12533
308 Ga0163163_10094162 3300014325 Bacteria 3013
309 Ga0163163_10115161 3300014325 Bacteria 2720
310 Ga0163163_10142805 3300014325 Bacteria 2436
311 Ga0163163_10277211 3300014325 Bacteria 1728
312 Ga0163163_10600751 3300014325 Bacteria 1163
313 Ga0157380_10506138 3300014326 Bacteria 1174
314 Ga0157377_10082353 3300014745 Bacteria 1884
315 Ga0157379_10120583 3300014968 Bacteria 2359
316 Ga0157379_10156684 3300014968 Bacteria 2055
317 Ga0157379_10162954 3300014968 Bacteria 2013
318 Ga0157376_10119674 3300014969 Bacteria 2332
319 Ga0157376_10187389 3300014969 Bacteria 1895
320 Ga0157376_10535805 3300014969 Bacteria 1156
321 Ga0163161_10066771 3300017792 Bacteria 2627
322 Ga0197907_10288381 3300020069 Bacteria 1599
323 Ga0197907_10522121 3300020069 Bacteria 2197
324 Ga0206356_11303995 3300020070 Bacteria 1589
325 Ga0206356_11334192 3300020070 Bacteria 1682
326 Ga0206350_10556797 3300020080 Bacteria 1358
327 Ga0206353_10940261 3300020082 Bacteria 2798
328 Ga0213874_10031886 3300021377 Bacteria 1527
329 Ga0213876_10010932 3300021384 Bacteria 4861
330 Ga0213876_10085289 3300021384 Bacteria 1671
331 Ga0213876_10190284 3300021384 Bacteria 1091
332 Ga0213875_10155114 3300021388 Bacteria 1074
333 Ga0213871_10005850 3300021441 Bacteria 2569
334 Ga0224572_1001489 3300024225 Bacteria 3484
335 Ga0224572_1007287 3300024225 Bacteria 2024
336 Ga0228598_1008279 3300024227 Bacteria 2104
337 Ga0209677_100241 3300025253 Bacteria 37674
338 Ga0209148_1004574 3300025254 Bacteria 3369
339 Ga0209233_1004313 3300025261 Bacteria 4860
340 Ga0209233_1004699 3300025261 Bacteria 4605
341 Ga0209455_1001933 3300025272 Bacteria 8558
342 Ga0209564_1002116 3300025295 Bacteria 16873
343 Ga0209758_1000720 3300025297 Bacteria 48767
344 Ga0209758_1002070 3300025297 Bacteria 21421
345 Ga0207656_10002763 3300025321 Bacteria 5957
346 Ga0207656_10141760 3300025321 Unclassified 1133
347 Ga0207653_10043061 3300025885 Bacteria 1486
348 Ga0207682_10075127 3300025893 Bacteria 1438
349 Ga0207692_10001993 3300025898 Bacteria 7798
350 Ga0207692_10002157 3300025898 Bacteria 7518
351 Ga0207642_10020500 3300025899 Bacteria 2582
352 Ga0207710_10117487 3300025900 Bacteria 1267
353 Ga0207647_10054116 3300025904 Bacteria 2470
354 Ga0207685_10000990 3300025905 Bacteria 5494
355 Ga0207685_10046986 3300025905 Bacteria 1646
356 Ga0207699_10000253 3300025906 Bacteria 29543
357 Ga0207699_10004697 3300025906 Bacteria 6525
358 Ga0207699_10015823 3300025906 Bacteria 3930
359 Ga0207699_10040953 3300025906 Bacteria 2672
360 Ga0207699_10111963 3300025906 Bacteria 1751
361 Ga0207699_10189381 3300025906 Bacteria 1387
362 Ga0207699_10205930 3300025906 Bacteria 1335
363 Ga0207705_10012927 3300025909 Bacteria 6023
364 Ga0207705_10032892 3300025909 Bacteria 3705
365 Ga0207705_10064461 3300025909 Bacteria 2648
366 Ga0207705_10154377 3300025909 Bacteria 1722
367 Ga0207654_10000526 3300025911 Bacteria 21868
368 Ga0207654_10014836 3300025911 Bacteria 4033
369 Ga0207707_10001093 3300025912 Bacteria 25844
370 Ga0207707_10006358 3300025912 Bacteria 10317
371 Ga0207707_10049372 3300025912 Bacteria 3666
372 Ga0207707_10054162 3300025912 Bacteria 3492
373 Ga0207707_10091475 3300025912 Bacteria 2659
374 Ga0207707_10116020 3300025912 Bacteria 2340
375 Ga0207707_10187798 3300025912 Bacteria 1803
376 Ga0207707_10479515 3300025912 Bacteria 1062
377 Ga0207695_10000163 3300025913 Bacteria 197030
378 Ga0207695_10000286 3300025913 Bacteria 125310
379 Ga0207695_10019088 3300025913 Bacteria 7907
380 Ga0207695_10022532 3300025913 Bacteria 7146
381 Ga0207695_10089735 3300025913 Bacteria 3090
382 Ga0207695_10438549 3300025913 Bacteria 1190
383 Ga0207671_10015168 3300025914 Bacteria 6052
384 Ga0207671_10026189 3300025914 Bacteria 4372
385 Ga0207671_10029468 3300025914 Bacteria 4098
386 Ga0207671_10165071 3300025914 Bacteria 1717
387 Ga0207671_10247068 3300025914 Bacteria 1402
388 Ga0207671_10248510 3300025914 Bacteria 1398
389 Ga0207671_10270796 3300025914 Bacteria 1338
390 Ga0207693_10000541 3300025915 Bacteria 34205
391 Ga0207693_10024218 3300025915 Bacteria 4820
392 Ga0207693_10036490 3300025915 Bacteria 3875
393 Ga0207693_10069864 3300025915 Bacteria 2748
394 Ga0207693_10282442 3300025915 Bacteria 1301
395 Ga0207663_10000261 3300025916 Bacteria 22957
396 Ga0207663_10041918 3300025916 Bacteria 2793
397 Ga0207663_10046871 3300025916 Bacteria 2665
398 Ga0207660_10026628 3300025917 Bacteria 3938
399 Ga0207660_10127810 3300025917 Bacteria 1931
400 Ga0207660_10201882 3300025917 Bacteria 1553
401 Ga0207660_10292197 3300025917 Bacteria 1296
402 Ga0207660_10400034 3300025917 Unclassified 1106
403 Ga0207657_10002321 3300025919 Bacteria 20614
404 Ga0207657_10036408 3300025919 Bacteria 4405
405 Ga0207657_10120589 3300025919 Bacteria 2158
406 Ga0207649_10019853 3300025920 Bacteria 3846
407 Ga0207649_10552560 3300025920 Bacteria 881
408 Ga0207652_10002982 3300025921 Bacteria 14138
409 Ga0207652_10014050 3300025921 Bacteria 6481
410 Ga0207652_10020676 3300025921 Bacteria 5424
411 Ga0207652_10041013 3300025921 Bacteria 3933
412 Ga0207652_10091653 3300025921 Bacteria 2673
413 Ga0207652_10161430 3300025921 Bacteria 2009
414 Ga0207652_10218318 3300025921 Bacteria 1718
415 Ga0207652_10248296 3300025921 Bacteria 1605
416 Ga0207652_10273737 3300025921 Bacteria 1523
417 Ga0207681_10337810 3300025923 Bacteria 1202
418 Ga0207694_10000120 3300025924 Bacteria 83624
419 Ga0207694_10005198 3300025924 Bacteria 10050
420 Ga0207694_10024012 3300025924 Bacteria 4630
421 Ga0207694_10036032 3300025924 Bacteria 3795
422 Ga0207694_10083458 3300025924 Bacteria 2512
423 Ga0207650_10299343 3300025925 Bacteria 1313
424 Ga0207659_10288701 3300025926 Bacteria 1343
425 Ga0207687_10109032 3300025927 Bacteria 2051
426 Ga0207687_10319657 3300025927 Bacteria 1256
427 Ga0207700_10003910 3300025928 Bacteria 8701
428 Ga0207700_10013470 3300025928 Bacteria 5324
429 Ga0207700_10021957 3300025928 Bacteria 4371
430 Ga0207700_10040335 3300025928 Bacteria 3407
431 Ga0207700_10063044 3300025928 Bacteria 2818
432 Ga0207700_10084230 3300025928 Bacteria 2491
433 Ga0207664_10004837 3300025929 Bacteria 9154
434 Ga0207664_10069877 3300025929 Bacteria 2824
435 Ga0207664_10187324 3300025929 Bacteria 1780
436 Ga0207664_10440078 3300025929 Bacteria 1163
437 Ga0207664_10442830 3300025929 Bacteria 1159
438 Ga0207664_10721955 3300025929 Bacteria 896
439 Ga0207644_10078270 3300025931 Bacteria 2437
440 Ga0207690_10015539 3300025932 Bacteria 4614
441 Ga0207690_10243760 3300025932 Bacteria 1385
442 Ga0207706_10230369 3300025933 Bacteria 1621
443 Ga0207706_10232786 3300025933 Bacteria 1611
444 Ga0207706_10453133 3300025933 Bacteria 1109
445 Ga0207709_10049331 3300025935 Bacteria 2569
446 Ga0207704_10014465 3300025938 Bacteria 3984
447 Ga0207704_10201888 3300025938 Bacteria 1456
448 Ga0207665_10000280 3300025939 Bacteria 35528
449 Ga0207665_10022222 3300025939 Bacteria 4171
450 Ga0207665_10041508 3300025939 Bacteria 3073
451 Ga0207665_10092061 3300025939 Bacteria 2103
452 Ga0207691_10071603 3300025940 Bacteria 3128
453 Ga0207691_10237979 3300025940 Bacteria 1575
454 Ga0207711_10192920 3300025941 Bacteria 1857
455 Ga0207689_10405390 3300025942 Bacteria 1137
456 Ga0207661_10002972 3300025944 Bacteria 11725
457 Ga0207661_10018500 3300025944 Bacteria 5176
458 Ga0207667_10001834 3300025949 Bacteria 26705
459 Ga0207667_10007460 3300025949 Bacteria 13140
460 Ga0207667_10032845 3300025949 Bacteria 5586
461 Ga0207667_10098220 3300025949 Bacteria 3022
462 Ga0207667_10152583 3300025949 Bacteria 2377
463 Ga0207667_10187258 3300025949 Bacteria 2124
464 Ga0207667_10437857 3300025949 Bacteria 1329
465 Ga0207667_10562118 3300025949 Bacteria 1153
466 Ga0207651_10246120 3300025960 Bacteria 1460
467 Ga0207651_10287634 3300025960 Bacteria 1361
468 Ga0207712_10219666 3300025961 Bacteria 1519
469 Ga0207712_10608762 3300025961 Bacteria 946
470 Ga0207712_10621311 3300025961 Bacteria 937
471 Ga0207668_10071073 3300025972 Bacteria 2484
472 Ga0207668_10139272 3300025972 Bacteria 1863
473 Ga0207640_10071327 3300025981 Bacteria 2339
474 Ga0207640_10145075 3300025981 Bacteria 1736
475 Ga0207640_10519393 3300025981 Bacteria 995
476 Ga0207658_10430999 3300025986 Bacteria 1164
477 Ga0207703_10080853 3300026035 Bacteria 2707
478 Ga0207703_10272724 3300026035 Bacteria 1533
479 Ga0207703_10669911 3300026035 Bacteria 985
480 Ga0207639_10003014 3300026041 Bacteria 11337
481 Ga0207639_10031045 3300026041 Bacteria 3924
482 Ga0207639_10081468 3300026041 Bacteria 2564
483 Ga0207639_10379064 3300026041 Bacteria 1270
484 Ga0207678_10006176 3300026067 Bacteria 10655
485 Ga0207678_10014837 3300026067 Bacteria 6854
486 Ga0207678_10044946 3300026067 Bacteria 3819
487 Ga0207678_10054813 3300026067 Bacteria 3434
488 Ga0207678_10067235 3300026067 Bacteria 3076
489 Ga0207678_10076408 3300026067 Bacteria 2869
490 Ga0207678_10284513 3300026067 Bacteria 1420
491 Ga0207678_10491946 3300026067 Bacteria 1069
492 Ga0207708_10153445 3300026075 Bacteria 1815
493 Ga0207702_10000019 3300026078 Bacteria 211843
494 Ga0207702_10000127 3300026078 Bacteria 89755
495 Ga0207702_10017659 3300026078 Bacteria 5903
496 Ga0207702_10063987 3300026078 Bacteria 3147
497 Ga0207702_10112912 3300026078 Bacteria 2419
498 Ga0207641_10193664 3300026088 Bacteria 1870
499 Ga0207641_10320313 3300026088 Bacteria 1470
500 Ga0207648_10035881 3300026089 Bacteria 4369
501 Ga0207648_10390145 3300026089 Bacteria 1260
502 Ga0207676_10150451 3300026095 Bacteria 2004
503 Ga0207676_10242911 3300026095 Bacteria 1616
504 Ga0207676_10315786 3300026095 Bacteria 1432
505 Ga0207676_10342551 3300026095 Bacteria 1380
506 Ga0207674_10004566 3300026116 Bacteria 16628
507 Ga0207674_10008031 3300026116 Bacteria 12231
508 Ga0207674_10020772 3300026116 Bacteria 7087
509 Ga0207674_10271668 3300026116 Bacteria 1643
510 Ga0207674_10476658 3300026116 Bacteria 1206
511 Ga0207675_100453582 3300026118 Bacteria 1271
512 Ga0207675_100505572 3300026118 Bacteria 1203
513 Ga0207683_10013367 3300026121 Bacteria 7001
514 Ga0207683_10028505 3300026121 Bacteria 4828
515 Ga0207683_10096117 3300026121 Bacteria 2642
516 Ga0207683_10097310 3300026121 Bacteria 2624
517 Ga0207683_10177126 3300026121 Bacteria 1933
518 Ga0207698_10105593 3300026142 Bacteria 2347
519 Ga0207698_10181890 3300026142 Bacteria 1863
520 Ga0207698_10233558 3300026142 Bacteria 1671
521 Ga0207698_10310003 3300026142 Bacteria 1473
522 Ga0207698_10648973 3300026142 Bacteria 1045
523 Ga0209588_1024398 3300027671 Bacteria 1909
524 Ga0265357_1001110 3300028023 Bacteria 1874
525 Ga0268266_10133677 3300028379 Bacteria 2220
526 Ga0268266_10175416 3300028379 Bacteria 1948
527 Ga0268266_10370150 3300028379 Bacteria 1349
528 Ga0268266_10496218 3300028379 Bacteria 1165
529 Ga0268265_10023019 3300028380 Bacteria 4386
530 Ga0268265_10585604 3300028380 Bacteria 1064
531 Ga0268264_10000030 3300028381 Bacteria 418542
532 Ga0268264_10400277 3300028381 Bacteria 1319
533 Ga0268264_10460019 3300028381 Bacteria 1234
534 Ga0265323_10011073 3300028653 Bacteria 3646
535 Ga0265336_10000125 3300028666 Bacteria 57377
536 Ga0307517_10000744 3300028786 Bacteria 56253
537 Ga0307517_10116215 3300028786 Bacteria 2004
538 Ga0307515_10084138 3300028794 Bacteria 4090
539 Ga0307515_10304581 3300028794 Bacteria 1275
540 Ga0265338_10000085 3300028800 Bacteria 175080
541 Ga0265338_10044048 3300028800 Bacteria 4126
542 Ga0265338_10047212 3300028800 Bacteria 3935
543 Ga0265338_10348293 3300028800 Bacteria 1066
544 Ga0265330_10009899 3300031235 Bacteria 4512
545 Ga0265332_10006066 3300031238 Bacteria 5520
546 Ga0265328_10012115 3300031239 Bacteria 3435
547 Ga0265325_10048757 3300031241 Bacteria 2188
548 Ga0265325_10082413 3300031241 Unclassified 1596
549 Ga0265340_10061536 3300031247 Bacteria 1795
550 Ga0265340_10102494 3300031247 Bacteria 1329
551 Ga0265339_10000047 3300031249 Bacteria 110601
552 Ga0265339_10038296 3300031249 Bacteria 2676
553 Ga0265339_10047059 3300031249 Bacteria 2369
554 Ga0265316_10089764 3300031344 Bacteria 2345
555 Ga0265316_10381064 3300031344 Bacteria 1017
556 Ga0307513_10345524 3300031456 Bacteria 1237
557 Ga0307513_10389891 3300031456 Bacteria 1130
558 Ga0307509_10249997 3300031507 Bacteria 1557
559 Ga0307509_10347576 3300031507 Bacteria 1208
560 Ga0265313_10000069 3300031595 Bacteria 100065
561 Ga0265313_10024594 3300031595 Bacteria 3213
562 Ga0307508_10000051 3300031616 Bacteria 134500
563 Ga0307508_10346029 3300031616 Bacteria 1078
564 Ga0265314_10015576 3300031711 Bacteria 6028
565 Ga0265314_10084897 3300031711 Bacteria 2077
566 Ga0265314_10102869 3300031711 Bacteria 1832
567 Ga0265342_10000502 3300031712 Bacteria 41908
568 Ga0265342_10007293 3300031712 Bacteria 8115
569 Ga0265342_10018370 3300031712 Bacteria 4532
570 Ga0265342_10065729 3300031712 Bacteria 2125
571 Ga0265342_10087021 3300031712 Bacteria 1796
572 Ga0307516_10015568 3300031730 Bacteria 7997
573 Ga0307516_10112595 3300031730 Bacteria 2521
574 Ga0307516_10186574 3300031730 Bacteria 1803
575 Ga0307516_10317292 3300031730 Bacteria 1230
576 Ga0307405_10136547 3300031731 Bacteria 1703
577 Ga0307405_10137974 3300031731 Bacteria 1696
578 Ga0307405_10251334 3300031731 Bacteria 1316
579 Ga0307406_10296540 3300031901 Bacteria 1240
580 Ga0307406_10535555 3300031901 Bacteria 955
581 Ga0307407_10407133 3300031903 Bacteria 977
582 Ga0307412_10309880 3300031911 Bacteria 1251
583 Ga0307412_10332256 3300031911 Bacteria 1213
584 Ga0307409_100151544 3300031995 Bacteria 2013
585 Ga0307416_100054843 3300032002 Bacteria 3206
586 Ga0307411_10119714 3300032005 Bacteria 1902
587 Ga0307415_100169177 3300032126 Bacteria 1702
588 Ga0307415_100458004 3300032126 Bacteria 1104
589 Ga0307507_10007677 3300033179 Bacteria 15449
590 Ga0307510_10005901 3300033180 Bacteria 14608
591 Ga0307510_10071695 3300033180 Bacteria 3448
592 Ga0373926_0128120 3300035083 Bacteria 960
593 Ga0373923_0001064 3300035111 Bacteria 7518
594 Ga0373923_0004092 3300035111 Bacteria 4794
595 Ga0373923_0044311 3300035111 Bacteria 1844
596 Ga0373936_0003661 3300035113 Bacteria 5768
597 Ga0373936_0008030 3300035113 Bacteria 3966
598 Ga0373936_0071436 3300035113 Bacteria 1431
599 Ga0373945_0014404 3300035116 Bacteria 2649
600 Ga0373953_0019853 3300035117 Bacteria 2505
