F491202

General Info

Members Datasets Scaffolds Average Seq Length
1173 549 2346 301

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10000311|Ga0105242_1000031126
Length 344
Sequence MRRTRSIHSSRWHSNANPCEIVTRFARLRTYNRASFVSGTFNAMSNSTELDLSSIAPRTKAEILAQALPYIRKFHGKTMVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQIETALNRLGKKGEFIQGMRVTDAETMEVVEWVLAGEVQQDIVGLINQAGGKAVGLTGRDGGMIRAQKLRMVDSKDPSIEHDIGQVGDIVSIDPSVVKALQDDAFIPVISPIGFGEDNESYNINADVVASKLATVLRAEKLVLLTNIPGVLNKAGELLTDLTSREIDGLFADGTISGGMLPKIAGALDAAKAGVNAVHIIDGRVPHAMLLEILTEQAYGTMIRSH

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
129 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
149 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
236 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
237 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
242 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
245 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
251 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
252 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
253 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
254 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
255 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
256 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
257 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
258 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
259 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
260 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
261 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
262 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
263 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
264 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
265 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
266 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
267 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
268 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
269 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
270 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
271 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
272 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
278 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
279 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
280 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
281 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
282 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
283 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
284 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
285 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
286 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
287 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
288 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
289 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
290 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
291 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
294 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
295 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
296 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
297 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
298 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
299 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
307 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
308 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
311 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
314 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
315 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
316 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
317 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
318 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
319 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
320 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
321 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
322 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
323 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
324 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
325 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
326 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
327 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
328 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
329 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
330 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
331 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
332 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
333 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
334 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
339 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
340 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
345 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
346 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
347 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
348 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
349 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
350 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
351 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
354 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
355 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
358 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
359 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
360 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
361 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
362 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
363 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
364 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
373 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
374 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
375 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
376 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
377 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
381 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
382 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
383 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
388 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
389 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
394 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
395 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
403 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
404 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
405 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
406 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
407 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
408 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
418 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
419 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
420 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
421 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
422 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
423 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
424 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
425 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
426 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
427 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
428 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
429 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
430 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
431 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
432 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
433 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
434 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
435 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
438 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
439 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
440 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
441 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
442 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
443 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
444 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
445 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
452 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
455 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
456 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
457 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
458 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
459 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
460 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
461 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
462 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
463 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
464 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
465 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
466 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
467 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
468 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
469 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
470 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
471 2547132374 Acidovorax radicis N35 Isolate Unclassified
472 2547132512 Azospira oryzae 6a3 Isolate Unclassified
473 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
474 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
475 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
476 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
477 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
478 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
479 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
480 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
481 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
482 2643221570 Acidovorax sp. Root568 Isolate Unclassified
483 2643221585 Pelomonas sp. Root662 Isolate Unclassified
484 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
485 2643221596 Acidovorax sp. Root70 Isolate Unclassified
486 2643221609 Acidovorax sp. Root217 Isolate Unclassified
487 2643221611 Acidovorax sp. Root219 Isolate Unclassified
488 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
489 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
490 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
491 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
492 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
493 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
494 2643221652 Acidovorax sp. Root402 Isolate Unclassified
495 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
496 2643221656 Pelomonas sp. Root405 Isolate Unclassified
497 2643221658 Variovorax sp. Root411 Isolate Unclassified
498 2643221660 Methylibium sp. Root1272 Isolate Unclassified
499 2643221672 Variovorax sp. Root434 Isolate Unclassified
500 2643221683 Variovorax sp. Root473 Isolate Unclassified
501 2643221717 Acidovorax sp. Root267 Isolate Unclassified
502 2721755523 Delftia sp. HK171 Isolate Unclassified
503 2738541277 Variovorax sp. GV051 Isolate Unclassified
504 2738541307 Variovorax sp. GV008 Isolate Unclassified
505 2738541337 Pelomonas sp. BT06 Isolate Unclassified
506 2738543012 Acidovorax sp. CF301 Isolate Unclassified
507 2738543013 Variovorax sp. BT01 Isolate Unclassified
508 2738543019 Variovorax sp. GV040 Isolate Unclassified
509 2816332133 Acidovorax radicis 2721A Isolate Unclassified
510 2818991446 Variovorax sp. 1180 Isolate Unclassified
511 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
512 2831864461 Roseateles noduli HZ7 Isolate Nodule
513 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
514 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
515 2842677519 Variovorax sp. R-72495 Isolate Unclassified
516 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
517 2842733646 Variovorax sp. R-72446 Isolate Unclassified
518 2842747753 Variovorax sp. R-72060 Isolate Unclassified
519 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
520 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
521 2885198086 Variovorax sp. 679 Isolate Unclassified
522 2885211737 Variovorax sp. 553 Isolate Unclassified
523 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
