F491237
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1175 | 430 | 2350 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100642713|Ga0068862_1006427132 |
| Length | 110 |
| Sequence | MAKAKKQAAQGVVDISHYDVILSPHITEKSTLLSEHNAVVFKVAREATKPQIKAAVEALFGVAVTGVNTITQKGKTKRWKGRPYKRSDSKKAIVTLAEGQSIDVTEGARG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 91 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 123 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 214 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 226 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 237 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 238 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 240 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 241 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 242 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 243 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 246 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 247 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 248 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 249 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 250 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 251 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 252 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 253 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 254 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 255 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 256 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 257 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 266 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 364 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 370 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 371 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 372 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 373 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 375 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 376 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 378 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 381 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 385 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 391 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 392 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 393 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 394 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 395 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 396 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 398 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 402 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 406 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 409 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 421 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 422 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 423 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 424 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 425 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 426 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 427 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 428 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 429 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 430 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.87 |
| Metatranscriptomes | 5.28 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4 |
| Nodule | 0.26 |
| Rhizoplane | 1.36 |
| Rhizosphere | 89.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068862_100642713 | 3300005844 | Bacteria | 1023 |
| 2 | SwRhRL2b_contig_1707570 | 2162886007 | Bacteria | 1694 |
| 3 | SwRhRL2b_contig_308716 | 2162886007 | Bacteria | 918 |
| 4 | SwRhRL2b_contig_373569 | 2162886007 | Bacteria | 900 |
| 5 | JGI24736J21556_1000017 | 3300001904 | Bacteria | 28475 |
| 6 | JGI24736J21556_1000244 | 3300001904 | Bacteria | 9911 |
| 7 | JGI24736J21556_1020976 | 3300001904 | Bacteria | 1025 |
| 8 | JGI24736J21556_1022190 | 3300001904 | Bacteria | 994 |
| 9 | JGI24741J21665_1016662 | 3300001915 | Bacteria | 1197 |
| 10 | JGI24752J21851_1000810 | 3300001976 | Bacteria | 4211 |
| 11 | JGI24740J21852_10008905 | 3300001979 | Bacteria | 3967 |
| 12 | JGI24740J21852_10008925 | 3300001979 | Bacteria | 3963 |
| 13 | JGI24740J21852_10115295 | 3300001979 | Bacteria | 675 |
| 14 | JGI24740J21852_10142843 | 3300001979 | Bacteria | 595 |
| 15 | JGI24739J22299_10017509 | 3300001989 | Bacteria | 2585 |
| 16 | JGI24739J22299_10026040 | 3300001989 | Bacteria | 2055 |
| 17 | JGI24739J22299_10029465 | 3300001989 | Bacteria | 1908 |
| 18 | JGI24739J22299_10065973 | 3300001989 | Bacteria | 1134 |
| 19 | JGI24737J22298_10010075 | 3300001990 | Bacteria | 3131 |
| 20 | JGI24737J22298_10027704 | 3300001990 | Bacteria | 1785 |
| 21 | JGI24737J22298_10057940 | 3300001990 | Bacteria | 1169 |
| 22 | JGI24737J22298_10092202 | 3300001990 | Bacteria | 898 |
| 23 | JGI24737J22298_10104394 | 3300001990 | Bacteria | 839 |
| 24 | JGI24737J22298_10142305 | 3300001990 | Bacteria | 708 |
| 25 | JGI24735J21928_10003396 | 3300002067 | Bacteria | 5432 |
| 26 | JGI24735J21928_10022535 | 3300002067 | Bacteria | 1916 |
| 27 | JGI24750J21931_1028129 | 3300002070 | Bacteria | 815 |
| 28 | JGI24738J21930_10002167 | 3300002075 | Bacteria | 5226 |
| 29 | JGI24738J21930_10013156 | 3300002075 | Bacteria | 1794 |
| 30 | JGI24738J21930_10035086 | 3300002075 | Bacteria | 1021 |
| 31 | JGI24749J21850_1000052 | 3300002076 | Bacteria | 22270 |
| 32 | JGI24749J21850_1001152 | 3300002076 | Bacteria | 3752 |
| 33 | JGI24034J26672_10002744 | 3300002239 | Bacteria | 2430 |
| 34 | JGI24034J26672_10009328 | 3300002239 | Bacteria | 1446 |
| 35 | JGI24751J29686_10000325 | 3300002459 | Bacteria | 17611 |
| 36 | Ga0055530_10027359 | 3300003791 | Bacteria | 1559 |
| 37 | JGI25405J52794_10005009 | 3300003911 | Bacteria | 2376 |
| 38 | Ga0058861_12019348 | 3300004800 | Bacteria | 2352 |
| 39 | Ga0058862_12510110 | 3300004803 | Bacteria | 535 |
| 40 | Ga0065704_10009321 | 3300005289 | Bacteria | 3045 |
| 41 | Ga0065704_10133643 | 3300005289 | Bacteria | 1598 |
| 42 | Ga0065704_10158827 | 3300005289 | Bacteria | 1370 |
| 43 | Ga0065712_10044080 | 3300005290 | Bacteria | 906 |
| 44 | Ga0065712_10520019 | 3300005290 | Bacteria | 636 |
| 45 | Ga0065715_10090134 | 3300005293 | Bacteria | 7598 |
| 46 | Ga0065715_10392675 | 3300005293 | Bacteria | 892 |
| 47 | Ga0065715_10446466 | 3300005293 | Bacteria | 830 |
| 48 | Ga0065715_10617514 | 3300005293 | Bacteria | 697 |
| 49 | Ga0065707_10007537 | 3300005295 | Bacteria | 4124 |
| 50 | Ga0065707_10108385 | 3300005295 | Bacteria | 2512 |
| 51 | Ga0065707_10186565 | 3300005295 | Bacteria | 1385 |
| 52 | Ga0065707_10385618 | 3300005295 | Bacteria | 871 |
| 53 | Ga0065707_10426403 | 3300005295 | Bacteria | 825 |
| 54 | Ga0070658_10000172 | 3300005327 | Bacteria | 56478 |
| 55 | Ga0070658_10000808 | 3300005327 | Bacteria | 26765 |
| 56 | Ga0070658_10026506 | 3300005327 | Bacteria | 4650 |
| 57 | Ga0070658_10034387 | 3300005327 | Bacteria | 4078 |
| 58 | Ga0070658_10147154 | 3300005327 | Bacteria | 1970 |
| 59 | Ga0070658_10151735 | 3300005327 | Bacteria | 1940 |
| 60 | Ga0070658_10181443 | 3300005327 | Bacteria | 1771 |
| 61 | Ga0070658_10414802 | 3300005327 | Bacteria | 1157 |
| 62 | Ga0070658_10660111 | 3300005327 | Bacteria | 907 |
| 63 | Ga0070658_10693818 | 3300005327 | Bacteria | 883 |
| 64 | Ga0070658_10747047 | 3300005327 | Bacteria | 849 |
| 65 | Ga0070658_10772191 | 3300005327 | Bacteria | 835 |
| 66 | Ga0070676_10056397 | 3300005328 | Bacteria | 2321 |
| 67 | Ga0070683_100222804 | 3300005329 | Bacteria | 1792 |
| 68 | Ga0070683_100711606 | 3300005329 | Bacteria | 962 |
| 69 | Ga0070690_101245132 | 3300005330 | Bacteria | 595 |
| 70 | Ga0070670_100002763 | 3300005331 | Bacteria | 14500 |