601 Ga0373953_0038072 3300035117 Bacteria 1901
602 Ga0373954_0000418 3300035118 Bacteria 15854
603 Ga0373954_0009743 3300035118 Bacteria 4231
604 Ga0373956_0000845 3300035119 Bacteria 12743
605 Ga0373956_0075896 3300035119 Bacteria 1537
606 Ga0373957_0000695 3300035120 Bacteria 8699
607 Ga0373957_0003864 3300035120 Bacteria 4491
608 Ga0373957_0114384 3300035120 Bacteria 1089
609 Ga0373943_0133020 3300035170 Bacteria 1333
610 Ga0373943_0144993 3300035170 Bacteria 1282
611 Ga0373946_0018140 3300035171 Bacteria 2698
612 Ga0373946_0111972 3300035171 Bacteria 1236
613 Ga0373955_0014293 3300035172 Bacteria 3858
614 Ga0373955_0145390 3300035172 Bacteria 1392
615 Ga0373924_0011574 3300035410 Bacteria 3279
616 Ga0373924_0019764 3300035410 Bacteria 2612
617 Ga0373924_0021465 3300035410 Bacteria 2519
618 Ga0373931_0182961 3300035691 Bacteria 1242
619 Ga0373935_0004409 3300035692 Bacteria 8264
620 Ga0373935_0030931 3300035692 Bacteria 3318
621 Ga0373927_0011920 3300035695 Bacteria 5786
622 Ga0373927_0013700 3300035695 Bacteria 5384
623 Ga0373927_0013723 3300035695 Bacteria 5379
624 Ga0373927_0047822 3300035695 Bacteria 2767
625 Ga0373927_0181775 3300035695 Bacteria 1379
626 Ga0373933_0004721 3300035724 Bacteria 7452
627 Ga0373933_0006387 3300035724 Bacteria 6416
628 Ga0373933_0007858 3300035724 Bacteria 5825
629 Ga0373933_0211092 3300035724 Bacteria 1244
630 Ga0373933_0267515 3300035724 Bacteria 1103
631 Ga0373947_0004935 3300035725 Bacteria 7803
632 Ga0373947_0029427 3300035725 Bacteria 3223
633 Ga0373937_0037050 3300036401 Bacteria 4444
634 Ga0373937_0040658 3300036401 Bacteria 4239
635 Ga0373937_0041120 3300036401 Bacteria 4217
636 Ga0373937_0135194 3300036401 Bacteria 2305
637 Ga0373937_0262002 3300036401 Bacteria 1630
638 Ga0372808_006082 3300036459 Bacteria 1616
639 Ga0373925_0004584 3300037068 Bacteria 10440
640 Ga0373925_0013971 3300037068 Bacteria 5812
641 Ga0373925_0068622 3300037068 Bacteria 2677
642 Ga0395900_0533277 3300037418 Bacteria 1120
643 Ga0395898_0100762 3300037466 Bacteria 2774
644 Ga0395898_0232296 3300037466 Bacteria 1759
645 Ga0395905_0190789 3300037471 Bacteria 1922
646 Ga0436364_0767694 3300037853 Bacteria 5645
647 Ga0436364_1169404 3300037853 Bacteria 992
648 Ga0436364_1204997 3300037853 Bacteria 1445
649 Ga0395901_0095869 3300038443 Bacteria 3109
650 Ga0395901_0516617 3300038443 Bacteria 1214
651 Ga0436365_0075269 3300039437 Bacteria 2385
652 Ga0436365_0167764 3300039437 Bacteria 15121
653 Ga0436365_0262407 3300039437 Bacteria 1495
654 Ga0436365_0276616 3300039437 Bacteria 4975
655 Ga0436365_0447222 3300039437 Bacteria 2191
656 Ga0436365_0743040 3300039437 Bacteria 1928
657 Ga0436365_1331117 3300039437 Bacteria 1468
658 Ga0436365_1826002 3300039437 Bacteria 2445
659 Ga0436360_0305024 3300039438 Bacteria 1029
660 Ga0436361_1012338 3300039447 Bacteria 9605
661 Ga0436363_1050788 3300039450 Bacteria 1270
662 Ga0436363_1366818 3300039450 Bacteria 2134
663 Ga0436362_0817319 3300039453 Bacteria 4121
664 Ga0436362_0938097 3300039453 Bacteria 1960
665 Ga0451795_0811766 3300041456 Bacteria 942
666 Ga0451798_0501681 3300041458 Bacteria 2239
667 Ga0451800_1202443 3300041459 Bacteria 771
668 Ga0451853_1410466 3300041512 Bacteria 955
669 Ga0466969_0059847 3300044656 Bacteria 1852
670 Ga0466966_0105951 3300044684 Bacteria 1735
671 Ga0466963_0134988 3300044694 Bacteria 1707
672 Ga0466964_0172850 3300044706 Bacteria 1019
673 Ga0466971_0031970 3300044719 Bacteria 2358
674 Ga0466957_0078893 3300044842 Bacteria 2048
675 Ga0466958_0016143 3300045836 Bacteria 4296
676 Ga0466958_0074489 3300045836 Bacteria 2081
677 Ga0466967_0089395 3300045976 Bacteria 2797
678 Ga0466967_0231875 3300045976 Bacteria 1758
679 Ga0466967_0385944 3300045976 Bacteria 1360
680 Ga0466967_0515596 3300045976 Bacteria 1174
681 Ga0495617_020984 3300046452 Bacteria 2207
682 Ga0495617_090626 3300046452 Bacteria 998
683 Ga0495592_0032950 3300046454 Bacteria 3908
684 Ga0495592_0079856 3300046454 Bacteria 2367
685 Ga0495592_0107928 3300046454 Bacteria 1974
686 Ga0495603_0000874 3300046455 Bacteria 17304
687 Ga0495603_0015087 3300046455 Bacteria 4673
688 Ga0495603_0015206 3300046455 Bacteria 4657
689 Ga0495603_0016074 3300046455 Bacteria 4524
690 Ga0495603_0075615 3300046455 Bacteria 1977
691 Ga0495603_0079011 3300046455 Bacteria 1929
692 Ga0495603_0244618 3300046455 Bacteria 1033
693 Ga0495590_0024886 3300046457 Bacteria 2107
694 Ga0495629_0000439 3300046459 Bacteria 34692
695 Ga0495629_0000957 3300046459 Bacteria 23286
696 Ga0495629_0041686 3300046459 Bacteria 3229
697 Ga0495638_0007152 3300046460 Bacteria 8040
698 Ga0495638_0069064 3300046460 Bacteria 2165
699 Ga0495641_0003351 3300046461 Bacteria 12041
700 Ga0495651_0003854 3300046462 Bacteria 11462
701 Ga0495651_0063543 3300046462 Bacteria 2821
702 Ga0495651_0121982 3300046462 Bacteria 1913
703 Ga0495653_0003152 3300046463 Bacteria 13226
704 Ga0495650_0074366 3300046471 Bacteria 1325
705 Ga0495580_0006287 3300046472 Bacteria 9712
706 Ga0495582_0002466 3300046473 Bacteria 10311
707 Ga0495582_0009442 3300046473 Bacteria 5373
708 Ga0495582_0099914 3300046473 Bacteria 1624
709 Ga0495582_0468234 3300046473 Bacteria 728
710 Ga0495605_0125840 3300046474 Bacteria 1159
711 Ga0495639_0000913 3300046475 Bacteria 13331
712 Ga0495639_0042792 3300046475 Bacteria 2044
713 Ga0495664_0004313 3300046477 Bacteria 7769
714 Ga0495664_0124565 3300046477 Bacteria 1559
715 Ga0495664_0139742 3300046477 Bacteria 1468
716 Ga0495664_0211886 3300046477 Bacteria 1173
717 Ga0495664_0266269 3300046477 Bacteria 1036
718 Ga0495594_0002715 3300046499 Bacteria 9180
719 Ga0495594_0045208 3300046499 Bacteria 2417
720 Ga0495594_0153818 3300046499 Bacteria 1306
721 Ga0495594_0155953 3300046499 Bacteria 1297
722 Ga0495594_0235883 3300046499 Bacteria 1043
723 Ga0495583_0106677 3300046506 Bacteria 1190
724 Ga0495606_0002132 3300046507 Bacteria 23896
725 Ga0495606_0105866 3300046507 Bacteria 1704
726 Ga0495606_0156169 3300046507 Bacteria 1334
727 Ga0495606_0165118 3300046507 Bacteria 1289
728 Ga0495608_0005973 3300046511 Bacteria 8658
729 Ga0495608_0028994 3300046511 Bacteria 3759
730 Ga0495610_0038842 3300046512 Bacteria 2412
731 Ga0495616_0084746 3300046513 Bacteria 1510
732 Ga0495618_0186705 3300046514 Bacteria 1316
733 Ga0495620_0026171 3300046515 Bacteria 2746
734 Ga0495628_0010152 3300046516 Bacteria 8008
735 Ga0495628_0011453 3300046516 Bacteria 7499
736 Ga0495628_0101177 3300046516 Bacteria 2224
737 Ga0495628_0144821 3300046516 Bacteria 1812
738 Ga0495630_0001220 3300046517 Bacteria 17769
739 Ga0495630_0107226 3300046517 Bacteria 2116
740 Ga0495631_0073046 3300046518 Bacteria 1481
741 Ga0495632_0044890 3300046519 Bacteria 2204
742 Ga0495632_0194523 3300046519 Bacteria 925
743 Ga0495643_0099231 3300046522 Bacteria 1494
744 Ga0495644_0097567 3300046523 Bacteria 1111
745 Ga0495648_0001613 3300046524 Bacteria 21927
746 Ga0495648_0055151 3300046524 Bacteria 2397
747 Ga0495648_0068090 3300046524 Bacteria 2079
748 Ga0495666_0021634 3300046526 Bacteria 3184
749 Ga0495652_0005540 3300046529 Bacteria 11876
750 Ga0495652_0011261 3300046529 Bacteria 8094
751 Ga0495652_0021754 3300046529 Bacteria 5702
752 Ga0495652_0153456 3300046529 Bacteria 1796
753 Ga0495652_0330243 3300046529 Bacteria 1099
754 Ga0495654_0106802 3300046530 Bacteria 1281
755 Ga0495665_0000555 3300046531 Bacteria 18998
756 Ga0495665_0004355 3300046531 Bacteria 7642
757 Ga0495640_0001232 3300046533 Bacteria 20045
758 Ga0495640_0009939 3300046533 Bacteria 7377
759 Ga0495640_0063282 3300046533 Bacteria 2506
760 Ga0495640_0065761 3300046533 Bacteria 2447
761 Ga0495586_0071955 3300046535 Bacteria 1890
762 Ga0495587_0013838 3300046536 Bacteria 5068
763 Ga0495621_0067365 3300046539 Bacteria 1312
764 Ga0495597_0111987 3300046542 Bacteria 1143
765 Ga0495645_0011972 3300046543 Bacteria 6112
766 Ga0495645_0013731 3300046543 Bacteria 5738
767 Ga0495645_0018292 3300046543 Bacteria 5031
768 Ga0495645_0165805 3300046543 Bacteria 1524
769 Ga0495645_0297639 3300046543 Bacteria 1055
770 Ga0495622_0003298 3300046557 Bacteria 7634
771 Ga0495622_0088271 3300046557 Bacteria 1425
772 Ga0495622_0133714 3300046557 Bacteria 1128
773 Ga0495633_0048486 3300046558 Bacteria 2005
774 Ga0495633_0184110 3300046558 Bacteria 961
775 Ga0495667_0016918 3300046559 Bacteria 4924
776 Ga0495656_0088988 3300046615 Bacteria 1408
777 Ga0495656_0103490 3300046615 Bacteria 1320
778 Ga0495668_0062733 3300046616 Bacteria 2047
779 Ga0495634_0014564 3300046642 Bacteria 5667
780 Ga0495634_0018636 3300046642 Bacteria 4938
781 Ga0495634_0060761 3300046642 Bacteria 2514
782 Ga0495611_0039800 3300046648 Bacteria 2094
783 Ga0495611_0126302 3300046648 Bacteria 1193
784 Ga0495611_0141212 3300046648 Bacteria 1124
785 Ga0495625_0088904 3300046660 Bacteria 2139
786 Ga0495625_0170061 3300046660 Bacteria 1456
787 Ga0495635_0001430 3300046663 Bacteria 15944
788 Ga0495635_0003515 3300046663 Bacteria 10840
789 Ga0495635_0004600 3300046663 Bacteria 9571
790 Ga0495635_0010771 3300046663 Bacteria 6406
791 Ga0495635_0363371 3300046663 Bacteria 965
792 Ga0495661_0081293 3300046665 Bacteria 1867
793 Ga0495661_0176250 3300046665 Bacteria 1136
794 Ga0495588_0005525 3300046674 Bacteria 5629
795 Ga0495588_0129047 3300046674 Bacteria 1333
796 Ga0495657_0020793 3300046675 Bacteria 4717
797 Ga0495657_0140199 3300046675 Bacteria 1507
798 Ga0495657_0217371 3300046675 Bacteria 1160
799 Ga0495657_0233457 3300046675 Bacteria 1112
800 Ga0495599_0007454 3300046678 Bacteria 6636
801 Ga0495599_0156105 3300046678 Bacteria 1412
802 Ga0495599_0184188 3300046678 Bacteria 1286
803 Ga0495623_0010183 3300046679 Bacteria 6083
804 Ga0495623_0019346 3300046679 Bacteria 4402
805 Ga0495623_0090795 3300046679 Bacteria 1875
806 Ga0495646_0003601 3300046680 Bacteria 9670
807 Ga0495646_0072368 3300046680 Bacteria 2027
808 Ga0495658_0065037 3300046683 Bacteria 2103
809 Ga0495669_0008503 3300046684 Bacteria 4318
810 Ga0495669_0136329 3300046684 Bacteria 1157
811 Ga0495624_0001252 3300046690 Bacteria 20060
812 Ga0495670_0007811 3300046691 Bacteria 5259
813 Ga0495670_0021246 3300046691 Bacteria 3201
814 Ga0495589_0054960 3300046794 Bacteria 1962
815 Ga0495589_0080116 3300046794 Bacteria 1589
816 Ga0495600_0001772 3300046809 Bacteria 12077
817 Ga0495600_0040077 3300046809 Bacteria 3050
818 Ga0495660_0088788 3300046810 Bacteria 1610
819 Ga0495581_0000019 3300047315 Bacteria 57810
820 Ga0495604_0007453 3300047317 Bacteria 8662
821 Ga0495604_0061883 3300047317 Bacteria 2861
822 Ga0495604_0313140 3300047317 Bacteria 1051
823 Ga0495636_0036181 3300047318 Bacteria 2035
824 Ga0495674_0000458 3300047319 Bacteria 36828
825 Ga0495674_0008586 3300047319 Bacteria 9723
826 Ga0495674_0039776 3300047319 Bacteria 4212
827 Ga0495674_0162963 3300047319 Bacteria 1865
828 Ga0495674_0254193 3300047319 Bacteria 1445
829 Ga0495672_0045609 3300047320 Bacteria 2621
830 Ga0495676_0065285 3300047321 Bacteria 2826
831 Ga0495676_0091683 3300047321 Bacteria 2270
832 Ga0495680_0006264 3300047322 Bacteria 11086
833 Ga0495680_0006496 3300047322 Bacteria 10851
834 Ga0495683_0124101 3300047323 Bacteria 1223
835 Ga0495675_0021254 3300047444 Bacteria 4132
836 Ga0495675_0049118 3300047444 Bacteria 2682
837 Ga0495685_135996 3300047447 Bacteria 802
838 Ga0495673_0077420 3300047469 Bacteria 1385
839 Ga0495673_0091708 3300047469 Bacteria 1241
840 Ga0495673_0103852 3300047469 Bacteria 1145
841 Ga0495681_0092181 3300047470 Bacteria 1336
842 Ga0495681_0104104 3300047470 Bacteria 1237
843 Ga0495684_0012962 3300047471 Bacteria 6435
844 Ga0495686_0017873 3300047472 Bacteria 4768
845 Ga0495686_0043114 3300047472 Bacteria 2863
846 Ga0495686_0092777 3300047472 Bacteria 1831
847 Ga0495686_0172967 3300047472 Bacteria 1255
848 Ga0495686_0212017 3300047472 Bacteria 1106
849 Ga0495593_0001308 3300047673 Bacteria 14618
850 Ga0495593_0008357 3300047673 Bacteria 6023
851 Ga0495602_0023461 3300048088 Bacteria 6009
852 Ga0495602_0025728 3300048088 Bacteria 5690
853 Ga0495602_0043067 3300048088 Bacteria 4108
854 Ga0495614_0108094 3300048089 Bacteria 1220
855 Ga0495626_0017777 3300048091 Bacteria 3585
856 Ga0496101_0007758 3300048904 Bacteria 6974
857 Ga0496101_0106028 3300048904 Bacteria 2110
858 Ga0496101_0722208 3300048904 Bacteria 786
859 Ga0496102_0010309 3300048905 Bacteria 8035
860 Ga0496102_0515596 3300048905 Bacteria 1118
861 Ga0496102_0613084 3300048905 Bacteria 1011
862 Ga0496103_0326749 3300048906 Bacteria 986
863 Ga0496104_0009462 3300048907 Bacteria 8668
864 Ga0496104_0071281 3300048907 Bacteria 3304
865 Ga0496104_0114517 3300048907 Bacteria 2586
866 Ga0496104_0471710 3300048907 Bacteria 1166
867 Ga0496105_0029974 3300048908 Bacteria 4455
868 Ga0496105_0052802 3300048908 Bacteria 3357
869 Ga0496105_0390837 3300048908 Bacteria 1106
870 Ga0496106_0002119 3300048909 Bacteria 14839
871 Ga0496106_0028877 3300048909 Bacteria 4133
872 Ga0496106_0028919 3300048909 Bacteria 4130
873 Ga0496106_0122458 3300048909 Bacteria 2034
874 Ga0496107_0003483 3300048910 Bacteria 10525
875 Ga0496107_0022807 3300048910 Bacteria 4425
876 Ga0496107_0215337 3300048910 Bacteria 1428
877 Ga0496108_0000938 3300048911 Bacteria 22748
878 Ga0496108_0012526 3300048911 Bacteria 6906
879 Ga0496108_0061584 3300048911 Bacteria 3158
880 Ga0496108_0119426 3300048911 Bacteria 2260
881 Ga0496109_0000977 3300048912 Bacteria 23646
882 Ga0496109_0068355 3300048912 Bacteria 3257
883 Ga0496109_0091458 3300048912 Bacteria 2814
884 Ga0496109_0174956 3300048912 Bacteria 2014
885 Ga0496109_0410057 3300048912 Bacteria 1280
886 Ga0496109_0430396 3300048912 Bacteria 1246
887 Ga0496110_0049690 3300048913 Bacteria 3680
888 Ga0496110_0063156 3300048913 Bacteria 3272
889 Ga0496110_0100573 3300048913 Bacteria 2591
890 Ga0496110_0212387 3300048913 Bacteria 1759
891 Ga0496110_1129949 3300048913 Bacteria 692
892 Ga0496111_0076850 3300048914 Bacteria 2434
893 Ga0496111_0090159 3300048914 Bacteria 2246
894 Ga0496112_0000045 3300048915 Bacteria 85873
895 Ga0496112_0000590 3300048915 Bacteria 24921
896 Ga0496112_0015545 3300048915 Bacteria 7108
897 Ga0496112_0070107 3300048915 Bacteria 3464
898 Ga0496112_0075203 3300048915 Bacteria 3340
899 Ga0496112_0093111 3300048915 Bacteria 2983
900 Ga0496112_0110069 3300048915 Bacteria 2725