524 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
525 2899924645 Variovorax sp. 369 Isolate Unclassified
526 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
527 2904456579 Variovorax sp. 2002 Isolate Unclassified
528 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
529 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
530 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
531 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
532 2928037797 Variovorax sp. 1126 Isolate Unclassified
533 2928044640 Variovorax sp. 1128 Isolate Unclassified
534 2928051484 Variovorax sp. 1133 Isolate Unclassified
535 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
536 2928070936 Variovorax gossypii 1167 Isolate Unclassified
537 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
538 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
539 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
540 2929520902 Variovorax beijingensis 502 Isolate Unclassified
541 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
542 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
543 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
544 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
545 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
546 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
547 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
548 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
549 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 0
Isolates 6.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.63
Nodule 0.94
Rhizoplane 2.39
Rhizosphere 64.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10000311 3300009176 Bacteria 39040
2 SwRhRL2b_contig_2261576 2162886007 Bacteria 8707
3 JGI24740J21852_10017328 3300001979 Bacteria 2578
4 JGI25155J39150_1000028 3300002704 Bacteria 120158
5 JGI25156J39149_1000013 3300002705 Bacteria 189553
6 JGI25156J39149_1016254 3300002705 Bacteria 1453
7 JGI25154J39366_1000032 3300002738 Bacteria 189265
8 JGI25154J39366_1000863 3300002738 Bacteria 13109
9 JGI25157J39369_1000017 3300002741 Bacteria 189553
10 JGI25157J39369_1000150 3300002741 Bacteria 58511
11 JGI25152J39213_1002181 3300002773 Bacteria 7663
12 JGI25150J39212_1007008 3300002774 Bacteria 2289
13 JGI25150J39212_1008049 3300002774 Bacteria 2086
14 JGI25150J39212_1019855 3300002774 Bacteria 1045
15 JGI25159J45721_1000039 3300002987 Bacteria 69707
16 JGI25159J45721_1000247 3300002987 Bacteria 25599
17 JGI25159J45721_1001604 3300002987 Bacteria 9239
18 JGI25159J45721_1008111 3300002987 Bacteria 2922
19 JGI25151J46595_10000792 3300003187 Bacteria 25467
20 JGI25151J46595_10000920 3300003187 Bacteria 22902
21 JGI25151J46595_10012721 3300003187 Bacteria 3817
22 JGI25153J46596_10001105 3300003215 Bacteria 16390
23 JGI25153J46596_10007118 3300003215 Bacteria 5551
24 JGI25153J46596_10018770 3300003215 Bacteria 2672
25 rootL2_10000300 3300003322 Bacteria 57400
26 JGI26128J50194_1000027 3300003347 Bacteria 4715
27 JGI25160J50197_1000106 3300003354 Bacteria 80449
28 JGI25160J50197_1006815 3300003354 Bacteria 4573
29 JGI25160J50197_1029078 3300003354 Bacteria 1470
30 JGI25161J50226_1000041 3300003374 Bacteria 124485
31 Ga0055533_1000016 3300003756 Bacteria 396179
32 Ga0055525_1000004 3300003759 Bacteria 888039
33 Ga0055525_1000910 3300003759 Bacteria 8421
34 Ga0055535_1000139 3300003761 Bacteria 76287
35 Ga0055535_1000546 3300003761 Bacteria 32302
36 Ga0055535_1006152 3300003761 Bacteria 2485
37 Ga0055542_1000091 3300003762 Bacteria 121973
38 Ga0055529_1000333 3300003763 Bacteria 52783
39 Ga0055526_1000414 3300003771 Bacteria 34422
40 Ga0055526_1004544 3300003771 Bacteria 8297
41 Ga0055526_1041734 3300003771 Bacteria 1140
42 Ga0055537_1000029 3300003773 Bacteria 101797
43 Ga0055537_1000229 3300003773 Bacteria 41052
44 Ga0055537_1003934 3300003773 Bacteria 4406
45 Ga0055537_1014452 3300003773 Bacteria 1433
46 Ga0055524_1000013 3300003775 Bacteria 259850
47 Ga0055524_1000040 3300003775 Bacteria 157409
48 Ga0055524_1009444 3300003775 Bacteria 3965
49 Ga0055536_1000611 3300003781 Bacteria 24357
50 Ga0055534_1000081 3300003784 Bacteria 75591
51 Ga0055534_1000271 3300003784 Bacteria 35350
52 Ga0055534_1008639 3300003784 Bacteria 2289
53 Ga0055534_1010033 3300003784 Bacteria 2009
54 Ga0055534_1011896 3300003784 Bacteria 1746
55 Ga0055528_1000107 3300003790 Bacteria 67056
56 Ga0055528_1000233 3300003790 Bacteria 46503
57 Ga0055528_1013275 3300003790 Bacteria 3132
58 Ga0055530_10000143 3300003791 Bacteria 63940
59 Ga0055530_10000493 3300003791 Bacteria 34162
60 Ga0055530_10002895 3300003791 Bacteria 10427
61 Ga0055530_10002922 3300003791 Bacteria 10349
62 Ga0055530_10007440 3300003791 Bacteria 4607
63 Ga0055540_1000001 3300003792 Bacteria 466834
64 Ga0055540_1000030 3300003792 Bacteria 177871
65 Ga0055540_1000641 3300003792 Bacteria 24815
66 Ga0055540_1016153 3300003792 Bacteria 2137
67 Ga0055531_10000179 3300003794 Bacteria 72059
68 Ga0055531_10000720 3300003794 Bacteria 28176
69 Ga0055531_10000975 3300003794 Bacteria 22807
70 Ga0055531_10005204 3300003794 Bacteria 7654
71 Ga0055543_1000092 3300004625 Bacteria 78538
72 Ga0065165_1000080 3300005262 Bacteria 159638
73 Ga0065165_1000177 3300005262 Bacteria 113446
74 Ga0065165_1020125 3300005262 Bacteria 2360
75 Ga0065714_10015162 3300005288 Bacteria 1686
76 Ga0065704_10070295 3300005289 Bacteria 37925
77 Ga0065704_10188786 3300005289 Bacteria 1197
78 Ga0065712_10103673 3300005290 Bacteria 1979
79 Ga0065707_10092018 3300005295 Bacteria 3842
80 Ga0070658_10084452 3300005327 Bacteria 2611
81 Ga0070658_10401306 3300005327 Bacteria 1178
82 Ga0070676_10004542 3300005328 Bacteria 7313
83 Ga0070676_10017485 3300005328 Bacteria 3968
84 Ga0070676_10030628 3300005328 Bacteria 3069
85 Ga0070676_10108739 3300005328 Bacteria 1723
86 Ga0070690_100011766 3300005330 Bacteria 5129
87 Ga0070690_100022220 3300005330 Bacteria 3879
88 Ga0070670_100004549 3300005331 Bacteria 11629
89 Ga0070677_10013596 3300005333 Bacteria 2850
90 Ga0070677_10050651 3300005333 Bacteria 1678
91 Ga0068869_100071442 3300005334 Bacteria 2570
92 Ga0068869_100415821 3300005334 Bacteria 1109
93 Ga0070666_10006864 3300005335 Bacteria 7011
94 Ga0070666_10076431 3300005335 Bacteria 2284
95 Ga0070680_100006232 3300005336 Bacteria 9050
96 Ga0070680_100378749 3300005336 Bacteria 1205
97 Ga0068868_100000966 3300005338 Bacteria 19576
98 Ga0068868_100034632 3300005338 Bacteria 3899
99 Ga0068868_100085136 3300005338 Bacteria 2540
100 Ga0070660_100125476 3300005339 Bacteria 2051
101 Ga0070689_100009409 3300005340 Bacteria 6928
102 Ga0070661_100001108 3300005344 Bacteria 18946
103 Ga0070661_100064789 3300005344 Bacteria 2686
104 Ga0070661_100233122 3300005344 Bacteria 1415
105 Ga0070668_100005300 3300005347 Bacteria 9570
106 Ga0070668_100038317 3300005347 Bacteria 3663
107 Ga0070668_100062337 3300005347 Bacteria 2889
108 Ga0070669_100281549 3300005353 Bacteria 1332
109 Ga0070675_100007167 3300005354 Bacteria 8594
110 Ga0070675_100273188 3300005354 Bacteria 1484
111 Ga0070675_100380393 3300005354 Bacteria 1256
112 Ga0070671_100052391 3300005355 Bacteria 3393
113 Ga0070671_100065512 3300005355 Bacteria 3026
114 Ga0070671_100216584 3300005355 Bacteria 1624
115 Ga0070674_100002485 3300005356 Bacteria 10209
116 Ga0070674_100004974 3300005356 Bacteria 7619
117 Ga0070674_100010811 3300005356 Bacteria 5534
118 Ga0070674_100015476 3300005356 Bacteria 4762
119 Ga0070674_100025436 3300005356 Bacteria 3854
120 Ga0070674_100031879 3300005356 Bacteria 3496
121 Ga0070674_100137618 3300005356 Bacteria 1829
122 Ga0070659_100001014 3300005366 Bacteria 20566
123 Ga0070659_100034653 3300005366 Bacteria 3927
124 Ga0070667_100019529 3300005367 Bacteria 5623
125 Ga0070667_100046770 3300005367 Bacteria 3640
126 Ga0070667_100121358 3300005367 Bacteria 2274
127 Ga0070700_100069516 3300005441 Bacteria 2242
128 Ga0070694_100029230 3300005444 Bacteria 3595
129 Ga0070663_100001375 3300005455 Bacteria 13329
130 Ga0070663_100074648 3300005455 Bacteria 2477
131 Ga0070663_100115124 3300005455 Bacteria 2025
132 Ga0070678_100009130 3300005456 Bacteria 5985
133 Ga0070678_100035841 3300005456 Bacteria 3468
134 Ga0070678_100115478 3300005456 Bacteria 2107
135 Ga0070662_100009941 3300005457 Bacteria 6232
136 Ga0070662_100010817 3300005457 Bacteria 6007
137 Ga0070681_10000135 3300005458 Bacteria 56156
138 Ga0070681_10002911 3300005458 Bacteria 15845
139 Ga0070681_10142443 3300005458 Bacteria 2327
140 Ga0070681_10243474 3300005458 Bacteria 1712
141 Ga0068867_100000081 3300005459 Bacteria 59361
142 Ga0068867_100001774 3300005459 Bacteria 15027
143 Ga0068867_100002071 3300005459 Bacteria 14068
144 Ga0068867_100024628 3300005459 Bacteria 4314
145 Ga0068867_100027632 3300005459 Bacteria 4080
146 Ga0068867_100162807 3300005459 Bacteria 1760
147 Ga0070685_10020911 3300005466 Bacteria 3549
148 Ga0070706_100032798 3300005467 Bacteria 4791
149 Ga0070706_100063330 3300005467 Bacteria 3418
150 Ga0070707_100119633 3300005468 Bacteria 2557
151 Ga0070698_100250101 3300005471 Bacteria 1705
152 Ga0068853_100215233 3300005539 Bacteria 1753
153 Ga0068853_100386790 3300005539 Bacteria 1307
154 Ga0068853_100427083 3300005539 Bacteria 1243
155 Ga0070672_100002675 3300005543 Bacteria 11393
156 Ga0070672_100338769 3300005543 Bacteria 1280
157 Ga0070695_100186816 3300005545 Bacteria 1472
158 Ga0070695_100200308 3300005545 Bacteria 1426
159 Ga0070693_100062366 3300005547 Bacteria 2169
160 Ga0070665_100059372 3300005548 Bacteria 3834
161 Ga0070665_100116746 3300005548 Bacteria 2671
162 Ga0070704_100009336 3300005549 Bacteria 5920
163 Ga0070704_100157923 3300005549 Bacteria 1790
164 Ga0068855_100168577 3300005563 Bacteria 2480
165 Ga0068855_100496489 3300005563 Bacteria 1327
166 Ga0070664_100009671 3300005564 Bacteria 7823
167 Ga0070664_100017465 3300005564 Bacteria 5892
168 Ga0070664_100284239 3300005564 Bacteria 1492
169 Ga0068857_100011645 3300005577 Bacteria 7650
170 Ga0068857_100022139 3300005577 Bacteria 5591
171 Ga0068854_100128902 3300005578 Bacteria 1929
172 Ga0068854_100387163 3300005578 Bacteria 1153
173 Ga0068856_100031334 3300005614 Bacteria 5202
174 Ga0068856_100463666 3300005614 Bacteria 1288
175 Ga0068852_100005075 3300005616 Bacteria 9367
176 Ga0068852_100191633 3300005616 Bacteria 1929
177 Ga0068859_100014864 3300005617 Bacteria 7817
178 Ga0068859_100053475 3300005617 Bacteria 4062
179 Ga0068859_100054638 3300005617 Bacteria 4017
180 Ga0068859_100271259 3300005617 Bacteria 1789
181 Ga0068864_100036333 3300005618 Bacteria 4199
182 Ga0068864_100085585 3300005618 Bacteria 2772
183 Ga0068864_100268343 3300005618 Bacteria 1589
184 Ga0068866_10024589 3300005718 Bacteria 2819
185 Ga0068861_100005602 3300005719 Bacteria 8512
186 Ga0068861_100038942 3300005719 Bacteria 3546
187 Ga0068851_10036616 3300005834 Bacteria 2457
188 Ga0068870_10036521 3300005840 Bacteria 2528
189 Ga0068863_100017036 3300005841 Bacteria 6968
190 Ga0068863_100034318 3300005841 Bacteria 4833
191 Ga0068863_100049573 3300005841 Bacteria 3981
192 Ga0068863_100058111 3300005841 Bacteria 3661
193 Ga0068858_100006772 3300005842 Bacteria 11149
194 Ga0068858_100009260 3300005842 Bacteria 9405
195 Ga0068858_100017497 3300005842 Bacteria 6724
196 Ga0068858_100023157 3300005842 Bacteria 5792
197 Ga0068858_100056487 3300005842 Bacteria 3628
198 Ga0068858_100319828 3300005842 Bacteria 1483
199 Ga0068860_100000823 3300005843 Bacteria 34706
200 Ga0068860_100002377 3300005843 Bacteria 19765
201 Ga0068860_100121690 3300005843 Bacteria 2499
202 Ga0068862_100008650 3300005844 Bacteria 8420
203 Ga0068862_100034816 3300005844 Bacteria 4263
204 Ga0081538_10115530 3300005981 Bacteria 1304
205 Ga0075365_10002751 3300006038 Bacteria 8779
206 Ga0075365_10141235 3300006038 Bacteria 1672
207 Ga0075368_10045226 3300006042 Bacteria 1738
208 Ga0075363_100011525 3300006048 Bacteria 4236
209 Ga0075363_100016272 3300006048 Bacteria 3672
210 Ga0075363_100110095 3300006048 Bacteria 1530
211 Ga0075364_10016678 3300006051 Bacteria 4573
212 Ga0075364_10046004 3300006051 Bacteria 2841
213 Ga0075432_10037892 3300006058 Bacteria 1678
214 Ga0070716_100008354 3300006173 Bacteria 5135
215 Ga0075362_10003710 3300006177 Bacteria 5397
216 Ga0075362_10009023 3300006177 Bacteria 3838
217 Ga0075362_10010550 3300006177 Bacteria 3610
218 Ga0075362_10013040 3300006177 Bacteria 3316
219 Ga0075362_10099452 3300006177 Bacteria 1358
220 Ga0075367_10003903 3300006178 Bacteria 7190
221 Ga0075369_10160672 3300006186 Bacteria 1030