| 71 | Ga0070670_100024275 | 3300005331 | Bacteria | 5215 |
| 72 | Ga0070670_100077325 | 3300005331 | Bacteria | 2860 |
| 73 | Ga0070670_100214326 | 3300005331 | Bacteria | 1674 |
| 74 | Ga0070670_100289018 | 3300005331 | Bacteria | 1432 |
| 75 | Ga0070670_100714672 | 3300005331 | Bacteria | 901 |
| 76 | Ga0070670_100938123 | 3300005331 | Bacteria | 785 |
| 77 | Ga0070670_101076645 | 3300005331 | Bacteria | 733 |
| 78 | Ga0070677_10012449 | 3300005333 | Bacteria | 2954 |
| 79 | Ga0070677_10216068 | 3300005333 | Bacteria | 934 |
| 80 | Ga0070677_10486318 | 3300005333 | Bacteria | 667 |
| 81 | Ga0068869_100534986 | 3300005334 | Bacteria | 982 |
| 82 | Ga0068869_102104140 | 3300005334 | Bacteria | 507 |
| 83 | Ga0070666_10001221 | 3300005335 | Bacteria | 15513 |
| 84 | Ga0070666_10141818 | 3300005335 | Bacteria | 1674 |
| 85 | Ga0070680_100033523 | 3300005336 | Bacteria | 4141 |
| 86 | Ga0070680_100069525 | 3300005336 | Bacteria | 2891 |
| 87 | Ga0070680_100284036 | 3300005336 | Bacteria | 1402 |
| 88 | Ga0070680_100666478 | 3300005336 | Bacteria | 894 |
| 89 | Ga0070682_100708565 | 3300005337 | Bacteria | 808 |
| 90 | Ga0070682_101045239 | 3300005337 | Bacteria | 680 |
| 91 | Ga0070682_102089921 | 3300005337 | Bacteria | 500 |
| 92 | Ga0068868_100063445 | 3300005338 | Bacteria | 2930 |
| 93 | Ga0070660_100023993 | 3300005339 | Bacteria | 4523 |
| 94 | Ga0070660_100028806 | 3300005339 | Bacteria | 4158 |
| 95 | Ga0070660_100038292 | 3300005339 | Bacteria | 3640 |
| 96 | Ga0070660_100057901 | 3300005339 | Bacteria | 3003 |
| 97 | Ga0070660_100060466 | 3300005339 | Bacteria | 2940 |
| 98 | Ga0070660_100076515 | 3300005339 | Bacteria | 2621 |
| 99 | Ga0070660_100307521 | 3300005339 | Bacteria | 1300 |
| 100 | Ga0070660_101878046 | 3300005339 | Bacteria | 510 |
| 101 | Ga0070691_10670371 | 3300005341 | Bacteria | 619 |
| 102 | Ga0070661_100016703 | 3300005344 | Bacteria | 5194 |
| 103 | Ga0070661_100041801 | 3300005344 | Bacteria | 3345 |
| 104 | Ga0070661_100083669 | 3300005344 | Bacteria | 2357 |
| 105 | Ga0070661_100156151 | 3300005344 | Bacteria | 1726 |
| 106 | Ga0070661_100185779 | 3300005344 | Bacteria | 1583 |
| 107 | Ga0070661_100267229 | 3300005344 | Bacteria | 1324 |
| 108 | Ga0070661_100281828 | 3300005344 | Bacteria | 1289 |
| 109 | Ga0070661_100485118 | 3300005344 | Bacteria | 987 |
| 110 | Ga0070661_100960141 | 3300005344 | Bacteria | 707 |
| 111 | Ga0070661_101572159 | 3300005344 | Bacteria | 556 |
| 112 | Ga0070692_10038561 | 3300005345 | Bacteria | 2436 |
| 113 | Ga0070692_10050904 | 3300005345 | Bacteria | 2153 |
| 114 | Ga0070692_10224230 | 3300005345 | Bacteria | 1112 |
| 115 | Ga0070668_100000831 | 3300005347 | Bacteria | 21324 |
| 116 | Ga0070668_100046306 | 3300005347 | Bacteria | 3339 |
| 117 | Ga0070668_100051441 | 3300005347 | Bacteria | 3174 |
| 118 | Ga0070668_100143128 | 3300005347 | Bacteria | 1928 |
| 119 | Ga0070668_101096050 | 3300005347 | Bacteria | 718 |
| 120 | Ga0070669_100000096 | 3300005353 | Bacteria | 86930 |
| 121 | Ga0070669_100002856 | 3300005353 | Bacteria | 12479 |
| 122 | Ga0070669_100033975 | 3300005353 | Bacteria | 3691 |
| 123 | Ga0070669_100268035 | 3300005353 | Bacteria | 1364 |
| 124 | Ga0070669_100497699 | 3300005353 | Bacteria | 1011 |
| 125 | Ga0070669_101999198 | 3300005353 | Bacteria | 507 |
| 126 | Ga0070675_100021317 | 3300005354 | Bacteria | 5177 |
| 127 | Ga0070675_100069477 | 3300005354 | Bacteria | 2918 |
| 128 | Ga0070675_101077801 | 3300005354 | Bacteria | 738 |
| 129 | Ga0070671_100000045 | 3300005355 | Bacteria | 85779 |
| 130 | Ga0070671_100002671 | 3300005355 | Bacteria | 13821 |
| 131 | Ga0070671_100075015 | 3300005355 | Bacteria | 2825 |
| 132 | Ga0070671_100089401 | 3300005355 | Bacteria | 2578 |
| 133 | Ga0070671_100222605 | 3300005355 | Bacteria | 1601 |
| 134 | Ga0070674_100070716 | 3300005356 | Bacteria | 2466 |
| 135 | Ga0070673_100034662 | 3300005364 | Bacteria | 3821 |
| 136 | Ga0070673_100948209 | 3300005364 | Bacteria | 799 |
| 137 | Ga0070673_101360880 | 3300005364 | Bacteria | 667 |
| 138 | Ga0070659_100016977 | 3300005366 | Bacteria | 5471 |
| 139 | Ga0070659_100024658 | 3300005366 | Bacteria | 4613 |
| 140 | Ga0070659_100121318 | 3300005366 | Bacteria | 2117 |
| 141 | Ga0070659_100166032 | 3300005366 | Bacteria | 1806 |
| 142 | Ga0070659_100331646 | 3300005366 | Bacteria | 1273 |
| 143 | Ga0070659_100606645 | 3300005366 | Bacteria | 941 |
| 144 | Ga0070659_100808624 | 3300005366 | Bacteria | 815 |
| 145 | Ga0070659_100830908 | 3300005366 | Bacteria | 804 |
| 146 | Ga0070659_101866823 | 3300005366 | Bacteria | 539 |
| 147 | Ga0070659_102134472 | 3300005366 | Bacteria | 504 |
| 148 | Ga0070667_100003534 | 3300005367 | Bacteria | 13313 |
| 149 | Ga0070667_100052979 | 3300005367 | Bacteria | 3424 |
| 150 | Ga0070667_100092578 | 3300005367 | Bacteria | 2601 |
| 151 | Ga0070667_100125062 | 3300005367 | Bacteria | 2240 |
| 152 | Ga0070667_100305375 | 3300005367 | Bacteria | 1433 |
| 153 | Ga0070701_10139054 | 3300005438 | Bacteria | 1387 |
| 154 | Ga0070701_10953549 | 3300005438 | Bacteria | 596 |
| 155 | Ga0070705_100025314 | 3300005440 | Bacteria | 3216 |
| 156 | Ga0070705_100127772 | 3300005440 | Bacteria | 1653 |
| 157 | Ga0070700_100559087 | 3300005441 | Bacteria | 890 |
| 158 | Ga0070708_100101983 | 3300005445 | Bacteria | 2629 |
| 159 | Ga0070663_100058865 | 3300005455 | Bacteria | 2760 |
| 160 | Ga0070663_100063578 | 3300005455 | Bacteria | 2665 |
| 161 | Ga0070663_100253556 | 3300005455 | Bacteria | 1393 |
| 162 | Ga0070663_100380493 | 3300005455 | Bacteria | 1149 |
| 163 | Ga0070663_100388964 | 3300005455 | Bacteria | 1137 |
| 164 | Ga0070663_100838437 | 3300005455 | Bacteria | 790 |
| 165 | Ga0070678_100042212 | 3300005456 | Bacteria | 3240 |
| 166 | Ga0070662_100005957 | 3300005457 | Bacteria | 7819 |
| 167 | Ga0070662_100138242 | 3300005457 | Bacteria | 1885 |
| 168 | Ga0070662_100163343 | 3300005457 | Bacteria | 1743 |
| 169 | Ga0070662_100188525 | 3300005457 | Bacteria | 1629 |
| 170 | Ga0070662_100373351 | 3300005457 | Bacteria | 1172 |
| 171 | Ga0070662_100472094 | 3300005457 | Bacteria | 1043 |
| 172 | Ga0070662_100496502 | 3300005457 | Bacteria | 1017 |
| 173 | Ga0070662_101107281 | 3300005457 | Bacteria | 679 |
| 174 | Ga0070662_101213121 | 3300005457 | Bacteria | 649 |
| 175 | Ga0070681_10088688 | 3300005458 | Bacteria | 3045 |
| 176 | Ga0070681_10177121 | 3300005458 | Bacteria | 2054 |
| 177 | Ga0070681_11264566 | 3300005458 | Bacteria | 660 |
| 178 | Ga0068867_100088936 | 3300005459 | Bacteria | 2342 |
| 179 | Ga0070685_10338871 | 3300005466 | Bacteria | 1025 |
| 180 | Ga0070679_100000873 | 3300005530 | Bacteria | 26175 |
| 181 | Ga0070679_100272454 | 3300005530 | Bacteria | 1646 |
| 182 | Ga0070679_100464363 | 3300005530 | Bacteria | 1210 |
| 183 | Ga0070679_100500972 | 3300005530 | Bacteria | 1158 |
| 184 | Ga0070679_100542586 | 3300005530 | Bacteria | 1106 |
| 185 | Ga0070679_100559293 | 3300005530 | Bacteria | 1087 |
| 186 | Ga0070679_100732699 | 3300005530 | Bacteria | 931 |
| 187 | Ga0070684_100279436 | 3300005535 | Bacteria | 1529 |
| 188 | Ga0070684_101940564 | 3300005535 | Bacteria | 556 |
| 189 | Ga0068853_100000960 | 3300005539 | Bacteria | 20266 |
| 190 | Ga0068853_100075015 | 3300005539 | Bacteria | 2951 |
| 191 | Ga0068853_100107432 | 3300005539 | Bacteria | 2474 |
| 192 | Ga0068853_100404879 | 3300005539 | Bacteria | 1277 |
| 193 | Ga0068853_101643023 | 3300005539 | Bacteria | 623 |
| 194 | Ga0070672_100034217 | 3300005543 | Bacteria | 3855 |
| 195 | Ga0070672_100089112 | 3300005543 | Bacteria | 2485 |
| 196 | Ga0070672_100623524 | 3300005543 | Bacteria | 941 |
| 197 | Ga0070695_101717119 | 3300005545 | Bacteria | 526 |
| 198 | Ga0070665_100001143 | 3300005548 | Bacteria | 32613 |
| 199 | Ga0070665_100277766 | 3300005548 | Bacteria | 1677 |
| 200 | Ga0070665_102140465 | 3300005548 | Bacteria | 564 |
| 201 | Ga0068855_100116496 | 3300005563 | Bacteria | 3062 |