901 Ga0496112_0153212 3300048915 Bacteria 2272
902 Ga0496113_0032399 3300048916 Bacteria 3799
903 Ga0496114_0234352 3300048917 Bacteria 1613
904 Ga0496115_0097205 3300048918 Bacteria 2411
905 Ga0496115_0132424 3300048918 Bacteria 2055
906 Ga0496115_0135353 3300048918 Bacteria 2031
907 Ga0496115_0159319 3300048918 Bacteria 1865
908 Ga0496115_0236424 3300048918 Bacteria 1506
909 Ga0496115_0270746 3300048918 Bacteria 1395
910 Ga0496116_0012386 3300048919 Bacteria 6973
911 Ga0496117_0016137 3300048920 Bacteria 6318
912 Ga0496117_0043048 3300048920 Bacteria 3288
913 Ga0496117_0052104 3300048920 Bacteria 2886
914 Ga0496117_0057914 3300048920 Bacteria 2687
915 Ga0496117_0268075 3300048920 Bacteria 921
916 Ga0496118_0018344 3300048921 Bacteria 6318
917 Ga0496118_0022527 3300048921 Bacteria 5502
918 Ga0496118_0031340 3300048921 Bacteria 4409
919 Ga0496118_0433473 3300048921 Bacteria 672
920 Ga0496119_0042013 3300048922 Bacteria 2904
921 Ga0496119_0062235 3300048922 Bacteria 2225
922 Ga0496119_0086948 3300048922 Bacteria 1785
923 Ga0496121_0000379 3300048924 Bacteria 91131
924 Ga0496121_0002555 3300048924 Bacteria 27565
925 Ga0496121_0004013 3300048924 Bacteria 20280
926 Ga0496121_0004472 3300048924 Bacteria 18782
927 Ga0496121_0010261 3300048924 Bacteria 10600
928 Ga0496121_0010612 3300048924 Bacteria 10350
929 Ga0496121_0024775 3300048924 Bacteria 5723
930 Ga0496121_0077052 3300048924 Bacteria 2656
931 Ga0496121_0078720 3300048924 Bacteria 2619
932 Ga0496121_0171025 3300048924 Bacteria 1578
933 Ga0496121_0180289 3300048924 Bacteria 1525
934 Ga0496121_0368773 3300048924 Bacteria 951
935 Ga0496121_0416496 3300048924 Bacteria 875
936 Ga0496122_0024591 3300048925 Bacteria 5265
937 Ga0496122_0075943 3300048925 Bacteria 2367
938 Ga0496122_0276291 3300048925 Bacteria 921
939 Ga0496123_0017035 3300048926 Bacteria 5867
940 Ga0496124_0001073 3300048927 Bacteria 43225
941 Ga0496124_0056109 3300048927 Bacteria 3324
942 Ga0496124_0257026 3300048927 Bacteria 1288
943 Ga0496124_0283856 3300048927 Bacteria 1205
944 Ga0496124_0289595 3300048927 Bacteria 1189
945 Ga0496124_0498712 3300048927 Bacteria 817
946 Ga0496125_0000252 3300048928 Bacteria 109988
947 Ga0496125_0000629 3300048928 Bacteria 59181
948 Ga0496125_0029288 3300048928 Bacteria 4951
949 Ga0496125_0182105 3300048928 Bacteria 1398
950 Ga0496126_0003114 3300048929 Bacteria 21387
951 Ga0496126_0008548 3300048929 Bacteria 11032
952 Ga0496126_0013956 3300048929 Bacteria 8147
953 Ga0496126_0031521 3300048929 Bacteria 5007
954 Ga0496126_0063374 3300048929 Bacteria 3314
955 Ga0496126_0090707 3300048929 Bacteria 2688
956 Ga0496126_0091348 3300048929 Bacteria 2677
957 Ga0496126_0126229 3300048929 Bacteria 2214
958 Ga0496126_0135055 3300048929 Bacteria 2129
959 Ga0496126_0141426 3300048929 Bacteria 2071
960 Ga0496126_0198282 3300048929 Bacteria 1696
961 Ga0496126_0222573 3300048929 Bacteria 1584
962 Ga0496126_0253163 3300048929 Bacteria 1467
963 Ga0496126_0537838 3300048929 Bacteria 929
964 Ga0496126_0629455 3300048929 Bacteria 842
965 Ga0496126_0830996 3300048929 Bacteria 706
966 Ga0501031_0000428 3300049568 Bacteria 24216
967 Ga0501032_0001029 3300049569 Bacteria 22396
968 Ga0501032_0127563 3300049569 Bacteria 1680
969 Ga0501032_0154916 3300049569 Bacteria 1506
970 Ga0501033_0000163 3300049570 Bacteria 63913
971 Ga0501033_0126297 3300049570 Bacteria 1854
972 Ga0501034_0000202 3300049571 Bacteria 112985
973 Ga0501034_0013020 3300049571 Bacteria 8573
974 Ga0501034_0119598 3300049571 Bacteria 2621
975 Ga0501034_0664853 3300049571 Bacteria 942
976 Ga0501036_0000042 3300049572 Bacteria 79876
977 Ga0501036_0137765 3300049572 Bacteria 2060
978 Ga0501037_0000100 3300049573 Bacteria 81013
979 Ga0501037_0081418 3300049573 Bacteria 2347
980 Ga0501038_0000226 3300049574 Bacteria 47831
981 Ga0501038_0149058 3300049574 Bacteria 1908
982 Ga0501039_0003287 3300049575 Bacteria 12087
983 Ga0501041_0208115 3300049577 Bacteria 1227
984 Ga0501043_0001024 3300049579 Bacteria 24571
985 Ga0501046_0000619 3300049580 Bacteria 34959
986 Ga0501046_0101211 3300049580 Bacteria 2210
987 Ga0501047_0000159 3300049581 Bacteria 82106
988 Ga0501047_0005748 3300049581 Bacteria 11674
989 Ga0501047_0008010 3300049581 Bacteria 9965
990 Ga0501047_0087590 3300049581 Bacteria 2991
991 Ga0501047_0089744 3300049581 Bacteria 2951
992 Ga0501048_0000050 3300049582 Bacteria 57921
993 Ga0501048_0222865 3300049582 Bacteria 1338
994 Ga0501067_0005945 3300049583 Bacteria 6764
995 Ga0501067_0136782 3300049583 Bacteria 1364
996 Ga0501067_0215665 3300049583 Bacteria 1069
997 Ga0501068_0000430 3300049584 Bacteria 21319
998 Ga0501068_0134498 3300049584 Bacteria 1547
999 Ga0501070_0014472 3300049586 Bacteria 6640
1000 Ga0501070_0053110 3300049586 Bacteria 3362
1001 Ga0501070_0068451 3300049586 Bacteria 2939
1002 Ga0501070_0106680 3300049586 Bacteria 2315
1003 Ga0501070_0177345 3300049586 Bacteria 1754
1004 Ga0501072_0068258 3300049588 Bacteria 2807
1005 Ga0501073_0000329 3300049589 Bacteria 31824
1006 Ga0501073_0185361 3300049589 Bacteria 1440
1007 Ga0501074_0000414 3300049590 Bacteria 25493
1008 Ga0501074_0007505 3300049590 Bacteria 7891
1009 Ga0501074_0334316 3300049590 Bacteria 1075
1010 Ga0501074_0476293 3300049590 Bacteria 885
1011 Ga0501079_0003664 3300049741 Bacteria 11319
1012 Ga0501079_0100317 3300049741 Bacteria 2245
1013 Ga0501080_0000403 3300049742 Bacteria 33373
1014 Ga0501080_0004615 3300049742 Bacteria 12271
1015 Ga0501080_0088856 3300049742 Bacteria 2870
1016 Ga0501080_0427689 3300049742 Bacteria 1189
1017 Ga0501083_0006265 3300049744 Bacteria 8443
1018 Ga0501035_0000120 3300049822 Bacteria 94532
1019 Ga0501035_0135892 3300049822 Bacteria 2141
1020 Ga0501035_0232759 3300049822 Bacteria 1570
1021 Ga0501035_0301458 3300049822 Bacteria 1350
1022 Ga0501044_0001777 3300049823 Bacteria 25225
1023 Ga0501044_0042476 3300049823 Bacteria 4728
1024 Ga0501044_0063727 3300049823 Bacteria 3764
1025 Ga0501044_0164517 3300049823 Bacteria 2193
1026 Ga0501044_0299840 3300049823 Bacteria 1536
1027 Ga0501044_0603787 3300049823 Bacteria 990
1028 Ga0501045_0003832 3300049824 Bacteria 10348
1029 nmdc:mga03n38_10620_c1 3300050490 Bacteria 3397
1030 nmdc:mga03n38_70407_c1 3300050490 Bacteria 1617
1031 nmdc:mga00v17_91201_c1 3300050491 Bacteria 1914
1032 nmdc:mga0yw44_24241_c1 3300050492 Bacteria 3431
1033 nmdc:mga0yw44_42619_c1 3300050492 Bacteria 1701
1034 nmdc:mga0yw44_83999_c1 3300050492 Bacteria 2001
1035 nmdc:mga0k408_183635_c1 3300050493 Bacteria 950
1036 nmdc:mga0k408_326403_c1 3300050493 Bacteria 916
1037 nmdc:mga06z11_136998_c1 3300050494 Bacteria 1380
1038 nmdc:mga07m45_132698_c1 3300050496 Bacteria 1441
1039 nmdc:mga07m45_17418_c1 3300050496 Bacteria 3859
1040 nmdc:mga07m45_53645_c1 3300050496 Bacteria 2278
1041 nmdc:mga05p37_141932_c1 3300050507 Bacteria 2942
1042 nmdc:mga0n895_123108_c1 3300050512 Bacteria 2615
1043 nmdc:mga0n895_8527_c1 3300050512 Bacteria 8881
1044 nmdc:mga0rr50_373004_c1 3300050513 Bacteria 1202
1045 nmdc:mga0rr50_460277_c1 3300050513 Bacteria 1079
1046 nmdc:mga0a205_112801_c1 3300050515 Bacteria 2617
1047 nmdc:mga0sz30_28629_c1 3300050516 Bacteria 2294
1048 Ga0495601_0037977 3300053077 Bacteria 3010
1049 Ga0495601_0044379 3300053077 Bacteria 2794
1050 Ga0495601_0091103 3300053077 Bacteria 1963
1051 Ga0495612_0019273 3300053078 Bacteria 2733
1052 Ga0495612_0119885 3300053078 Bacteria 1131
1053 Ga0500635_0013844 3300053080 Bacteria 2351
1054 Ga0500635_0020627 3300053080 Bacteria 2020
1055 Ga0495595_0002284 3300053084 Bacteria 7462
1056 Ga0495595_0043669 3300053084 Bacteria 2057
1057 Ga0495619_0006156 3300053085 Bacteria 7601
1058 Ga0495619_0206380 3300053085 Bacteria 1360
1059 Ga0500644_0095771 3300053088 Bacteria 1119
1060 Ga0500581_028462 3300053089 Bacteria 2849
1061 Ga0500651_0001684 3300053093 Bacteria 11290
1062 Ga0500651_0021035 3300053093 Bacteria 4065
1063 Ga0500651_0130353 3300053093 Bacteria 1521
1064 Ga0500651_0222539 3300053093 Bacteria 1106
1065 Ga0500651_0236169 3300053093 Bacteria 1067
1066 Ga0500566_0000046 3300053094 Bacteria 59187
1067 Ga0500566_0015683 3300053094 Bacteria 4446
1068 Ga0500640_000122 3300053095 Bacteria 14571
1069 Ga0500641_0016700 3300053096 Bacteria 2735
1070 Ga0500650_0050889 3300053098 Bacteria 1923
1071 Ga0500554_001975 3300053102 Bacteria 3980
1072 Ga0500554_005676 3300053102 Bacteria 2742
1073 Ga0500554_068408 3300053102 Bacteria 1152
1074 Ga0500556_0000003 3300053104 Bacteria 679379
1075 Ga0500562_003130 3300053108 Bacteria 4131
1076 Ga0500569_070535 3300053109 Bacteria 1098
1077 Ga0500572_000277 3300053111 Bacteria 18643
1078 Ga0500592_000602 3300053116 Bacteria 5900
1079 Ga0500592_004767 3300053116 Bacteria 2153
1080 Ga0500594_0003113 3300053118 Bacteria 3630
1081 Ga0500594_0016522 3300053118 Bacteria 1794
1082 Ga0500595_001435 3300053119 Bacteria 12781
1083 Ga0500595_002523 3300053119 Bacteria 9027
1084 Ga0500595_003315 3300053119 Bacteria 7571
1085 Ga0500595_005416 3300053119 Bacteria 5575
1086 Ga0500595_022337 3300053119 Bacteria 2242
1087 Ga0500608_021992 3300053122 Bacteria 2953
1088 Ga0500614_064242 3300053123 Bacteria 993
1089 Ga0500618_006771 3300053125 Bacteria 3336
1090 Ga0500642_0000015 3300053130 Bacteria 181424
1091 Ga0500642_0012591 3300053130 Bacteria 3075
1092 Ga0500652_000456 3300053131 Bacteria 14464
1093 Ga0500658_0198572 3300053134 Bacteria 916
1094 Ga0500559_0000301 3300053136 Bacteria 37742
1095 Ga0500559_0001197 3300053136 Bacteria 15425
1096 Ga0500559_0006509 3300053136 Bacteria 5271
1097 Ga0500559_0084943 3300053136 Bacteria 1443
1098 Ga0500568_0000334 3300053139 Bacteria 37071
1099 Ga0500568_0004685 3300053139 Bacteria 7268
1100 Ga0500573_0004365 3300053140 Bacteria 7439
1101 Ga0500577_0000239 3300053142 Bacteria 14570
1102 Ga0500586_000409 3300053145 Bacteria 8597
1103 Ga0500588_0104321 3300053146 Bacteria 981
1104 Ga0500589_094864 3300053147 Bacteria 1306
1105 Ga0500589_134231 3300053147 Bacteria 1029
1106 Ga0500590_036369 3300053148 Bacteria 2545
1107 Ga0500590_081314 3300053148 Bacteria 1591
1108 Ga0500603_001802 3300053150 Bacteria 4811
1109 Ga0500603_002934 3300053150 Bacteria 3693
1110 Ga0500603_059283 3300053150 Bacteria 1066
1111 Ga0500603_068748 3300053150 Bacteria 1005
1112 Ga0500604_0025305 3300053151 Bacteria 1705
1113 Ga0500604_0127133 3300053151 Bacteria 855
1114 Ga0500616_0000028 3300053153 Bacteria 435722
1115 Ga0500616_0000033 3300053153 Bacteria 398830
1116 Ga0500622_0007863 3300053156 Bacteria 6006
1117 Ga0500622_0012142 3300053156 Bacteria 4673
1118 Ga0500627_0030694 3300053158 Bacteria 2252
1119 Ga0500627_0163336 3300053158 Bacteria 1004
1120 Ga0500630_001838 3300053159 Bacteria 10201
1121 Ga0500633_0081565 3300053160 Bacteria 1171
1122 Ga0500638_009710 3300053162 Bacteria 4177
1123 Ga0500639_001285 3300053163 Bacteria 12720
1124 Ga0500639_019202 3300053163 Bacteria 3606
1125 Ga0500639_094416 3300053163 Bacteria 1484
1126 Ga0500636_0001477 3300053177 Bacteria 12758
1127 Ga0500636_0005231 3300053177 Bacteria 7387
1128 Ga0500636_0045273 3300053177 Bacteria 2595
1129 Ga0500637_0000262 3300053178 Bacteria 19711
1130 Ga0500637_0017144 3300053178 Bacteria 3874
1131 Ga0500637_0077191 3300053178 Bacteria 1921
1132 Ga0500645_018874 3300053730 Bacteria 2149
1133 Ga0500645_083462 3300053730 Bacteria 910
1134 Ga0500656_008164 3300053732 Bacteria 1106
1135 Ga0500596_002379 3300053735 Bacteria 3708
1136 Ga0500596_011759 3300053735 Bacteria 1335
1137 Ga0500601_010257 3300053737 Bacteria 1047
1138 Ga0501084_0007843 3300054114 Bacteria 8784
1139 Ga0500661_000172 3300055283 Bacteria 11274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0134988 Ga0466963_0134988_572_1348 198
2 3300041459 Ga0451800_1202443 Ga0451800_1202443_28_654 207
3 3300046473 Ga0495582_0468234 Ga0495582_0468234_67_696 207
4 3300046663 Ga0495635_0363371 Ga0495635_0363371_297_926 207
5 3300048913 Ga0496110_1129949 Ga0496110_1129949_41_670 207
6 3300037466 Ga0395898_0232296 Ga0395898_0232296_69_707 208
7 3300048921 Ga0496118_0433473 Ga0496118_0433473_18_647 208
8 3300048929 Ga0496126_0830996 Ga0496126_0830996_24_650 208
9 3300053730 Ga0500645_083462 Ga0500645_083462_13_642 208
10 3300041456 Ga0451795_0811766 Ga0451795_0811766_273_926 211
11 3300028800 Ga0265338_10348293 Ga0265338_103482931 221
12 3300005435 Ga0070714_100563354 Ga0070714_1005633541 226
13 3300025929 Ga0207664_10442830 Ga0207664_104428302 226
14 3300005327 Ga0070658_10034116 Ga0070658_100341165 227
15 3300005458 Ga0070681_10057834 Ga0070681_100578344 227
16 3300005616 Ga0068852_100394018 Ga0068852_1003940181 227
17 3300013102 Ga0157371_10304228 Ga0157371_103042282 227
18 3300013104 Ga0157370_10423169 Ga0157370_104231692 227
19 3300025909 Ga0207705_10012927 Ga0207705_100129277 227
20 3300025917 Ga0207660_10201882 Ga0207660_102018821 227
21 3300025921 Ga0207652_10020676 Ga0207652_100206762 227
22 3300026142 Ga0207698_10310003 Ga0207698_103100031 227
23 3300031595 Ga0265313_10024594 Ga0265313_100245944 227
24 3300031711 Ga0265314_10084897 Ga0265314_100848972 227
25 3300031712 Ga0265342_10000502 Ga0265342_1000050237 227
26 3300049581 Ga0501047_0087590 Ga0501047_0087590_1542_2342 227
27 3300049590 Ga0501074_0334316 Ga0501074_0334316_76_876 227
28 3300049823 Ga0501044_0042476 Ga0501044_0042476_940_1740 227
29 3300005434 Ga0070709_10362430 Ga0070709_103624302 228
30 3300005437 Ga0070710_10076678 Ga0070710_100766782 228
31 3300028800 Ga0265338_10047212 Ga0265338_100472123 231
32 3300031249 Ga0265339_10047059 Ga0265339_100470592 231
33 3300031712 Ga0265342_10018370 Ga0265342_100183702 231
34 3300024225 Ga0224572_1007287 Ga0224572_10072872 232
35 3300024227 Ga0228598_1008279 Ga0228598_10082792 232
36 3300044842 Ga0466957_0078893 Ga0466957_0078893_438_1247 233
37 3300045836 Ga0466958_0016143 Ga0466958_0016143_1497_2306 233
38 3300005355 Ga0070671_100148618 Ga0070671_1001486181 235
39 3300005367 Ga0070667_100059884 Ga0070667_1000598842 235
40 3300025986 Ga0207658_10430999 Ga0207658_104309991 235
41 3300026041 Ga0207639_10379064 Ga0207639_103790641 235
42 3300031247 Ga0265340_10102494 Ga0265340_101024942 235
43 3300006038 Ga0075365_10293690 Ga0075365_102936902 236
44 3300039437 Ga0436365_0447222 Ga0436365_0447222_593_1378 236