222 Ga0075366_10002485 3300006195 Bacteria 9454
223 Ga0075366_10007403 3300006195 Bacteria 6062
224 Ga0075366_10014484 3300006195 Bacteria 4503
225 Ga0075366_10017250 3300006195 Bacteria 4154
226 Ga0075366_10163863 3300006195 Bacteria 1348
227 Ga0097621_100016784 3300006237 Bacteria 5547
228 Ga0097621_100072610 3300006237 Bacteria 2847
229 Ga0097621_100166929 3300006237 Bacteria 1895
230 Ga0097621_100325282 3300006237 Bacteria 1363
231 Ga0075370_10001524 3300006353 Bacteria 10129
232 Ga0075370_10002918 3300006353 Bacteria 8034
233 Ga0075370_10014039 3300006353 Bacteria 4265
234 Ga0075370_10015390 3300006353 Bacteria 4095
235 Ga0075370_10019536 3300006353 Bacteria 3692
236 Ga0075370_10020448 3300006353 Bacteria 3619
237 Ga0075370_10047859 3300006353 Bacteria 2421
238 Ga0068871_100006526 3300006358 Bacteria 8262
239 Ga0075430_100005009 3300006846 Bacteria 11150
240 Ga0075430_100073448 3300006846 Bacteria 2868
241 Ga0075434_100302713 3300006871 Bacteria 1619
242 Ga0075434_100433519 3300006871 Bacteria 1336
243 Ga0075429_100004433 3300006880 Bacteria 12064
244 Ga0075429_100020805 3300006880 Bacteria 5694
245 Ga0068865_100008602 3300006881 Bacteria 6312
246 Ga0068865_100080540 3300006881 Bacteria 2336
247 Ga0068865_100099977 3300006881 Bacteria 2121
248 Ga0097620_100014863 3300006931 Bacteria 7817
249 Ga0097620_100053476 3300006931 Bacteria 4062
250 Ga0097620_100054640 3300006931 Bacteria 4017
251 Ga0097620_100271261 3300006931 Bacteria 1789
252 Ga0099823_1000139 3300006944 Bacteria 37935
253 Ga0079104_1000020 3300006946 Bacteria 256848
254 Ga0079104_1000070 3300006946 Bacteria 153879
255 Ga0099826_10000087 3300006948 Bacteria 46364
256 Ga0099794_10009849 3300007265 Bacteria 4039
257 Ga0105244_10009057 3300009036 Bacteria 6153
258 Ga0105244_10178341 3300009036 Bacteria 1008
259 Ga0105250_10000225 3300009092 Bacteria 47059
260 Ga0105240_10015714 3300009093 Bacteria 10273
261 Ga0105240_10075155 3300009093 Bacteria 4168
262 Ga0105240_10095551 3300009093 Bacteria 3623
263 Ga0111539_10140424 3300009094 Bacteria 2828
264 Ga0111539_10183573 3300009094 Bacteria 2443
265 Ga0105245_10063562 3300009098 Bacteria 3333
266 Ga0105245_10125592 3300009098 Bacteria 2401
267 Ga0105247_10138711 3300009101 Bacteria 1591
268 Ga0105247_10217589 3300009101 Bacteria 1291
269 Ga0114129_10376350 3300009147 Bacteria 1876
270 Ga0105243_10000677 3300009148 Bacteria 33243
271 Ga0105243_10010168 3300009148 Bacteria 7154
272 Ga0105243_10031595 3300009148 Bacteria 4082
273 Ga0105243_10039423 3300009148 Bacteria 3682
274 Ga0105243_10056678 3300009148 Bacteria 3117
275 Ga0105243_10060893 3300009148 Bacteria 3016
276 Ga0105243_10439561 3300009148 Bacteria 1221
277 Ga0105241_10013733 3300009174 Bacteria 5932
278 Ga0105241_10043587 3300009174 Bacteria 3398
279 Ga0105241_10401355 3300009174 Bacteria 1202
280 Ga0105242_10099583 3300009176 Bacteria 2460
281 Ga0105248_10000507 3300009177 Bacteria 44310
282 Ga0105248_10000878 3300009177 Bacteria 33719
283 Ga0105248_10036942 3300009177 Bacteria 5463
284 Ga0105237_10019624 3300009545 Bacteria 6981
285 Ga0105237_10022166 3300009545 Bacteria 6518
286 Ga0105237_10030120 3300009545 Bacteria 5514
287 Ga0105237_10137852 3300009545 Bacteria 2434
288 Ga0105238_10173423 3300009551 Bacteria 2133
289 Ga0105249_10024900 3300009553 Bacteria 5385
290 Ga0105249_10031885 3300009553 Bacteria 4768
291 Ga0105249_10048644 3300009553 Bacteria 3865
292 Ga0105249_10537562 3300009553 Bacteria 1218
293 Ga0099796_10038699 3300010159 Bacteria 1601
294 Ga0105239_10000335 3300010375 Bacteria 68810
295 Ga0105239_10087972 3300010375 Bacteria 3424
296 Ga0105239_10088417 3300010375 Bacteria 3416
297 Ga0105239_10139330 3300010375 Bacteria 2702
298 Ga0105246_10408338 3300011119 Bacteria 1130
299 Ga0157319_1000008 3300012497 Bacteria 315600
300 Ga0157326_1000718 3300012513 Bacteria 3879
301 Ga0157371_10142210 3300013102 Bacteria 1709
302 Ga0157371_10365462 3300013102 Bacteria 1052
303 Ga0157369_10024821 3300013105 Bacteria 6660
304 Ga0157369_10046878 3300013105 Bacteria 4695
305 Ga0157369_10071552 3300013105 Bacteria 3723
306 Ga0157374_10026288 3300013296 Bacteria 5236
307 Ga0157374_10315222 3300013296 Bacteria 1549
308 Ga0157374_10342808 3300013296 Bacteria 1483
309 Ga0157378_10013085 3300013297 Bacteria 7259
310 Ga0157378_10054411 3300013297 Bacteria 3563
311 Ga0157378_10058193 3300013297 Bacteria 3446
312 Ga0163162_10002252 3300013306 Bacteria 18114
313 Ga0163162_10009449 3300013306 Bacteria 9482
314 Ga0163162_10011131 3300013306 Bacteria 8762
315 Ga0157372_10100793 3300013307 Bacteria 3296
316 Ga0163163_10071427 3300014325 Bacteria 3459
317 Ga0157380_10037730 3300014326 Bacteria 3746
318 Ga0157380_10065609 3300014326 Bacteria 2918
319 Ga0157380_10139666 3300014326 Bacteria 2079
320 Ga0182008_10000156 3300014497 Bacteria 53866
321 Ga0182008_10014321 3300014497 Bacteria 4155
322 Ga0157377_10000032 3300014745 Bacteria 121003
323 Ga0157377_10136395 3300014745 Bacteria 1504
324 Ga0157379_10028474 3300014968 Bacteria 4968
325 Ga0157379_10451662 3300014968 Bacteria 1187
326 Ga0157376_10005369 3300014969 Bacteria 8954
327 Ga0157376_10007734 3300014969 Bacteria 7700
328 Ga0157376_10166777 3300014969 Bacteria 2002
329 Ga0182006_1056692 3300015261 Bacteria 1491
330 Ga0182007_10000685 3300015262 Bacteria 19419
331 Ga0182007_10002920 3300015262 Bacteria 8301
332 Ga0183362_10005 3300015683 Bacteria 437616
333 Ga0163161_10014666 3300017792 Bacteria 5457
334 Ga0213872_10000007 3300021361 Bacteria 228206
335 Ga0213872_10000313 3300021361 Bacteria 41306
336 Ga0213872_10000498 3300021361 Bacteria 31427
337 Ga0213872_10000542 3300021361 Bacteria 29380
338 Ga0213872_10026135 3300021361 Bacteria 2682
339 Ga0213872_10028836 3300021361 Bacteria 2545
340 Ga0213872_10142002 3300021361 Bacteria 1053
341 Ga0213876_10095684 3300021384 Bacteria 1573
342 Ga0209435_100003 3300025206 Bacteria 669534
343 Ga0209674_100041 3300025226 Bacteria 396231
344 Ga0209672_100420 3300025228 Bacteria 24863
345 Ga0209147_100846 3300025229 Bacteria 14369
346 Ga0209563_100013 3300025230 Bacteria 941463
347 Ga0209563_100043 3300025230 Bacteria 397271
348 Ga0207427_100294 3300025231 Bacteria 35289
349 Ga0209258_100143 3300025242 Bacteria 165551
350 Ga0209258_100344 3300025242 Bacteria 68131
351 Ga0209258_100994 3300025242 Bacteria 13092
352 Ga0207425_1000828 3300025245 Bacteria 15426
353 Ga0207425_1001243 3300025245 Bacteria 11182
354 Ga0207425_1001473 3300025245 Bacteria 9804
355 Ga0209646_1000008 3300025246 Bacteria 669534
356 Ga0209646_1000069 3300025246 Bacteria 230340
357 Ga0209026_1000006 3300025250 Bacteria 677225
358 Ga0209026_1000007 3300025250 Bacteria 669534
359 Ga0209677_100096 3300025253 Bacteria 99089
360 Ga0209677_101004 3300025253 Bacteria 13531
361 Ga0209148_1000007 3300025254 Bacteria 1592273
362 Ga0209759_1000026 3300025256 Bacteria 311743
363 Ga0209759_1000075 3300025256 Bacteria 176235
364 Ga0209759_1001206 3300025256 Bacteria 16040
365 Ga0209759_1002921 3300025256 Bacteria 7164
366 Ga0209759_1011975 3300025256 Bacteria 2428
367 Ga0209129_1000027 3300025258 Bacteria 409587
368 Ga0209129_1000117 3300025258 Bacteria 140115
369 Ga0209565_1000026 3300025263 Bacteria 365910
370 Ga0209565_1000150 3300025263 Bacteria 94073
371 Ga0209565_1000221 3300025263 Bacteria 63818
372 Ga0209565_1000468 3300025263 Bacteria 30337
373 Ga0209565_1012544 3300025263 Bacteria 2017
374 Ga0209455_1000242 3300025272 Bacteria 68131
375 Ga0209673_1000009 3300025273 Bacteria 620735
376 Ga0209673_1000012 3300025273 Bacteria 579480
377 Ga0209673_1000114 3300025273 Bacteria 178557
378 Ga0209673_1000578 3300025273 Bacteria 57974
379 Ga0209673_1001014 3300025273 Bacteria 33876
380 Ga0209673_1002844 3300025273 Bacteria 11093
381 Ga0209673_1009062 3300025273 Bacteria 4355
382 Ga0209673_1010962 3300025273 Bacteria 3778
383 Ga0209673_1015690 3300025273 Bacteria 2864
384 Ga0209673_1052024 3300025273 Bacteria 1077
385 Ga0209130_1000099 3300025284 Bacteria 141717
386 Ga0209130_1000123 3300025284 Bacteria 125840
387 Ga0209130_1000458 3300025284 Bacteria 42850
388 Ga0209130_1000551 3300025284 Bacteria 37431
389 Ga0209130_1005355 3300025284 Bacteria 4484
390 Ga0209675_1000062 3300025291 Bacteria 178557
391 Ga0209675_1000155 3300025291 Bacteria 89020
392 Ga0209675_1000215 3300025291 Bacteria 60572
393 Ga0209675_1004277 3300025291 Bacteria 6422
394 Ga0209675_1018216 3300025291 Bacteria 1972
395 Ga0209675_1018803 3300025291 Bacteria 1922
396 Ga0209676_1000051 3300025292 Bacteria 389016
397 Ga0209676_1000112 3300025292 Bacteria 208328
398 Ga0209676_1000325 3300025292 Bacteria 91840
399 Ga0209676_1004311 3300025292 Bacteria 8007
400 Ga0209025_1002109 3300025294 Bacteria 22421
401 Ga0209025_1003002 3300025294 Bacteria 16681
402 Ga0209025_1005372 3300025294 Bacteria 10488
403 Ga0209025_1010685 3300025294 Bacteria 6178
404 Ga0209025_1033970 3300025294 Bacteria 2343
405 Ga0209564_1000008 3300025295 Bacteria 953227
406 Ga0209564_1000108 3300025295 Bacteria 213699
407 Ga0209564_1000139 3300025295 Bacteria 180328
408 Ga0209564_1000211 3300025295 Bacteria 133277
409 Ga0209564_1000212 3300025295 Bacteria 133160
410 Ga0209564_1000228 3300025295 Bacteria 125206
411 Ga0209564_1014892 3300025295 Bacteria 3202
412 Ga0209758_1000281 3300025297 Bacteria 100826
413 Ga0209758_1000310 3300025297 Bacteria 94307
414 Ga0209758_1000664 3300025297 Bacteria 51488
415 Ga0209758_1010818 3300025297 Bacteria 5394
416 Ga0209758_1026168 3300025297 Bacteria 2535
417 Ga0209758_1074194 3300025297 Bacteria 1056
418 Ga0209050_1000044 3300025298 Bacteria 391114
419 Ga0209050_1000052 3300025298 Bacteria 351785
420 Ga0209050_1000303 3300025298 Bacteria 101498
421 Ga0209050_1000366 3300025298 Bacteria 86616
422 Ga0209050_1000730 3300025298 Bacteria 47896
423 Ga0209050_1003036 3300025298 Bacteria 12951
424 Ga0209050_1005184 3300025298 Bacteria 8337
425 Ga0209050_1015000 3300025298 Bacteria 3290
426 Ga0209256_1000003 3300025299 Bacteria 1661127
427 Ga0209256_1000061 3300025299 Bacteria 260890
428 Ga0209256_1000101 3300025299 Bacteria 200246
429 Ga0209256_1000589 3300025299 Bacteria 50593
430 Ga0209256_1001514 3300025299 Bacteria 23507
431 Ga0209256_1001861 3300025299 Bacteria 19505
432 Ga0207426_1000062 3300025302 Bacteria 362040
433 Ga0207426_1000086 3300025302 Bacteria 292089
434 Ga0207426_1000207 3300025302 Bacteria 140594
435 Ga0207426_1000351 3300025302 Bacteria 84439
436 Ga0207426_1003120 3300025302 Bacteria 9451
437 Ga0209051_1000018 3300025303 Bacteria 527061
438 Ga0209051_1000025 3300025303 Bacteria 415397
439 Ga0209051_1000031 3300025303 Bacteria 391114
440 Ga0209051_1000105 3300025303 Bacteria 160893
441 Ga0209051_1000208 3300025303 Bacteria 102967
442 Ga0209051_1000216 3300025303 Bacteria 97590
443 Ga0209051_1001714 3300025303 Bacteria 17502
444 Ga0209051_1007336 3300025303 Bacteria 6048
445 Ga0209051_1019609 3300025303 Bacteria 2943
446 Ga0209257_1000037 3300025304 Bacteria 612915
447 Ga0209257_1000039 3300025304 Bacteria 591694
448 Ga0209257_1000047 3300025304 Bacteria 460507
449 Ga0209257_1000058 3300025304 Bacteria 381686
450 Ga0209257_1000461 3300025304 Bacteria 75360
451 Ga0209257_1008802 3300025304 Bacteria 5597
452 Ga0209257_1022401 3300025304 Bacteria 2254
453 Ga0209257_1030775 3300025304 Bacteria 1727
454 Ga0207697_10008832 3300025315 Bacteria 4385
455 Ga0207697_10035588 3300025315 Bacteria 2038
456 Ga0207697_10106068 3300025315 Bacteria 1201
457 Ga0207696_1009319 3300025711 Bacteria 3667
458 Ga0207655_1007214 3300025728 Bacteria 7248
459 Ga0207682_10006324 3300025893 Bacteria 4779
460 Ga0207682_10010128 3300025893 Bacteria 3700
461 Ga0207642_10001537 3300025899 Bacteria 7094
462 Ga0207688_10003991 3300025901 Bacteria 8036
463 Ga0207680_10002140 3300025903 Bacteria 9255
464 Ga0207680_10093251 3300025903 Bacteria 1920
465 Ga0207685_10172049 3300025905 Bacteria 997
466 Ga0207645_10004357 3300025907 Bacteria 10481
467 Ga0207645_10008984 3300025907 Bacteria 6939
468 Ga0207645_10010647 3300025907 Bacteria 6310
469 Ga0207645_10055997 3300025907 Bacteria 2517
470 Ga0207643_10022306 3300025908 Bacteria 3484
471 Ga0207705_10081125 3300025909 Bacteria 2364
472 Ga0207705_10166928 3300025909 Bacteria 1656
473 Ga0207684_10030509 3300025910 Bacteria 4589
474 Ga0207684_10050952 3300025910 Bacteria 3512
475 Ga0207654_10029774 3300025911 Bacteria 2992
476 Ga0207707_10003043 3300025912 Bacteria 14898
477 Ga0207707_10070012 3300025912 Bacteria 3057
478 Ga0207707_10091695 3300025912 Bacteria 2655
479 Ga0207695_10025878 3300025913 Bacteria 6558