| 202 | Ga0068855_100367274 | 3300005563 | Bacteria | 1582 |
| 203 | Ga0068855_100378198 | 3300005563 | Bacteria | 1555 |
| 204 | Ga0068855_101604438 | 3300005563 | Bacteria | 665 |
| 205 | Ga0068855_101834455 | 3300005563 | Bacteria | 615 |
| 206 | Ga0070664_100071016 | 3300005564 | Bacteria | 2983 |
| 207 | Ga0070664_100288384 | 3300005564 | Bacteria | 1481 |
| 208 | Ga0070664_100498178 | 3300005564 | Bacteria | 1122 |
| 209 | Ga0070664_100616986 | 3300005564 | Bacteria | 1006 |
| 210 | Ga0070664_100919590 | 3300005564 | Bacteria | 820 |
| 211 | Ga0070664_100944155 | 3300005564 | Bacteria | 809 |
| 212 | Ga0070664_101361903 | 3300005564 | Bacteria | 670 |
| 213 | Ga0070664_102386190 | 3300005564 | Bacteria | 501 |
| 214 | Ga0068857_100128809 | 3300005577 | Bacteria | 2282 |
| 215 | Ga0068857_100222421 | 3300005577 | Bacteria | 1725 |
| 216 | Ga0068857_100232146 | 3300005577 | Bacteria | 1687 |
| 217 | Ga0068857_100234824 | 3300005577 | Bacteria | 1678 |
| 218 | Ga0068857_100755108 | 3300005577 | Bacteria | 927 |
| 219 | Ga0068857_101036775 | 3300005577 | Bacteria | 790 |
| 220 | Ga0068857_101125820 | 3300005577 | Bacteria | 758 |
| 221 | Ga0068854_100290859 | 3300005578 | Bacteria | 1318 |
| 222 | Ga0068854_100315773 | 3300005578 | Bacteria | 1268 |
| 223 | Ga0068854_100440919 | 3300005578 | Bacteria | 1085 |
| 224 | Ga0068854_101826752 | 3300005578 | Bacteria | 557 |
| 225 | Ga0068856_100272871 | 3300005614 | Bacteria | 1707 |
| 226 | Ga0068856_100450706 | 3300005614 | Bacteria | 1307 |
| 227 | Ga0068856_100464472 | 3300005614 | Bacteria | 1286 |
| 228 | Ga0068856_100527026 | 3300005614 | Bacteria | 1202 |
| 229 | Ga0068856_100975530 | 3300005614 | Bacteria | 866 |
| 230 | Ga0070702_100249413 | 3300005615 | Bacteria | 1202 |
| 231 | Ga0070702_100808329 | 3300005615 | Bacteria | 726 |
| 232 | Ga0068852_100085271 | 3300005616 | Bacteria | 2814 |
| 233 | Ga0068852_100090864 | 3300005616 | Bacteria | 2731 |
| 234 | Ga0068852_100384355 | 3300005616 | Bacteria | 1378 |
| 235 | Ga0068852_100435529 | 3300005616 | Bacteria | 1295 |
| 236 | Ga0068852_100446513 | 3300005616 | Bacteria | 1279 |
| 237 | Ga0068852_100458987 | 3300005616 | Bacteria | 1262 |
| 238 | Ga0068852_100602980 | 3300005616 | Bacteria | 1102 |
| 239 | Ga0068852_101611652 | 3300005616 | Bacteria | 671 |
| 240 | Ga0068852_101731395 | 3300005616 | Bacteria | 647 |
| 241 | Ga0068852_101943250 | 3300005616 | Bacteria | 610 |
| 242 | Ga0068852_101974323 | 3300005616 | Bacteria | 606 |
| 243 | Ga0068852_102017798 | 3300005616 | Bacteria | 599 |
| 244 | Ga0068859_100000162 | 3300005617 | Bacteria | 65033 |
| 245 | Ga0068859_100003314 | 3300005617 | Bacteria | 16364 |
| 246 | Ga0068859_100006387 | 3300005617 | Bacteria | 11959 |
| 247 | Ga0068859_100056194 | 3300005617 | Bacteria | 3960 |
| 248 | Ga0068859_100197558 | 3300005617 | Bacteria | 2096 |
| 249 | Ga0068859_100355516 | 3300005617 | Bacteria | 1560 |
| 250 | Ga0068864_100000677 | 3300005618 | Bacteria | 28506 |
| 251 | Ga0068864_100002491 | 3300005618 | Bacteria | 15219 |
| 252 | Ga0068864_100014199 | 3300005618 | Bacteria | 6612 |
| 253 | Ga0068864_100188944 | 3300005618 | Bacteria | 1887 |
| 254 | Ga0068864_102418338 | 3300005618 | Bacteria | 532 |
| 255 | Ga0068866_10990043 | 3300005718 | Bacteria | 597 |
| 256 | Ga0068866_11025973 | 3300005718 | Bacteria | 587 |
| 257 | Ga0068861_100001385 | 3300005719 | Bacteria | 15218 |
| 258 | Ga0068861_100002700 | 3300005719 | Bacteria | 11613 |
| 259 | Ga0068861_100248927 | 3300005719 | Bacteria | 1515 |
| 260 | Ga0068861_101504408 | 3300005719 | Bacteria | 661 |
| 261 | Ga0068870_10187152 | 3300005840 | Bacteria | 1247 |
| 262 | Ga0068863_100000017 | 3300005841 | Bacteria | 207950 |
| 263 | Ga0068863_100000784 | 3300005841 | Bacteria | 31931 |
| 264 | Ga0068863_100021286 | 3300005841 | Bacteria | 6189 |
| 265 | Ga0068863_100084537 | 3300005841 | Bacteria | 3007 |
| 266 | Ga0068863_100109631 | 3300005841 | Bacteria | 2628 |
| 267 | Ga0068858_100004068 | 3300005842 | Bacteria | 14403 |
| 268 | Ga0068858_100363754 | 3300005842 | Bacteria | 1387 |
| 269 | Ga0068858_100488747 | 3300005842 | Bacteria | 1188 |
| 270 | Ga0068858_101405465 | 3300005842 | Bacteria | 687 |
| 271 | Ga0068860_100028664 | 3300005843 | Bacteria | 5359 |
| 272 | Ga0068860_100059055 | 3300005843 | Bacteria | 3647 |
| 273 | Ga0068860_100159782 | 3300005843 | Bacteria | 2172 |
| 274 | Ga0068860_100307284 | 3300005843 | Bacteria | 1555 |
| 275 | Ga0068860_100309619 | 3300005843 | Bacteria | 1548 |
| 276 | Ga0068862_100000032 | 3300005844 | Bacteria | 179887 |
| 277 | Ga0068862_100000126 | 3300005844 | Bacteria | 89210 |
| 278 | Ga0068862_100001411 | 3300005844 | Bacteria | 22262 |
| 279 | Ga0068862_100037303 | 3300005844 | Bacteria | 4119 |
| 280 | Ga0068862_100183079 | 3300005844 | Bacteria | 1881 |
| 281 | Ga0068862_100254494 | 3300005844 | Bacteria | 1601 |
| 282 | Ga0068862_100403349 | 3300005844 | Bacteria | 1279 |
| 283 | Ga0068862_100517794 | 3300005844 | Bacteria | 1135 |
| 284 | Ga0068862_100740357 | 3300005844 | Bacteria | 955 |
| 285 | Ga0081455_10000215 | 3300005937 | Bacteria | 73808 |
| 286 | Ga0081539_10024226 | 3300005985 | Bacteria | 3945 |
| 287 | Ga0075363_100000592 | 3300006048 | Bacteria | 11936 |
| 288 | Ga0075364_10039797 | 3300006051 | Bacteria | 3048 |
| 289 | Ga0075362_10000383 | 3300006177 | Bacteria | 12678 |
| 290 | Ga0075367_10034804 | 3300006178 | Bacteria | 2912 |
| 291 | Ga0075369_10007430 | 3300006186 | Bacteria | 4172 |
| 292 | Ga0075369_10207627 | 3300006186 | Bacteria | 905 |
| 293 | Ga0075366_10044214 | 3300006195 | Bacteria | 2639 |
| 294 | Ga0075366_10251147 | 3300006195 | Bacteria | 1079 |
| 295 | Ga0075366_10482922 | 3300006195 | Bacteria | 765 |
| 296 | Ga0075370_10385755 | 3300006353 | Bacteria | 839 |
| 297 | Ga0068871_101615763 | 3300006358 | Bacteria | 614 |
| 298 | Ga0075429_101202087 | 3300006880 | Bacteria | 662 |
| 299 | Ga0068865_101513032 | 3300006881 | Bacteria | 602 |
| 300 | Ga0097620_100000162 | 3300006931 | Bacteria | 65033 |
| 301 | Ga0097620_100003314 | 3300006931 | Bacteria | 16364 |
| 302 | Ga0097620_100006388 | 3300006931 | Bacteria | 11959 |
| 303 | Ga0097620_100056192 | 3300006931 | Bacteria | 3960 |
| 304 | Ga0097620_100197562 | 3300006931 | Bacteria | 2096 |
| 305 | Ga0097620_100355530 | 3300006931 | Bacteria | 1560 |
| 306 | Ga0079104_1061406 | 3300006946 | Bacteria | 809 |
| 307 | Ga0099826_10515445 | 3300006948 | Bacteria | 556 |
| 308 | Ga0105251_10119144 | 3300009011 | Bacteria | 1199 |
| 309 | Ga0105250_10006758 | 3300009092 | Bacteria | 4981 |
| 310 | Ga0105250_10090725 | 3300009092 | Bacteria | 1242 |
| 311 | Ga0105240_10183433 | 3300009093 | Bacteria | 2468 |
| 312 | Ga0105240_10327247 | 3300009093 | Bacteria | 1745 |
| 313 | Ga0105240_10663942 | 3300009093 | Bacteria | 1141 |
| 314 | Ga0105240_11725974 | 3300009093 | Bacteria | 653 |
| 315 | Ga0105240_11889769 | 3300009093 | Bacteria | 621 |
| 316 | Ga0111539_10400226 | 3300009094 | Bacteria | 1599 |
| 317 | Ga0111539_10675436 | 3300009094 | Bacteria | 1203 |
| 318 | Ga0111539_12147524 | 3300009094 | Bacteria | 648 |
| 319 | Ga0105247_10030286 | 3300009101 | Bacteria | 3280 |
| 320 | Ga0105247_10832572 | 3300009101 | Bacteria | 707 |
| 321 | Ga0105247_11057356 | 3300009101 | Bacteria | 638 |
| 322 | Ga0114129_12365235 | 3300009147 | Bacteria | 637 |
| 323 | Ga0105243_10078256 | 3300009148 | Bacteria | 2692 |
| 324 | Ga0105241_10189845 | 3300009174 | Bacteria | 1710 |
| 325 | Ga0105241_10739862 | 3300009174 | Bacteria | 901 |
| 326 | Ga0105241_10858753 | 3300009174 | Bacteria | 840 |
| 327 | Ga0105241_11100455 | 3300009174 | Bacteria | 748 |
| 328 | Ga0105248_10012645 | 3300009177 | Bacteria | 9314 |
| 329 | Ga0105248_10052852 | 3300009177 | Bacteria | 4559 |
| 330 | Ga0105248_10065663 | 3300009177 | Bacteria | 4074 |
| 331 | Ga0105248_10293477 | 3300009177 | Bacteria | 1831 |
| 332 | Ga0105248_10434374 | 3300009177 | Bacteria | 1479 |