45 3300039437 Ga0436365_0262407 Ga0436365_0262407_168_881 237
46 3300003322 rootL2_10024455 rootL2_100244551 239
47 3300005336 Ga0070680_100417061 Ga0070680_1004170612 239
48 3300005458 Ga0070681_10109584 Ga0070681_101095843 239
49 3300005530 Ga0070679_100060424 Ga0070679_1000604243 239
50 3300025912 Ga0207707_10116020 Ga0207707_101160202 239
51 3300025917 Ga0207660_10400034 Ga0207660_104000342 239
52 3300025921 Ga0207652_10218318 Ga0207652_102183181 239
53 3300005435 Ga0070714_100460661 Ga0070714_1004606612 243
54 3300005530 Ga0070679_100146533 Ga0070679_1001465333 243
55 3300005616 Ga0068852_100011300 Ga0068852_1000113004 243
56 3300025921 Ga0207652_10248296 Ga0207652_102482962 243
57 3300025929 Ga0207664_10440078 Ga0207664_104400782 243
58 3300025949 Ga0207667_10152583 Ga0207667_101525833 243
59 3300026142 Ga0207698_10233558 Ga0207698_102335582 243
60 3300013297 Ga0157378_10324120 Ga0157378_103241202 244
61 3300048929 Ga0496126_0537838 Ga0496126_0537838_41_808 244
62 3300005535 Ga0070684_100243608 Ga0070684_1002436082 245
63 3300009551 Ga0105238_10094377 Ga0105238_100943771 245
64 3300025924 Ga0207694_10083458 Ga0207694_100834583 245
65 3300025949 Ga0207667_10437857 Ga0207667_104378572 245
66 3300005439 Ga0070711_100253020 Ga0070711_1002530202 247
67 3300006173 Ga0070716_100130543 Ga0070716_1001305431 247
68 3300025939 Ga0207665_10041508 Ga0207665_100415082 247
69 3300028653 Ga0265323_10011073 Ga0265323_100110731 247
70 3300028666 Ga0265336_10000125 Ga0265336_100001254 247
71 3300028800 Ga0265338_10000085 Ga0265338_1000008530 247
72 3300007076 Ga0075435_100123099 Ga0075435_1001230992 248
73 3300050512 nmdc:mga0n895_123108_c1 nmdc:mga0n895_123108_c1_1541_2311 248
74 3300050513 nmdc:mga0rr50_460277_c1 nmdc:mga0rr50_460277_c1_33_803 248
75 3300053134 Ga0500658_0198572 Ga0500658_0198572_21_773 249
76 3300009174 Ga0105241_10202834 Ga0105241_102028342 250
77 3300013297 Ga0157378_10641265 Ga0157378_106412651 250
78 3300014325 Ga0163163_10142805 Ga0163163_101428051 250
79 3300014968 Ga0157379_10162954 Ga0157379_101629542 250
80 3300035691 Ga0373931_0182961 Ga0373931_0182961_185_937 250
81 3300048904 Ga0496101_0722208 Ga0496101_0722208_16_768 250
82 3300048908 Ga0496105_0052802 Ga0496105_0052802_1704_2456 250
83 3300048911 Ga0496108_0061584 Ga0496108_0061584_1079_1831 250
84 3300048912 Ga0496109_0068355 Ga0496109_0068355_1399_2151 250
85 3300048913 Ga0496110_0100573 Ga0496110_0100573_28_780 250
86 3300048914 Ga0496111_0090159 Ga0496111_0090159_419_1171 250
87 3300048915 Ga0496112_0015545 Ga0496112_0015545_612_1364 250
88 iso_pu_bacteria 2791355197 2793066354 250
89 iso_pu_bacteria 2885374607 2885377318 250
90 iso_pu_bacteria 2906610324 2906616197 250
91 iso_pu_bacteria 2908739725 2908741264 250
92 iso_pu_bacteria 2922425934 2922431827 250
93 iso_pu_bacteria 8019555841 8019559945 250
94 iso_pu_bacteria 8019565922 8019570048 250
95 3300003215 JGI25153J46596_10026735 JGI25153J46596_100267351 251
96 3300025297 Ga0209758_1000720 Ga0209758_100072035 251
97 3300048928 Ga0496125_0000252 Ga0496125_0000252_109102_109857 251
98 iso_pu_bacteria 2508501128 2509151040 251
99 iso_pu_bacteria 2513237101 2513693063 251
100 iso_pu_bacteria 2513237141 2513887313 251
101 iso_pu_bacteria 2721755755 2723843301 251
102 iso_pu_bacteria 2874604998 2874611808 251
103 iso_pu_bacteria 2876808645 2876809628 251
104 iso_pu_bacteria 2879110137 2879110866 251
105 iso_pu_bacteria 2922386360 2922387206 251
106 iso_pu_bacteria 8006984368 8006985047 251
107 iso_pu_bacteria 8006994254 8006999760 251
108 iso_pu_bacteria 8056673599 8056677611 251
109 iso_pu_bacteria 2513237098 2513678776 252
110 iso_pu_bacteria 2524023210 2524464966 252
111 iso_pu_bacteria 2602042107 2603860123 252
112 iso_pu_bacteria 2643221651 2644289352 252
113 iso_pu_bacteria 2791355199 2793080707 252
114 iso_pu_bacteria 2857524615 2857525106 252
115 iso_pu_bacteria 2885383462 2885390085 252
116 iso_pu_bacteria 2889033259 2889037619 252
117 iso_pu_bacteria 2893066018 2893069690 252
118 iso_pu_bacteria 2903768456 2903773185 252
119 iso_pu_bacteria 2919073203 2919078995 252
120 iso_pu_bacteria 8006964411 8006968082 252
121 iso_pu_bacteria 8056681323 8056687830 252
122 3300020069 Ga0197907_10288381 Ga0197907_102883812 253
123 3300025949 Ga0207667_10187258 Ga0207667_101872582 253
124 3300026067 Ga0207678_10014837 Ga0207678_100148374 253
125 3300045976 Ga0466967_0089395 Ga0466967_0089395_1096_1860 253
126 3300049571 Ga0501034_0013020 Ga0501034_0013020_2540_3316 253
127 3300049586 Ga0501070_0068451 Ga0501070_0068451_155_931 253
128 3300005434 Ga0070709_10020362 Ga0070709_100203624 254
129 3300005436 Ga0070713_100140124 Ga0070713_1001401242 254
130 3300005439 Ga0070711_100010247 Ga0070711_1000102473 254
131 3300005456 Ga0070678_100056469 Ga0070678_1000564692 254
132 3300005543 Ga0070672_100069702 Ga0070672_1000697022 254
133 3300005614 Ga0068856_100122875 Ga0068856_1001228752 254
134 3300006163 Ga0070715_10012186 Ga0070715_100121862 254
135 3300006173 Ga0070716_100219623 Ga0070716_1002196232 254
136 3300014969 Ga0157376_10187389 Ga0157376_101873892 254
137 3300025261 Ga0209233_1004699 Ga0209233_10046992 254
138 3300025906 Ga0207699_10040953 Ga0207699_100409531 254
139 3300025916 Ga0207663_10041918 Ga0207663_100419182 254
140 3300025928 Ga0207700_10084230 Ga0207700_100842302 254
141 3300025940 Ga0207691_10071603 Ga0207691_100716032 254
142 3300026121 Ga0207683_10028505 Ga0207683_100285055 254
143 3300048929 Ga0496126_0031521 Ga0496126_0031521_3419_4204 254
144 3300048929 Ga0496126_0091348 Ga0496126_0091348_456_1223 254
145 3300001990 JGI24737J22298_10001768 JGI24737J22298_100017686 255
146 3300003308 Ga0006777J48905_1012525 Ga0006777J48905_10125251 255
147 3300003320 rootH2_10115860 rootH2_101158602 255
148 3300003771 Ga0055526_1031838 Ga0055526_10318382 255
149 3300005262 Ga0065165_1041708 Ga0065165_10417082 255
150 3300005334 Ga0068869_100092114 Ga0068869_1000921143 255
151 3300005338 Ga0068868_100304927 Ga0068868_1003049272 255
152 3300005340 Ga0070689_100652361 Ga0070689_1006523611 255
153 3300005347 Ga0070668_100266734 Ga0070668_1002667342 255
154 3300005347 Ga0070668_100277616 Ga0070668_1002776162 255
155 3300005347 Ga0070668_100375144 Ga0070668_1003751441 255
156 3300005347 Ga0070668_100406455 Ga0070668_1004064551 255
157 3300005354 Ga0070675_100191642 Ga0070675_1001916422 255
158 3300005355 Ga0070671_100148721 Ga0070671_1001487211 255
159 3300005367 Ga0070667_100100855 Ga0070667_1001008553 255
160 3300005367 Ga0070667_100303982 Ga0070667_1003039822 255
161 3300005434 Ga0070709_10018509 Ga0070709_100185092 255
162 3300005434 Ga0070709_10075990 Ga0070709_100759901 255
163 3300005435 Ga0070714_100002134 Ga0070714_10000213411 255
164 3300005435 Ga0070714_100084149 Ga0070714_1000841494 255
165 3300005436 Ga0070713_100053782 Ga0070713_1000537821 255
166 3300005436 Ga0070713_100097526 Ga0070713_1000975263 255
167 3300005437 Ga0070710_10002054 Ga0070710_100020546 255
168 3300005437 Ga0070710_10034900 Ga0070710_100349002 255
169 3300005439 Ga0070711_100002128 Ga0070711_1000021283 255
170 3300005439 Ga0070711_100023165 Ga0070711_1000231653 255
171 3300005455 Ga0070663_100162182 Ga0070663_1001621821 255
172 3300005456 Ga0070678_100158637 Ga0070678_1001586372 255
173 3300005457 Ga0070662_100024079 Ga0070662_1000240792 255
174 3300005518 Ga0070699_100497984 Ga0070699_1004979842 255
175 3300005539 Ga0068853_100038437 Ga0068853_1000384374 255
176 3300005539 Ga0068853_100695666 Ga0068853_1006956661 255
177 3300005543 Ga0070672_100250509 Ga0070672_1002505092 255
178 3300005545 Ga0070695_100395401 Ga0070695_1003954011 255
179 3300005548 Ga0070665_100246669 Ga0070665_1002466693 255
180 3300005548 Ga0070665_100375196 Ga0070665_1003751961 255
181 3300005563 Ga0068855_100012743 Ga0068855_1000127433 255
182 3300005563 Ga0068855_100029305 Ga0068855_1000293054 255
183 3300005563 Ga0068855_100870260 Ga0068855_1008702601 255
184 3300005577 Ga0068857_100010916 Ga0068857_1000109165 255
185 3300005578 Ga0068854_100046207 Ga0068854_1000462073 255
186 3300005578 Ga0068854_100142231 Ga0068854_1001422313 255
187 3300005614 Ga0068856_100003706 Ga0068856_10000370615 255
188 3300005614 Ga0068856_100005176 Ga0068856_10000517610 255
189 3300005614 Ga0068856_100013224 Ga0068856_1000132247 255
190 3300005616 Ga0068852_100006419 Ga0068852_1000064198 255
191 3300005616 Ga0068852_100129445 Ga0068852_1001294453 255
192 3300005616 Ga0068852_100292315 Ga0068852_1002923152 255
193 3300005618 Ga0068864_100223959 Ga0068864_1002239591 255
194 3300005719 Ga0068861_100161939 Ga0068861_1001619393 255
195 3300005719 Ga0068861_100324686 Ga0068861_1003246861 255
196 3300005834 Ga0068851_10001156 Ga0068851_1000115610 255
197 3300005841 Ga0068863_100273194 Ga0068863_1002731942 255
198 3300005842 Ga0068858_100307433 Ga0068858_1003074332 255
199 3300005843 Ga0068860_100515333 Ga0068860_1005153332 255
200 3300005844 Ga0068862_100193470 Ga0068862_1001934701 255
201 3300005844 Ga0068862_100463610 Ga0068862_1004636102 255
202 3300005983 Ga0081540_1003852 Ga0081540_100385216 255
203 3300006028 Ga0070717_10050603 Ga0070717_100506032 255
204 3300006038 Ga0075365_10034155 Ga0075365_100341552 255
205 3300006048 Ga0075363_100059406 Ga0075363_1000594062 255
206 3300006051 Ga0075364_10334752 Ga0075364_103347522 255
207 3300006163 Ga0070715_10000097 Ga0070715_1000009717 255
208 3300006173 Ga0070716_100036969 Ga0070716_1000369692 255
209 3300006173 Ga0070716_100088225 Ga0070716_1000882252 255
210 3300006175 Ga0070712_100008651 Ga0070712_1000086515 255
211 3300006178 Ga0075367_10090351 Ga0075367_100903512 255
212 3300006178 Ga0075367_10238426 Ga0075367_102384262 255
213 3300006353 Ga0075370_10015658 Ga0075370_100156581 255
214 3300006358 Ga0068871_100381292 Ga0068871_1003812922 255
215 3300009092 Ga0105250_10028114 Ga0105250_100281143 255
216 3300009093 Ga0105240_10004584 Ga0105240_1000458422 255
217 3300009093 Ga0105240_10008073 Ga0105240_100080739 255
218 3300009093 Ga0105240_10014611 Ga0105240_100146114 255
219 3300009101 Ga0105247_10047230 Ga0105247_100472304 255
220 3300009174 Ga0105241_10006953 Ga0105241_100069534 255
221 3300009545 Ga0105237_10059625 Ga0105237_100596254 255
222 3300009545 Ga0105237_10084203 Ga0105237_100842033 255
223 3300009551 Ga0105238_10000514 Ga0105238_1000051431 255
224 3300009551 Ga0105238_10005508 Ga0105238_1000550811 255
225 3300010375 Ga0105239_10005274 Ga0105239_1000527414 255
226 3300010375 Ga0105239_10006195 Ga0105239_1000619511 255
227 3300010375 Ga0105239_10098984 Ga0105239_100989842 255
228 3300010375 Ga0105239_10489518 Ga0105239_104895182 255
229 3300010375 Ga0105239_10709170 Ga0105239_107091701 255
230 3300013102 Ga0157371_10010534 Ga0157371_100105344 255
231 3300013104 Ga0157370_10043547 Ga0157370_100435473 255
232 3300013296 Ga0157374_10505326 Ga0157374_105053262 255
233 3300013297 Ga0157378_10230816 Ga0157378_102308162 255
234 3300014745 Ga0157377_10082353 Ga0157377_100823533 255
235 3300014968 Ga0157379_10156684 Ga0157379_101566841 255
236 3300014969 Ga0157376_10119674 Ga0157376_101196741 255
237 3300014969 Ga0157376_10535805 Ga0157376_105358052 255
238 3300021441 Ga0213871_10005850 Ga0213871_100058502 255
239 3300024225 Ga0224572_1001489 Ga0224572_10014895 255
240 3300025295 Ga0209564_1002116 Ga0209564_10021164 255
241 3300025321 Ga0207656_10141760 Ga0207656_101417601 255
242 3300025885 Ga0207653_10043061 Ga0207653_100430611 255
243 3300025898 Ga0207692_10002157 Ga0207692_100021575 255
244 3300025905 Ga0207685_10000990 Ga0207685_100009904 255
245 3300025905 Ga0207685_10046986 Ga0207685_100469862 255
246 3300025906 Ga0207699_10004697 Ga0207699_100046972 255
247 3300025906 Ga0207699_10189381 Ga0207699_101893811 255
248 3300025911 Ga0207654_10000526 Ga0207654_1000052618 255
249 3300025911 Ga0207654_10014836 Ga0207654_100148364 255
250 3300025913 Ga0207695_10000163 Ga0207695_1000016380 255
251 3300025913 Ga0207695_10000286 Ga0207695_1000028683 255
252 3300025913 Ga0207695_10019088 Ga0207695_100190887 255
253 3300025914 Ga0207671_10026189 Ga0207671_100261891 255
254 3300025914 Ga0207671_10165071 Ga0207671_101650712 255
255 3300025915 Ga0207693_10000541 Ga0207693_1000054129 255
256 3300025915 Ga0207693_10282442 Ga0207693_102824422 255
257 3300025916 Ga0207663_10000261 Ga0207663_1000026117 255
258 3300025923 Ga0207681_10337810 Ga0207681_103378102 255
259 3300025924 Ga0207694_10000120 Ga0207694_1000012027 255
260 3300025924 Ga0207694_10024012 Ga0207694_100240122 255
261 3300025924 Ga0207694_10036032 Ga0207694_100360325 255
262 3300025925 Ga0207650_10299343 Ga0207650_102993431 255
263 3300025926 Ga0207659_10288701 Ga0207659_102887012 255
264 3300025927 Ga0207687_10109032 Ga0207687_101090322 255
265 3300025928 Ga0207700_10003910 Ga0207700_100039105 255
266 3300025929 Ga0207664_10004837 Ga0207664_100048375 255
267 3300025929 Ga0207664_10069877 Ga0207664_100698772 255
268 3300025931 Ga0207644_10078270 Ga0207644_100782702 255
269 3300025933 Ga0207706_10230369 Ga0207706_102303692 255
270 3300025933 Ga0207706_10232786 Ga0207706_102327862 255
271 3300025939 Ga0207665_10000280 Ga0207665_1000028020 255
272 3300025939 Ga0207665_10022222 Ga0207665_100222222 255
273 3300025940 Ga0207691_10237979 Ga0207691_102379792 255
274 3300025942 Ga0207689_10405390 Ga0207689_104053901 255
275 3300025949 Ga0207667_10001834 Ga0207667_1000183414 255
276 3300025949 Ga0207667_10032845 Ga0207667_100328453 255
277 3300025960 Ga0207651_10246120 Ga0207651_102461202 255
278 3300025960 Ga0207651_10287634 Ga0207651_102876342 255
279 3300025961 Ga0207712_10219666 Ga0207712_102196661 255
280 3300025961 Ga0207712_10608762 Ga0207712_106087621 255
281 3300025972 Ga0207668_10071073 Ga0207668_100710731 255
282 3300025981 Ga0207640_10145075 Ga0207640_101450751 255
283 3300026035 Ga0207703_10080853 Ga0207703_100808532 255
284 3300026035 Ga0207703_10272724 Ga0207703_102727242 255
285 3300026041 Ga0207639_10003014 Ga0207639_100030143 255
286 3300026067 Ga0207678_10054813 Ga0207678_100548134 255
287 3300026067 Ga0207678_10284513 Ga0207678_102845132 255
288 3300026078 Ga0207702_10000019 Ga0207702_10000019119 255
289 3300026078 Ga0207702_10017659 Ga0207702_100176595 255
290 3300026078 Ga0207702_10063987 Ga0207702_100639873 255