480 Ga0207671_10032549 3300025914 Bacteria 3880
481 Ga0207671_10036327 3300025914 Bacteria 3654
482 Ga0207671_10106796 3300025914 Bacteria 2126
483 Ga0207660_10022774 3300025917 Bacteria 4223
484 Ga0207660_10259814 3300025917 Bacteria 1373
485 Ga0207662_10003895 3300025918 Bacteria 7772
486 Ga0207657_10040181 3300025919 Bacteria 4147
487 Ga0207657_10080305 3300025919 Bacteria 2742
488 Ga0207649_10370290 3300025920 Bacteria 1065
489 Ga0207652_10046465 3300025921 Bacteria 3704
490 Ga0207652_10054337 3300025921 Bacteria 3443
491 Ga0207652_10156356 3300025921 Bacteria 2043
492 Ga0207646_10223147 3300025922 Bacteria 1702
493 Ga0207681_10000424 3300025923 Bacteria 29435
494 Ga0207681_10209192 3300025923 Bacteria 1502
495 Ga0207694_10162148 3300025924 Bacteria 1806
496 Ga0207650_10000149 3300025925 Bacteria 83837
497 Ga0207650_10006179 3300025925 Bacteria 8164
498 Ga0207650_10055823 3300025925 Bacteria 2933
499 Ga0207659_10000394 3300025926 Bacteria 26304
500 Ga0207659_10004511 3300025926 Bacteria 8420
501 Ga0207659_10006638 3300025926 Bacteria 7106
502 Ga0207659_10008780 3300025926 Bacteria 6295
503 Ga0207687_10014962 3300025927 Bacteria 5081
504 Ga0207687_10146225 3300025927 Bacteria 1798
505 Ga0207687_10228263 3300025927 Bacteria 1469
506 Ga0207644_10002654 3300025931 Bacteria 11522
507 Ga0207644_10106656 3300025931 Bacteria 2112
508 Ga0207644_10108073 3300025931 Bacteria 2099
509 Ga0207644_10114391 3300025931 Bacteria 2044
510 Ga0207644_10157534 3300025931 Bacteria 1762
511 Ga0207644_10319753 3300025931 Bacteria 1255
512 Ga0207690_10000658 3300025932 Bacteria 22107
513 Ga0207690_10097858 3300025932 Bacteria 2089
514 Ga0207690_10257673 3300025932 Bacteria 1350
515 Ga0207706_10002114 3300025933 Bacteria 19441
516 Ga0207706_10002134 3300025933 Bacteria 19354
517 Ga0207706_10013254 3300025933 Bacteria 7500
518 Ga0207706_10027736 3300025933 Bacteria 5062
519 Ga0207686_10001083 3300025934 Bacteria 15936
520 Ga0207686_10089519 3300025934 Bacteria 2029
521 Ga0207686_10258033 3300025934 Bacteria 1277
522 Ga0207709_10000198 3300025935 Bacteria 80022
523 Ga0207709_10000395 3300025935 Bacteria 42894
524 Ga0207709_10024555 3300025935 Bacteria 3443
525 Ga0207709_10031936 3300025935 Bacteria 3080
526 Ga0207709_10042949 3300025935 Bacteria 2722
527 Ga0207709_10114882 3300025935 Bacteria 1807
528 Ga0207709_10347663 3300025935 Bacteria 1118
529 Ga0207670_10009560 3300025936 Bacteria 5538
530 Ga0207669_10006477 3300025937 Bacteria 5354
531 Ga0207669_10014673 3300025937 Bacteria 3933
532 Ga0207669_10022402 3300025937 Bacteria 3355
533 Ga0207669_10027623 3300025937 Bacteria 3110
534 Ga0207669_10117787 3300025937 Bacteria 1796
535 Ga0207704_10106027 3300025938 Bacteria 1887
536 Ga0207704_10117024 3300025938 Bacteria 1815
537 Ga0207665_10001866 3300025939 Bacteria 14205
538 Ga0207691_10000362 3300025940 Bacteria 45799
539 Ga0207691_10080565 3300025940 Bacteria 2928
540 Ga0207711_10072622 3300025941 Bacteria 2989
541 Ga0207711_10074715 3300025941 Bacteria 2948
542 Ga0207689_10001822 3300025942 Bacteria 20138
543 Ga0207689_10007058 3300025942 Bacteria 9876
544 Ga0207689_10008417 3300025942 Bacteria 8984
545 Ga0207689_10032878 3300025942 Bacteria 4312
546 Ga0207689_10265520 3300025942 Bacteria 1420
547 Ga0207661_10071506 3300025944 Bacteria 2835
548 Ga0207679_10002836 3300025945 Bacteria 10749
549 Ga0207679_10127459 3300025945 Bacteria 2036
550 Ga0207679_10336012 3300025945 Bacteria 1312
551 Ga0207667_10024596 3300025949 Bacteria 6608
552 Ga0207667_10091074 3300025949 Bacteria 3151
553 Ga0207667_10224273 3300025949 Bacteria 1925
554 Ga0207667_10444300 3300025949 Bacteria 1318
555 Ga0207651_10016485 3300025960 Bacteria 4329
556 Ga0207651_10135937 3300025960 Bacteria 1891
557 Ga0207712_10009614 3300025961 Bacteria 6123
558 Ga0207712_10014447 3300025961 Bacteria 5081
559 Ga0207712_10136951 3300025961 Bacteria 1874
560 Ga0207668_10002951 3300025972 Bacteria 9967
561 Ga0207668_10076419 3300025972 Bacteria 2411
562 Ga0207668_10133119 3300025972 Bacteria 1901
563 Ga0207668_10360007 3300025972 Bacteria 1219
564 Ga0207658_10002509 3300025986 Bacteria 13356
565 Ga0207677_10001881 3300026023 Bacteria 11091
566 Ga0207677_10026591 3300026023 Bacteria 3632
567 Ga0207677_10050279 3300026023 Bacteria 2819
568 Ga0207677_10208054 3300026023 Bacteria 1560
569 Ga0207703_10001816 3300026035 Bacteria 19028
570 Ga0207703_10006009 3300026035 Bacteria 9719
571 Ga0207703_10016275 3300026035 Bacteria 5796
572 Ga0207703_10039580 3300026035 Bacteria 3767
573 Ga0207703_10063309 3300026035 Bacteria 3032
574 Ga0207639_10303549 3300026041 Bacteria 1412
575 Ga0207678_10016216 3300026067 Bacteria 6538
576 Ga0207678_10028591 3300026067 Bacteria 4865
577 Ga0207678_10097403 3300026067 Bacteria 2514
578 Ga0207678_10178441 3300026067 Bacteria 1813
579 Ga0207708_10003081 3300026075 Bacteria 12272
580 Ga0207702_10004015 3300026078 Bacteria 13221
581 Ga0207641_10001603 3300026088 Bacteria 22077
582 Ga0207641_10003329 3300026088 Bacteria 14294
583 Ga0207648_10001296 3300026089 Bacteria 27908
584 Ga0207648_10008674 3300026089 Bacteria 9809
585 Ga0207648_10009826 3300026089 Bacteria 9136
586 Ga0207648_10016948 3300026089 Bacteria 6638
587 Ga0207648_10023655 3300026089 Bacteria 5500
588 Ga0207648_10023777 3300026089 Bacteria 5482
589 Ga0207648_10262402 3300026089 Bacteria 1541
590 Ga0207676_10358587 3300026095 Bacteria 1350
591 Ga0207674_10008406 3300026116 Bacteria 11930
592 Ga0207674_10008627 3300026116 Bacteria 11748
593 Ga0207674_10017378 3300026116 Bacteria 7849
594 Ga0207674_10160744 3300026116 Bacteria 2201
595 Ga0207675_100005391 3300026118 Bacteria 12258
596 Ga0207675_100005639 3300026118 Bacteria 11983
597 Ga0207675_100008096 3300026118 Bacteria 9902
598 Ga0207675_100014267 3300026118 Bacteria 7406
599 Ga0207675_100026913 3300026118 Bacteria 5354
600 Ga0207675_100086506 3300026118 Bacteria 2943
601 Ga0207683_10002281 3300026121 Bacteria 16815
602 Ga0207683_10015467 3300026121 Bacteria 6499
603 Ga0207683_10089616 3300026121 Bacteria 2738
604 Ga0207683_10235123 3300026121 Bacteria 1671
605 Ga0207683_10292382 3300026121 Bacteria 1490
606 Ga0207698_10009766 3300026142 Bacteria 6129
607 Ga0209281_1000002 3300027111 Bacteria 1924012
608 Ga0209281_1000103 3300027111 Bacteria 221425
609 Ga0209389_1051666 3300027296 Bacteria 2820
610 Ga0209996_1001118 3300027395 Bacteria 3198
611 Ga0209968_1001916 3300027526 Bacteria 3160
612 Ga0209968_1009267 3300027526 Bacteria 1506
613 Ga0209999_1002667 3300027543 Bacteria 3155
614 Ga0209970_1000729 3300027614 Bacteria 5691
615 Ga0209282_1002130 3300027666 Bacteria 11281
616 Ga0209966_1000272 3300027695 Bacteria 18297
617 Ga0209998_10021722 3300027717 Bacteria 1380
618 Ga0209813_10002658 3300027866 Bacteria 4110
619 Ga0209813_10017124 3300027866 Bacteria 1985
620 Ga0209974_10000663 3300027876 Bacteria 11654
621 Ga0209974_10028494 3300027876 Bacteria 1850
622 Ga0209974_10049841 3300027876 Bacteria 1405
623 Ga0207428_10138972 3300027907 Bacteria 1856
624 Ga0207428_10168577 3300027907 Bacteria 1659
625 Ga0268266_10271093 3300028379 Bacteria 1575
626 Ga0268265_10005592 3300028380 Bacteria 8582
627 Ga0268265_10031635 3300028380 Bacteria 3823
628 Ga0268265_10061624 3300028380 Bacteria 2879
629 Ga0268264_10000613 3300028381 Bacteria 42687
630 Ga0268264_10001082 3300028381 Bacteria 26946
631 Ga0268264_10029104 3300028381 Bacteria 4523
632 Ga0265334_10033932 3300028573 Bacteria 2028
633 Ga0265318_10001267 3300028577 Bacteria 15290
634 Ga0265336_10000013 3300028666 Bacteria 252156
635 Ga0307517_10020662 3300028786 Bacteria 8372
636 Ga0307517_10064568 3300028786 Bacteria 3401
637 Ga0307515_10000011 3300028794 Bacteria 633903
638 Ga0307515_10000186 3300028794 Bacteria 153531
639 Ga0307515_10000609 3300028794 Bacteria 83557
640 Ga0307515_10001484 3300028794 Bacteria 52674
641 Ga0307515_10001693 3300028794 Bacteria 49203
642 Ga0307515_10003934 3300028794 Bacteria 31018
643 Ga0307515_10005551 3300028794 Bacteria 25536
644 Ga0307515_10028582 3300028794 Bacteria 9474
645 Ga0307515_10044072 3300028794 Bacteria 6908
646 Ga0307515_10087494 3300028794 Bacteria 3953
647 Ga0307515_10126720 3300028794 Bacteria 2845
648 Ga0307515_10129467 3300028794 Bacteria 2791
649 Ga0265324_10001525 3300029957 Bacteria 13036
650 Ga0265324_10018167 3300029957 Bacteria 2549
651 Ga0307511_10165378 3300030521 Bacteria 1230
652 Ga0307512_10022022 3300030522 Bacteria 5739
653 Ga0307512_10066559 3300030522 Bacteria 2721
654 Ga0316178_1133079 3300030735 Bacteria 9243
655 Ga0265330_10000116 3300031235 Bacteria 64622
656 Ga0265330_10005977 3300031235 Bacteria 6025
657 Ga0265330_10019627 3300031235 Bacteria 3095
658 Ga0265332_10000012 3300031238 Bacteria 272641
659 Ga0265332_10000022 3300031238 Bacteria 213072
660 Ga0265332_10000039 3300031238 Bacteria 128373
661 Ga0265332_10001619 3300031238 Bacteria 12328
662 Ga0265332_10001913 3300031238 Bacteria 11023
663 Ga0265328_10009242 3300031239 Bacteria 4022
664 Ga0265328_10009634 3300031239 Bacteria 3926
665 Ga0265328_10018479 3300031239 Bacteria 2687
666 Ga0265320_10005313 3300031240 Bacteria 8288
667 Ga0265325_10008490 3300031241 Bacteria 6058
668 Ga0265340_10007714 3300031247 Bacteria 5836
669 Ga0265331_10000966 3300031250 Bacteria 22822
670 Ga0265327_10000012 3300031251 Bacteria 530403
671 Ga0265327_10000135 3300031251 Bacteria 162683
672 Ga0265327_10000174 3300031251 Bacteria 138922
673 Ga0265327_10000399 3300031251 Bacteria 81304
674 Ga0265327_10003933 3300031251 Bacteria 13608
675 Ga0265327_10012526 3300031251 Bacteria 5712
676 Ga0265327_10042419 3300031251 Bacteria 2442
677 Ga0265316_10000349 3300031344 Bacteria 51876
678 Ga0265316_10003002 3300031344 Bacteria 17258
679 Ga0265316_10011827 3300031344 Bacteria 7851
680 Ga0265316_10025542 3300031344 Bacteria 4927
681 Ga0265316_10173229 3300031344 Bacteria 1609
682 Ga0307513_10000008 3300031456 Bacteria 442128
683 Ga0307513_10000090 3300031456 Bacteria 129750
684 Ga0307513_10004316 3300031456 Bacteria 18998
685 Ga0307513_10017676 3300031456 Bacteria 8543
686 Ga0307513_10043579 3300031456 Bacteria 4925
687 Ga0307513_10093821 3300031456 Bacteria 3049
688 Ga0307513_10102560 3300031456 Bacteria 2880
689 Ga0307513_10119849 3300031456 Bacteria 2602
690 Ga0307513_10151977 3300031456 Bacteria 2222
691 Ga0307513_10211832 3300031456 Bacteria 1768
692 Ga0307509_10000018 3300031507 Bacteria 258998
693 Ga0307509_10000991 3300031507 Bacteria 48763
694 Ga0307509_10015880 3300031507 Bacteria 8748
695 Ga0307509_10019559 3300031507 Bacteria 7714
696 Ga0307509_10025753 3300031507 Bacteria 6568
697 Ga0307509_10034805 3300031507 Bacteria 5533
698 Ga0307509_10090775 3300031507 Bacteria 3129
699 Ga0307509_10164399 3300031507 Bacteria 2111
700 Ga0307408_100000109 3300031548 Bacteria 91284
701 Ga0307408_100000153 3300031548 Bacteria 76717
702 Ga0307408_100001523 3300031548 Bacteria 17206
703 Ga0307408_100019433 3300031548 Bacteria 4575
704 Ga0307408_100057094 3300031548 Bacteria 2832
705 Ga0307408_100128771 3300031548 Bacteria 1972
706 Ga0307408_100152952 3300031548 Bacteria 1823
707 Ga0307408_100153600 3300031548 Bacteria 1820
708 Ga0307408_100177530 3300031548 Bacteria 1705
709 Ga0307508_10000404 3300031616 Bacteria 51734
710 Ga0307508_10005736 3300031616 Bacteria 11754
711 Ga0307508_10079168 3300031616 Bacteria 2867
712 Ga0307508_10253107 3300031616 Bacteria 1357
713 Ga0307514_10000355 3300031649 Bacteria 106758
714 Ga0307514_10006428 3300031649 Bacteria 10246
715 Ga0307514_10061104 3300031649 Bacteria 2871
716 Ga0265314_10000029 3300031711 Bacteria 272506
717 Ga0265314_10001032 3300031711 Bacteria 32416
718 Ga0265314_10006722 3300031711 Bacteria 10097
719 Ga0307516_10000359 3300031730 Bacteria 59207
720 Ga0307516_10001691 3300031730 Bacteria 30381
721 Ga0307516_10001752 3300031730 Bacteria 29850
722 Ga0307516_10009071 3300031730 Bacteria 11141
723 Ga0307516_10012623 3300031730 Bacteria 9084
724 Ga0307516_10042856 3300031730 Bacteria 4487
725 Ga0307516_10043918 3300031730 Bacteria 4426
726 Ga0307516_10113248 3300031730 Bacteria 2511
727 Ga0307516_10165203 3300031730 Bacteria 1959
728 Ga0307516_10219900 3300031730 Bacteria 1609
729 Ga0307516_10290732 3300031730 Bacteria 1313
730 Ga0307405_10018120 3300031731 Bacteria 3879
731 Ga0307405_10022313 3300031731 Bacteria 3577
732 Ga0307405_10024028 3300031731 Bacteria 3475
733 Ga0307405_10222537 3300031731 Bacteria 1386
734 Ga0307405_10277172 3300031731 Bacteria 1260
735 Ga0307405_10321491 3300031731 Bacteria 1182