| 333 | Ga0105248_11342716 | 3300009177 | Bacteria | 809 |
| 334 | Ga0105248_11346039 | 3300009177 | Bacteria | 808 |
| 335 | Ga0105248_12240059 | 3300009177 | Bacteria | 622 |
| 336 | Ga0105237_10136651 | 3300009545 | Bacteria | 2446 |
| 337 | Ga0105238_10200701 | 3300009551 | Bacteria | 1970 |
| 338 | Ga0105238_10324005 | 3300009551 | Bacteria | 1527 |
| 339 | Ga0105238_10461795 | 3300009551 | Bacteria | 1268 |
| 340 | Ga0105238_10512303 | 3300009551 | Bacteria | 1202 |
| 341 | Ga0105238_11085613 | 3300009551 | Bacteria | 823 |
| 342 | Ga0105238_11187354 | 3300009551 | Bacteria | 787 |
| 343 | Ga0105238_11405512 | 3300009551 | Bacteria | 725 |
| 344 | Ga0105238_11623408 | 3300009551 | Bacteria | 677 |
| 345 | Ga0105249_10000017 | 3300009553 | Bacteria | 277115 |
| 346 | Ga0105249_10001061 | 3300009553 | Bacteria | 24372 |
| 347 | Ga0105249_10198131 | 3300009553 | Bacteria | 1964 |
| 348 | Ga0105249_10295869 | 3300009553 | Bacteria | 1622 |
| 349 | Ga0105249_10829669 | 3300009553 | Bacteria | 989 |
| 350 | Ga0105249_13066452 | 3300009553 | Bacteria | 537 |
| 351 | Ga0105239_10643434 | 3300010375 | Bacteria | 1211 |
| 352 | Ga0105239_11355486 | 3300010375 | Bacteria | 821 |
| 353 | Ga0105239_11583216 | 3300010375 | Bacteria | 758 |
| 354 | Ga0105239_12209445 | 3300010375 | Bacteria | 640 |
| 355 | Ga0105246_10903991 | 3300011119 | Bacteria | 792 |
| 356 | Ga0157373_10025892 | 3300013100 | Bacteria | 4239 |
| 357 | Ga0157373_10094244 | 3300013100 | Bacteria | 2108 |
| 358 | Ga0157373_10227442 | 3300013100 | Bacteria | 1317 |
| 359 | Ga0157373_10435491 | 3300013100 | Bacteria | 942 |
| 360 | Ga0157373_10447762 | 3300013100 | Bacteria | 929 |
| 361 | Ga0157373_11176786 | 3300013100 | Bacteria | 577 |
| 362 | Ga0157371_10004539 | 3300013102 | Bacteria | 12094 |
| 363 | Ga0157371_10028673 | 3300013102 | Bacteria | 4030 |
| 364 | Ga0157371_10137992 | 3300013102 | Bacteria | 1737 |
| 365 | Ga0157371_10547722 | 3300013102 | Bacteria | 857 |
| 366 | Ga0157371_10553536 | 3300013102 | Bacteria | 853 |
| 367 | Ga0157371_10875025 | 3300013102 | Bacteria | 680 |
| 368 | Ga0157371_11409624 | 3300013102 | Bacteria | 541 |
| 369 | Ga0157370_10029812 | 3300013104 | Bacteria | 5349 |
| 370 | Ga0157370_10362128 | 3300013104 | Bacteria | 1336 |
| 371 | Ga0157370_10477761 | 3300013104 | Bacteria | 1145 |
| 372 | Ga0157370_10662166 | 3300013104 | Bacteria | 954 |
| 373 | Ga0157370_11042690 | 3300013104 | Bacteria | 740 |
| 374 | Ga0157370_11208062 | 3300013104 | Bacteria | 682 |
| 375 | Ga0157370_11379634 | 3300013104 | Bacteria | 634 |
| 376 | Ga0157370_11485467 | 3300013104 | Bacteria | 609 |
| 377 | Ga0157369_10006198 | 3300013105 | Bacteria | 13875 |
| 378 | Ga0157369_10060072 | 3300013105 | Bacteria | 4100 |
| 379 | Ga0157369_10224608 | 3300013105 | Bacteria | 1965 |
| 380 | Ga0157369_10226825 | 3300013105 | Bacteria | 1954 |
| 381 | Ga0157369_10238577 | 3300013105 | Bacteria | 1899 |
| 382 | Ga0157369_10888629 | 3300013105 | Bacteria | 914 |
| 383 | Ga0157369_10915875 | 3300013105 | Bacteria | 899 |
| 384 | Ga0157369_12509251 | 3300013105 | Bacteria | 522 |
| 385 | Ga0157374_10010551 | 3300013296 | Bacteria | 7953 |
| 386 | Ga0157374_10367864 | 3300013296 | Bacteria | 1431 |
| 387 | Ga0157374_10604380 | 3300013296 | Bacteria | 1107 |
| 388 | Ga0157374_10645116 | 3300013296 | Bacteria | 1070 |
| 389 | Ga0157378_10974112 | 3300013297 | Bacteria | 881 |
| 390 | Ga0157378_11672718 | 3300013297 | Bacteria | 683 |
| 391 | Ga0163162_10553296 | 3300013306 | Bacteria | 1279 |
| 392 | Ga0163162_11009033 | 3300013306 | Bacteria | 941 |
| 393 | Ga0163162_12754800 | 3300013306 | Bacteria | 566 |
| 394 | Ga0157372_10078683 | 3300013307 | Bacteria | 3726 |
| 395 | Ga0157372_10166269 | 3300013307 | Bacteria | 2551 |
| 396 | Ga0157372_10544908 | 3300013307 | Bacteria | 1352 |
| 397 | Ga0157372_11342906 | 3300013307 | Bacteria | 825 |
| 398 | Ga0157372_11835532 | 3300013307 | Bacteria | 697 |
| 399 | Ga0157375_10583570 | 3300013308 | Bacteria | 1278 |
| 400 | Ga0157375_12141176 | 3300013308 | Bacteria | 666 |
| 401 | Ga0163163_10007592 | 3300014325 | Bacteria | 9578 |
| 402 | Ga0163163_10058122 | 3300014325 | Bacteria | 3824 |
| 403 | Ga0163163_10093123 | 3300014325 | Bacteria | 3029 |
| 404 | Ga0163163_10840836 | 3300014325 | Bacteria | 981 |
| 405 | Ga0157380_10015607 | 3300014326 | Bacteria | 5584 |
| 406 | Ga0157380_10032640 | 3300014326 | Bacteria | 4007 |
| 407 | Ga0157380_10274963 | 3300014326 | Bacteria | 1538 |
| 408 | Ga0157380_11840572 | 3300014326 | Bacteria | 665 |
| 409 | Ga0157380_12216059 | 3300014326 | Bacteria | 613 |
| 410 | Ga0157380_12435952 | 3300014326 | Bacteria | 589 |
| 411 | Ga0182008_10915337 | 3300014497 | Bacteria | 517 |
| 412 | Ga0157379_10191534 | 3300014968 | Bacteria | 1848 |
| 413 | Ga0157379_10489365 | 3300014968 | Bacteria | 1139 |
| 414 | Ga0182006_1319469 | 3300015261 | Bacteria | 510 |
| 415 | Ga0163161_10318399 | 3300017792 | Bacteria | 1229 |
| 416 | Ga0163161_10342924 | 3300017792 | Bacteria | 1186 |
| 417 | Ga0163161_10386121 | 3300017792 | Bacteria | 1120 |
| 418 | Ga0163161_10568245 | 3300017792 | Bacteria | 931 |
| 419 | Ga0163161_10977395 | 3300017792 | Bacteria | 721 |
| 420 | Ga0163161_11528167 | 3300017792 | Bacteria | 587 |
| 421 | Ga0197907_10242937 | 3300020069 | Bacteria | 3764 |
| 422 | Ga0206355_1520041 | 3300020076 | Bacteria | 1090 |
| 423 | Ga0206351_10800997 | 3300020077 | Bacteria | 750 |
| 424 | Ga0206350_10783216 | 3300020080 | Bacteria | 547 |
| 425 | Ga0206350_11209014 | 3300020080 | Bacteria | 1185 |
| 426 | Ga0206353_10409967 | 3300020082 | Bacteria | 717 |
| 427 | Ga0213873_10000021 | 3300021358 | Bacteria | 113830 |
| 428 | Ga0213876_10000050 | 3300021384 | Bacteria | 144836 |
| 429 | Ga0213876_10012794 | 3300021384 | Bacteria | 4461 |
| 430 | Ga0213875_10009078 | 3300021388 | Bacteria | 5053 |
| 431 | Ga0224712_10370067 | 3300022467 | Bacteria | 680 |
| 432 | Ga0209147_100666 | 3300025229 | Bacteria | 17803 |
| 433 | Ga0207673_1052737 | 3300025290 | Bacteria | 577 |
| 434 | Ga0209050_1001064 | 3300025298 | Bacteria | 33727 |
| 435 | Ga0207697_10000357 | 3300025315 | Bacteria | 25521 |
| 436 | Ga0207697_10009568 | 3300025315 | Bacteria | 4180 |
| 437 | Ga0207656_10006798 | 3300025321 | Bacteria | 4135 |
| 438 | Ga0207696_1044417 | 3300025711 | Bacteria | 1289 |
| 439 | Ga0207696_1051971 | 3300025711 | Bacteria | 1169 |
| 440 | Ga0207713_1023315 | 3300025735 | Bacteria | 2915 |
| 441 | Ga0207713_1120151 | 3300025735 | Bacteria | 882 |
| 442 | Ga0207682_10004483 | 3300025893 | Bacteria | 5825 |
| 443 | Ga0207682_10056719 | 3300025893 | Bacteria | 1631 |
| 444 | Ga0207682_10132618 | 3300025893 | Bacteria | 1113 |
| 445 | Ga0207682_10220696 | 3300025893 | Bacteria | 877 |
| 446 | Ga0207642_10696797 | 3300025899 | Bacteria | 640 |
| 447 | Ga0207710_10030890 | 3300025900 | Bacteria | 2339 |
| 448 | Ga0207710_10587716 | 3300025900 | Bacteria | 581 |
| 449 | Ga0207688_10121879 | 3300025901 | Bacteria | 1522 |
| 450 | Ga0207688_10492005 | 3300025901 | Bacteria | 767 |
| 451 | Ga0207680_10000156 | 3300025903 | Bacteria | 33323 |
| 452 | Ga0207680_10218378 | 3300025903 | Bacteria | 1306 |
| 453 | Ga0207647_10008472 | 3300025904 | Bacteria | 7370 |
| 454 | Ga0207647_10009694 | 3300025904 | Bacteria | 6833 |
| 455 | Ga0207647_10137863 | 3300025904 | Bacteria | 1431 |
| 456 | Ga0207647_10249901 | 3300025904 | Bacteria | 1017 |
| 457 | Ga0207647_10282856 | 3300025904 | Bacteria | 946 |
| 458 | Ga0207647_10339741 | 3300025904 | Bacteria | 851 |
| 459 | Ga0207647_10387483 | 3300025904 | Bacteria | 788 |
| 460 | Ga0207647_10612732 | 3300025904 | Bacteria | 600 |
| 461 | Ga0207647_10614215 | 3300025904 | Bacteria | 599 |
| 462 | Ga0207645_10703103 | 3300025907 | Bacteria | 687 |
| 463 | Ga0207643_10134237 | 3300025908 | Bacteria | 1474 |
| 464 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 465 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 466 | Ga0207705_10000059 | 3300025909 | Bacteria | 155683 |