291 3300026088 Ga0207641_10193664 Ga0207641_101936642 255
292 3300026089 Ga0207648_10390145 Ga0207648_103901452 255
293 3300026095 Ga0207676_10150451 Ga0207676_101504512 255
294 3300026095 Ga0207676_10315786 Ga0207676_103157861 255
295 3300026116 Ga0207674_10004566 Ga0207674_100045665 255
296 3300026116 Ga0207674_10008031 Ga0207674_1000803110 255
297 3300026118 Ga0207675_100453582 Ga0207675_1004535822 255
298 3300026118 Ga0207675_100505572 Ga0207675_1005055722 255
299 3300026142 Ga0207698_10105593 Ga0207698_101055931 255
300 3300028023 Ga0265357_1001110 Ga0265357_10011102 255
301 3300028379 Ga0268266_10133677 Ga0268266_101336771 255
302 3300028380 Ga0268265_10023019 Ga0268265_100230194 255
303 3300028381 Ga0268264_10460019 Ga0268264_104600192 255
304 3300028786 Ga0307517_10116215 Ga0307517_101162151 255
305 3300028794 Ga0307515_10304581 Ga0307515_103045812 255
306 3300031456 Ga0307513_10345524 Ga0307513_103455241 255
307 3300031507 Ga0307509_10347576 Ga0307509_103475761 255
308 3300031712 Ga0265342_10007293 Ga0265342_100072934 255
309 3300031730 Ga0307516_10317292 Ga0307516_103172921 255
310 3300031731 Ga0307405_10136547 Ga0307405_101365472 255
311 3300031901 Ga0307406_10535555 Ga0307406_105355551 255
312 3300031903 Ga0307407_10407133 Ga0307407_104071331 255
313 3300031995 Ga0307409_100151544 Ga0307409_1001515443 255
314 3300032002 Ga0307416_100054843 Ga0307416_1000548435 255
315 3300032005 Ga0307411_10119714 Ga0307411_101197141 255
316 3300032126 Ga0307415_100169177 Ga0307415_1001691773 255
317 3300032126 Ga0307415_100458004 Ga0307415_1004580041 255
318 3300033180 Ga0307510_10005901 Ga0307510_100059015 255
319 3300036401 Ga0373937_0135194 Ga0373937_0135194_275_1042 255
320 3300039447 Ga0436361_1012338 Ga0436361_1012338_4454_5230 255
321 3300039450 Ga0436363_1050788 Ga0436363_1050788_346_1116 255
322 3300039453 Ga0436362_0938097 Ga0436362_0938097_306_1082 255
323 3300041458 Ga0451798_0501681 Ga0451798_0501681_596_1366 255
324 3300044656 Ga0466969_0059847 Ga0466969_0059847_488_1255 255
325 3300044684 Ga0466966_0105951 Ga0466966_0105951_189_956 255
326 3300044706 Ga0466964_0172850 Ga0466964_0172850_19_801 255
327 3300046455 Ga0495603_0015087 Ga0495603_0015087_1701_2471 255
328 3300046455 Ga0495603_0016074 Ga0495603_0016074_2537_3304 255
329 3300046457 Ga0495590_0024886 Ga0495590_0024886_1277_2047 255
330 3300046471 Ga0495650_0074366 Ga0495650_0074366_353_1126 255
331 3300046475 Ga0495639_0042792 Ga0495639_0042792_1101_1868 255
332 3300046499 Ga0495594_0045208 Ga0495594_0045208_584_1354 255
333 3300046506 Ga0495583_0106677 Ga0495583_0106677_248_1018 255
334 3300046507 Ga0495606_0156169 Ga0495606_0156169_536_1306 255
335 3300046512 Ga0495610_0038842 Ga0495610_0038842_643_1413 255
336 3300046513 Ga0495616_0084746 Ga0495616_0084746_343_1116 255
337 3300046518 Ga0495631_0073046 Ga0495631_0073046_151_921 255
338 3300046519 Ga0495632_0194523 Ga0495632_0194523_115_885 255
339 3300046523 Ga0495644_0097567 Ga0495644_0097567_317_1087 255
340 3300046524 Ga0495648_0068090 Ga0495648_0068090_895_1665 255
341 3300046542 Ga0495597_0111987 Ga0495597_0111987_49_819 255
342 3300046557 Ga0495622_0088271 Ga0495622_0088271_301_1071 255
343 3300046558 Ga0495633_0184110 Ga0495633_0184110_91_864 255
344 3300046615 Ga0495656_0088988 Ga0495656_0088988_252_1022 255
345 3300046648 Ga0495611_0141212 Ga0495611_0141212_267_1037 255
346 3300046665 Ga0495661_0176250 Ga0495661_0176250_328_1098 255
347 3300046675 Ga0495657_0233457 Ga0495657_0233457_298_1065 255
348 3300046691 Ga0495670_0021246 Ga0495670_0021246_969_1739 255
349 3300046794 Ga0495589_0054960 Ga0495589_0054960_715_1485 255
350 3300047317 Ga0495604_0313140 Ga0495604_0313140_39_806 255
351 3300047318 Ga0495636_0036181 Ga0495636_0036181_1116_1886 255
352 3300047323 Ga0495683_0124101 Ga0495683_0124101_60_830 255
353 3300047469 Ga0495673_0077420 Ga0495673_0077420_201_971 255
354 3300047472 Ga0495686_0043114 Ga0495686_0043114_845_1618 255
355 3300047472 Ga0495686_0092777 Ga0495686_0092777_324_1094 255
356 3300048908 Ga0496105_0390837 Ga0496105_0390837_183_956 255
357 3300048911 Ga0496108_0119426 Ga0496108_0119426_692_1462 255
358 3300048912 Ga0496109_0091458 Ga0496109_0091458_655_1425 255
359 3300048912 Ga0496109_0410057 Ga0496109_0410057_212_985 255
360 3300048915 Ga0496112_0153212 Ga0496112_0153212_1313_2083 255
361 3300048924 Ga0496121_0077052 Ga0496121_0077052_1484_2254 255
362 3300048924 Ga0496121_0171025 Ga0496121_0171025_216_986 255
363 3300048924 Ga0496121_0368773 Ga0496121_0368773_129_905 255
364 3300048924 Ga0496121_0416496 Ga0496121_0416496_13_783 255
365 3300048925 Ga0496122_0276291 Ga0496122_0276291_19_795 255
366 3300048927 Ga0496124_0056109 Ga0496124_0056109_1213_1983 255
367 3300048927 Ga0496124_0289595 Ga0496124_0289595_171_941 255
368 3300048927 Ga0496124_0498712 Ga0496124_0498712_32_802 255
369 3300048929 Ga0496126_0008548 Ga0496126_0008548_2014_2784 255
370 3300048929 Ga0496126_0090707 Ga0496126_0090707_914_1684 255
371 3300049568 Ga0501031_0000428 Ga0501031_0000428_23370_24143 255
372 3300049569 Ga0501032_0001029 Ga0501032_0001029_13622_14395 255
373 3300049570 Ga0501033_0000163 Ga0501033_0000163_58167_58940 255
374 3300049571 Ga0501034_0000202 Ga0501034_0000202_36320_37093 255
375 3300049572 Ga0501036_0000042 Ga0501036_0000042_3236_4009 255
376 3300049573 Ga0501037_0000100 Ga0501037_0000100_72_845 255
377 3300049574 Ga0501038_0000226 Ga0501038_0000226_32681_33454 255
378 3300049575 Ga0501039_0003287 Ga0501039_0003287_11183_11956 255
379 3300049579 Ga0501043_0001024 Ga0501043_0001024_447_1220 255
380 3300049580 Ga0501046_0000619 Ga0501046_0000619_31994_32767 255
381 3300049581 Ga0501047_0000159 Ga0501047_0000159_77819_78592 255
382 3300049582 Ga0501048_0000050 Ga0501048_0000050_37034_37807 255
383 3300049583 Ga0501067_0005945 Ga0501067_0005945_1660_2433 255
384 3300049584 Ga0501068_0000430 Ga0501068_0000430_15608_16381 255
385 3300049586 Ga0501070_0053110 Ga0501070_0053110_667_1440 255
386 3300049586 Ga0501070_0177345 Ga0501070_0177345_18_791 255
387 3300049589 Ga0501073_0000329 Ga0501073_0000329_6069_6842 255
388 3300049590 Ga0501074_0000414 Ga0501074_0000414_21658_22431 255
389 3300049741 Ga0501079_0003664 Ga0501079_0003664_145_918 255
390 3300049742 Ga0501080_0000403 Ga0501080_0000403_24466_25239 255
391 3300049744 Ga0501083_0006265 Ga0501083_0006265_783_1556 255
392 3300049822 Ga0501035_0000120 Ga0501035_0000120_32807_33580 255
393 3300049822 Ga0501035_0232759 Ga0501035_0232759_601_1374 255
394 3300049823 Ga0501044_0001777 Ga0501044_0001777_15608_16381 255
395 3300049824 Ga0501045_0003832 Ga0501045_0003832_3434_4207 255
396 3300050492 nmdc:mga0yw44_42619_c1 nmdc:mga0yw44_42619_c1_589_1359 255
397 3300050493 nmdc:mga0k408_326403_c1 nmdc:mga0k408_326403_c1_108_878 255
398 3300050494 nmdc:mga06z11_136998_c1 nmdc:mga06z11_136998_c1_388_1158 255
399 3300050496 nmdc:mga07m45_132698_c1 nmdc:mga07m45_132698_c1_643_1413 255
400 3300050496 nmdc:mga07m45_17418_c1 nmdc:mga07m45_17418_c1_2781_3551 255
401 3300050496 nmdc:mga07m45_53645_c1 nmdc:mga07m45_53645_c1_1103_1873 255
402 3300050513 nmdc:mga0rr50_373004_c1 nmdc:mga0rr50_373004_c1_168_938 255
403 3300050515 nmdc:mga0a205_112801_c1 nmdc:mga0a205_112801_c1_1804_2574 255
404 3300053093 Ga0500651_0236169 Ga0500651_0236169_132_902 255
405 3300053096 Ga0500641_0016700 Ga0500641_0016700_29_799 255
406 3300053108 Ga0500562_003130 Ga0500562_003130_2315_3085 255
407 3300053119 Ga0500595_001435 Ga0500595_001435_3528_4298 255
408 3300053147 Ga0500589_094864 Ga0500589_094864_272_1042 255
409 3300053147 Ga0500589_134231 Ga0500589_134231_166_936 255
410 3300053150 Ga0500603_068748 Ga0500603_068748_181_948 255
411 3300053151 Ga0500604_0127133 Ga0500604_0127133_30_800 255
412 3300053158 Ga0500627_0163336 Ga0500627_0163336_222_992 255
413 3300053732 Ga0500656_008164 Ga0500656_008164_299_1069 255
414 3300054114 Ga0501084_0007843 Ga0501084_0007843_1703_2476 255
415 3300000549 LJQas_1006317 LJQas_10063172 256
416 3300003215 JGI25153J46596_10003412 JGI25153J46596_100034122 256
417 3300003323 rootH1_10044347 rootH1_100443472 256
418 3300003659 JGI25404J52841_10037718 JGI25404J52841_100377181 256
419 3300005327 Ga0070658_10019292 Ga0070658_100192923 256
420 3300005327 Ga0070658_10271726 Ga0070658_102717262 256
421 3300005329 Ga0070683_100003303 Ga0070683_10000330310 256
422 3300005329 Ga0070683_100040395 Ga0070683_1000403954 256
423 3300005329 Ga0070683_100049222 Ga0070683_1000492222 256
424 3300005331 Ga0070670_100184301 Ga0070670_1001843013 256
425 3300005336 Ga0070680_100030563 Ga0070680_1000305634 256
426 3300005336 Ga0070680_100261526 Ga0070680_1002615261 256
427 3300005339 Ga0070660_100001126 Ga0070660_10000112613 256
428 3300005339 Ga0070660_100047104 Ga0070660_1000471044 256
429 3300005344 Ga0070661_100013721 Ga0070661_1000137214 256
430 3300005347 Ga0070668_100108941 Ga0070668_1001089413 256
431 3300005347 Ga0070668_100118734 Ga0070668_1001187342 256
432 3300005355 Ga0070671_100034539 Ga0070671_1000345392 256
433 3300005356 Ga0070674_100050181 Ga0070674_1000501813 256
434 3300005366 Ga0070659_100010953 Ga0070659_1000109534 256
435 3300005366 Ga0070659_100542944 Ga0070659_1005429441 256
436 3300005434 Ga0070709_10277985 Ga0070709_102779851 256
437 3300005435 Ga0070714_100022705 Ga0070714_1000227055 256
438 3300005435 Ga0070714_100026305 Ga0070714_1000263055 256
439 3300005435 Ga0070714_100633225 Ga0070714_1006332251 256
440 3300005436 Ga0070713_100024693 Ga0070713_1000246935 256
441 3300005436 Ga0070713_100027055 Ga0070713_1000270556 256
442 3300005436 Ga0070713_100062854 Ga0070713_1000628543 256
443 3300005436 Ga0070713_100464401 Ga0070713_1004644011 256
444 3300005437 Ga0070710_10000869 Ga0070710_100008691 256
445 3300005437 Ga0070710_10481898 Ga0070710_104818981 256
446 3300005438 Ga0070701_10175276 Ga0070701_101752762 256
447 3300005439 Ga0070711_100001638 Ga0070711_1000016381 256
448 3300005439 Ga0070711_100013567 Ga0070711_1000135672 256
449 3300005439 Ga0070711_100233615 Ga0070711_1002336152 256
450 3300005439 Ga0070711_100509365 Ga0070711_1005093651 256
451 3300005455 Ga0070663_100024391 Ga0070663_1000243913 256
452 3300005455 Ga0070663_100030275 Ga0070663_1000302752 256
453 3300005455 Ga0070663_100078737 Ga0070663_1000787371 256
454 3300005456 Ga0070678_100066749 Ga0070678_1000667492 256
455 3300005456 Ga0070678_100098709 Ga0070678_1000987092 256
456 3300005458 Ga0070681_10019518 Ga0070681_100195185 256
457 3300005458 Ga0070681_10058646 Ga0070681_100586462 256
458 3300005458 Ga0070681_10273678 Ga0070681_102736781 256
459 3300005459 Ga0068867_100008066 Ga0068867_1000080665 256
460 3300005471 Ga0070698_100077919 Ga0070698_1000779193 256
461 3300005530 Ga0070679_100013683 Ga0070679_1000136832 256
462 3300005530 Ga0070679_100030393 Ga0070679_1000303931 256
463 3300005530 Ga0070679_100092886 Ga0070679_1000928861 256
464 3300005530 Ga0070679_100197687 Ga0070679_1001976872 256
465 3300005535 Ga0070684_100030375 Ga0070684_1000303755 256
466 3300005535 Ga0070684_100096932 Ga0070684_1000969321 256
467 3300005535 Ga0070684_100115400 Ga0070684_1001154002 256
468 3300005535 Ga0070684_100246669 Ga0070684_1002466692 256
469 3300005535 Ga0070684_100807973 Ga0070684_1008079731 256
470 3300005536 Ga0070697_100040365 Ga0070697_1000403653 256
471 3300005539 Ga0068853_100002631 Ga0068853_1000026317 256
472 3300005539 Ga0068853_100034375 Ga0068853_1000343755 256
473 3300005539 Ga0068853_100247085 Ga0068853_1002470852 256
474 3300005543 Ga0070672_100230303 Ga0070672_1002303032 256
475 3300005544 Ga0070686_100090732 Ga0070686_1000907322 256
476 3300005546 Ga0070696_100272168 Ga0070696_1002721682 256
477 3300005548 Ga0070665_100054477 Ga0070665_1000544774 256
478 3300005548 Ga0070665_100063343 Ga0070665_1000633432 256
479 3300005548 Ga0070665_100103479 Ga0070665_1001034793 256
480 3300005548 Ga0070665_100155974 Ga0070665_1001559743 256
481 3300005563 Ga0068855_100009152 Ga0068855_10000915211 256
482 3300005563 Ga0068855_100107428 Ga0068855_1001074281 256
483 3300005563 Ga0068855_100108093 Ga0068855_1001080935 256
484 3300005563 Ga0068855_100233987 Ga0068855_1002339872 256
485 3300005563 Ga0068855_100350593 Ga0068855_1003505932 256
486 3300005563 Ga0068855_100477272 Ga0068855_1004772721 256
487 3300005564 Ga0070664_100173417 Ga0070664_1001734173 256
488 3300005577 Ga0068857_100111646 Ga0068857_1001116462 256
489 3300005577 Ga0068857_100449801 Ga0068857_1004498011 256
490 3300005578 Ga0068854_100135231 Ga0068854_1001352312 256
491 3300005578 Ga0068854_100404860 Ga0068854_1004048602 256
492 3300005578 Ga0068854_100470440 Ga0068854_1004704401 256
493 3300005614 Ga0068856_100000505 Ga0068856_1000005058 256
494 3300005614 Ga0068856_100343639 Ga0068856_1003436392 256
495 3300005615 Ga0070702_100182398 Ga0070702_1001823982 256
496 3300005615 Ga0070702_100348618 Ga0070702_1003486181 256
497 3300005616 Ga0068852_100057367 Ga0068852_1000573672 256
498 3300005616 Ga0068852_100081648 Ga0068852_1000816482 256
499 3300005617 Ga0068859_100169985 Ga0068859_1001699851 256
500 3300005618 Ga0068864_100023598 Ga0068864_1000235983 256
501 3300005718 Ga0068866_10017775 Ga0068866_100177753 256
502 3300005719 Ga0068861_100135350 Ga0068861_1001353502 256
503 3300005719 Ga0068861_100210584 Ga0068861_1002105842 256
504 3300005834 Ga0068851_10011174 Ga0068851_100111744 256
505 3300005834 Ga0068851_10193561 Ga0068851_101935611 256
506 3300005840 Ga0068870_10141997 Ga0068870_101419972 256
507 3300005841 Ga0068863_100238926 Ga0068863_1002389262 256
508 3300005843 Ga0068860_100001118 Ga0068860_10000111826 256
509 3300005843 Ga0068860_100149647 Ga0068860_1001496472 256
510 3300005844 Ga0068862_100798318 Ga0068862_1007983181 256
511 3300005937 Ga0081455_10026711 Ga0081455_100267112 256
512 3300005937 Ga0081455_10054044 Ga0081455_100540441 256
513 3300005937 Ga0081455_10067184 Ga0081455_100671841 256
514 3300005937 Ga0081455_10085022 Ga0081455_100850222 256
515 3300005937 Ga0081455_10330485 Ga0081455_103304852 256
516 3300005983 Ga0081540_1003833 Ga0081540_10038332 256
517 3300005983 Ga0081540_1014162 Ga0081540_10141627 256
518 3300005983 Ga0081540_1053246 Ga0081540_10532462 256