736 Ga0307413_10009024 3300031824 Bacteria 4748
737 Ga0307410_10263871 3300031852 Bacteria 1344
738 Ga0307406_10000177 3300031901 Bacteria 38241
739 Ga0307406_10005953 3300031901 Bacteria 6693
740 Ga0307406_10083645 3300031901 Bacteria 2129
741 Ga0307406_10101070 3300031901 Bacteria 1964
742 Ga0307407_10109679 3300031903 Bacteria 1730
743 Ga0307412_10020952 3300031911 Bacteria 3986
744 Ga0307412_10021758 3300031911 Bacteria 3921
745 Ga0307412_10051126 3300031911 Bacteria 2730
746 Ga0307412_10068222 3300031911 Bacteria 2417
747 Ga0307412_10068691 3300031911 Bacteria 2410
748 Ga0307409_100000580 3300031995 Bacteria 15944
749 Ga0307409_100002327 3300031995 Bacteria 9871
750 Ga0307409_100233933 3300031995 Bacteria 1668
751 Ga0307416_100016758 3300032002 Bacteria 5105
752 Ga0307416_100157473 3300032002 Bacteria 2093
753 Ga0307414_10009449 3300032004 Bacteria 5602
754 Ga0307411_10000980 3300032005 Bacteria 10974
755 Ga0307411_10045495 3300032005 Bacteria 2823
756 Ga0307411_10252410 3300032005 Bacteria 1388
757 Ga0307415_100002051 3300032126 Bacteria 9953
758 Ga0307415_100050003 3300032126 Bacteria 2830
759 Ga0307507_10080089 3300033179 Bacteria 2882
760 Ga0307510_10003212 3300033180 Bacteria 19002
761 Ga0307510_10034309 3300033180 Bacteria 5684
762 Ga0307510_10090259 3300033180 Bacteria 2911
763 Ga0307510_10154008 3300033180 Bacteria 1910
764 Ga0373958_0004949 3300034819 Bacteria 1999
765 Ga0373938_0039150 3300034957 Bacteria 1047
766 Ga0373944_0055416 3300035089 Bacteria 1259
767 Ga0373923_0002186 3300035111 Bacteria 5937
768 Ga0373939_0000040 3300035114 Bacteria 45617
769 Ga0373939_0044191 3300035114 Bacteria 1355
770 Ga0373953_0113541 3300035117 Bacteria 1147
771 Ga0373954_0001977 3300035118 Bacteria 8503
772 Ga0373954_0019842 3300035118 Bacteria 3035
773 Ga0373956_0000019 3300035119 Bacteria 50599
774 Ga0373956_0005947 3300035119 Bacteria 4880
775 Ga0373956_0060822 3300035119 Bacteria 1711
776 Ga0373943_0102525 3300035170 Bacteria 1499
777 Ga0373961_0016111 3300035241 Bacteria 1922
778 Ga0373962_0014948 3300035242 Bacteria 1984
779 Ga0373924_0031962 3300035410 Bacteria 2118
780 Ga0373931_0000371 3300035691 Bacteria 18458
781 Ga0373931_0004077 3300035691 Bacteria 6625
782 Ga0373931_0008459 3300035691 Bacteria 4882
783 Ga0373935_0021523 3300035692 Bacteria 3948
784 Ga0373935_0076621 3300035692 Bacteria 2166
785 Ga0373927_0038359 3300035695 Bacteria 3111
786 Ga0373933_0001258 3300035724 Bacteria 14963
787 Ga0373933_0149254 3300035724 Bacteria 1480
788 Ga0373937_0008018 3300036401 Bacteria 9154
789 Ga0373937_0021786 3300036401 Bacteria 5753
790 Ga0373937_0052884 3300036401 Bacteria 3725
791 Ga0373937_0070918 3300036401 Bacteria 3214
792 Ga0373925_0002526 3300037068 Bacteria 14599
793 Ga0373925_0031551 3300037068 Bacteria 3894
794 Ga0373925_0262172 3300037068 Bacteria 1388
795 Ga0395899_0001730 3300037312 Bacteria 18156
796 Ga0395900_0000050 3300037418 Bacteria 224616
797 Ga0395900_0012094 3300037418 Bacteria 8821
798 Ga0395900_0035661 3300037418 Bacteria 5124
799 Ga0395900_0045709 3300037418 Bacteria 4510
800 Ga0395898_0027591 3300037466 Bacteria 5696
801 Ga0395898_0075520 3300037466 Bacteria 3255
802 Ga0395898_0293533 3300037466 Bacteria 1551
803 Ga0395905_0000027 3300037471 Bacteria 297239
804 Ga0395905_0001331 3300037471 Bacteria 30156
805 Ga0395905_0003262 3300037471 Bacteria 17445
806 Ga0395905_0003887 3300037471 Bacteria 15759
807 Ga0395905_0005984 3300037471 Bacteria 12318
808 Ga0395905_0013719 3300037471 Bacteria 7757
809 Ga0395905_0018757 3300037471 Bacteria 6562
810 Ga0395905_0021666 3300037471 Bacteria 6080
811 Ga0395905_0031917 3300037471 Bacteria 4955
812 Ga0395905_0068368 3300037471 Bacteria 3327
813 Ga0395905_0169393 3300037471 Bacteria 2051
814 Ga0395905_0208507 3300037471 Bacteria 1831
815 Ga0395905_0215417 3300037471 Bacteria 1798
816 Ga0395901_0006743 3300038443 Bacteria 11597
817 Ga0395901_0028659 3300038443 Bacteria 5727
818 Ga0395901_0075212 3300038443 Bacteria 3523
819 Ga0395901_0079875 3300038443 Bacteria 3415
820 Ga0395901_0080221 3300038443 Bacteria 3407
821 Ga0395901_0627333 3300038443 Bacteria 1081
822 Ga0400490_19738 3300038726 Bacteria 21312
823 Ga0436365_0218817 3300039437 Bacteria 1234
824 Ga0436365_0623519 3300039437 Bacteria 1415
825 Ga0436365_1276620 3300039437 Bacteria 3556
826 Ga0436361_0074177 3300039447 Bacteria 20991
827 Ga0436361_0094944 3300039447 Bacteria 20715
828 Ga0436361_0163583 3300039447 Bacteria 173204
829 Ga0436361_0692684 3300039447 Bacteria 133303
830 Ga0436361_0716937 3300039447 Bacteria 2813
831 Ga0436361_1102546 3300039447 Bacteria 2266
832 Ga0436361_1131941 3300039447 Bacteria 7064
833 Ga0436361_1173038 3300039447 Bacteria 5235
834 Ga0439466_0026204 3300041411 Bacteria 2029
835 Ga0451789_0076338 3300041443 Bacteria 3083
836 Ga0451793_0931357 3300041452 Bacteria 1807
837 Ga0451798_0093215 3300041458 Bacteria 1988
838 Ga0451853_2357137 3300041512 Bacteria 1367
839 Ga0439450_009577 3300042008 Bacteria 1844
840 Ga0439450_017381 3300042008 Bacteria 1499
841 Ga0439457_034626 3300042014 Bacteria 1122
842 Ga0439462_0008063 3300042015 Bacteria 2650
843 Ga0450911_000403 3300042115 Bacteria 14279
844 Ga0450888_003140 3300042126 Bacteria 1661
845 Ga0450890_003864 3300042127 Bacteria 1973
846 Ga0450891_007241 3300042129 Bacteria 1016
847 Ga0450892_000203 3300042130 Bacteria 7032
848 Ga0439446_0020567 3300042156 Bacteria 1860
849 Ga0439434_0001372 3300042435 Bacteria 7025
850 Ga0450918_000036 3300042531 Bacteria 26790
851 Ga0450918_003265 3300042531 Bacteria 3025
852 Ga0450893_0003621 3300042532 Bacteria 2437
853 Ga0451577_0001123 3300042876 Bacteria 37983
854 Ga0451577_0001607 3300042876 Bacteria 29368
855 Ga0451577_0004221 3300042876 Bacteria 15320
856 Ga0451577_0080512 3300042876 Bacteria 2904
857 Ga0451577_0085934 3300042876 Bacteria 2806
858 Ga0451577_0091087 3300042876 Bacteria 2722
859 Ga0451577_0214682 3300042876 Bacteria 1738
860 Ga0451577_0255761 3300042876 Bacteria 1586
861 Ga0466969_0000169 3300044656 Bacteria 35088
862 Ga0466969_0061062 3300044656 Bacteria 1831
863 Ga0466969_0091121 3300044656 Bacteria 1444
864 Ga0453683_0011844 3300044673 Bacteria 5738
865 Ga0453683_0016343 3300044673 Bacteria 4789
866 Ga0453683_0158019 3300044673 Bacteria 1433
867 Ga0466965_0002959 3300044683 Bacteria 7356
868 Ga0466966_0000328 3300044684 Bacteria 30788
869 Ga0466966_0001013 3300044684 Bacteria 17899
870 Ga0466966_0041256 3300044684 Bacteria 2965
871 Ga0466966_0146473 3300044684 Bacteria 1441
872 Ga0466966_0172533 3300044684 Bacteria 1314
873 Ga0466961_0009158 3300044693 Bacteria 6303
874 Ga0466961_0012914 3300044693 Bacteria 5342
875 Ga0466963_0008951 3300044694 Bacteria 6009
876 Ga0466963_0046791 3300044694 Bacteria 2854
877 Ga0466964_0000580 3300044706 Bacteria 11539
878 Ga0466964_0012347 3300044706 Bacteria 3232
879 Ga0453684_0000187 3300044712 Bacteria 272378
880 Ga0453684_0000677 3300044712 Bacteria 122140
881 Ga0453684_0005216 3300044712 Bacteria 26063
882 Ga0453684_0033030 3300044712 Bacteria 7222
883 Ga0453684_0053963 3300044712 Bacteria 5241
884 Ga0453684_0058728 3300044712 Bacteria 4967
885 Ga0453684_0111239 3300044712 Bacteria 3327
886 Ga0453684_0164299 3300044712 Bacteria 2623
887 Ga0453684_0449138 3300044712 Bacteria 1435
888 Ga0466971_0002510 3300044719 Bacteria 7764
889 Ga0466971_0007772 3300044719 Bacteria 4673
890 Ga0466968_0009784 3300044735 Bacteria 3700
891 Ga0466968_0090867 3300044735 Bacteria 1352
892 Ga0466970_0045922 3300044765 Bacteria 2326
893 Ga0466957_0001010 3300044842 Bacteria 14493
894 Ga0466957_0018755 3300044842 Bacteria 4064
895 Ga0466957_0188806 3300044842 Bacteria 1349
896 Ga0466959_0000027 3300045049 Bacteria 114262
897 Ga0466959_0002529 3300045049 Bacteria 11728
898 Ga0466959_0003589 3300045049 Bacteria 10219
899 Ga0451576_0000424 3300045051 Bacteria 97297
900 Ga0451576_0001693 3300045051 Bacteria 36462
901 Ga0451576_0001927 3300045051 Bacteria 33232
902 Ga0451576_0002279 3300045051 Bacteria 29284
903 Ga0451576_0011270 3300045051 Bacteria 10177
904 Ga0451576_0053992 3300045051 Bacteria 4207
905 Ga0451576_0058585 3300045051 Bacteria 4024
906 Ga0451576_0095925 3300045051 Bacteria 3085
907 Ga0451576_0121897 3300045051 Bacteria 2715
908 Ga0451576_0361349 3300045051 Bacteria 1521
909 Ga0466958_0081922 3300045836 Bacteria 1986
910 Ga0466958_0111685 3300045836 Bacteria 1706
911 Ga0466958_0198371 3300045836 Bacteria 1277
912 Ga0466967_0114702 3300045976 Bacteria 2480
913 Ga0495627_014868 3300046453 Bacteria 2701
914 Ga0495592_0000083 3300046454 Bacteria 83092
915 Ga0495592_0005283 3300046454 Bacteria 9519
916 Ga0495592_0005630 3300046454 Bacteria 9263
917 Ga0495592_0012039 3300046454 Bacteria 6557
918 Ga0495629_0040384 3300046459 Bacteria 3282
919 Ga0495651_0000147 3300046462 Bacteria 51361
920 Ga0495639_0015665 3300046475 Bacteria 3288
921 Ga0495662_0030371 3300046476 Bacteria 2608
922 Ga0495583_0000081 3300046506 Bacteria 168304
923 Ga0495583_0134954 3300046506 Bacteria 1031
924 Ga0495610_0100095 3300046512 Bacteria 1300
925 Ga0495618_0056530 3300046514 Bacteria 2484
926 Ga0495620_0020326 3300046515 Bacteria 3244
927 Ga0495628_0000681 3300046516 Bacteria 31276
928 Ga0495628_0021588 3300046516 Bacteria 5294
929 Ga0495628_0131642 3300046516 Bacteria 1912
930 Ga0495628_0176904 3300046516 Bacteria 1616
931 Ga0495630_0012641 3300046517 Bacteria 6134
932 Ga0495630_0312781 3300046517 Bacteria 1201
933 Ga0495632_0018159 3300046519 Bacteria 3865
934 Ga0495643_0026129 3300046522 Bacteria 3298
935 Ga0495666_0050441 3300046526 Bacteria 2000
936 Ga0495652_0002007 3300046529 Bacteria 21698
937 Ga0495654_0001177 3300046530 Bacteria 18624
938 Ga0495665_0010927 3300046531 Bacteria 4911
939 Ga0495640_0210910 3300046533 Bacteria 1228
940 Ga0495586_0080294 3300046535 Bacteria 1792
941 Ga0495587_0217453 3300046536 Bacteria 1078
942 Ga0495621_0088282 3300046539 Bacteria 1166
943 Ga0495597_0000054 3300046542 Bacteria 95390
944 Ga0495645_0000366 3300046543 Bacteria 31440
945 Ga0495656_0004892 3300046615 Bacteria 4611
946 Ga0495625_0000297 3300046660 Bacteria 76945
947 Ga0495625_0005366 3300046660 Bacteria 11724
948 Ga0495625_0008840 3300046660 Bacteria 8525
949 Ga0495625_0095707 3300046660 Bacteria 2046
950 Ga0495635_0295003 3300046663 Bacteria 1087
951 Ga0495588_0036807 3300046674 Bacteria 2484
952 Ga0495599_0001135 3300046678 Bacteria 15036
953 Ga0495599_0009382 3300046678 Bacteria 5979
954 Ga0495647_0006990 3300046681 Bacteria 3761
955 Ga0495613_0046804 3300046689 Bacteria 3197
956 Ga0495613_0170907 3300046689 Bacteria 1543
957 Ga0495624_0024079 3300046690 Bacteria 4008
958 Ga0495624_0036628 3300046690 Bacteria 3161
959 Ga0495671_0079439 3300046692 Bacteria 1608
960 Ga0495649_0000717 3300046694 Bacteria 26952
961 Ga0495589_0031839 3300046794 Bacteria 2654
962 Ga0495600_0003010 3300046809 Bacteria 9837
963 Ga0495604_0233443 3300047317 Bacteria 1261
964 Ga0495636_0001523 3300047318 Bacteria 8797
965 Ga0495636_0020026 3300047318 Bacteria 2694
966 Ga0495674_0031602 3300047319 Bacteria 4809
967 Ga0495674_0072401 3300047319 Bacteria 2972
968 Ga0495676_0172993 3300047321 Bacteria 1518
969 Ga0495687_000961 3300047443 Bacteria 29557
970 Ga0495687_014525 3300047443 Bacteria 4047
971 Ga0495675_0005144 3300047444 Bacteria 7959
972 Ga0495686_0017654 3300047472 Bacteria 4802
973 Ga0495686_0027994 3300047472 Bacteria 3674
974 Ga0496101_0055131 3300048904 Bacteria 2870
975 Ga0496101_0105707 3300048904 Bacteria 2113
976 Ga0496102_0005909 3300048905 Bacteria 10418
977 Ga0496102_0026996 3300048905 Bacteria 5127
978 Ga0496102_0316078 3300048905 Bacteria 1471
979 Ga0496106_0019322 3300048909 Bacteria 5052
980 Ga0496106_0042660 3300048909 Bacteria 3402
981 Ga0496106_0194782 3300048909 Bacteria 1612
982 Ga0496106_0367134 3300048909 Bacteria 1156
983 Ga0496107_0031338 3300048910 Bacteria 3793
984 Ga0496108_0074417 3300048911 Bacteria 2868
985 Ga0496108_0182821 3300048911 Bacteria 1816
986 Ga0496109_0061056 3300048912 Bacteria 3445
987 Ga0496109_0529868 3300048912 Bacteria 1112
988 Ga0496110_0337753 3300048913 Bacteria 1372
989 Ga0496111_0076961 3300048914 Bacteria 2432
990 Ga0496112_0129906 3300048915 Bacteria 2490
991 Ga0496112_0223801 3300048915 Bacteria 1837
992 Ga0496113_0028039 3300048916 Bacteria 4045
993 Ga0496114_0041873 3300048917 Bacteria 3795
994 Ga0496114_0210270 3300048917 Bacteria 1706
995 Ga0496114_0342276 3300048917 Bacteria 1322
996 Ga0496116_0015211 3300048919 Bacteria 6095
997 Ga0496117_0042591 3300048920 Bacteria 3311
998 Ga0496118_0007545 3300048921 Bacteria 11487