| 467 | Ga0207705_10000648 | 3300025909 | Bacteria | 28951 |
| 468 | Ga0207705_10007902 | 3300025909 | Bacteria | 7809 |
| 469 | Ga0207705_10043522 | 3300025909 | Bacteria | 3226 |
| 470 | Ga0207705_10058249 | 3300025909 | Bacteria | 2787 |
| 471 | Ga0207705_10243893 | 3300025909 | Bacteria | 1369 |
| 472 | Ga0207705_10467741 | 3300025909 | Bacteria | 978 |
| 473 | Ga0207705_10877927 | 3300025909 | Bacteria | 695 |
| 474 | Ga0207705_11445779 | 3300025909 | Bacteria | 522 |
| 475 | Ga0207654_10000796 | 3300025911 | Bacteria | 17350 |
| 476 | Ga0207654_10240018 | 3300025911 | Bacteria | 1211 |
| 477 | Ga0207707_10099833 | 3300025912 | Bacteria | 2537 |
| 478 | Ga0207695_10006167 | 3300025913 | Bacteria | 15631 |
| 479 | Ga0207695_10049127 | 3300025913 | Bacteria | 4450 |
| 480 | Ga0207695_10155268 | 3300025913 | Bacteria | 2223 |
| 481 | Ga0207695_10254886 | 3300025913 | Bacteria | 1653 |
| 482 | Ga0207671_10003173 | 3300025914 | Bacteria | 16603 |
| 483 | Ga0207671_10688793 | 3300025914 | Bacteria | 813 |
| 484 | Ga0207660_10011674 | 3300025917 | Bacteria | 5728 |
| 485 | Ga0207660_10235666 | 3300025917 | Bacteria | 1440 |
| 486 | Ga0207660_10643598 | 3300025917 | Bacteria | 864 |
| 487 | Ga0207660_11578567 | 3300025917 | Bacteria | 529 |
| 488 | Ga0207657_10025646 | 3300025919 | Bacteria | 5431 |
| 489 | Ga0207657_10035454 | 3300025919 | Bacteria | 4474 |
| 490 | Ga0207657_10047199 | 3300025919 | Bacteria | 3768 |
| 491 | Ga0207657_10051890 | 3300025919 | Bacteria | 3563 |
| 492 | Ga0207657_10068579 | 3300025919 | Bacteria | 3012 |
| 493 | Ga0207657_10178187 | 3300025919 | Bacteria | 1719 |
| 494 | Ga0207657_10213574 | 3300025919 | Bacteria | 1548 |
| 495 | Ga0207657_10256142 | 3300025919 | Bacteria | 1393 |
| 496 | Ga0207657_10377056 | 3300025919 | Bacteria | 1117 |
| 497 | Ga0207657_10822361 | 3300025919 | Bacteria | 718 |
| 498 | Ga0207649_10000089 | 3300025920 | Bacteria | 76923 |
| 499 | Ga0207649_10000785 | 3300025920 | Bacteria | 20599 |
| 500 | Ga0207649_10208905 | 3300025920 | Bacteria | 1384 |
| 501 | Ga0207649_10387534 | 3300025920 | Bacteria | 1043 |
| 502 | Ga0207649_10568364 | 3300025920 | Bacteria | 869 |
| 503 | Ga0207649_10592923 | 3300025920 | Bacteria | 852 |
| 504 | Ga0207652_10000008 | 3300025921 | Bacteria | 286698 |
| 505 | Ga0207652_10196206 | 3300025921 | Bacteria | 1816 |
| 506 | Ga0207652_10579214 | 3300025921 | Bacteria | 1007 |
| 507 | Ga0207652_11495349 | 3300025921 | Bacteria | 579 |
| 508 | Ga0207652_11660720 | 3300025921 | Bacteria | 543 |
| 509 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 510 | Ga0207681_10000030 | 3300025923 | Bacteria | 173766 |
| 511 | Ga0207681_10024920 | 3300025923 | Bacteria | 3843 |
| 512 | Ga0207681_10237408 | 3300025923 | Bacteria | 1417 |
| 513 | Ga0207681_10438802 | 3300025923 | Bacteria | 1060 |
| 514 | Ga0207681_10744080 | 3300025923 | Bacteria | 817 |
| 515 | Ga0207681_10896019 | 3300025923 | Bacteria | 743 |
| 516 | Ga0207681_10896977 | 3300025923 | Bacteria | 742 |
| 517 | Ga0207681_11251936 | 3300025923 | Bacteria | 623 |
| 518 | Ga0207694_10002782 | 3300025924 | Bacteria | 14124 |
| 519 | Ga0207694_10017336 | 3300025924 | Bacteria | 5445 |
| 520 | Ga0207694_10042554 | 3300025924 | Bacteria | 3504 |
| 521 | Ga0207694_10461078 | 3300025924 | Bacteria | 1062 |
| 522 | Ga0207694_10691263 | 3300025924 | Bacteria | 860 |
| 523 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 524 | Ga0207650_10003319 | 3300025925 | Bacteria | 11082 |
| 525 | Ga0207650_10129317 | 3300025925 | Bacteria | 1974 |
| 526 | Ga0207650_10252160 | 3300025925 | Bacteria | 1429 |
| 527 | Ga0207650_10376453 | 3300025925 | Bacteria | 1172 |
| 528 | Ga0207650_10590891 | 3300025925 | Bacteria | 933 |
| 529 | Ga0207650_10601662 | 3300025925 | Bacteria | 925 |
| 530 | Ga0207659_10143155 | 3300025926 | Bacteria | 1858 |
| 531 | Ga0207659_10411697 | 3300025926 | Bacteria | 1133 |
| 532 | Ga0207664_10592174 | 3300025929 | Bacteria | 996 |
| 533 | Ga0207664_11354761 | 3300025929 | Bacteria | 632 |
| 534 | Ga0207644_10000017 | 3300025931 | Bacteria | 177818 |
| 535 | Ga0207644_10000145 | 3300025931 | Bacteria | 50586 |
| 536 | Ga0207644_10002200 | 3300025931 | Bacteria | 12646 |
| 537 | Ga0207644_10035625 | 3300025931 | Bacteria | 3488 |
| 538 | Ga0207644_10103807 | 3300025931 | Bacteria | 2139 |
| 539 | Ga0207690_10004087 | 3300025932 | Bacteria | 8614 |
| 540 | Ga0207690_10010225 | 3300025932 | Bacteria | 5571 |
| 541 | Ga0207690_10018583 | 3300025932 | Bacteria | 4265 |
| 542 | Ga0207690_10301811 | 3300025932 | Bacteria | 1253 |
| 543 | Ga0207690_10319063 | 3300025932 | Bacteria | 1221 |
| 544 | Ga0207690_10898366 | 3300025932 | Bacteria | 735 |
| 545 | Ga0207690_11006847 | 3300025932 | Bacteria | 693 |
| 546 | Ga0207690_11517323 | 3300025932 | Bacteria | 560 |
| 547 | Ga0207690_11567916 | 3300025932 | Bacteria | 550 |
| 548 | Ga0207690_11689146 | 3300025932 | Bacteria | 529 |
| 549 | Ga0207706_10006766 | 3300025933 | Bacteria | 10600 |
| 550 | Ga0207706_10018915 | 3300025933 | Bacteria | 6194 |
| 551 | Ga0207706_10059527 | 3300025933 | Bacteria | 3363 |
| 552 | Ga0207706_10091353 | 3300025933 | Bacteria | 2677 |
| 553 | Ga0207706_10470622 | 3300025933 | Bacteria | 1086 |
| 554 | Ga0207706_10667366 | 3300025933 | Bacteria | 890 |
| 555 | Ga0207706_11243318 | 3300025933 | Bacteria | 617 |
| 556 | Ga0207706_11564719 | 3300025933 | Bacteria | 535 |
| 557 | Ga0207709_10340059 | 3300025935 | Bacteria | 1129 |
| 558 | Ga0207669_10012728 | 3300025937 | Bacteria | 4147 |
| 559 | Ga0207669_10819468 | 3300025937 | Bacteria | 773 |
| 560 | Ga0207665_10592010 | 3300025939 | Bacteria | 865 |
| 561 | Ga0207691_10017921 | 3300025940 | Bacteria | 6710 |
| 562 | Ga0207691_10112431 | 3300025940 | Bacteria | 2421 |
| 563 | Ga0207691_10154274 | 3300025940 | Bacteria | 2018 |
| 564 | Ga0207691_10190926 | 3300025940 | Bacteria | 1786 |
| 565 | Ga0207691_10217168 | 3300025940 | Bacteria | 1659 |
| 566 | Ga0207691_10597300 | 3300025940 | Bacteria | 934 |
| 567 | Ga0207711_10000187 | 3300025941 | Bacteria | 66307 |
| 568 | Ga0207711_10001472 | 3300025941 | Bacteria | 21955 |
| 569 | Ga0207711_10042359 | 3300025941 | Bacteria | 3879 |
| 570 | Ga0207711_10502944 | 3300025941 | Bacteria | 1129 |
| 571 | Ga0207711_10716462 | 3300025941 | Bacteria | 933 |
| 572 | Ga0207711_11890537 | 3300025941 | Bacteria | 540 |
| 573 | Ga0207689_10177884 | 3300025942 | Bacteria | 1754 |
| 574 | Ga0207689_10288547 | 3300025942 | Bacteria | 1359 |
| 575 | Ga0207689_10610737 | 3300025942 | Bacteria | 918 |
| 576 | Ga0207661_10040411 | 3300025944 | Bacteria | 3666 |
| 577 | Ga0207661_10809183 | 3300025944 | Bacteria | 863 |
| 578 | Ga0207661_11558456 | 3300025944 | Bacteria | 605 |
| 579 | Ga0207679_10141657 | 3300025945 | Bacteria | 1944 |
| 580 | Ga0207679_10356505 | 3300025945 | Bacteria | 1276 |
| 581 | Ga0207679_10637693 | 3300025945 | Bacteria | 963 |
| 582 | Ga0207679_10732276 | 3300025945 | Bacteria | 899 |
| 583 | Ga0207679_10775286 | 3300025945 | Bacteria | 873 |
| 584 | Ga0207667_10004183 | 3300025949 | Bacteria | 17730 |
| 585 | Ga0207667_10009258 | 3300025949 | Bacteria | 11628 |
| 586 | Ga0207667_10016050 | 3300025949 | Bacteria | 8482 |
| 587 | Ga0207667_10038060 | 3300025949 | Bacteria | 5138 |
| 588 | Ga0207667_10198387 | 3300025949 | Bacteria | 2059 |
| 589 | Ga0207667_10441448 | 3300025949 | Bacteria | 1323 |
| 590 | Ga0207667_10555556 | 3300025949 | Bacteria | 1161 |
| 591 | Ga0207667_10857485 | 3300025949 | Bacteria | 902 |
| 592 | Ga0207651_10061277 | 3300025960 | Bacteria | 2616 |
| 593 | Ga0207651_10704852 | 3300025960 | Bacteria | 889 |
| 594 | Ga0207651_11385965 | 3300025960 | Bacteria | 633 |
| 595 | Ga0207712_10000012 | 3300025961 | Bacteria | 392363 |
| 596 | Ga0207712_10028639 | 3300025961 | Bacteria | 3728 |
| 597 | Ga0207712_10063646 | 3300025961 | Bacteria | 2627 |