519 3300005983 Ga0081540_1097116 Ga0081540_10971161 256
520 3300005983 Ga0081540_1121082 Ga0081540_11210821 256
521 3300005983 Ga0081540_1128391 Ga0081540_11283911 256
522 3300005985 Ga0081539_10000003 Ga0081539_10000003389 256
523 3300005985 Ga0081539_10000199 Ga0081539_1000019978 256
524 3300005985 Ga0081539_10011226 Ga0081539_100112266 256
525 3300005985 Ga0081539_10091375 Ga0081539_100913752 256
526 3300006028 Ga0070717_10000877 Ga0070717_100008777 256
527 3300006028 Ga0070717_10052422 Ga0070717_100524222 256
528 3300006028 Ga0070717_10259682 Ga0070717_102596822 256
529 3300006028 Ga0070717_10276491 Ga0070717_102764912 256
530 3300006038 Ga0075365_10074211 Ga0075365_100742112 256
531 3300006038 Ga0075365_10135542 Ga0075365_101355422 256
532 3300006038 Ga0075365_10254275 Ga0075365_102542752 256
533 3300006048 Ga0075363_100000869 Ga0075363_10000086911 256
534 3300006048 Ga0075363_100205554 Ga0075363_1002055542 256
535 3300006051 Ga0075364_10041151 Ga0075364_100411513 256
536 3300006051 Ga0075364_10289562 Ga0075364_102895622 256
537 3300006173 Ga0070716_100533039 Ga0070716_1005330391 256
538 3300006175 Ga0070712_100031048 Ga0070712_1000310483 256
539 3300006175 Ga0070712_100043775 Ga0070712_1000437752 256
540 3300006175 Ga0070712_100072270 Ga0070712_1000722701 256
541 3300006175 Ga0070712_100432392 Ga0070712_1004323921 256
542 3300006177 Ga0075362_10049030 Ga0075362_100490302 256
543 3300006186 Ga0075369_10037853 Ga0075369_100378531 256
544 3300006195 Ga0075366_10158205 Ga0075366_101582052 256
545 3300006237 Ga0097621_100158115 Ga0097621_1001581152 256
546 3300006237 Ga0097621_100207232 Ga0097621_1002072322 256
547 3300006358 Ga0068871_100177603 Ga0068871_1001776032 256
548 3300006844 Ga0075428_100109348 Ga0075428_1001093481 256
549 3300006844 Ga0075428_100222393 Ga0075428_1002223932 256
550 3300006871 Ga0075434_100051816 Ga0075434_1000518163 256
551 3300006931 Ga0097620_100169978 Ga0097620_1001699781 256
552 3300007265 Ga0099794_10007546 Ga0099794_100075462 256
553 3300007265 Ga0099794_10056404 Ga0099794_100564042 256
554 3300007788 Ga0099795_10022059 Ga0099795_100220592 256
555 3300007788 Ga0099795_10062412 Ga0099795_100624122 256
556 3300009093 Ga0105240_10027790 Ga0105240_100277907 256
557 3300009093 Ga0105240_10190656 Ga0105240_101906563 256
558 3300009093 Ga0105240_10371331 Ga0105240_103713312 256
559 3300009098 Ga0105245_10074181 Ga0105245_100741813 256
560 3300009098 Ga0105245_10256732 Ga0105245_102567322 256
561 3300009098 Ga0105245_10392154 Ga0105245_103921541 256
562 3300009098 Ga0105245_11014968 Ga0105245_110149681 256
563 3300009101 Ga0105247_10221319 Ga0105247_102213191 256
564 3300009101 Ga0105247_10307748 Ga0105247_103077481 256
565 3300009147 Ga0114129_10029983 Ga0114129_100299837 256
566 3300009148 Ga0105243_10013895 Ga0105243_100138955 256
567 3300009176 Ga0105242_10046792 Ga0105242_100467921 256
568 3300009177 Ga0105248_10104039 Ga0105248_101040394 256
569 3300009177 Ga0105248_10232662 Ga0105248_102326622 256
570 3300009545 Ga0105237_10068507 Ga0105237_100685075 256
571 3300009545 Ga0105237_10111604 Ga0105237_101116042 256
572 3300009545 Ga0105237_10359508 Ga0105237_103595082 256
573 3300009545 Ga0105237_10370604 Ga0105237_103706042 256
574 3300009545 Ga0105237_10540123 Ga0105237_105401232 256
575 3300009551 Ga0105238_10003122 Ga0105238_100031227 256
576 3300009551 Ga0105238_10052584 Ga0105238_100525843 256
577 3300009551 Ga0105238_10387041 Ga0105238_103870412 256
578 3300009551 Ga0105238_10494024 Ga0105238_104940242 256
579 3300009553 Ga0105249_10133967 Ga0105249_101339672 256
580 3300009553 Ga0105249_10198083 Ga0105249_101980833 256
581 3300010159 Ga0099796_10012565 Ga0099796_100125653 256
582 3300010375 Ga0105239_10154485 Ga0105239_101544852 256
583 3300010375 Ga0105239_10203170 Ga0105239_102031703 256
584 3300010375 Ga0105239_10688720 Ga0105239_106887201 256
585 3300013100 Ga0157373_10078661 Ga0157373_100786612 256
586 3300013104 Ga0157370_10085199 Ga0157370_100851993 256
587 3300013105 Ga0157369_10013290 Ga0157369_100132909 256
588 3300013105 Ga0157369_10042781 Ga0157369_100427815 256
589 3300013105 Ga0157369_10045117 Ga0157369_100451172 256
590 3300013105 Ga0157369_10249624 Ga0157369_102496242 256
591 3300013296 Ga0157374_10071052 Ga0157374_100710522 256
592 3300013296 Ga0157374_10094370 Ga0157374_100943702 256
593 3300013306 Ga0163162_10013124 Ga0163162_100131242 256
594 3300013306 Ga0163162_10062945 Ga0163162_100629453 256
595 3300013306 Ga0163162_10308505 Ga0163162_103085052 256
596 3300013307 Ga0157372_10045190 Ga0157372_100451903 256
597 3300013308 Ga0157375_10004177 Ga0157375_100041773 256
598 3300014325 Ga0163163_10094162 Ga0163163_100941624 256
599 3300014325 Ga0163163_10115161 Ga0163163_101151611 256
600 3300014325 Ga0163163_10277211 Ga0163163_102772111 256
601 3300014325 Ga0163163_10600751 Ga0163163_106007512 256
602 3300014326 Ga0157380_10506138 Ga0157380_105061382 256
603 3300014968 Ga0157379_10120583 Ga0157379_101205832 256
604 3300017792 Ga0163161_10066771 Ga0163161_100667712 256
605 3300020069 Ga0197907_10522121 Ga0197907_105221213 256
606 3300020070 Ga0206356_11303995 Ga0206356_113039951 256
607 3300020070 Ga0206356_11334192 Ga0206356_113341922 256
608 3300020080 Ga0206350_10556797 Ga0206350_105567971 256
609 3300020082 Ga0206353_10940261 Ga0206353_109402612 256
610 3300021377 Ga0213874_10031886 Ga0213874_100318862 256
611 3300021384 Ga0213876_10010932 Ga0213876_100109322 256
612 3300021384 Ga0213876_10085289 Ga0213876_100852891 256
613 3300021384 Ga0213876_10190284 Ga0213876_101902841 256
614 3300021388 Ga0213875_10155114 Ga0213875_101551141 256
615 3300025253 Ga0209677_100241 Ga0209677_1002417 256
616 3300025254 Ga0209148_1004574 Ga0209148_10045743 256
617 3300025261 Ga0209233_1004313 Ga0209233_10043135 256
618 3300025272 Ga0209455_1001933 Ga0209455_10019337 256
619 3300025297 Ga0209758_1002070 Ga0209758_100207016 256
620 3300025321 Ga0207656_10002763 Ga0207656_100027634 256
621 3300025893 Ga0207682_10075127 Ga0207682_100751271 256
622 3300025898 Ga0207692_10001993 Ga0207692_100019934 256
623 3300025899 Ga0207642_10020500 Ga0207642_100205002 256
624 3300025900 Ga0207710_10117487 Ga0207710_101174872 256
625 3300025904 Ga0207647_10054116 Ga0207647_100541163 256
626 3300025906 Ga0207699_10000253 Ga0207699_1000025310 256
627 3300025906 Ga0207699_10015823 Ga0207699_100158233 256
628 3300025906 Ga0207699_10111963 Ga0207699_101119632 256
629 3300025906 Ga0207699_10205930 Ga0207699_102059302 256
630 3300025909 Ga0207705_10032892 Ga0207705_100328922 256
631 3300025909 Ga0207705_10064461 Ga0207705_100644612 256
632 3300025909 Ga0207705_10154377 Ga0207705_101543771 256
633 3300025912 Ga0207707_10001093 Ga0207707_100010939 256
634 3300025912 Ga0207707_10006358 Ga0207707_100063588 256
635 3300025912 Ga0207707_10049372 Ga0207707_100493721 256
636 3300025912 Ga0207707_10054162 Ga0207707_100541625 256
637 3300025912 Ga0207707_10091475 Ga0207707_100914751 256
638 3300025912 Ga0207707_10187798 Ga0207707_101877981 256
639 3300025912 Ga0207707_10479515 Ga0207707_104795152 256
640 3300025913 Ga0207695_10022532 Ga0207695_100225322 256
641 3300025913 Ga0207695_10089735 Ga0207695_100897352 256
642 3300025913 Ga0207695_10438549 Ga0207695_104385491 256
643 3300025914 Ga0207671_10015168 Ga0207671_100151685 256
644 3300025914 Ga0207671_10029468 Ga0207671_100294681 256
645 3300025914 Ga0207671_10247068 Ga0207671_102470682 256
646 3300025914 Ga0207671_10248510 Ga0207671_102485102 256
647 3300025914 Ga0207671_10270796 Ga0207671_102707962 256
648 3300025915 Ga0207693_10024218 Ga0207693_100242185 256
649 3300025915 Ga0207693_10036490 Ga0207693_100364902 256
650 3300025915 Ga0207693_10069864 Ga0207693_100698641 256
651 3300025916 Ga0207663_10046871 Ga0207663_100468712 256
652 3300025917 Ga0207660_10026628 Ga0207660_100266282 256
653 3300025917 Ga0207660_10127810 Ga0207660_101278102 256
654 3300025917 Ga0207660_10292197 Ga0207660_102921972 256
655 3300025919 Ga0207657_10002321 Ga0207657_1000232111 256
656 3300025919 Ga0207657_10036408 Ga0207657_100364084 256
657 3300025919 Ga0207657_10120589 Ga0207657_101205892 256
658 3300025920 Ga0207649_10019853 Ga0207649_100198533 256
659 3300025920 Ga0207649_10552560 Ga0207649_105525601 256
660 3300025921 Ga0207652_10002982 Ga0207652_1000298211 256
661 3300025921 Ga0207652_10014050 Ga0207652_100140506 256
662 3300025921 Ga0207652_10041013 Ga0207652_100410132 256
663 3300025921 Ga0207652_10091653 Ga0207652_100916533 256
664 3300025921 Ga0207652_10161430 Ga0207652_101614302 256
665 3300025921 Ga0207652_10273737 Ga0207652_102737372 256
666 3300025924 Ga0207694_10005198 Ga0207694_100051983 256
667 3300025927 Ga0207687_10319657 Ga0207687_103196572 256
668 3300025928 Ga0207700_10013470 Ga0207700_100134705 256
669 3300025928 Ga0207700_10021957 Ga0207700_100219576 256
670 3300025928 Ga0207700_10040335 Ga0207700_100403354 256
671 3300025928 Ga0207700_10063044 Ga0207700_100630443 256
672 3300025929 Ga0207664_10187324 Ga0207664_101873241 256
673 3300025929 Ga0207664_10721955 Ga0207664_107219551 256
674 3300025932 Ga0207690_10015539 Ga0207690_100155393 256
675 3300025932 Ga0207690_10243760 Ga0207690_102437602 256
676 3300025933 Ga0207706_10453133 Ga0207706_104531331 256
677 3300025935 Ga0207709_10049331 Ga0207709_100493312 256
678 3300025938 Ga0207704_10014465 Ga0207704_100144655 256
679 3300025938 Ga0207704_10201888 Ga0207704_102018881 256
680 3300025939 Ga0207665_10092061 Ga0207665_100920613 256
681 3300025941 Ga0207711_10192920 Ga0207711_101929201 256
682 3300025944 Ga0207661_10002972 Ga0207661_1000297210 256
683 3300025944 Ga0207661_10018500 Ga0207661_100185004 256
684 3300025949 Ga0207667_10007460 Ga0207667_100074604 256
685 3300025949 Ga0207667_10098220 Ga0207667_100982203 256
686 3300025949 Ga0207667_10562118 Ga0207667_105621182 256
687 3300025961 Ga0207712_10621311 Ga0207712_106213111 256
688 3300025972 Ga0207668_10139272 Ga0207668_101392722 256
689 3300025981 Ga0207640_10071327 Ga0207640_100713272 256
690 3300025981 Ga0207640_10519393 Ga0207640_105193931 256
691 3300026035 Ga0207703_10669911 Ga0207703_106699111 256
692 3300026041 Ga0207639_10031045 Ga0207639_100310453 256
693 3300026041 Ga0207639_10081468 Ga0207639_100814681 256
694 3300026067 Ga0207678_10006176 Ga0207678_100061762 256
695 3300026067 Ga0207678_10044946 Ga0207678_100449463 256
696 3300026067 Ga0207678_10067235 Ga0207678_100672351 256
697 3300026067 Ga0207678_10076408 Ga0207678_100764081 256
698 3300026067 Ga0207678_10491946 Ga0207678_104919461 256
699 3300026075 Ga0207708_10153445 Ga0207708_101534452 256
700 3300026078 Ga0207702_10000127 Ga0207702_1000012760 256
701 3300026078 Ga0207702_10112912 Ga0207702_101129121 256
702 3300026088 Ga0207641_10320313 Ga0207641_103203132 256
703 3300026089 Ga0207648_10035881 Ga0207648_100358814 256
704 3300026095 Ga0207676_10242911 Ga0207676_102429112 256
705 3300026095 Ga0207676_10342551 Ga0207676_103425511 256
706 3300026116 Ga0207674_10020772 Ga0207674_100207724 256
707 3300026116 Ga0207674_10271668 Ga0207674_102716681 256
708 3300026116 Ga0207674_10476658 Ga0207674_104766581 256
709 3300026121 Ga0207683_10013367 Ga0207683_100133674 256
710 3300026121 Ga0207683_10096117 Ga0207683_100961173 256
711 3300026121 Ga0207683_10097310 Ga0207683_100973102 256
712 3300026121 Ga0207683_10177126 Ga0207683_101771261 256
713 3300026142 Ga0207698_10181890 Ga0207698_101818901 256
714 3300026142 Ga0207698_10648973 Ga0207698_106489731 256
715 3300027671 Ga0209588_1024398 Ga0209588_10243982 256
716 3300028379 Ga0268266_10175416 Ga0268266_101754162 256
717 3300028379 Ga0268266_10370150 Ga0268266_103701501 256
718 3300028379 Ga0268266_10496218 Ga0268266_104962181 256
719 3300028380 Ga0268265_10585604 Ga0268265_105856042 256
720 3300028381 Ga0268264_10000030 Ga0268264_1000003091 256
721 3300028381 Ga0268264_10400277 Ga0268264_104002772 256
722 3300028786 Ga0307517_10000744 Ga0307517_1000074421 256
723 3300028794 Ga0307515_10084138 Ga0307515_100841383 256
724 3300028800 Ga0265338_10044048 Ga0265338_100440483 256
725 3300031235 Ga0265330_10009899 Ga0265330_100098994 256
726 3300031238 Ga0265332_10006066 Ga0265332_100060663 256
727 3300031239 Ga0265328_10012115 Ga0265328_100121154 256
728 3300031241 Ga0265325_10048757 Ga0265325_100487571 256
729 3300031241 Ga0265325_10082413 Ga0265325_100824132 256
730 3300031247 Ga0265340_10061536 Ga0265340_100615362 256
731 3300031249 Ga0265339_10000047 Ga0265339_1000004754 256
732 3300031249 Ga0265339_10038296 Ga0265339_100382962 256
733 3300031344 Ga0265316_10089764 Ga0265316_100897642 256
734 3300031344 Ga0265316_10381064 Ga0265316_103810641 256
735 3300031456 Ga0307513_10389891 Ga0307513_103898912 256
736 3300031507 Ga0307509_10249997 Ga0307509_102499972 256
737 3300031595 Ga0265313_10000069 Ga0265313_1000006939 256
738 3300031616 Ga0307508_10000051 Ga0307508_1000005156 256
739 3300031616 Ga0307508_10346029 Ga0307508_103460291 256
740 3300031711 Ga0265314_10015576 Ga0265314_100155762 256
741 3300031711 Ga0265314_10102869 Ga0265314_101028692 256
742 3300031712 Ga0265342_10065729 Ga0265342_100657291 256
743 3300031712 Ga0265342_10087021 Ga0265342_100870212 256
744 3300031730 Ga0307516_10015568 Ga0307516_100155687 256
745 3300031730 Ga0307516_10112595 Ga0307516_101125952 256
746 3300031730 Ga0307516_10186574 Ga0307516_101865742 256
747 3300031731 Ga0307405_10137974 Ga0307405_101379741 256
748 3300031731 Ga0307405_10251334 Ga0307405_102513342 256
749 3300031901 Ga0307406_10296540 Ga0307406_102965401 256
750 3300031911 Ga0307412_10309880 Ga0307412_103098802 256
751 3300031911 Ga0307412_10332256 Ga0307412_103322562 256
752 3300033179 Ga0307507_10007677 Ga0307507_100076772 256
753 3300033180 Ga0307510_10071695 Ga0307510_100716953 256
754 3300035083 Ga0373926_0128120 Ga0373926_0128120_167_949 256
755 3300035111 Ga0373923_0001064 Ga0373923_0001064_2356_3138 256
756 3300035111 Ga0373923_0004092 Ga0373923_0004092_3222_3992 256
757 3300035111 Ga0373923_0044311 Ga0373923_0044311_819_1598 256
758 3300035113 Ga0373936_0003661 Ga0373936_0003661_1835_2605 256
759 3300035113 Ga0373936_0008030 Ga0373936_0008030_2885_3667 256
760 3300035113 Ga0373936_0071436 Ga0373936_0071436_536_1306 256