999 Ga0496122_0000184 3300048925 Bacteria 144437
1000 Ga0496123_0000181 3300048926 Bacteria 127092
1001 Ga0496123_0089861 3300048926 Bacteria 1828
1002 Ga0496125_0045844 3300048928 Bacteria 3674
1003 Ga0501294_007176 3300049517 Bacteria 1074
1004 Ga0501031_0001313 3300049568 Bacteria 15265
1005 Ga0501032_0260328 3300049569 Bacteria 1125
1006 Ga0501033_0076965 3300049570 Bacteria 2449
1007 Ga0501040_0007443 3300049576 Bacteria 7091
1008 Ga0501041_0024372 3300049577 Bacteria 3632
1009 Ga0501043_0000057 3300049579 Bacteria 103997
1010 Ga0501046_0000075 3300049580 Bacteria 104000
1011 Ga0501046_0052371 3300049580 Bacteria 3217
1012 Ga0501047_0000081 3300049581 Bacteria 122697
1013 Ga0501047_0032891 3300049581 Bacteria 5007
1014 Ga0501067_0048159 3300049583 Bacteria 2364
1015 Ga0501070_0257021 3300049586 Bacteria 1428
1016 Ga0501075_0252531 3300049591 Bacteria 1344
1017 Ga0501076_0082527 3300049592 Bacteria 2580
1018 Ga0501198_000012 3300049649 Bacteria 113529
1019 Ga0501199_001320 3300049650 Bacteria 2236
1020 Ga0501209_000016 3300049656 Bacteria 17356
1021 Ga0501211_001645 3300049658 Bacteria 2393
1022 Ga0501222_000010 3300049662 Bacteria 113536
1023 Ga0501235_003731 3300049669 Bacteria 3290
1024 Ga0501253_001974 3300049683 Bacteria 2223
1025 Ga0501258_000834 3300049687 Bacteria 2296
1026 Ga0501259_023966 3300049688 Bacteria 1107
1027 Ga0501079_0195468 3300049741 Bacteria 1579
1028 Ga0501080_0005085 3300049742 Bacteria 11720
1029 Ga0501081_0024872 3300049743 Bacteria 4024
1030 Ga0501262_000007 3300049759 Bacteria 38668
1031 Ga0501267_000181 3300049764 Bacteria 4367
1032 Ga0501035_0207404 3300049822 Bacteria 1678
1033 Ga0501044_0179283 3300049823 Bacteria 2086
1034 Ga0501045_0002738 3300049824 Bacteria 12043
1035 Ga0501045_0095581 3300049824 Bacteria 2198
1036 nmdc:mga03683_36973_c1 3300050489 Bacteria 1988
1037 nmdc:mga03683_3849_c2 3300050489 Bacteria 3502
1038 nmdc:mga03n38_18316_c1 3300050490 Bacteria 2762
1039 nmdc:mga0yw44_1657_c1 3300050492 Bacteria 8982
1040 nmdc:mga0yw44_57447_c1 3300050492 Bacteria 2373
1041 nmdc:mga0k408_161_c1 3300050493 Bacteria 34843
1042 nmdc:mga0k408_21583_c1 3300050493 Bacteria 3618
1043 nmdc:mga0k408_37719_c2 3300050493 Bacteria 1548
1044 nmdc:mga0k408_4724_c1 3300050493 Bacteria 7214
1045 nmdc:mga0k408_8075_c1 3300050493 Bacteria 5642
1046 nmdc:mga06z11_36846_c1 3300050494 Bacteria 2418
1047 nmdc:mga06z11_95353_c1 3300050494 Bacteria 1623
1048 nmdc:mga07m45_125038_c1 3300050496 Bacteria 1487
1049 nmdc:mga07m45_135625_c1 3300050496 Bacteria 1425
1050 nmdc:mga07m45_1699_c1 3300050496 Bacteria 10129
1051 nmdc:mga07m45_22960_c1 3300050496 Bacteria 3408
1052 nmdc:mga07m45_25520_c1 3300050496 Bacteria 3242
1053 nmdc:mga07m45_31264_c1 3300050496 Bacteria 2950
1054 nmdc:mga07m45_34873_c1 3300050496 Bacteria 2798
1055 nmdc:mga07m45_3881_c1 3300050496 Bacteria 7255
1056 nmdc:mga07m45_68660_c1 3300050496 Bacteria 2015
1057 nmdc:mga07m45_73628_c1 3300050496 Bacteria 1945
1058 nmdc:mga07m45_8129_c1 3300050496 Bacteria 5378
1059 nmdc:mga09592_3580_c1 3300050508 Bacteria 12538
1060 nmdc:mga09592_69130_c1 3300050508 Bacteria 2996
1061 nmdc:mga0qj67_4254_c1 3300050509 Bacteria 10371
1062 nmdc:mga0qj67_82221_c1 3300050509 Bacteria 2583
1063 nmdc:mga0n895_42645_c1 3300050512 Bacteria 4415
1064 nmdc:mga08x19_146818_c1 3300050514 Bacteria 1595
1065 nmdc:mga0sz30_147037_c1 3300050516 Bacteria 1041
1066 nmdc:mga0sz30_22715_c1 3300050516 Bacteria 2548
1067 Ga0500635_0000011 3300053080 Bacteria 144219
1068 Ga0495595_0004261 3300053084 Bacteria 5751
1069 Ga0500578_0000363 3300053086 Bacteria 55670
1070 Ga0500644_0002532 3300053088 Bacteria 4566
1071 Ga0500651_0000030 3300053093 Bacteria 112247
1072 Ga0500593_000526 3300053117 Bacteria 15083
1073 Ga0500607_000706 3300053121 Bacteria 32099
1074 Ga0500608_001067 3300053122 Bacteria 9808
1075 Ga0500652_001558 3300053131 Bacteria 7009
1076 Ga0500658_0001860 3300053134 Bacteria 8298
1077 Ga0500658_0001896 3300053134 Bacteria 8203
1078 Ga0500559_0000019 3300053136 Bacteria 134862
1079 Ga0500568_0005487 3300053139 Bacteria 6543
1080 Ga0500568_0016465 3300053139 Bacteria 3286
1081 Ga0500574_005109 3300053141 Bacteria 2523
1082 Ga0500577_0003064 3300053142 Bacteria 4316
1083 Ga0500604_0039163 3300053151 Bacteria 1424
1084 Ga0500616_0072500 3300053153 Bacteria 1750
1085 Ga0500622_0000011 3300053156 Bacteria 386096
1086 Ga0500622_0000332 3300053156 Bacteria 46878
1087 Ga0500622_0003170 3300053156 Bacteria 11250
1088 Ga0500622_0021036 3300053156 Bacteria 3463
1089 Ga0500645_000061 3300053730 Bacteria 85703
1090 Ga0500645_000257 3300053730 Bacteria 38752
1091 Ga0466962_0023386 3300061719 Bacteria 2970
1092 2511242515 2511231002 Bacteria 5042903
1093 2513231871 2513020051 Bacteria 6053213
1094 2526211927 2526164512 Bacteria 4025691
1095 2548499320 2547132374 Bacteria 5530232
1096 2548848754 2547132512 Bacteria 3416496
1097 2587724940 2585428057 Bacteria 6737412
1098 2587731693 2585428058 Bacteria 6853932
1099 2587754183 2585428062 Bacteria 6842168
1100 2588292442 2588253510 Bacteria 6901809
1101 2599621035 2599185214 Bacteria 8209958
1102 2599674159 2599185226 Bacteria 8233575
1103 2599678349 2599185227 Bacteria 8246414
1104 2599690546 2599185229 Bacteria 8216126
1105 2643743740 2643221544 Bacteria 5886209
1106 2643866152 2643221570 Bacteria 5103772
1107 2643936510 2643221585 Bacteria 5812563
1108 2643968178 2643221592 Bacteria 6608788
1109 2643994140 2643221596 Bacteria 5006805
1110 2644057633 2643221609 Bacteria 6756331
1111 2644072279 2643221611 Bacteria 6820941
1112 2644142466 2643221625 Bacteria 6512927
1113 2644161230 2643221628 Bacteria 5745828
1114 2644222347 2643221639 Bacteria 6649903
1115 2644247009 2643221644 Bacteria 6865017
1116 2644256361 2643221646 Bacteria 6433402
1117 2644277035 2643221648 Bacteria 6521465
1118 2644292965 2643221652 Bacteria 5140275
1119 2644301360 2643221654 Bacteria 5273570
1120 2644317866 2643221656 Bacteria 5809961
1121 2644325724 2643221658 Bacteria 6064537
1122 2644340867 2643221660 Bacteria 4208257
1123 2644400890 2643221672 Bacteria 6322190
1124 2644466128 2643221683 Bacteria 5749203
1125 2644647981 2643221717 Bacteria 5676132
1126 2722885827 2721755523 Bacteria 6430384
1127 2738723058 2738541277 Bacteria 7458140
1128 2738882485 2738541307 Bacteria 8606193
1129 2739058398 2738541337 Bacteria 6183410
1130 2739241906 2738543012 Bacteria 7115078
1131 2739251815 2738543013 Bacteria 5618633
1132 2739283789 2738543019 Bacteria 7459457
1133 2816470792 2816332133 Bacteria 7249298
1134 2819602696 2818991446 Bacteria 7757362
1135 2831270007 2831265667 Bacteria 7184833
1136 2831869077 2831864461 Bacteria 6502356
1137 2838054996 2838054893 Bacteria 7451788
1138 2839144053 2839138175 Bacteria 6549354
1139 2842681163 2842677519 Bacteria 5615038
1140 2842718360 2842718218 Bacteria 4560148
1141 2842737405 2842733646 Bacteria 5716726
1142 2842749847 2842747753 Bacteria 5578255
1143 2881103475 2881101125 Bacteria 4590519
1144 2885196542 2885192300 Bacteria 5882526
1145 2885202013 2885198086 Bacteria 7212419
1146 2885215277 2885211737 Bacteria 7212420
1147 2886850368 2886848708 Bacteria 5632523
1148 2894023942 2894023352 Bacteria 5167372
1149 2899927074 2899924645 Bacteria 7487985
1150 2904454139 2904449895 Bacteria 6927402
1151 2904462004 2904456579 Bacteria 6819253
1152 2904479453 2904479285 Bacteria 5073931
1153 2904545940 2904541872 Bacteria 8915136
1154 2919465263 2919462493 Bacteria 5817112
1155 2919706781 2919704043 Bacteria 5560311
1156 2928043922 2928037797 Bacteria 7273642
1157 2928048570 2928044640 Bacteria 7271509
1158 2928054892 2928051484 Bacteria 7773759
1159 2928068332 2928064002 Bacteria 7419480
1160 2928073770 2928070936 Bacteria 8062541
1161 2928086028 2928084124 Bacteria 7159212
1162 2928118362 2928115317 Bacteria 6477646
1163 2929161135 2929160207 Bacteria 9075316
1164 2929521870 2929520902 Bacteria 6765052
1165 2932423250 2932422444 Bacteria 4678430
1166 2939635817 2939631187 Bacteria 6118131
1167 2945914387 2945909444 Bacteria 7065066
1168 2945949917 2945945610 Bacteria 5951079
1169 2945973937 2945972063 Bacteria 6086495
1170 2945990218 2945984333 Bacteria 7358892
1171 2954770478 2954767861 Bacteria 5535784
1172 2974320677 2974320154 Bacteria 4571377
1173 2990714206 2990710928 Bacteria 5002431
1174 Ga0105242_10000311
1175 SwRhRL2b_contig_2261576
1176 JGI24740J21852_10017328
1177 JGI25155J39150_1000028
1178 JGI25156J39149_1000013
1179 JGI25156J39149_1016254
1180 JGI25154J39366_1000032
1181 JGI25154J39366_1000863
1182 JGI25157J39369_1000017
1183 JGI25157J39369_1000150
1184 JGI25152J39213_1002181
1185 JGI25150J39212_1007008
1186 JGI25150J39212_1008049
1187 JGI25150J39212_1019855
1188 JGI25159J45721_1000039
1189 JGI25159J45721_1000247
1190 JGI25159J45721_1001604
1191 JGI25159J45721_1008111
1192 JGI25151J46595_10000792
1193 JGI25151J46595_10000920
1194 JGI25151J46595_10012721
1195 JGI25153J46596_10001105
1196 JGI25153J46596_10007118
1197 JGI25153J46596_10018770
1198 rootL2_10000300
1199 JGI26128J50194_1000027
1200 JGI25160J50197_1000106
1201 JGI25160J50197_1006815
1202 JGI25160J50197_1029078
1203 JGI25161J50226_1000041
1204 Ga0055533_1000016
1205 Ga0055525_1000004
1206 Ga0055525_1000910
1207 Ga0055535_1000139
1208 Ga0055535_1000546
1209 Ga0055535_1006152
1210 Ga0055542_1000091
1211 Ga0055529_1000333
1212 Ga0055526_1000414
1213 Ga0055526_1004544
1214 Ga0055526_1041734
1215 Ga0055537_1000029
1216 Ga0055537_1000229
1217 Ga0055537_1003934
1218 Ga0055537_1014452
1219 Ga0055524_1000013
1220 Ga0055524_1000040
1221 Ga0055524_1009444
1222 Ga0055536_1000611
1223 Ga0055534_1000081
1224 Ga0055534_1000271
1225 Ga0055534_1008639
1226 Ga0055534_1010033
1227 Ga0055534_1011896
1228 Ga0055528_1000107
1229 Ga0055528_1000233
1230 Ga0055528_1013275
1231 Ga0055530_10000143
1232 Ga0055530_10000493
1233 Ga0055530_10002895
1234 Ga0055530_10002922
1235 Ga0055530_10007440
1236 Ga0055540_1000001
1237 Ga0055540_1000030
1238 Ga0055540_1000641
1239 Ga0055540_1016153
1240 Ga0055531_10000179
1241 Ga0055531_10000720
1242 Ga0055531_10000975
1243 Ga0055531_10005204
1244 Ga0055543_1000092
1245 Ga0065165_1000080
1246 Ga0065165_1000177
1247 Ga0065165_1020125
1248 Ga0065714_10015162
1249 Ga0065704_10070295
1250 Ga0065704_10188786
1251 Ga0065712_10103673
1252 Ga0065707_10092018
1253 Ga0070658_10084452
1254 Ga0070658_10401306
1255 Ga0070676_10004542
1256 Ga0070676_10017485
1257 Ga0070676_10030628
1258 Ga0070676_10108739
1259 Ga0070690_100011766
1260 Ga0070690_100022220
1261 Ga0070670_100004549
1262 Ga0070677_10013596
1263 Ga0070677_10050651
1264 Ga0068869_100071442
1265 Ga0068869_100415821
1266 Ga0070666_10006864
1267 Ga0070666_10076431
1268 Ga0070680_100006232
1269 Ga0070680_100378749
1270 Ga0068868_100000966
1271 Ga0068868_100034632
1272 Ga0068868_100085136
1273 Ga0070660_100125476
1274 Ga0070689_100009409
1275 Ga0070661_100001108
1276 Ga0070661_100064789
1277 Ga0070661_100233122
1278 Ga0070668_100005300
1279 Ga0070668_100038317
1280 Ga0070668_100062337
1281 Ga0070669_100281549
1282 Ga0070675_100007167
1283 Ga0070675_100273188
1284 Ga0070675_100380393
1285 Ga0070671_100052391
1286 Ga0070671_100065512
1287 Ga0070671_100216584
1288 Ga0070674_100002485
1289 Ga0070674_100004974
1290 Ga0070674_100010811
1291 Ga0070674_100015476
1292 Ga0070674_100025436
1293 Ga0070674_100031879
1294 Ga0070674_100137618
1295 Ga0070659_100001014
1296 Ga0070659_100034653
1297 Ga0070667_100019529
1298 Ga0070667_100046770
1299 Ga0070667_100121358
1300 Ga0070700_100069516
1301 Ga0070694_100029230
1302 Ga0070663_100001375
1303 Ga0070663_100074648
1304 Ga0070663_100115124
1305 Ga0070678_100009130
1306 Ga0070678_100035841
1307 Ga0070678_100115478
1308 Ga0070662_100009941
1309 Ga0070662_100010817
1310 Ga0070681_10000135
1311 Ga0070681_10002911
1312 Ga0070681_10142443
1313 Ga0070681_10243474
1314 Ga0068867_100000081
1315 Ga0068867_100001774
1316 Ga0068867_100002071
1317 Ga0068867_100024628
1318 Ga0068867_100027632
1319 Ga0068867_100162807
1320 Ga0070685_10020911
1321 Ga0070706_100032798
1322 Ga0070706_100063330
1323 Ga0070707_100119633
1324 Ga0070698_100250101
1325 Ga0068853_100215233
1326 Ga0068853_100386790
1327 Ga0068853_100427083
1328 Ga0070672_100002675
1329 Ga0070672_100338769
1330 Ga0070695_100186816
1331 Ga0070695_100200308
1332 Ga0070693_100062366
1333 Ga0070665_100059372
1334 Ga0070665_100116746
1335 Ga0070704_100009336
1336 Ga0070704_100157923
1337 Ga0068855_100168577
1338 Ga0068855_100496489
1339 Ga0070664_100009671
1340 Ga0070664_100017465
1341 Ga0070664_100284239