| 598 | Ga0207712_10106755 | 3300025961 | Bacteria | 2092 |
| 599 | Ga0207712_10259357 | 3300025961 | Bacteria | 1409 |
| 600 | Ga0207712_11603027 | 3300025961 | Bacteria | 583 |
| 601 | Ga0207668_10000113 | 3300025972 | Bacteria | 57453 |
| 602 | Ga0207668_10001639 | 3300025972 | Bacteria | 13068 |
| 603 | Ga0207668_10038990 | 3300025972 | Bacteria | 3193 |
| 604 | Ga0207668_10097003 | 3300025972 | Bacteria | 2180 |
| 605 | Ga0207668_10123359 | 3300025972 | Bacteria | 1965 |
| 606 | Ga0207668_10225229 | 3300025972 | Bacteria | 1508 |
| 607 | Ga0207668_10384373 | 3300025972 | Bacteria | 1182 |
| 608 | Ga0207640_10014726 | 3300025981 | Bacteria | 4508 |
| 609 | Ga0207640_10159500 | 3300025981 | Bacteria | 1667 |
| 610 | Ga0207640_11190624 | 3300025981 | Bacteria | 677 |
| 611 | Ga0207640_11543698 | 3300025981 | Bacteria | 597 |
| 612 | Ga0207658_10002550 | 3300025986 | Bacteria | 13234 |
| 613 | Ga0207658_10005381 | 3300025986 | Bacteria | 8790 |
| 614 | Ga0207658_10009479 | 3300025986 | Bacteria | 6606 |
| 615 | Ga0207658_10086347 | 3300025986 | Bacteria | 2419 |
| 616 | Ga0207658_10130025 | 3300025986 | Bacteria | 2021 |
| 617 | Ga0207658_10195774 | 3300025986 | Bacteria | 1683 |
| 618 | Ga0207677_10173486 | 3300026023 | Bacteria | 1689 |
| 619 | Ga0207703_10001977 | 3300026035 | Bacteria | 18099 |
| 620 | Ga0207703_10109804 | 3300026035 | Bacteria | 2352 |
| 621 | Ga0207703_10540822 | 3300026035 | Bacteria | 1098 |
| 622 | Ga0207639_10089225 | 3300026041 | Bacteria | 2463 |
| 623 | Ga0207639_10438956 | 3300026041 | Bacteria | 1183 |
| 624 | Ga0207639_11445655 | 3300026041 | Bacteria | 645 |
| 625 | Ga0207678_10014182 | 3300026067 | Bacteria | 7006 |
| 626 | Ga0207678_10062609 | 3300026067 | Bacteria | 3197 |
| 627 | Ga0207678_10081076 | 3300026067 | Bacteria | 2777 |
| 628 | Ga0207678_10086490 | 3300026067 | Bacteria | 2679 |
| 629 | Ga0207678_10361305 | 3300026067 | Bacteria | 1253 |
| 630 | Ga0207678_10361306 | 3300026067 | Bacteria | 1253 |
| 631 | Ga0207678_10368645 | 3300026067 | Bacteria | 1240 |
| 632 | Ga0207678_10481879 | 3300026067 | Bacteria | 1080 |
| 633 | Ga0207678_10752877 | 3300026067 | Bacteria | 859 |
| 634 | Ga0207708_10516679 | 3300026075 | Bacteria | 1003 |
| 635 | Ga0207708_11724839 | 3300026075 | Bacteria | 550 |
| 636 | Ga0207702_10003021 | 3300026078 | Bacteria | 15630 |
| 637 | Ga0207702_10034722 | 3300026078 | Bacteria | 4218 |
| 638 | Ga0207702_10082689 | 3300026078 | Bacteria | 2792 |
| 639 | Ga0207702_10182476 | 3300026078 | Bacteria | 1934 |
| 640 | Ga0207702_10280373 | 3300026078 | Bacteria | 1575 |
| 641 | Ga0207641_10000036 | 3300026088 | Bacteria | 213165 |
| 642 | Ga0207641_10001914 | 3300026088 | Bacteria | 19977 |
| 643 | Ga0207641_10002919 | 3300026088 | Bacteria | 15481 |
| 644 | Ga0207641_10026844 | 3300026088 | Bacteria | 4754 |
| 645 | Ga0207641_10047020 | 3300026088 | Bacteria | 3638 |
| 646 | Ga0207641_10383474 | 3300026088 | Bacteria | 1346 |
| 647 | Ga0207648_10384132 | 3300026089 | Bacteria | 1270 |
| 648 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 649 | Ga0207676_10000887 | 3300026095 | Bacteria | 23213 |
| 650 | Ga0207676_10004014 | 3300026095 | Bacteria | 10388 |
| 651 | Ga0207676_10136112 | 3300026095 | Bacteria | 2096 |
| 652 | Ga0207676_11012475 | 3300026095 | Bacteria | 819 |
| 653 | Ga0207674_10037223 | 3300026116 | Bacteria | 5063 |
| 654 | Ga0207674_10122043 | 3300026116 | Bacteria | 2572 |
| 655 | Ga0207674_10152816 | 3300026116 | Bacteria | 2265 |
| 656 | Ga0207674_10374507 | 3300026116 | Bacteria | 1376 |
| 657 | Ga0207674_10480318 | 3300026116 | Bacteria | 1201 |
| 658 | Ga0207674_10531816 | 3300026116 | Bacteria | 1136 |
| 659 | Ga0207674_11701258 | 3300026116 | Bacteria | 599 |
| 660 | Ga0207675_100000221 | 3300026118 | Bacteria | 53325 |
| 661 | Ga0207675_100001117 | 3300026118 | Bacteria | 26571 |
| 662 | Ga0207675_100097949 | 3300026118 | Bacteria | 2762 |
| 663 | Ga0207675_100564088 | 3300026118 | Bacteria | 1139 |
| 664 | Ga0207683_10056958 | 3300026121 | Bacteria | 3430 |
| 665 | Ga0207683_11333115 | 3300026121 | Bacteria | 664 |
| 666 | Ga0207683_12148952 | 3300026121 | Bacteria | 506 |
| 667 | Ga0207698_10001088 | 3300026142 | Bacteria | 15791 |
| 668 | Ga0207698_10001432 | 3300026142 | Bacteria | 13858 |
| 669 | Ga0207698_10016673 | 3300026142 | Bacteria | 4962 |
| 670 | Ga0207698_10587584 | 3300026142 | Bacteria | 1096 |
| 671 | Ga0209281_1042455 | 3300027111 | Bacteria | 758 |
| 672 | Ga0210002_1056761 | 3300027617 | Bacteria | 680 |
| 673 | Ga0209966_1099655 | 3300027695 | Bacteria | 656 |
| 674 | Ga0209998_10186520 | 3300027717 | Bacteria | 540 |
| 675 | Ga0209813_10000047 | 3300027866 | Bacteria | 49657 |
| 676 | Ga0209974_10064225 | 3300027876 | Bacteria | 1245 |
| 677 | Ga0268266_10000879 | 3300028379 | Bacteria | 38938 |
| 678 | Ga0268266_10039920 | 3300028379 | Bacteria | 3999 |
| 679 | Ga0268266_10175097 | 3300028379 | Bacteria | 1950 |
| 680 | Ga0268266_11724146 | 3300028379 | Bacteria | 601 |
| 681 | Ga0268266_11870774 | 3300028379 | Bacteria | 574 |
| 682 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 683 | Ga0268265_10000125 | 3300028380 | Bacteria | 96710 |
| 684 | Ga0268265_10011465 | 3300028380 | Bacteria | 5994 |
| 685 | Ga0268265_10051345 | 3300028380 | Bacteria | 3112 |
| 686 | Ga0268265_10076395 | 3300028380 | Bacteria | 2627 |
| 687 | Ga0268265_10430560 | 3300028380 | Bacteria | 1227 |
| 688 | Ga0268265_11032239 | 3300028380 | Bacteria | 813 |
| 689 | Ga0268265_11922987 | 3300028380 | Bacteria | 598 |
| 690 | Ga0268264_10000347 | 3300028381 | Bacteria | 70884 |
| 691 | Ga0268264_10005218 | 3300028381 | Bacteria | 11000 |
| 692 | Ga0268264_10012633 | 3300028381 | Bacteria | 6956 |
| 693 | Ga0268264_10062575 | 3300028381 | Bacteria | 3125 |
| 694 | Ga0268264_10103721 | 3300028381 | Bacteria | 2477 |
| 695 | Ga0268264_10133809 | 3300028381 | Bacteria | 2202 |
| 696 | Ga0268264_12404327 | 3300028381 | Bacteria | 533 |
| 697 | Ga0265338_10366206 | 3300028800 | Bacteria | 1033 |
| 698 | Ga0316180_1068718 | 3300030736 | Bacteria | 1536 |
| 699 | Ga0307513_10044306 | 3300031456 | Bacteria | 4875 |
| 700 | Ga0307408_100023913 | 3300031548 | Bacteria | 4166 |
| 701 | Ga0307408_100247980 | 3300031548 | Bacteria | 1467 |
| 702 | Ga0307408_100373128 | 3300031548 | Bacteria | 1217 |
| 703 | Ga0307408_100634340 | 3300031548 | Bacteria | 953 |
| 704 | Ga0307408_101461325 | 3300031548 | Bacteria | 645 |
| 705 | Ga0307408_101902476 | 3300031548 | Bacteria | 570 |
| 706 | Ga0307408_101945598 | 3300031548 | Bacteria | 564 |
| 707 | Ga0307408_102466309 | 3300031548 | Bacteria | 505 |
| 708 | Ga0307405_10069109 | 3300031731 | Bacteria | 2263 |
| 709 | Ga0307405_10086456 | 3300031731 | Bacteria | 2064 |
| 710 | Ga0307405_10115978 | 3300031731 | Bacteria | 1823 |
| 711 | Ga0307405_10163033 | 3300031731 | Bacteria | 1581 |
| 712 | Ga0307405_10187789 | 3300031731 | Bacteria | 1489 |
| 713 | Ga0307405_10194213 | 3300031731 | Bacteria | 1468 |
| 714 | Ga0307405_10196596 | 3300031731 | Bacteria | 1461 |
| 715 | Ga0307405_10963409 | 3300031731 | Bacteria | 726 |
| 716 | Ga0307405_11048792 | 3300031731 | Bacteria | 698 |
| 717 | Ga0307405_11731923 | 3300031731 | Bacteria | 554 |
| 718 | Ga0307413_10030876 | 3300031824 | Bacteria | 3015 |
| 719 | Ga0307413_10043026 | 3300031824 | Bacteria | 2658 |
| 720 | Ga0307413_10195307 | 3300031824 | Bacteria | 1456 |
| 721 | Ga0307413_10210075 | 3300031824 | Bacteria | 1413 |
| 722 | Ga0307413_10235334 | 3300031824 | Bacteria | 1348 |
| 723 | Ga0307413_10285628 | 3300031824 | Bacteria | 1243 |
| 724 | Ga0307413_10486341 | 3300031824 | Bacteria | 988 |
| 725 | Ga0307413_11042587 | 3300031824 | Bacteria | 703 |
| 726 | Ga0307413_11426460 | 3300031824 | Bacteria | 610 |
| 727 | Ga0307413_12053999 | 3300031824 | Bacteria | 516 |
| 728 | Ga0307410_10004670 | 3300031852 | Bacteria | 7118 |
| 729 | Ga0307410_10039465 | 3300031852 | Bacteria | 3100 |