761 3300035116 Ga0373945_0014404 Ga0373945_0014404_212_982 256
762 3300035117 Ga0373953_0019853 Ga0373953_0019853_1108_1887 256
763 3300035117 Ga0373953_0038072 Ga0373953_0038072_616_1398 256
764 3300035118 Ga0373954_0000418 Ga0373954_0000418_9679_10449 256
765 3300035118 Ga0373954_0009743 Ga0373954_0009743_3424_4206 256
766 3300035119 Ga0373956_0000845 Ga0373956_0000845_4183_4953 256
767 3300035119 Ga0373956_0075896 Ga0373956_0075896_546_1325 256
768 3300035120 Ga0373957_0000695 Ga0373957_0000695_3839_4609 256
769 3300035120 Ga0373957_0003864 Ga0373957_0003864_475_1257 256
770 3300035120 Ga0373957_0114384 Ga0373957_0114384_89_859 256
771 3300035170 Ga0373943_0133020 Ga0373943_0133020_496_1269 256
772 3300035170 Ga0373943_0144993 Ga0373943_0144993_206_976 256
773 3300035171 Ga0373946_0018140 Ga0373946_0018140_827_1597 256
774 3300035171 Ga0373946_0111972 Ga0373946_0111972_66_848 256
775 3300035172 Ga0373955_0014293 Ga0373955_0014293_3019_3801 256
776 3300035172 Ga0373955_0145390 Ga0373955_0145390_282_1052 256
777 3300035410 Ga0373924_0011574 Ga0373924_0011574_1584_2366 256
778 3300035410 Ga0373924_0019764 Ga0373924_0019764_1648_2475 256
779 3300035410 Ga0373924_0021465 Ga0373924_0021465_82_852 256
780 3300035692 Ga0373935_0004409 Ga0373935_0004409_2450_3220 256
781 3300035692 Ga0373935_0030931 Ga0373935_0030931_1037_1819 256
782 3300035695 Ga0373927_0011920 Ga0373927_0011920_4462_5232 256
783 3300035695 Ga0373927_0013700 Ga0373927_0013700_2100_2870 256
784 3300035695 Ga0373927_0013723 Ga0373927_0013723_2734_3504 256
785 3300035695 Ga0373927_0047822 Ga0373927_0047822_284_1054 256
786 3300035695 Ga0373927_0181775 Ga0373927_0181775_416_1186 256
787 3300035724 Ga0373933_0004721 Ga0373933_0004721_6411_7181 256
788 3300035724 Ga0373933_0006387 Ga0373933_0006387_2336_3118 256
789 3300035724 Ga0373933_0007858 Ga0373933_0007858_28_807 256
790 3300035724 Ga0373933_0211092 Ga0373933_0211092_201_971 256
791 3300035724 Ga0373933_0267515 Ga0373933_0267515_135_905 256
792 3300035725 Ga0373947_0004935 Ga0373947_0004935_4568_5338 256
793 3300035725 Ga0373947_0029427 Ga0373947_0029427_735_1517 256
794 3300036401 Ga0373937_0037050 Ga0373937_0037050_1602_2372 256
795 3300036401 Ga0373937_0040658 Ga0373937_0040658_1020_1817 256
796 3300036401 Ga0373937_0041120 Ga0373937_0041120_1892_2662 256
797 3300036401 Ga0373937_0262002 Ga0373937_0262002_156_938 256
798 3300036459 Ga0372808_006082 Ga0372808_006082_157_1047 256
799 3300037068 Ga0373925_0004584 Ga0373925_0004584_8552_9334 256
800 3300037068 Ga0373925_0013971 Ga0373925_0013971_1916_2686 256
801 3300037068 Ga0373925_0068622 Ga0373925_0068622_484_1254 256
802 3300037418 Ga0395900_0533277 Ga0395900_0533277_332_1102 256
803 3300037466 Ga0395898_0100762 Ga0395898_0100762_643_1413 256
804 3300037471 Ga0395905_0190789 Ga0395905_0190789_308_1081 256
805 3300037853 Ga0436364_0767694 Ga0436364_0767694_3648_4433 256
806 3300037853 Ga0436364_1169404 Ga0436364_1169404_116_886 256
807 3300037853 Ga0436364_1204997 Ga0436364_1204997_544_1329 256
808 3300038443 Ga0395901_0095869 Ga0395901_0095869_1206_1988 256
809 3300038443 Ga0395901_0516617 Ga0395901_0516617_22_792 256
810 3300039437 Ga0436365_0075269 Ga0436365_0075269_845_1615 256
811 3300039437 Ga0436365_0167764 Ga0436365_0167764_13801_14571 256
812 3300039437 Ga0436365_0276616 Ga0436365_0276616_294_1064 256
813 3300039437 Ga0436365_0743040 Ga0436365_0743040_263_1036 256
814 3300039437 Ga0436365_1331117 Ga0436365_1331117_467_1249 256
815 3300039437 Ga0436365_1826002 Ga0436365_1826002_1374_2144 256
816 3300039438 Ga0436360_0305024 Ga0436360_0305024_136_906 256
817 3300039450 Ga0436363_1366818 Ga0436363_1366818_1284_2054 256
818 3300039453 Ga0436362_0817319 Ga0436362_0817319_1991_2761 256
819 3300041512 Ga0451853_1410466 Ga0451853_1410466_52_822 256
820 3300044719 Ga0466971_0031970 Ga0466971_0031970_868_1650 256
821 3300045836 Ga0466958_0074489 Ga0466958_0074489_992_1774 256
822 3300045976 Ga0466967_0231875 Ga0466967_0231875_179_949 256
823 3300045976 Ga0466967_0385944 Ga0466967_0385944_437_1219 256
824 3300045976 Ga0466967_0515596 Ga0466967_0515596_98_880 256
825 3300046452 Ga0495617_020984 Ga0495617_020984_912_1682 256
826 3300046452 Ga0495617_090626 Ga0495617_090626_29_799 256
827 3300046454 Ga0495592_0032950 Ga0495592_0032950_2508_3278 256
828 3300046454 Ga0495592_0079856 Ga0495592_0079856_828_1610 256
829 3300046454 Ga0495592_0107928 Ga0495592_0107928_503_1273 256
830 3300046455 Ga0495603_0000874 Ga0495603_0000874_7702_8472 256
831 3300046455 Ga0495603_0015206 Ga0495603_0015206_1618_2388 256
832 3300046455 Ga0495603_0075615 Ga0495603_0075615_871_1653 256
833 3300046455 Ga0495603_0079011 Ga0495603_0079011_997_1770 256
834 3300046455 Ga0495603_0244618 Ga0495603_0244618_231_1010 256
835 3300046459 Ga0495629_0000439 Ga0495629_0000439_10668_11438 256
836 3300046459 Ga0495629_0000957 Ga0495629_0000957_5485_6255 256
837 3300046459 Ga0495629_0041686 Ga0495629_0041686_1673_2455 256
838 3300046460 Ga0495638_0007152 Ga0495638_0007152_6755_7528 256
839 3300046460 Ga0495638_0069064 Ga0495638_0069064_54_827 256
840 3300046461 Ga0495641_0003351 Ga0495641_0003351_8747_9517 256
841 3300046462 Ga0495651_0003854 Ga0495651_0003854_2683_3510 256
842 3300046462 Ga0495651_0063543 Ga0495651_0063543_170_940 256
843 3300046462 Ga0495651_0121982 Ga0495651_0121982_804_1574 256
844 3300046463 Ga0495653_0003152 Ga0495653_0003152_4801_5571 256
845 3300046472 Ga0495580_0006287 Ga0495580_0006287_3952_4722 256
846 3300046473 Ga0495582_0002466 Ga0495582_0002466_4057_4827 256
847 3300046473 Ga0495582_0009442 Ga0495582_0009442_3436_4218 256
848 3300046473 Ga0495582_0099914 Ga0495582_0099914_35_805 256
849 3300046474 Ga0495605_0125840 Ga0495605_0125840_307_1080 256
850 3300046475 Ga0495639_0000913 Ga0495639_0000913_6367_7137 256
851 3300046477 Ga0495664_0004313 Ga0495664_0004313_4761_5531 256
852 3300046477 Ga0495664_0124565 Ga0495664_0124565_423_1193 256
853 3300046477 Ga0495664_0139742 Ga0495664_0139742_404_1183 256
854 3300046477 Ga0495664_0211886 Ga0495664_0211886_164_934 256
855 3300046477 Ga0495664_0266269 Ga0495664_0266269_44_814 256
856 3300046499 Ga0495594_0002715 Ga0495594_0002715_2044_2814 256
857 3300046499 Ga0495594_0153818 Ga0495594_0153818_51_833 256
858 3300046499 Ga0495594_0155953 Ga0495594_0155953_224_994 256
859 3300046499 Ga0495594_0235883 Ga0495594_0235883_240_1013 256
860 3300046507 Ga0495606_0002132 Ga0495606_0002132_18863_19633 256
861 3300046507 Ga0495606_0105866 Ga0495606_0105866_335_1105 256
862 3300046507 Ga0495606_0165118 Ga0495606_0165118_170_940 256
863 3300046511 Ga0495608_0005973 Ga0495608_0005973_5847_6626 256
864 3300046511 Ga0495608_0028994 Ga0495608_0028994_1521_2291 256
865 3300046514 Ga0495618_0186705 Ga0495618_0186705_456_1226 256
866 3300046515 Ga0495620_0026171 Ga0495620_0026171_757_1530 256
867 3300046516 Ga0495628_0010152 Ga0495628_0010152_6051_6821 256
868 3300046516 Ga0495628_0011453 Ga0495628_0011453_5676_6503 256
869 3300046516 Ga0495628_0101177 Ga0495628_0101177_1354_2136 256
870 3300046516 Ga0495628_0144821 Ga0495628_0144821_98_868 256
871 3300046517 Ga0495630_0001220 Ga0495630_0001220_15960_16730 256
872 3300046517 Ga0495630_0107226 Ga0495630_0107226_443_1270 256
873 3300046519 Ga0495632_0044890 Ga0495632_0044890_913_1686 256
874 3300046522 Ga0495643_0099231 Ga0495643_0099231_545_1318 256
875 3300046524 Ga0495648_0001613 Ga0495648_0001613_12343_13113 256
876 3300046524 Ga0495648_0055151 Ga0495648_0055151_1174_1944 256
877 3300046526 Ga0495666_0021634 Ga0495666_0021634_2362_3144 256
878 3300046529 Ga0495652_0005540 Ga0495652_0005540_3172_3951 256
879 3300046529 Ga0495652_0011261 Ga0495652_0011261_6411_7181 256
880 3300046529 Ga0495652_0021754 Ga0495652_0021754_1270_2040 256
881 3300046529 Ga0495652_0153456 Ga0495652_0153456_627_1409 256
882 3300046529 Ga0495652_0330243 Ga0495652_0330243_85_855 256
883 3300046530 Ga0495654_0106802 Ga0495654_0106802_168_941 256
884 3300046531 Ga0495665_0000555 Ga0495665_0000555_10760_11530 256
885 3300046531 Ga0495665_0004355 Ga0495665_0004355_4290_5072 256
886 3300046533 Ga0495640_0001232 Ga0495640_0001232_16236_17006 256
887 3300046533 Ga0495640_0009939 Ga0495640_0009939_2592_3374 256
888 3300046533 Ga0495640_0063282 Ga0495640_0063282_337_1116 256
889 3300046533 Ga0495640_0065761 Ga0495640_0065761_82_852 256
890 3300046535 Ga0495586_0071955 Ga0495586_0071955_310_1089 256
891 3300046536 Ga0495587_0013838 Ga0495587_0013838_427_1197 256
892 3300046539 Ga0495621_0067365 Ga0495621_0067365_328_1101 256
893 3300046543 Ga0495645_0011972 Ga0495645_0011972_3420_4202 256
894 3300046543 Ga0495645_0013731 Ga0495645_0013731_1890_2717 256
895 3300046543 Ga0495645_0018292 Ga0495645_0018292_1995_2765 256
896 3300046543 Ga0495645_0165805 Ga0495645_0165805_696_1478 256
897 3300046543 Ga0495645_0297639 Ga0495645_0297639_93_863 256
898 3300046557 Ga0495622_0003298 Ga0495622_0003298_3640_4410 256
899 3300046557 Ga0495622_0133714 Ga0495622_0133714_302_1075 256
900 3300046558 Ga0495633_0048486 Ga0495633_0048486_247_1020 256
901 3300046559 Ga0495667_0016918 Ga0495667_0016918_468_1238 256
902 3300046615 Ga0495656_0103490 Ga0495656_0103490_96_869 256
903 3300046616 Ga0495668_0062733 Ga0495668_0062733_940_1710 256
904 3300046642 Ga0495634_0014564 Ga0495634_0014564_4372_5142 256
905 3300046642 Ga0495634_0018636 Ga0495634_0018636_2286_3065 256
906 3300046642 Ga0495634_0060761 Ga0495634_0060761_1576_2346 256
907 3300046648 Ga0495611_0039800 Ga0495611_0039800_724_1494 256
908 3300046648 Ga0495611_0126302 Ga0495611_0126302_135_908 256
909 3300046660 Ga0495625_0088904 Ga0495625_0088904_347_1120 256
910 3300046660 Ga0495625_0170061 Ga0495625_0170061_415_1185 256
911 3300046663 Ga0495635_0001430 Ga0495635_0001430_6299_7069 256
912 3300046663 Ga0495635_0003515 Ga0495635_0003515_52_822 256
913 3300046663 Ga0495635_0004600 Ga0495635_0004600_8302_9081 256
914 3300046663 Ga0495635_0010771 Ga0495635_0010771_4219_5001 256
915 3300046665 Ga0495661_0081293 Ga0495661_0081293_75_848 256
916 3300046674 Ga0495588_0005525 Ga0495588_0005525_4756_5526 256
917 3300046674 Ga0495588_0129047 Ga0495588_0129047_483_1256 256
918 3300046675 Ga0495657_0020793 Ga0495657_0020793_3521_4291 256
919 3300046675 Ga0495657_0140199 Ga0495657_0140199_235_1062 256
920 3300046675 Ga0495657_0217371 Ga0495657_0217371_88_858 256
921 3300046678 Ga0495599_0007454 Ga0495599_0007454_981_1751 256
922 3300046678 Ga0495599_0156105 Ga0495599_0156105_132_902 256
923 3300046678 Ga0495599_0184188 Ga0495599_0184188_277_1056 256
924 3300046679 Ga0495623_0010183 Ga0495623_0010183_427_1197 256
925 3300046679 Ga0495623_0019346 Ga0495623_0019346_1781_2560 256
926 3300046679 Ga0495623_0090795 Ga0495623_0090795_19_801 256
927 3300046680 Ga0495646_0003601 Ga0495646_0003601_7523_8293 256
928 3300046680 Ga0495646_0072368 Ga0495646_0072368_930_1700 256
929 3300046683 Ga0495658_0065037 Ga0495658_0065037_48_818 256
930 3300046684 Ga0495669_0008503 Ga0495669_0008503_857_1630 256
931 3300046684 Ga0495669_0136329 Ga0495669_0136329_130_900 256
932 3300046690 Ga0495624_0001252 Ga0495624_0001252_15445_16215 256
933 3300046691 Ga0495670_0007811 Ga0495670_0007811_3805_4578 256
934 3300046794 Ga0495589_0080116 Ga0495589_0080116_278_1051 256
935 3300046809 Ga0495600_0001772 Ga0495600_0001772_5822_6601 256
936 3300046809 Ga0495600_0040077 Ga0495600_0040077_1650_2420 256
937 3300046810 Ga0495660_0088788 Ga0495660_0088788_489_1262 256
938 3300047315 Ga0495581_0000019 Ga0495581_0000019_16367_17137 256
939 3300047317 Ga0495604_0007453 Ga0495604_0007453_1866_2636 256
940 3300047317 Ga0495604_0061883 Ga0495604_0061883_1123_1902 256
941 3300047319 Ga0495674_0000458 Ga0495674_0000458_24730_25500 256
942 3300047319 Ga0495674_0008586 Ga0495674_0008586_317_1096 256
943 3300047319 Ga0495674_0039776 Ga0495674_0039776_2309_3079 256
944 3300047319 Ga0495674_0162963 Ga0495674_0162963_400_1170 256
945 3300047319 Ga0495674_0254193 Ga0495674_0254193_628_1410 256
946 3300047320 Ga0495672_0045609 Ga0495672_0045609_1813_2595 256
947 3300047321 Ga0495676_0065285 Ga0495676_0065285_1389_2171 256
948 3300047321 Ga0495676_0091683 Ga0495676_0091683_1024_1794 256
949 3300047322 Ga0495680_0006264 Ga0495680_0006264_1650_2420 256
950 3300047322 Ga0495680_0006496 Ga0495680_0006496_6491_7318 256
951 3300047444 Ga0495675_0021254 Ga0495675_0021254_2759_3538 256
952 3300047444 Ga0495675_0049118 Ga0495675_0049118_1282_2052 256
953 3300047447 Ga0495685_135996 Ga0495685_135996_17_787 256
954 3300047469 Ga0495673_0091708 Ga0495673_0091708_317_1090 256
955 3300047469 Ga0495673_0103852 Ga0495673_0103852_231_1004 256
956 3300047470 Ga0495681_0092181 Ga0495681_0092181_76_849 256
957 3300047470 Ga0495681_0104104 Ga0495681_0104104_128_901 256
958 3300047471 Ga0495684_0012962 Ga0495684_0012962_4267_5037 256
959 3300047472 Ga0495686_0017873 Ga0495686_0017873_3029_3802 256
960 3300047472 Ga0495686_0172967 Ga0495686_0172967_225_995 256
961 3300047472 Ga0495686_0212017 Ga0495686_0212017_210_980 256
962 3300047673 Ga0495593_0001308 Ga0495593_0001308_1157_1927 256
963 3300047673 Ga0495593_0008357 Ga0495593_0008357_3983_4753 256
964 3300048088 Ga0495602_0023461 Ga0495602_0023461_1952_2779 256
965 3300048088 Ga0495602_0025728 Ga0495602_0025728_4117_4887 256
966 3300048088 Ga0495602_0043067 Ga0495602_0043067_1802_2572 256
967 3300048089 Ga0495614_0108094 Ga0495614_0108094_425_1195 256
968 3300048091 Ga0495626_0017777 Ga0495626_0017777_342_1115 256
969 3300048904 Ga0496101_0007758 Ga0496101_0007758_825_1595 256
970 3300048904 Ga0496101_0106028 Ga0496101_0106028_524_1294 256
971 3300048905 Ga0496102_0010309 Ga0496102_0010309_1358_2128 256
972 3300048905 Ga0496102_0515596 Ga0496102_0515596_158_931 256
973 3300048905 Ga0496102_0613084 Ga0496102_0613084_41_814 256
974 3300048906 Ga0496103_0326749 Ga0496103_0326749_101_871 256
975 3300048907 Ga0496104_0009462 Ga0496104_0009462_2742_3512 256
976 3300048907 Ga0496104_0071281 Ga0496104_0071281_387_1160 256
977 3300048907 Ga0496104_0114517 Ga0496104_0114517_1610_2380 256
978 3300048907 Ga0496104_0471710 Ga0496104_0471710_233_1003 256
979 3300048908 Ga0496105_0029974 Ga0496105_0029974_3082_3852 256
980 3300048909 Ga0496106_0002119 Ga0496106_0002119_8060_8830 256