1342 Ga0068857_100011645
1343 Ga0068857_100022139
1344 Ga0068854_100128902
1345 Ga0068854_100387163
1346 Ga0068856_100031334
1347 Ga0068856_100463666
1348 Ga0068852_100005075
1349 Ga0068852_100191633
1350 Ga0068859_100014864
1351 Ga0068859_100053475
1352 Ga0068859_100054638
1353 Ga0068859_100271259
1354 Ga0068864_100036333
1355 Ga0068864_100085585
1356 Ga0068864_100268343
1357 Ga0068866_10024589
1358 Ga0068861_100005602
1359 Ga0068861_100038942
1360 Ga0068851_10036616
1361 Ga0068870_10036521
1362 Ga0068863_100017036
1363 Ga0068863_100034318
1364 Ga0068863_100049573
1365 Ga0068863_100058111
1366 Ga0068858_100006772
1367 Ga0068858_100009260
1368 Ga0068858_100017497
1369 Ga0068858_100023157
1370 Ga0068858_100056487
1371 Ga0068858_100319828
1372 Ga0068860_100000823
1373 Ga0068860_100002377
1374 Ga0068860_100121690
1375 Ga0068862_100008650
1376 Ga0068862_100034816
1377 Ga0081538_10115530
1378 Ga0075365_10002751
1379 Ga0075365_10141235
1380 Ga0075368_10045226
1381 Ga0075363_100011525
1382 Ga0075363_100016272
1383 Ga0075363_100110095
1384 Ga0075364_10016678
1385 Ga0075364_10046004
1386 Ga0075432_10037892
1387 Ga0070716_100008354
1388 Ga0075362_10003710
1389 Ga0075362_10009023
1390 Ga0075362_10010550
1391 Ga0075362_10013040
1392 Ga0075362_10099452
1393 Ga0075367_10003903
1394 Ga0075369_10160672
1395 Ga0075366_10002485
1396 Ga0075366_10007403
1397 Ga0075366_10014484
1398 Ga0075366_10017250
1399 Ga0075366_10163863
1400 Ga0097621_100016784
1401 Ga0097621_100072610
1402 Ga0097621_100166929
1403 Ga0097621_100325282
1404 Ga0075370_10001524
1405 Ga0075370_10002918
1406 Ga0075370_10014039
1407 Ga0075370_10015390
1408 Ga0075370_10019536
1409 Ga0075370_10020448
1410 Ga0075370_10047859
1411 Ga0068871_100006526
1412 Ga0075430_100005009
1413 Ga0075430_100073448
1414 Ga0075434_100302713
1415 Ga0075434_100433519
1416 Ga0075429_100004433
1417 Ga0075429_100020805
1418 Ga0068865_100008602
1419 Ga0068865_100080540
1420 Ga0068865_100099977
1421 Ga0097620_100014863
1422 Ga0097620_100053476
1423 Ga0097620_100054640
1424 Ga0097620_100271261
1425 Ga0099823_1000139
1426 Ga0079104_1000020
1427 Ga0079104_1000070
1428 Ga0099826_10000087
1429 Ga0099794_10009849
1430 Ga0105244_10009057
1431 Ga0105244_10178341
1432 Ga0105250_10000225
1433 Ga0105240_10015714
1434 Ga0105240_10075155
1435 Ga0105240_10095551
1436 Ga0111539_10140424
1437 Ga0111539_10183573
1438 Ga0105245_10063562
1439 Ga0105245_10125592
1440 Ga0105247_10138711
1441 Ga0105247_10217589
1442 Ga0114129_10376350
1443 Ga0105243_10000677
1444 Ga0105243_10010168
1445 Ga0105243_10031595
1446 Ga0105243_10039423
1447 Ga0105243_10056678
1448 Ga0105243_10060893
1449 Ga0105243_10439561
1450 Ga0105241_10013733
1451 Ga0105241_10043587
1452 Ga0105241_10401355
1453 Ga0105242_10099583
1454 Ga0105248_10000507
1455 Ga0105248_10000878
1456 Ga0105248_10036942
1457 Ga0105237_10019624
1458 Ga0105237_10022166
1459 Ga0105237_10030120
1460 Ga0105237_10137852
1461 Ga0105238_10173423
1462 Ga0105249_10024900
1463 Ga0105249_10031885
1464 Ga0105249_10048644
1465 Ga0105249_10537562
1466 Ga0099796_10038699
1467 Ga0105239_10000335
1468 Ga0105239_10087972
1469 Ga0105239_10088417
1470 Ga0105239_10139330
1471 Ga0105246_10408338
1472 Ga0157319_1000008
1473 Ga0157326_1000718
1474 Ga0157371_10142210
1475 Ga0157371_10365462
1476 Ga0157369_10024821
1477 Ga0157369_10046878
1478 Ga0157369_10071552
1479 Ga0157374_10026288
1480 Ga0157374_10315222
1481 Ga0157374_10342808
1482 Ga0157378_10013085
1483 Ga0157378_10054411
1484 Ga0157378_10058193
1485 Ga0163162_10002252
1486 Ga0163162_10009449
1487 Ga0163162_10011131
1488 Ga0157372_10100793
1489 Ga0163163_10071427
1490 Ga0157380_10037730
1491 Ga0157380_10065609
1492 Ga0157380_10139666
1493 Ga0182008_10000156
1494 Ga0182008_10014321
1495 Ga0157377_10000032
1496 Ga0157377_10136395
1497 Ga0157379_10028474
1498 Ga0157379_10451662
1499 Ga0157376_10005369
1500 Ga0157376_10007734
1501 Ga0157376_10166777
1502 Ga0182006_1056692
1503 Ga0182007_10000685
1504 Ga0182007_10002920
1505 Ga0183362_10005
1506 Ga0163161_10014666
1507 Ga0213872_10000007
1508 Ga0213872_10000313
1509 Ga0213872_10000498
1510 Ga0213872_10000542
1511 Ga0213872_10026135
1512 Ga0213872_10028836
1513 Ga0213872_10142002
1514 Ga0213876_10095684
1515 Ga0209435_100003
1516 Ga0209674_100041
1517 Ga0209672_100420
1518 Ga0209147_100846
1519 Ga0209563_100013
1520 Ga0209563_100043
1521 Ga0207427_100294
1522 Ga0209258_100143
1523 Ga0209258_100344
1524 Ga0209258_100994
1525 Ga0207425_1000828
1526 Ga0207425_1001243
1527 Ga0207425_1001473
1528 Ga0209646_1000008
1529 Ga0209646_1000069
1530 Ga0209026_1000006
1531 Ga0209026_1000007
1532 Ga0209677_100096
1533 Ga0209677_101004
1534 Ga0209148_1000007
1535 Ga0209759_1000026
1536 Ga0209759_1000075
1537 Ga0209759_1001206
1538 Ga0209759_1002921
1539 Ga0209759_1011975
1540 Ga0209129_1000027
1541 Ga0209129_1000117
1542 Ga0209565_1000026
1543 Ga0209565_1000150
1544 Ga0209565_1000221
1545 Ga0209565_1000468
1546 Ga0209565_1012544
1547 Ga0209455_1000242
1548 Ga0209673_1000009
1549 Ga0209673_1000012
1550 Ga0209673_1000114
1551 Ga0209673_1000578
1552 Ga0209673_1001014
1553 Ga0209673_1002844
1554 Ga0209673_1009062
1555 Ga0209673_1010962
1556 Ga0209673_1015690
1557 Ga0209673_1052024
1558 Ga0209130_1000099
1559 Ga0209130_1000123
1560 Ga0209130_1000458
1561 Ga0209130_1000551
1562 Ga0209130_1005355
1563 Ga0209675_1000062
1564 Ga0209675_1000155
1565 Ga0209675_1000215
1566 Ga0209675_1004277
1567 Ga0209675_1018216
1568 Ga0209675_1018803
1569 Ga0209676_1000051
1570 Ga0209676_1000112
1571 Ga0209676_1000325
1572 Ga0209676_1004311
1573 Ga0209025_1002109
1574 Ga0209025_1003002
1575 Ga0209025_1005372
1576 Ga0209025_1010685
1577 Ga0209025_1033970
1578 Ga0209564_1000008
1579 Ga0209564_1000108
1580 Ga0209564_1000139
1581 Ga0209564_1000211
1582 Ga0209564_1000212
1583 Ga0209564_1000228
1584 Ga0209564_1014892
1585 Ga0209758_1000281
1586 Ga0209758_1000310
1587 Ga0209758_1000664
1588 Ga0209758_1010818
1589 Ga0209758_1026168
1590 Ga0209758_1074194
1591 Ga0209050_1000044
1592 Ga0209050_1000052
1593 Ga0209050_1000303
1594 Ga0209050_1000366
1595 Ga0209050_1000730
1596 Ga0209050_1003036
1597 Ga0209050_1005184
1598 Ga0209050_1015000
1599 Ga0209256_1000003
1600 Ga0209256_1000061
1601 Ga0209256_1000101
1602 Ga0209256_1000589
1603 Ga0209256_1001514
1604 Ga0209256_1001861
1605 Ga0207426_1000062
1606 Ga0207426_1000086
1607 Ga0207426_1000207
1608 Ga0207426_1000351
1609 Ga0207426_1003120
1610 Ga0209051_1000018
1611 Ga0209051_1000025
1612 Ga0209051_1000031
1613 Ga0209051_1000105
1614 Ga0209051_1000208
1615 Ga0209051_1000216
1616 Ga0209051_1001714
1617 Ga0209051_1007336
1618 Ga0209051_1019609
1619 Ga0209257_1000037
1620 Ga0209257_1000039
1621 Ga0209257_1000047
1622 Ga0209257_1000058
1623 Ga0209257_1000461
1624 Ga0209257_1008802
1625 Ga0209257_1022401
1626 Ga0209257_1030775
1627 Ga0207697_10008832
1628 Ga0207697_10035588
1629 Ga0207697_10106068
1630 Ga0207696_1009319
1631 Ga0207655_1007214
1632 Ga0207682_10006324
1633 Ga0207682_10010128
1634 Ga0207642_10001537
1635 Ga0207688_10003991
1636 Ga0207680_10002140
1637 Ga0207680_10093251
1638 Ga0207685_10172049
1639 Ga0207645_10004357
1640 Ga0207645_10008984
1641 Ga0207645_10010647
1642 Ga0207645_10055997
1643 Ga0207643_10022306
1644 Ga0207705_10081125
1645 Ga0207705_10166928
1646 Ga0207684_10030509
1647 Ga0207684_10050952
1648 Ga0207654_10029774
1649 Ga0207707_10003043
1650 Ga0207707_10070012
1651 Ga0207707_10091695
1652 Ga0207695_10025878
1653 Ga0207671_10032549
1654 Ga0207671_10036327
1655 Ga0207671_10106796
1656 Ga0207660_10022774
1657 Ga0207660_10259814
1658 Ga0207662_10003895
1659 Ga0207657_10040181
1660 Ga0207657_10080305
1661 Ga0207649_10370290
1662 Ga0207652_10046465
1663 Ga0207652_10054337
1664 Ga0207652_10156356
1665 Ga0207646_10223147
1666 Ga0207681_10000424
1667 Ga0207681_10209192
1668 Ga0207694_10162148
1669 Ga0207650_10000149
1670 Ga0207650_10006179
1671 Ga0207650_10055823
1672 Ga0207659_10000394
1673 Ga0207659_10004511
1674 Ga0207659_10006638
1675 Ga0207659_10008780
1676 Ga0207687_10014962
1677 Ga0207687_10146225
1678 Ga0207687_10228263
1679 Ga0207644_10002654
1680 Ga0207644_10106656
1681 Ga0207644_10108073
1682 Ga0207644_10114391
1683 Ga0207644_10157534
1684 Ga0207644_10319753
1685 Ga0207690_10000658
1686 Ga0207690_10097858
1687 Ga0207690_10257673
1688 Ga0207706_10002114
1689 Ga0207706_10002134
1690 Ga0207706_10013254
1691 Ga0207706_10027736
1692 Ga0207686_10001083
1693 Ga0207686_10089519
1694 Ga0207686_10258033
1695 Ga0207709_10000198
1696 Ga0207709_10000395
1697 Ga0207709_10024555
1698 Ga0207709_10031936
1699 Ga0207709_10042949
1700 Ga0207709_10114882
1701 Ga0207709_10347663
1702 Ga0207670_10009560
1703 Ga0207669_10006477
1704 Ga0207669_10014673
1705 Ga0207669_10022402
1706 Ga0207669_10027623
1707 Ga0207669_10117787
1708 Ga0207704_10106027
1709 Ga0207704_10117024
1710 Ga0207665_10001866
1711 Ga0207691_10000362
1712 Ga0207691_10080565
1713 Ga0207711_10072622
1714 Ga0207711_10074715
1715 Ga0207689_10001822
1716 Ga0207689_10007058
1717 Ga0207689_10008417
1718 Ga0207689_10032878
1719 Ga0207689_10265520
1720 Ga0207661_10071506
1721 Ga0207679_10002836
1722 Ga0207679_10127459
1723 Ga0207679_10336012
1724 Ga0207667_10024596
1725 Ga0207667_10091074
1726 Ga0207667_10224273
1727 Ga0207667_10444300
1728 Ga0207651_10016485
1729 Ga0207651_10135937
1730 Ga0207712_10009614
1731 Ga0207712_10014447
1732 Ga0207712_10136951
1733 Ga0207668_10002951
1734 Ga0207668_10076419
1735 Ga0207668_10133119
1736 Ga0207668_10360007
1737 Ga0207658_10002509
1738 Ga0207677_10001881
1739 Ga0207677_10026591
1740 Ga0207677_10050279
1741 Ga0207677_10208054
1742 Ga0207703_10001816
1743 Ga0207703_10006009
1744 Ga0207703_10016275
1745 Ga0207703_10039580
1746 Ga0207703_10063309
1747 Ga0207639_10303549
1748 Ga0207678_10016216
1749 Ga0207678_10028591
1750 Ga0207678_10097403
1751 Ga0207678_10178441
1752 Ga0207708_10003081
1753 Ga0207702_10004015
1754 Ga0207641_10001603
1755 Ga0207641_10003329
1756 Ga0207648_10001296
1757 Ga0207648_10008674
1758 Ga0207648_10009826
1759 Ga0207648_10016948
1760 Ga0207648_10023655
1761 Ga0207648_10023777
1762 Ga0207648_10262402
1763 Ga0207676_10358587
1764 Ga0207674_10008406
1765 Ga0207674_10008627
1766 Ga0207674_10017378
1767 Ga0207674_10160744
1768 Ga0207675_100005391
1769 Ga0207675_100005639
1770 Ga0207675_100008096
1771 Ga0207675_100014267
1772 Ga0207675_100026913
1773 Ga0207675_100086506
1774 Ga0207683_10002281
1775 Ga0207683_10015467
1776 Ga0207683_10089616
1777 Ga0207683_10235123
1778 Ga0207683_10292382
1779 Ga0207698_10009766
1780 Ga0209281_1000002
1781 Ga0209281_1000103
1782 Ga0209389_1051666
1783 Ga0209996_1001118
1784 Ga0209968_1001916
1785 Ga0209968_1009267
1786 Ga0209999_1002667
1787 Ga0209970_1000729
1788 Ga0209282_1002130
1789 Ga0209966_1000272
1790 Ga0209998_10021722
1791 Ga0209813_10002658
1792 Ga0209813_10017124
1793 Ga0209974_10000663
1794 Ga0209974_10028494
1795 Ga0209974_10049841
1796 Ga0207428_10138972
1797 Ga0207428_10168577
1798 Ga0268266_10271093
1799 Ga0268265_10005592
1800 Ga0268265_10031635
1801 Ga0268265_10061624
1802 Ga0268264_10000613
1803 Ga0268264_10001082
1804 Ga0268264_10029104
1805 Ga0265334_10033932
1806 Ga0265318_10001267
1807 Ga0265336_10000013
1808 Ga0307517_10020662
1809 Ga0307517_10064568
1810 Ga0307515_10000011
1811 Ga0307515_10000186
1812 Ga0307515_10000609
1813 Ga0307515_10001484
1814 Ga0307515_10001693
1815 Ga0307515_10003934
1816 Ga0307515_10005551
1817 Ga0307515_10028582
1818 Ga0307515_10044072
1819 Ga0307515_10087494
1820 Ga0307515_10126720
1821 Ga0307515_10129467
1822 Ga0265324_10001525
1823 Ga0265324_10018167
1824 Ga0307511_10165378
1825 Ga0307512_10022022
1826 Ga0307512_10066559
1827 Ga0316178_1133079
1828 Ga0265330_10000116
1829 Ga0265330_10005977
1830 Ga0265330_10019627
1831 Ga0265332_10000012
1832 Ga0265332_10000022
1833 Ga0265332_10000039
1834 Ga0265332_10001619
1835 Ga0265332_10001913
1836 Ga0265328_10009242
1837 Ga0265328_10009634
1838 Ga0265328_10018479
1839 Ga0265320_10005313
1840 Ga0265325_10008490
1841 Ga0265340_10007714
1842 Ga0265331_10000966
1843 Ga0265327_10000012
1844 Ga0265327_10000135
1845 Ga0265327_10000174
1846 Ga0265327_10000399
1847 Ga0265327_10003933
1848 Ga0265327_10012526
1849 Ga0265327_10042419
1850 Ga0265316_10000349
1851 Ga0265316_10003002
1852 Ga0265316_10011827
1853 Ga0265316_10025542
1854 Ga0265316_10173229
1855 Ga0307513_10000008
1856 Ga0307513_10000090
1857 Ga0307513_10004316
1858 Ga0307513_10017676
1859 Ga0307513_10043579
1860 Ga0307513_10093821
1861 Ga0307513_10102560
1862 Ga0307513_10119849