| 730 | Ga0307410_10308422 | 3300031852 | Bacteria | 1251 |
| 731 | Ga0307410_10314938 | 3300031852 | Bacteria | 1239 |
| 732 | Ga0307410_10380325 | 3300031852 | Bacteria | 1136 |
| 733 | Ga0307410_10685354 | 3300031852 | Bacteria | 862 |
| 734 | Ga0307410_11530911 | 3300031852 | Bacteria | 588 |
| 735 | Ga0307406_10074475 | 3300031901 | Bacteria | 2235 |
| 736 | Ga0307406_10301492 | 3300031901 | Bacteria | 1231 |
| 737 | Ga0307406_10389877 | 3300031901 | Bacteria | 1101 |
| 738 | Ga0307406_10629288 | 3300031901 | Bacteria | 888 |
| 739 | Ga0307406_10672756 | 3300031901 | Bacteria | 861 |
| 740 | Ga0307406_10838775 | 3300031901 | Bacteria | 778 |
| 741 | Ga0307406_10867521 | 3300031901 | Bacteria | 766 |
| 742 | Ga0307406_11267540 | 3300031901 | Bacteria | 642 |
| 743 | Ga0307406_11587672 | 3300031901 | Bacteria | 578 |
| 744 | Ga0307406_11705939 | 3300031901 | Bacteria | 558 |
| 745 | Ga0307407_10074906 | 3300031903 | Bacteria | 2027 |
| 746 | Ga0307407_10092921 | 3300031903 | Bacteria | 1854 |
| 747 | Ga0307407_10150545 | 3300031903 | Bacteria | 1511 |
| 748 | Ga0307407_10179491 | 3300031903 | Bacteria | 1402 |
| 749 | Ga0307407_10272175 | 3300031903 | Bacteria | 1169 |
| 750 | Ga0307407_10628125 | 3300031903 | Bacteria | 802 |
| 751 | Ga0307412_10000330 | 3300031911 | Bacteria | 30088 |
| 752 | Ga0307412_10077051 | 3300031911 | Bacteria | 2292 |
| 753 | Ga0307412_10110217 | 3300031911 | Bacteria | 1964 |
| 754 | Ga0307412_10423101 | 3300031911 | Bacteria | 1090 |
| 755 | Ga0307412_10505142 | 3300031911 | Bacteria | 1007 |
| 756 | Ga0307412_10800071 | 3300031911 | Bacteria | 818 |
| 757 | Ga0307412_11054315 | 3300031911 | Bacteria | 721 |
| 758 | Ga0307412_11119425 | 3300031911 | Bacteria | 701 |
| 759 | Ga0307412_11316391 | 3300031911 | Bacteria | 651 |
| 760 | Ga0307412_11406462 | 3300031911 | Bacteria | 631 |
| 761 | Ga0307412_11943653 | 3300031911 | Bacteria | 544 |
| 762 | Ga0307412_11985012 | 3300031911 | Bacteria | 538 |
| 763 | Ga0307412_12194471 | 3300031911 | Bacteria | 514 |
| 764 | Ga0307409_100071909 | 3300031995 | Bacteria | 2752 |
| 765 | Ga0307409_100115383 | 3300031995 | Bacteria | 2261 |
| 766 | Ga0307409_100127526 | 3300031995 | Bacteria | 2167 |
| 767 | Ga0307409_100136560 | 3300031995 | Bacteria | 2105 |
| 768 | Ga0307409_100165191 | 3300031995 | Bacteria | 1941 |
| 769 | Ga0307409_100601111 | 3300031995 | Bacteria | 1087 |
| 770 | Ga0307409_102415976 | 3300031995 | Bacteria | 555 |
| 771 | Ga0307416_100030267 | 3300032002 | Bacteria | 4059 |
| 772 | Ga0307416_100222558 | 3300032002 | Bacteria | 1811 |
| 773 | Ga0307416_100877262 | 3300032002 | Bacteria | 996 |
| 774 | Ga0307416_101601608 | 3300032002 | Bacteria | 756 |
| 775 | Ga0307416_101747416 | 3300032002 | Bacteria | 726 |
| 776 | Ga0307416_101822002 | 3300032002 | Bacteria | 712 |
| 777 | Ga0307416_102722320 | 3300032002 | Bacteria | 591 |
| 778 | Ga0307416_103475503 | 3300032002 | Bacteria | 527 |
| 779 | Ga0307414_10000117 | 3300032004 | Bacteria | 56697 |
| 780 | Ga0307414_10033711 | 3300032004 | Bacteria | 3387 |
| 781 | Ga0307414_10075940 | 3300032004 | Bacteria | 2440 |
| 782 | Ga0307414_10094751 | 3300032004 | Bacteria | 2229 |
| 783 | Ga0307414_10154782 | 3300032004 | Bacteria | 1813 |
| 784 | Ga0307414_10995308 | 3300032004 | Bacteria | 771 |
| 785 | Ga0307414_11024731 | 3300032004 | Bacteria | 760 |
| 786 | Ga0307414_11075915 | 3300032004 | Bacteria | 742 |
| 787 | Ga0307414_11312136 | 3300032004 | Bacteria | 672 |
| 788 | Ga0307411_10034694 | 3300032005 | Bacteria | 3142 |
| 789 | Ga0307411_10046564 | 3300032005 | Bacteria | 2797 |
| 790 | Ga0307411_10051008 | 3300032005 | Bacteria | 2697 |
| 791 | Ga0307411_10628963 | 3300032005 | Bacteria | 926 |
| 792 | Ga0307411_10634356 | 3300032005 | Bacteria | 923 |
| 793 | Ga0307411_10807471 | 3300032005 | Bacteria | 826 |
| 794 | Ga0307411_11679718 | 3300032005 | Bacteria | 587 |
| 795 | Ga0307415_100050700 | 3300032126 | Bacteria | 2813 |
| 796 | Ga0307415_100154075 | 3300032126 | Bacteria | 1772 |
| 797 | Ga0307415_100329418 | 3300032126 | Bacteria | 1277 |
| 798 | Ga0307415_100394269 | 3300032126 | Bacteria | 1180 |
| 799 | Ga0307415_100848306 | 3300032126 | Bacteria | 838 |
| 800 | Ga0307415_101208521 | 3300032126 | Bacteria | 712 |
| 801 | Ga0307415_101265530 | 3300032126 | Bacteria | 697 |
| 802 | Ga0307415_101357190 | 3300032126 | Bacteria | 675 |
| 803 | Ga0307415_101829157 | 3300032126 | Bacteria | 588 |
| 804 | Ga0316583_10099043 | 3300032133 | Bacteria | 1016 |
| 805 | Ga0316593_10146762 | 3300032168 | Bacteria | 857 |
| 806 | Ga0373940_0155251 | 3300035088 | Bacteria | 732 |
| 807 | Ga0373932_0021465 | 3300035112 | Bacteria | 1705 |
| 808 | Ga0373953_0113089 | 3300035117 | Bacteria | 1149 |
| 809 | Ga0373954_0089363 | 3300035118 | Bacteria | 1478 |
| 810 | Ga0373956_0024664 | 3300035119 | Bacteria | 2593 |
| 811 | Ga0373957_0027492 | 3300035120 | Bacteria | 2067 |
| 812 | Ga0373955_0008414 | 3300035172 | Bacteria | 4791 |
| 813 | Ga0373931_0322058 | 3300035691 | Bacteria | 960 |
| 814 | Ga0373933_0056561 | 3300035724 | Bacteria | 2355 |
| 815 | Ga0373937_0004874 | 3300036401 | Bacteria | 11407 |
| 816 | Ga0316582_0007349 | 3300036647 | Bacteria | 5860 |
| 817 | Ga0316582_0575591 | 3300036647 | Bacteria | 776 |
| 818 | Ga0316584_0206101 | 3300036712 | Bacteria | 1449 |
| 819 | Ga0395899_0021762 | 3300037312 | Bacteria | 4863 |
| 820 | Ga0395899_0044175 | 3300037312 | Bacteria | 3321 |
| 821 | Ga0395899_0100756 | 3300037312 | Bacteria | 2085 |
| 822 | Ga0395899_0140215 | 3300037312 | Bacteria | 1720 |
| 823 | Ga0395899_0153650 | 3300037312 | Bacteria | 1630 |
| 824 | Ga0395899_0199433 | 3300037312 | Bacteria | 1396 |
| 825 | Ga0395900_0000129 | 3300037418 | Bacteria | 126281 |
| 826 | Ga0395900_0037171 | 3300037418 | Bacteria | 5021 |
| 827 | Ga0395900_0086699 | 3300037418 | Bacteria | 3217 |
| 828 | Ga0395900_0107296 | 3300037418 | Bacteria | 2869 |
| 829 | Ga0395900_0114419 | 3300037418 | Bacteria | 2768 |
| 830 | Ga0395900_0146188 | 3300037418 | Bacteria | 2417 |
| 831 | Ga0395900_0459933 | 3300037418 | Bacteria | 1227 |
| 832 | Ga0395900_0518365 | 3300037418 | Bacteria | 1140 |
| 833 | Ga0395900_0531213 | 3300037418 | Bacteria | 1123 |
| 834 | Ga0395900_0921487 | 3300037418 | Bacteria | 796 |
| 835 | Ga0395900_1290340 | 3300037418 | Bacteria | 644 |
| 836 | Ga0395898_0037825 | 3300037466 | Bacteria | 4785 |
| 837 | Ga0395898_0064833 | 3300037466 | Bacteria | 3542 |
| 838 | Ga0395898_0295219 | 3300037466 | Bacteria | 1546 |
| 839 | Ga0395898_0386003 | 3300037466 | Bacteria | 1335 |
| 840 | Ga0395898_0640393 | 3300037466 | Bacteria | 1005 |
| 841 | Ga0395898_0722819 | 3300037466 | Bacteria | 937 |
| 842 | Ga0395898_1637197 | 3300037466 | Bacteria | 567 |
| 843 | Ga0395905_0025750 | 3300037471 | Bacteria | 5546 |
| 844 | Ga0395905_0046000 | 3300037471 | Bacteria | 4093 |
| 845 | Ga0395905_0130100 | 3300037471 | Bacteria | 2367 |
| 846 | Ga0395905_0155152 | 3300037471 | Bacteria | 2153 |
| 847 | Ga0395905_0352456 | 3300037471 | Bacteria | 1364 |
| 848 | Ga0395905_0597559 | 3300037471 | Bacteria | 1005 |
| 849 | Ga0395905_1415085 | 3300037471 | Bacteria | 599 |
| 850 | Ga0436364_0191800 | 3300037853 | Bacteria | 21312 |
| 851 | Ga0436364_0684712 | 3300037853 | Bacteria | 571 |
| 852 | Ga0395901_0002264 | 3300038443 | Bacteria | 19637 |
| 853 | Ga0395901_0068560 | 3300038443 | Bacteria | 3695 |
| 854 | Ga0395901_0142895 | 3300038443 | Bacteria | 2515 |
| 855 | Ga0395901_0147369 | 3300038443 | Bacteria | 2473 |
| 856 | Ga0395901_0162228 | 3300038443 | Bacteria | 2347 |
| 857 | Ga0395901_0351773 | 3300038443 | Bacteria | 1520 |
| 858 | Ga0395901_0578985 | 3300038443 | Bacteria | 1134 |
| 859 | Ga0395901_0997622 | 3300038443 | Bacteria | 813 |
| 860 | Ga0395901_1275939 | 3300038443 | Bacteria | 697 |
| 861 | Ga0436365_0184497 | 3300039437 | Bacteria | 3907 |
| 862 | Ga0436365_0450653 | 3300039437 | Bacteria | 1172 |