981 3300048909 Ga0496106_0028877 Ga0496106_0028877_283_1053 256
982 3300048909 Ga0496106_0028919 Ga0496106_0028919_2695_3465 256
983 3300048909 Ga0496106_0122458 Ga0496106_0122458_1233_2006 256
984 3300048910 Ga0496107_0003483 Ga0496107_0003483_9572_10342 256
985 3300048910 Ga0496107_0022807 Ga0496107_0022807_784_1554 256
986 3300048910 Ga0496107_0215337 Ga0496107_0215337_459_1232 256
987 3300048911 Ga0496108_0000938 Ga0496108_0000938_20546_21316 256
988 3300048911 Ga0496108_0012526 Ga0496108_0012526_3752_4522 256
989 3300048912 Ga0496109_0000977 Ga0496109_0000977_10170_10940 256
990 3300048912 Ga0496109_0174956 Ga0496109_0174956_804_1574 256
991 3300048912 Ga0496109_0430396 Ga0496109_0430396_105_875 256
992 3300048913 Ga0496110_0049690 Ga0496110_0049690_1923_2693 256
993 3300048913 Ga0496110_0063156 Ga0496110_0063156_2243_3013 256
994 3300048913 Ga0496110_0212387 Ga0496110_0212387_228_998 256
995 3300048914 Ga0496111_0076850 Ga0496111_0076850_351_1121 256
996 3300048915 Ga0496112_0000045 Ga0496112_0000045_66220_66990 256
997 3300048915 Ga0496112_0000590 Ga0496112_0000590_14352_15122 256
998 3300048915 Ga0496112_0070107 Ga0496112_0070107_111_881 256
999 3300048915 Ga0496112_0075203 Ga0496112_0075203_1786_2556 256
1000 3300048915 Ga0496112_0093111 Ga0496112_0093111_1369_2139 256
1001 3300048915 Ga0496112_0110069 Ga0496112_0110069_470_1249 256
1002 3300048916 Ga0496113_0032399 Ga0496113_0032399_942_1712 256
1003 3300048917 Ga0496114_0234352 Ga0496114_0234352_444_1217 256
1004 3300048918 Ga0496115_0097205 Ga0496115_0097205_925_1698 256
1005 3300048918 Ga0496115_0132424 Ga0496115_0132424_129_899 256
1006 3300048918 Ga0496115_0135353 Ga0496115_0135353_73_843 256
1007 3300048918 Ga0496115_0159319 Ga0496115_0159319_774_1544 256
1008 3300048918 Ga0496115_0236424 Ga0496115_0236424_225_995 256
1009 3300048918 Ga0496115_0270746 Ga0496115_0270746_202_975 256
1010 3300048919 Ga0496116_0012386 Ga0496116_0012386_5189_5962 256
1011 3300048920 Ga0496117_0016137 Ga0496117_0016137_3896_4669 256
1012 3300048920 Ga0496117_0043048 Ga0496117_0043048_441_1214 256
1013 3300048920 Ga0496117_0052104 Ga0496117_0052104_373_1143 256
1014 3300048920 Ga0496117_0057914 Ga0496117_0057914_1304_2074 256
1015 3300048920 Ga0496117_0268075 Ga0496117_0268075_94_864 256
1016 3300048921 Ga0496118_0018344 Ga0496118_0018344_5403_6173 256
1017 3300048921 Ga0496118_0022527 Ga0496118_0022527_1207_1977 256
1018 3300048921 Ga0496118_0031340 Ga0496118_0031340_2498_3271 256
1019 3300048922 Ga0496119_0042013 Ga0496119_0042013_702_1472 256
1020 3300048922 Ga0496119_0062235 Ga0496119_0062235_1012_1782 256
1021 3300048922 Ga0496119_0086948 Ga0496119_0086948_277_1050 256
1022 3300048924 Ga0496121_0000379 Ga0496121_0000379_69233_70003 256
1023 3300048924 Ga0496121_0002555 Ga0496121_0002555_25934_26719 256
1024 3300048924 Ga0496121_0004013 Ga0496121_0004013_14097_14867 256
1025 3300048924 Ga0496121_0004472 Ga0496121_0004472_16127_16900 256
1026 3300048924 Ga0496121_0010261 Ga0496121_0010261_104_874 256
1027 3300048924 Ga0496121_0010612 Ga0496121_0010612_1107_1889 256
1028 3300048924 Ga0496121_0024775 Ga0496121_0024775_4876_5646 256
1029 3300048924 Ga0496121_0078720 Ga0496121_0078720_1412_2182 256
1030 3300048924 Ga0496121_0180289 Ga0496121_0180289_187_957 256
1031 3300048925 Ga0496122_0024591 Ga0496122_0024591_673_1446 256
1032 3300048925 Ga0496122_0075943 Ga0496122_0075943_426_1199 256
1033 3300048926 Ga0496123_0017035 Ga0496123_0017035_3838_4611 256
1034 3300048927 Ga0496124_0001073 Ga0496124_0001073_28095_28865 256
1035 3300048927 Ga0496124_0257026 Ga0496124_0257026_275_1045 256
1036 3300048927 Ga0496124_0283856 Ga0496124_0283856_284_1057 256
1037 3300048928 Ga0496125_0000629 Ga0496125_0000629_9840_10610 256
1038 3300048928 Ga0496125_0029288 Ga0496125_0029288_1484_2257 256
1039 3300048928 Ga0496125_0182105 Ga0496125_0182105_53_823 256
1040 3300048929 Ga0496126_0003114 Ga0496126_0003114_12738_13511 256
1041 3300048929 Ga0496126_0013956 Ga0496126_0013956_6051_6821 256
1042 3300048929 Ga0496126_0063374 Ga0496126_0063374_1217_1987 256
1043 3300048929 Ga0496126_0126229 Ga0496126_0126229_1219_2001 256
1044 3300048929 Ga0496126_0135055 Ga0496126_0135055_775_1545 256
1045 3300048929 Ga0496126_0141426 Ga0496126_0141426_622_1392 256
1046 3300048929 Ga0496126_0198282 Ga0496126_0198282_276_1049 256
1047 3300048929 Ga0496126_0222573 Ga0496126_0222573_453_1226 256
1048 3300048929 Ga0496126_0253163 Ga0496126_0253163_354_1124 256
1049 3300048929 Ga0496126_0629455 Ga0496126_0629455_40_810 256
1050 3300049569 Ga0501032_0127563 Ga0501032_0127563_381_1154 256
1051 3300049569 Ga0501032_0154916 Ga0501032_0154916_129_899 256
1052 3300049570 Ga0501033_0126297 Ga0501033_0126297_904_1677 256
1053 3300049571 Ga0501034_0119598 Ga0501034_0119598_1206_1979 256
1054 3300049571 Ga0501034_0664853 Ga0501034_0664853_118_888 256
1055 3300049572 Ga0501036_0137765 Ga0501036_0137765_1078_1851 256
1056 3300049573 Ga0501037_0081418 Ga0501037_0081418_1312_2085 256
1057 3300049574 Ga0501038_0149058 Ga0501038_0149058_735_1505 256
1058 3300049577 Ga0501041_0208115 Ga0501041_0208115_231_1004 256
1059 3300049580 Ga0501046_0101211 Ga0501046_0101211_904_1674 256
1060 3300049581 Ga0501047_0005748 Ga0501047_0005748_9236_10006 256
1061 3300049581 Ga0501047_0008010 Ga0501047_0008010_3340_4110 256
1062 3300049581 Ga0501047_0089744 Ga0501047_0089744_1295_2068 256
1063 3300049582 Ga0501048_0222865 Ga0501048_0222865_250_1023 256
1064 3300049583 Ga0501067_0136782 Ga0501067_0136782_510_1280 256
1065 3300049583 Ga0501067_0215665 Ga0501067_0215665_129_902 256
1066 3300049584 Ga0501068_0134498 Ga0501068_0134498_156_929 256
1067 3300049586 Ga0501070_0014472 Ga0501070_0014472_648_1418 256
1068 3300049586 Ga0501070_0106680 Ga0501070_0106680_735_1505 256
1069 3300049588 Ga0501072_0068258 Ga0501072_0068258_1226_1999 256
1070 3300049589 Ga0501073_0185361 Ga0501073_0185361_90_860 256
1071 3300049590 Ga0501074_0007505 Ga0501074_0007505_7098_7868 256
1072 3300049590 Ga0501074_0476293 Ga0501074_0476293_93_863 256
1073 3300049741 Ga0501079_0100317 Ga0501079_0100317_242_1015 256
1074 3300049742 Ga0501080_0004615 Ga0501080_0004615_2581_3351 256
1075 3300049742 Ga0501080_0088856 Ga0501080_0088856_1811_2584 256
1076 3300049742 Ga0501080_0427689 Ga0501080_0427689_11_784 256
1077 3300049822 Ga0501035_0135892 Ga0501035_0135892_1220_1993 256
1078 3300049822 Ga0501035_0301458 Ga0501035_0301458_223_993 256
1079 3300049823 Ga0501044_0063727 Ga0501044_0063727_209_979 256
1080 3300049823 Ga0501044_0164517 Ga0501044_0164517_46_906 256
1081 3300049823 Ga0501044_0299840 Ga0501044_0299840_751_1521 256
1082 3300049823 Ga0501044_0603787 Ga0501044_0603787_79_852 256
1083 3300050490 nmdc:mga03n38_10620_c1 nmdc:mga03n38_10620_c1_2029_2802 256
1084 3300050490 nmdc:mga03n38_70407_c1 nmdc:mga03n38_70407_c1_756_1541 256
1085 3300050491 nmdc:mga00v17_91201_c1 nmdc:mga00v17_91201_c1_226_999 256
1086 3300050492 nmdc:mga0yw44_24241_c1 nmdc:mga0yw44_24241_c1_797_1570 256
1087 3300050492 nmdc:mga0yw44_83999_c1 nmdc:mga0yw44_83999_c1_1047_1820 256
1088 3300050493 nmdc:mga0k408_183635_c1 nmdc:mga0k408_183635_c1_32_805 256
1089 3300050507 nmdc:mga05p37_141932_c1 nmdc:mga05p37_141932_c1_1852_2625 256
1090 3300050512 nmdc:mga0n895_8527_c1 nmdc:mga0n895_8527_c1_3309_4079 256
1091 3300050516 nmdc:mga0sz30_28629_c1 nmdc:mga0sz30_28629_c1_313_1086 256
1092 3300053077 Ga0495601_0037977 Ga0495601_0037977_1467_2249 256
1093 3300053077 Ga0495601_0044379 Ga0495601_0044379_1831_2601 256
1094 3300053077 Ga0495601_0091103 Ga0495601_0091103_302_1072 256
1095 3300053078 Ga0495612_0019273 Ga0495612_0019273_1583_2365 256
1096 3300053078 Ga0495612_0119885 Ga0495612_0119885_285_1055 256
1097 3300053080 Ga0500635_0013844 Ga0500635_0013844_1208_1978 256
1098 3300053080 Ga0500635_0020627 Ga0500635_0020627_26_796 256
1099 3300053084 Ga0495595_0002284 Ga0495595_0002284_426_1196 256
1100 3300053084 Ga0495595_0043669 Ga0495595_0043669_386_1156 256
1101 3300053085 Ga0495619_0006156 Ga0495619_0006156_6028_6798 256
1102 3300053085 Ga0495619_0206380 Ga0495619_0206380_208_978 256
1103 3300053088 Ga0500644_0095771 Ga0500644_0095771_60_833 256
1104 3300053089 Ga0500581_028462 Ga0500581_028462_325_1098 256
1105 3300053093 Ga0500651_0001684 Ga0500651_0001684_3308_4078 256
1106 3300053093 Ga0500651_0021035 Ga0500651_0021035_727_1500 256
1107 3300053093 Ga0500651_0130353 Ga0500651_0130353_319_1092 256
1108 3300053093 Ga0500651_0222539 Ga0500651_0222539_178_951 256
1109 3300053094 Ga0500566_0000046 Ga0500566_0000046_52733_53503 256
1110 3300053094 Ga0500566_0015683 Ga0500566_0015683_1171_1944 256
1111 3300053095 Ga0500640_000122 Ga0500640_000122_10980_11750 256
1112 3300053098 Ga0500650_0050889 Ga0500650_0050889_325_1098 256
1113 3300053102 Ga0500554_001975 Ga0500554_001975_1465_2235 256
1114 3300053102 Ga0500554_005676 Ga0500554_005676_796_1566 256
1115 3300053102 Ga0500554_068408 Ga0500554_068408_292_1062 256
1116 3300053104 Ga0500556_0000003 Ga0500556_0000003_335120_335893 256
1117 3300053109 Ga0500569_070535 Ga0500569_070535_60_833 256
1118 3300053111 Ga0500572_000277 Ga0500572_000277_7241_8011 256
1119 3300053116 Ga0500592_000602 Ga0500592_000602_3819_4592 256
1120 3300053116 Ga0500592_004767 Ga0500592_004767_950_1720 256
1121 3300053118 Ga0500594_0003113 Ga0500594_0003113_2580_3353 256
1122 3300053118 Ga0500594_0016522 Ga0500594_0016522_373_1143 256
1123 3300053119 Ga0500595_002523 Ga0500595_002523_2972_3742 256
1124 3300053119 Ga0500595_003315 Ga0500595_003315_1672_2442 256
1125 3300053119 Ga0500595_005416 Ga0500595_005416_596_1366 256
1126 3300053119 Ga0500595_022337 Ga0500595_022337_1222_1992 256
1127 3300053122 Ga0500608_021992 Ga0500608_021992_507_1280 256
1128 3300053123 Ga0500614_064242 Ga0500614_064242_73_843 256
1129 3300053125 Ga0500618_006771 Ga0500618_006771_1294_2067 256
1130 3300053130 Ga0500642_0000015 Ga0500642_0000015_176783_177556 256
1131 3300053130 Ga0500642_0012591 Ga0500642_0012591_378_1148 256
1132 3300053131 Ga0500652_000456 Ga0500652_000456_3409_4182 256
1133 3300053136 Ga0500559_0000301 Ga0500559_0000301_5550_6326 256
1134 3300053136 Ga0500559_0001197 Ga0500559_0001197_3547_4320 256
1135 3300053136 Ga0500559_0006509 Ga0500559_0006509_2796_3566 256
1136 3300053136 Ga0500559_0084943 Ga0500559_0084943_449_1219 256
1137 3300053139 Ga0500568_0000334 Ga0500568_0000334_22634_23407 256
1138 3300053139 Ga0500568_0004685 Ga0500568_0004685_2359_3129 256
1139 3300053140 Ga0500573_0004365 Ga0500573_0004365_5092_5862 256
1140 3300053142 Ga0500577_0000239 Ga0500577_0000239_9963_10733 256
1141 3300053145 Ga0500586_000409 Ga0500586_000409_4412_5185 256
1142 3300053146 Ga0500588_0104321 Ga0500588_0104321_154_927 256
1143 3300053148 Ga0500590_036369 Ga0500590_036369_402_1175 256
1144 3300053148 Ga0500590_081314 Ga0500590_081314_489_1259 256
1145 3300053150 Ga0500603_001802 Ga0500603_001802_2766_3536 256
1146 3300053150 Ga0500603_002934 Ga0500603_002934_55_825 256
1147 3300053150 Ga0500603_059283 Ga0500603_059283_136_906 256
1148 3300053151 Ga0500604_0025305 Ga0500604_0025305_650_1423 256
1149 3300053153 Ga0500616_0000028 Ga0500616_0000028_239802_240572 256
1150 3300053153 Ga0500616_0000033 Ga0500616_0000033_130257_131030 256
1151 3300053156 Ga0500622_0007863 Ga0500622_0007863_25_798 256
1152 3300053156 Ga0500622_0012142 Ga0500622_0012142_3866_4639 256
1153 3300053158 Ga0500627_0030694 Ga0500627_0030694_133_903 256
1154 3300053159 Ga0500630_001838 Ga0500630_001838_3269_4039 256
1155 3300053160 Ga0500633_0081565 Ga0500633_0081565_277_1050 256
1156 3300053162 Ga0500638_009710 Ga0500638_009710_2035_2805 256
1157 3300053163 Ga0500639_001285 Ga0500639_001285_5889_6659 256
1158 3300053163 Ga0500639_019202 Ga0500639_019202_1117_1893 256
1159 3300053163 Ga0500639_094416 Ga0500639_094416_414_1184 256
1160 3300053177 Ga0500636_0001477 Ga0500636_0001477_11259_12032 256
1161 3300053177 Ga0500636_0005231 Ga0500636_0005231_6370_7140 256
1162 3300053177 Ga0500636_0045273 Ga0500636_0045273_929_1699 256
1163 3300053178 Ga0500637_0000262 Ga0500637_0000262_15177_15947 256
1164 3300053178 Ga0500637_0017144 Ga0500637_0017144_1275_2045 256
1165 3300053178 Ga0500637_0077191 Ga0500637_0077191_699_1469 256
1166 3300053730 Ga0500645_018874 Ga0500645_018874_671_1444 256
1167 3300053735 Ga0500596_002379 Ga0500596_002379_974_1744 256
1168 3300053735 Ga0500596_011759 Ga0500596_011759_180_953 256
1169 3300053737 Ga0500601_010257 Ga0500601_010257_55_825 256
1170 3300055283 Ga0500661_000172 Ga0500661_000172_1298_2068 256

Structural Annotation

Top 5 Hits

ID Description Score Start End
6saw-assembly2.cif.gz_E-2 chromophore binding domain of bacteriophytochrome linked diguanylyl cyclase from idiomarina species a28l (dimeric pfr-like state). 0.8036 202 234
5lly-assembly1.cif.gz_C photosensory module of bacteriophytochrome linked diguanylyl cyclase from idiomarina species a28l 0.792 202 232
5llw-assembly1.cif.gz_B bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l 0.7896 202 232
5llx-assembly1.cif.gz_A bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l with gtp bound 0.7873 202 232
5llx-assembly1.cif.gz_B bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l with gtp bound 0.7858 202 232
ID Description Score Start End Superfamily
af_Q54DY3_12_87_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8165 207 232 3.30.450.30
af_Q4CS17_13_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8143 209 234 3.50.50.60
af_Q8I1T3_1_178_3.30.450.60 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8097 208 248 3.30.450.60
af_C0HLF1_1_152_3.30.450.60 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8061 209 243 3.30.450.60
af_Q8H1F4_3_152_3.30.450.60 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.794 207 236 3.30.450.60
ID Description Score Start End GO Terms
AF-A0A3C1Y302-F1-model_v4 Anti-sigma factor 0.951 112 252
AF-A0A843SLT0-F1-model_v4 Anti-sigma factor 0.9509 111 250 GO:0006508
GO:0008237
AF-A0A7C5GCF1-F1-model_v4 Anti-sigma factor 0.9466 122 250
AF-A0A6J5BR83-F1-model_v4 Anti-sigma factor 0.9453 133 250
AF-A0A349QGV3-F1-model_v4 deleted 0.9451 144 250

Feature Viewer

pLDDT pTM Quality
72.19 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map