1863 Ga0307513_10151977
1864 Ga0307513_10211832
1865 Ga0307509_10000018
1866 Ga0307509_10000991
1867 Ga0307509_10015880
1868 Ga0307509_10019559
1869 Ga0307509_10025753
1870 Ga0307509_10034805
1871 Ga0307509_10090775
1872 Ga0307509_10164399
1873 Ga0307408_100000109
1874 Ga0307408_100000153
1875 Ga0307408_100001523
1876 Ga0307408_100019433
1877 Ga0307408_100057094
1878 Ga0307408_100128771
1879 Ga0307408_100152952
1880 Ga0307408_100153600
1881 Ga0307408_100177530
1882 Ga0307508_10000404
1883 Ga0307508_10005736
1884 Ga0307508_10079168
1885 Ga0307508_10253107
1886 Ga0307514_10000355
1887 Ga0307514_10006428
1888 Ga0307514_10061104
1889 Ga0265314_10000029
1890 Ga0265314_10001032
1891 Ga0265314_10006722
1892 Ga0307516_10000359
1893 Ga0307516_10001691
1894 Ga0307516_10001752
1895 Ga0307516_10009071
1896 Ga0307516_10012623
1897 Ga0307516_10042856
1898 Ga0307516_10043918
1899 Ga0307516_10113248
1900 Ga0307516_10165203
1901 Ga0307516_10219900
1902 Ga0307516_10290732
1903 Ga0307405_10018120
1904 Ga0307405_10022313
1905 Ga0307405_10024028
1906 Ga0307405_10222537
1907 Ga0307405_10277172
1908 Ga0307405_10321491
1909 Ga0307413_10009024
1910 Ga0307410_10263871
1911 Ga0307406_10000177
1912 Ga0307406_10005953
1913 Ga0307406_10083645
1914 Ga0307406_10101070
1915 Ga0307407_10109679
1916 Ga0307412_10020952
1917 Ga0307412_10021758
1918 Ga0307412_10051126
1919 Ga0307412_10068222
1920 Ga0307412_10068691
1921 Ga0307409_100000580
1922 Ga0307409_100002327
1923 Ga0307409_100233933
1924 Ga0307416_100016758
1925 Ga0307416_100157473
1926 Ga0307414_10009449
1927 Ga0307411_10000980
1928 Ga0307411_10045495
1929 Ga0307411_10252410
1930 Ga0307415_100002051
1931 Ga0307415_100050003
1932 Ga0307507_10080089
1933 Ga0307510_10003212
1934 Ga0307510_10034309
1935 Ga0307510_10090259
1936 Ga0307510_10154008
1937 Ga0373958_0004949
1938 Ga0373938_0039150
1939 Ga0373944_0055416
1940 Ga0373923_0002186
1941 Ga0373939_0000040
1942 Ga0373939_0044191
1943 Ga0373953_0113541
1944 Ga0373954_0001977
1945 Ga0373954_0019842
1946 Ga0373956_0000019
1947 Ga0373956_0005947
1948 Ga0373956_0060822
1949 Ga0373943_0102525
1950 Ga0373961_0016111
1951 Ga0373962_0014948
1952 Ga0373924_0031962
1953 Ga0373931_0000371
1954 Ga0373931_0004077
1955 Ga0373931_0008459
1956 Ga0373935_0021523
1957 Ga0373935_0076621
1958 Ga0373927_0038359
1959 Ga0373933_0001258
1960 Ga0373933_0149254
1961 Ga0373937_0008018
1962 Ga0373937_0021786
1963 Ga0373937_0052884
1964 Ga0373937_0070918
1965 Ga0373925_0002526
1966 Ga0373925_0031551
1967 Ga0373925_0262172
1968 Ga0395899_0001730
1969 Ga0395900_0000050
1970 Ga0395900_0012094
1971 Ga0395900_0035661
1972 Ga0395900_0045709
1973 Ga0395898_0027591
1974 Ga0395898_0075520
1975 Ga0395898_0293533
1976 Ga0395905_0000027
1977 Ga0395905_0001331
1978 Ga0395905_0003262
1979 Ga0395905_0003887
1980 Ga0395905_0005984
1981 Ga0395905_0013719
1982 Ga0395905_0018757
1983 Ga0395905_0021666
1984 Ga0395905_0031917
1985 Ga0395905_0068368
1986 Ga0395905_0169393
1987 Ga0395905_0208507
1988 Ga0395905_0215417
1989 Ga0395901_0006743
1990 Ga0395901_0028659
1991 Ga0395901_0075212
1992 Ga0395901_0079875
1993 Ga0395901_0080221
1994 Ga0395901_0627333
1995 Ga0400490_19738
1996 Ga0436365_0218817
1997 Ga0436365_0623519
1998 Ga0436365_1276620
1999 Ga0436361_0074177
2000 Ga0436361_0094944
2001 Ga0436361_0163583
2002 Ga0436361_0692684
2003 Ga0436361_0716937
2004 Ga0436361_1102546
2005 Ga0436361_1131941
2006 Ga0436361_1173038
2007 Ga0439466_0026204
2008 Ga0451789_0076338
2009 Ga0451793_0931357
2010 Ga0451798_0093215
2011 Ga0451853_2357137
2012 Ga0439450_009577
2013 Ga0439450_017381
2014 Ga0439457_034626
2015 Ga0439462_0008063
2016 Ga0450911_000403
2017 Ga0450888_003140
2018 Ga0450890_003864
2019 Ga0450891_007241
2020 Ga0450892_000203
2021 Ga0439446_0020567
2022 Ga0439434_0001372
2023 Ga0450918_000036
2024 Ga0450918_003265
2025 Ga0450893_0003621
2026 Ga0451577_0001123
2027 Ga0451577_0001607
2028 Ga0451577_0004221
2029 Ga0451577_0080512
2030 Ga0451577_0085934
2031 Ga0451577_0091087
2032 Ga0451577_0214682
2033 Ga0451577_0255761
2034 Ga0466969_0000169
2035 Ga0466969_0061062
2036 Ga0466969_0091121
2037 Ga0453683_0011844
2038 Ga0453683_0016343
2039 Ga0453683_0158019
2040 Ga0466965_0002959
2041 Ga0466966_0000328
2042 Ga0466966_0001013
2043 Ga0466966_0041256
2044 Ga0466966_0146473
2045 Ga0466966_0172533
2046 Ga0466961_0009158
2047 Ga0466961_0012914
2048 Ga0466963_0008951
2049 Ga0466963_0046791
2050 Ga0466964_0000580
2051 Ga0466964_0012347
2052 Ga0453684_0000187
2053 Ga0453684_0000677
2054 Ga0453684_0005216
2055 Ga0453684_0033030
2056 Ga0453684_0053963
2057 Ga0453684_0058728
2058 Ga0453684_0111239
2059 Ga0453684_0164299
2060 Ga0453684_0449138
2061 Ga0466971_0002510
2062 Ga0466971_0007772
2063 Ga0466968_0009784
2064 Ga0466968_0090867
2065 Ga0466970_0045922
2066 Ga0466957_0001010
2067 Ga0466957_0018755
2068 Ga0466957_0188806
2069 Ga0466959_0000027
2070 Ga0466959_0002529
2071 Ga0466959_0003589
2072 Ga0451576_0000424
2073 Ga0451576_0001693
2074 Ga0451576_0001927
2075 Ga0451576_0002279
2076 Ga0451576_0011270
2077 Ga0451576_0053992
2078 Ga0451576_0058585
2079 Ga0451576_0095925
2080 Ga0451576_0121897
2081 Ga0451576_0361349
2082 Ga0466958_0081922
2083 Ga0466958_0111685
2084 Ga0466958_0198371
2085 Ga0466967_0114702
2086 Ga0495627_014868
2087 Ga0495592_0000083
2088 Ga0495592_0005283
2089 Ga0495592_0005630
2090 Ga0495592_0012039
2091 Ga0495629_0040384
2092 Ga0495651_0000147
2093 Ga0495639_0015665
2094 Ga0495662_0030371
2095 Ga0495583_0000081
2096 Ga0495583_0134954
2097 Ga0495610_0100095
2098 Ga0495618_0056530
2099 Ga0495620_0020326
2100 Ga0495628_0000681
2101 Ga0495628_0021588
2102 Ga0495628_0131642
2103 Ga0495628_0176904
2104 Ga0495630_0012641
2105 Ga0495630_0312781
2106 Ga0495632_0018159
2107 Ga0495643_0026129
2108 Ga0495666_0050441
2109 Ga0495652_0002007
2110 Ga0495654_0001177
2111 Ga0495665_0010927
2112 Ga0495640_0210910
2113 Ga0495586_0080294
2114 Ga0495587_0217453
2115 Ga0495621_0088282
2116 Ga0495597_0000054
2117 Ga0495645_0000366
2118 Ga0495656_0004892
2119 Ga0495625_0000297
2120 Ga0495625_0005366
2121 Ga0495625_0008840
2122 Ga0495625_0095707
2123 Ga0495635_0295003
2124 Ga0495588_0036807
2125 Ga0495599_0001135
2126 Ga0495599_0009382
2127 Ga0495647_0006990
2128 Ga0495613_0046804
2129 Ga0495613_0170907
2130 Ga0495624_0024079
2131 Ga0495624_0036628
2132 Ga0495671_0079439
2133 Ga0495649_0000717
2134 Ga0495589_0031839
2135 Ga0495600_0003010
2136 Ga0495604_0233443
2137 Ga0495636_0001523
2138 Ga0495636_0020026
2139 Ga0495674_0031602
2140 Ga0495674_0072401
2141 Ga0495676_0172993
2142 Ga0495687_000961
2143 Ga0495687_014525
2144 Ga0495675_0005144
2145 Ga0495686_0017654
2146 Ga0495686_0027994
2147 Ga0496101_0055131
2148 Ga0496101_0105707
2149 Ga0496102_0005909
2150 Ga0496102_0026996
2151 Ga0496102_0316078
2152 Ga0496106_0019322
2153 Ga0496106_0042660
2154 Ga0496106_0194782
2155 Ga0496106_0367134
2156 Ga0496107_0031338
2157 Ga0496108_0074417
2158 Ga0496108_0182821
2159 Ga0496109_0061056
2160 Ga0496109_0529868
2161 Ga0496110_0337753
2162 Ga0496111_0076961
2163 Ga0496112_0129906
2164 Ga0496112_0223801
2165 Ga0496113_0028039
2166 Ga0496114_0041873
2167 Ga0496114_0210270
2168 Ga0496114_0342276
2169 Ga0496116_0015211
2170 Ga0496117_0042591
2171 Ga0496118_0007545
2172 Ga0496122_0000184
2173 Ga0496123_0000181
2174 Ga0496123_0089861
2175 Ga0496125_0045844
2176 Ga0501294_007176
2177 Ga0501031_0001313
2178 Ga0501032_0260328
2179 Ga0501033_0076965
2180 Ga0501040_0007443
2181 Ga0501041_0024372
2182 Ga0501043_0000057
2183 Ga0501046_0000075
2184 Ga0501046_0052371
2185 Ga0501047_0000081
2186 Ga0501047_0032891
2187 Ga0501067_0048159
2188 Ga0501070_0257021
2189 Ga0501075_0252531
2190 Ga0501076_0082527
2191 Ga0501198_000012
2192 Ga0501199_001320
2193 Ga0501209_000016
2194 Ga0501211_001645
2195 Ga0501222_000010
2196 Ga0501235_003731
2197 Ga0501253_001974
2198 Ga0501258_000834
2199 Ga0501259_023966
2200 Ga0501079_0195468
2201 Ga0501080_0005085
2202 Ga0501081_0024872
2203 Ga0501262_000007
2204 Ga0501267_000181
2205 Ga0501035_0207404
2206 Ga0501044_0179283
2207 Ga0501045_0002738
2208 Ga0501045_0095581
2209 nmdc:mga03683_36973_c1
2210 nmdc:mga03683_3849_c2
2211 nmdc:mga03n38_18316_c1
2212 nmdc:mga0yw44_1657_c1
2213 nmdc:mga0yw44_57447_c1
2214 nmdc:mga0k408_161_c1
2215 nmdc:mga0k408_21583_c1
2216 nmdc:mga0k408_37719_c2
2217 nmdc:mga0k408_4724_c1
2218 nmdc:mga0k408_8075_c1
2219 nmdc:mga06z11_36846_c1
2220 nmdc:mga06z11_95353_c1
2221 nmdc:mga07m45_125038_c1
2222 nmdc:mga07m45_135625_c1
2223 nmdc:mga07m45_1699_c1
2224 nmdc:mga07m45_22960_c1
2225 nmdc:mga07m45_25520_c1
2226 nmdc:mga07m45_31264_c1
2227 nmdc:mga07m45_34873_c1
2228 nmdc:mga07m45_3881_c1
2229 nmdc:mga07m45_68660_c1
2230 nmdc:mga07m45_73628_c1
2231 nmdc:mga07m45_8129_c1
2232 nmdc:mga09592_3580_c1
2233 nmdc:mga09592_69130_c1
2234 nmdc:mga0qj67_4254_c1
2235 nmdc:mga0qj67_82221_c1
2236 nmdc:mga0n895_42645_c1
2237 nmdc:mga08x19_146818_c1
2238 nmdc:mga0sz30_147037_c1
2239 nmdc:mga0sz30_22715_c1
2240 Ga0500635_0000011
2241 Ga0495595_0004261
2242 Ga0500578_0000363
2243 Ga0500644_0002532
2244 Ga0500651_0000030
2245 Ga0500593_000526
2246 Ga0500607_000706
2247 Ga0500608_001067
2248 Ga0500652_001558
2249 Ga0500658_0001860
2250 Ga0500658_0001896
2251 Ga0500559_0000019
2252 Ga0500568_0005487
2253 Ga0500568_0016465
2254 Ga0500574_005109
2255 Ga0500577_0003064
2256 Ga0500604_0039163
2257 Ga0500616_0072500
2258 Ga0500622_0000011
2259 Ga0500622_0000332
2260 Ga0500622_0003170
2261 Ga0500622_0021036
2262 Ga0500645_000061
2263 Ga0500645_000257
2264 Ga0466962_0023386
2265 2511242515
2266 2513231871
2267 2526211927
2268 2548499320
2269 2548848754
2270 2587724940
2271 2587731693
2272 2587754183
2273 2588292442
2274 2599621035
2275 2599674159
2276 2599678349
2277 2599690546
2278 2643743740
2279 2643866152
2280 2643936510
2281 2643968178
2282 2643994140
2283 2644057633
2284 2644072279
2285 2644142466
2286 2644161230
2287 2644222347
2288 2644247009
2289 2644256361
2290 2644277035
2291 2644292965
2292 2644301360
2293 2644317866
2294 2644325724
2295 2644340867
2296 2644400890
2297 2644466128
2298 2644647981
2299 2722885827
2300 2738723058
2301 2738882485
2302 2739058398
2303 2739241906
2304 2739251815
2305 2739283789
2306 2816470792
2307 2819602696
2308 2831270007
2309 2831869077
2310 2838054996
2311 2839144053
2312 2842681163
2313 2842718360
2314 2842737405
2315 2842749847
2316 2881103475
2317 2885196542
2318 2885202013
2319 2885215277
2320 2886850368
2321 2894023942
2322 2899927074
2323 2904454139
2324 2904462004
2325 2904479453
2326 2904545940
2327 2919465263
2328 2919706781
2329 2928043922
2330 2928048570
2331 2928054892
2332 2928068332
2333 2928073770
2334 2928086028
2335 2928118362
2336 2929161135
2337 2929521870
2338 2932423250
2339 2939635817
2340 2945914387
2341 2945949917
2342 2945973937
2343 2945990218
2344 2954770478
2345 2974320677
2346 2990714206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

77

320

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2buf-assembly2.cif.gz_H arginine feed-back inhibitable acetylglutamate kinase 0.9598 11 294
2v5h-assembly1.cif.gz_D controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 0.9595 12 295
2buf-assembly1.cif.gz_D arginine feed-back inhibitable acetylglutamate kinase 0.9547 8 295
2buf-assembly2.cif.gz_I arginine feed-back inhibitable acetylglutamate kinase 0.9542 9 295
2buf-assembly2.cif.gz_J arginine feed-back inhibitable acetylglutamate kinase 0.9534 11 295
ID Description Score Start End Superfamily
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9596 12 295 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9531 8 295 3.40.1160.10
1uvdA00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9495 9 297 3.40.1160.10
af_Q2G1H6_1_252_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9419 30 294 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9339 8 295 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A3B9L877-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) 0.993 66 297 GO:0003991
GO:0005524
GO:0005737
GO:0006526
AF-A0A3D1CJ80-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9917 183 295 GO:0003991
GO:0005524
GO:0006526
AF-A0A1W1CNB7-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) 0.9895 41 295 GO:0003991
GO:0005524
GO:0005737
GO:0006526
AF-A0A534WVP5-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9894 8 295 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A3B9L877-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) 0.9887 66 297 GO:0003991
GO:0005524
GO:0005737
GO:0006526

Map