| 863 | Ga0436365_0580131 | 3300039437 | Bacteria | 6135 |
| 864 | Ga0436365_1244318 | 3300039437 | Bacteria | 547 |
| 865 | Ga0436363_0358357 | 3300039450 | Bacteria | 888 |
| 866 | Ga0436362_0385235 | 3300039453 | Bacteria | 33119 |
| 867 | Ga0439465_0334775 | 3300041413 | Bacteria | 570 |
| 868 | Ga0451790_28622 | 3300041444 | Bacteria | 568 |
| 869 | Ga0451807_0011806 | 3300041486 | Bacteria | 866 |
| 870 | Ga0451837_0351521 | 3300041494 | Bacteria | 648 |
| 871 | Ga0451839_1304614 | 3300041496 | Bacteria | 666 |
| 872 | Ga0451846_69758 | 3300041502 | Bacteria | 524 |
| 873 | Ga0451849_0595459 | 3300041505 | Bacteria | 745 |
| 874 | Ga0451843_0138888 | 3300041509 | Bacteria | 547 |
| 875 | Ga0451843_1021534 | 3300041509 | Bacteria | 596 |
| 876 | Ga0451853_3234207 | 3300041512 | Bacteria | 1799 |
| 877 | Ga0451853_3599086 | 3300041512 | Bacteria | 851 |
| 878 | Ga0451853_3947895 | 3300041512 | Bacteria | 890 |
| 879 | Ga0439445_0003060 | 3300042004 | Bacteria | 3744 |
| 880 | Ga0439445_0279442 | 3300042004 | Bacteria | 501 |
| 881 | Ga0439448_0008621 | 3300042005 | Bacteria | 2987 |
| 882 | Ga0439448_0022837 | 3300042005 | Bacteria | 1947 |
| 883 | Ga0439450_083826 | 3300042008 | Bacteria | 795 |
| 884 | Ga0439455_0033721 | 3300042012 | Bacteria | 1285 |
| 885 | Ga0450919_027172 | 3300042121 | Bacteria | 651 |
| 886 | Ga0450922_024105 | 3300042124 | Bacteria | 639 |
| 887 | Ga0450896_035742 | 3300042133 | Bacteria | 764 |
| 888 | Ga0450902_057117 | 3300042137 | Bacteria | 673 |
| 889 | Ga0439446_0344644 | 3300042156 | Bacteria | 530 |
| 890 | Ga0439458_0001304 | 3300042157 | Bacteria | 6297 |
| 891 | Ga0439458_0079831 | 3300042157 | Bacteria | 833 |
| 892 | Ga0450909_036264 | 3300042185 | Bacteria | 754 |
| 893 | Ga0450893_0022040 | 3300042532 | Bacteria | 1102 |
| 894 | Ga0466969_0223310 | 3300044656 | Bacteria | 856 |
| 895 | Ga0466972_0013424 | 3300044658 | Bacteria | 4113 |
| 896 | Ga0466973_0608614 | 3300044659 | Bacteria | 570 |
| 897 | Ga0466965_0309790 | 3300044683 | Bacteria | 858 |
| 898 | Ga0466966_0000003 | 3300044684 | Bacteria | 233677 |
| 899 | Ga0466966_0002392 | 3300044684 | Bacteria | 12260 |
| 900 | Ga0466966_0369278 | 3300044684 | Bacteria | 862 |
| 901 | Ga0466961_0098457 | 3300044693 | Bacteria | 1844 |
| 902 | Ga0466963_0026446 | 3300044694 | Bacteria | 3711 |
| 903 | Ga0466963_0211997 | 3300044694 | Bacteria | 1355 |
| 904 | Ga0466964_0055158 | 3300044706 | Bacteria | 1640 |
| 905 | Ga0466971_0016839 | 3300044719 | Bacteria | 3229 |
| 906 | Ga0466971_0135148 | 3300044719 | Bacteria | 1147 |
| 907 | Ga0466968_0070572 | 3300044735 | Bacteria | 1520 |
| 908 | Ga0466970_0271138 | 3300044765 | Bacteria | 953 |
| 909 | Ga0466970_0422565 | 3300044765 | Bacteria | 762 |
| 910 | Ga0466957_0006798 | 3300044842 | Bacteria | 6462 |
| 911 | Ga0466957_0015092 | 3300044842 | Bacteria | 4508 |
| 912 | Ga0466957_0559603 | 3300044842 | Bacteria | 797 |
| 913 | Ga0466957_0799164 | 3300044842 | Bacteria | 670 |
| 914 | Ga0466960_0036448 | 3300044901 | Bacteria | 2303 |
| 915 | Ga0466960_0147435 | 3300044901 | Bacteria | 1254 |
| 916 | Ga0466960_0455960 | 3300044901 | Bacteria | 744 |
| 917 | Ga0466959_0101644 | 3300045049 | Bacteria | 2058 |
| 918 | Ga0466959_0252297 | 3300045049 | Bacteria | 1216 |
| 919 | Ga0466958_0014358 | 3300045836 | Bacteria | 4522 |
| 920 | Ga0466967_0070609 | 3300045976 | Bacteria | 3124 |
| 921 | Ga0466967_1578940 | 3300045976 | Bacteria | 653 |
| 922 | Ga0495627_000259 | 3300046453 | Bacteria | 54358 |
| 923 | Ga0495627_001182 | 3300046453 | Bacteria | 16582 |
| 924 | Ga0495629_1128117 | 3300046459 | Bacteria | 506 |
| 925 | Ga0495638_0151783 | 3300046460 | Bacteria | 1343 |
| 926 | Ga0495638_0163241 | 3300046460 | Bacteria | 1284 |
| 927 | Ga0495638_0241159 | 3300046460 | Bacteria | 1001 |
| 928 | Ga0495650_0018352 | 3300046471 | Bacteria | 3477 |
| 929 | Ga0495650_0242389 | 3300046471 | Bacteria | 615 |
| 930 | Ga0495584_0069703 | 3300046491 | Bacteria | 1767 |
| 931 | Ga0495584_0595530 | 3300046491 | Bacteria | 564 |
| 932 | Ga0495585_0124421 | 3300046492 | Bacteria | 1362 |
| 933 | Ga0495585_0212795 | 3300046492 | Bacteria | 979 |
| 934 | Ga0495596_0000054 | 3300046500 | Bacteria | 83068 |
| 935 | Ga0495596_0007788 | 3300046500 | Bacteria | 4806 |
| 936 | Ga0495607_0211118 | 3300046501 | Bacteria | 955 |
| 937 | Ga0495583_0164366 | 3300046506 | Bacteria | 914 |
| 938 | Ga0495606_0131411 | 3300046507 | Bacteria | 1488 |
| 939 | Ga0495606_0133485 | 3300046507 | Bacteria | 1473 |
| 940 | Ga0495606_0363718 | 3300046507 | Bacteria | 764 |
| 941 | Ga0495606_0428674 | 3300046507 | Bacteria | 682 |
| 942 | Ga0495610_0002336 | 3300046512 | Bacteria | 16035 |
| 943 | Ga0495610_0107757 | 3300046512 | Bacteria | 1238 |
| 944 | Ga0495620_0016521 | 3300046515 | Bacteria | 3700 |
| 945 | Ga0495620_0047476 | 3300046515 | Bacteria | 1848 |
| 946 | Ga0495620_0052278 | 3300046515 | Bacteria | 1736 |
| 947 | Ga0495631_0113666 | 3300046518 | Bacteria | 1164 |
| 948 | Ga0495632_0000095 | 3300046519 | Bacteria | 89499 |
| 949 | Ga0495632_0111602 | 3300046519 | Bacteria | 1283 |
| 950 | Ga0495637_0010393 | 3300046520 | Bacteria | 4503 |
| 951 | Ga0495637_0291324 | 3300046520 | Bacteria | 581 |
| 952 | Ga0495643_0000038 | 3300046522 | Bacteria | 236010 |
| 953 | Ga0495643_0018247 | 3300046522 | Bacteria | 4082 |
| 954 | Ga0495648_0015595 | 3300046524 | Bacteria | 5510 |
| 955 | Ga0495663_0000028 | 3300046525 | Bacteria | 89526 |
| 956 | Ga0495663_0113344 | 3300046525 | Bacteria | 902 |
| 957 | Ga0495663_0135747 | 3300046525 | Bacteria | 832 |
| 958 | Ga0495654_0013841 | 3300046530 | Bacteria | 4306 |
| 959 | Ga0495654_0114493 | 3300046530 | Bacteria | 1227 |
| 960 | Ga0495598_0189653 | 3300046537 | Bacteria | 737 |
| 961 | Ga0495609_0078741 | 3300046538 | Bacteria | 1442 |
| 962 | Ga0495609_0463555 | 3300046538 | Bacteria | 503 |
| 963 | Ga0495621_0083657 | 3300046539 | Bacteria | 1193 |
| 964 | Ga0495633_0002760 | 3300046558 | Bacteria | 12138 |
| 965 | Ga0495633_0032405 | 3300046558 | Bacteria | 2525 |
| 966 | Ga0495668_0014797 | 3300046616 | Bacteria | 4567 |
| 967 | Ga0495668_0055513 | 3300046616 | Bacteria | 2187 |
| 968 | Ga0495668_0080044 | 3300046616 | Bacteria | 1793 |
| 969 | Ga0495668_0283224 | 3300046616 | Bacteria | 908 |
| 970 | Ga0495625_0067721 | 3300046660 | Bacteria | 2512 |
| 971 | Ga0495625_0068887 | 3300046660 | Bacteria | 2486 |
| 972 | Ga0495625_0599845 | 3300046660 | Bacteria | 661 |
| 973 | Ga0495659_0221508 | 3300046664 | Bacteria | 781 |
| 974 | Ga0495669_0043715 | 3300046684 | Bacteria | 1995 |
| 975 | Ga0495669_0088257 | 3300046684 | Bacteria | 1429 |
| 976 | Ga0495670_0147361 | 3300046691 | Bacteria | 1233 |
| 977 | Ga0495671_0000027 | 3300046692 | Bacteria | 236011 |
| 978 | Ga0495671_0038864 | 3300046692 | Bacteria | 2404 |
| 979 | Ga0495671_0526141 | 3300046692 | Bacteria | 563 |
| 980 | Ga0495589_0442145 | 3300046794 | Bacteria | 595 |
| 981 | Ga0495683_0233532 | 3300047323 | Bacteria | 814 |
| 982 | Ga0495677_0039987 | 3300047445 | Bacteria | 1714 |
| 983 | Ga0495673_0056682 | 3300047469 | Bacteria | 1694 |
| 984 | Ga0495673_0064355 | 3300047469 | Bacteria | 1560 |
| 985 | Ga0495681_0000360 | 3300047470 | Bacteria | 35550 |
| 986 | Ga0495681_0007198 | 3300047470 | Bacteria | 7153 |
| 987 | Ga0495686_0210647 | 3300047472 | Bacteria | 1110 |
| 988 | Ga0495686_0458233 | 3300047472 | Bacteria | 676 |
| 989 | Ga0495602_0018419 | 3300048088 | Bacteria | 6974 |
| 990 | Ga0495615_0000152 | 3300048090 | Bacteria | 17446 |
| 991 | Ga0495615_0116664 | 3300048090 | Bacteria | 768 |
| 992 | Ga0495626_0000356 | 3300048091 | Bacteria | 47831 |
| 993 | Ga0496100_0970557 | 3300048903 | Bacteria | 668 |
| 994 | Ga0496101_1160668 | 3300048904 | Bacteria | 606 |
| 995 | Ga0496102_0000345 | 3300048905 | Bacteria | 56618 |
| 996 | Ga0496102_0299968 | 3300048905 | Bacteria | 1514 |
| 997 | Ga0496102_0734907 | 3300048905 | Bacteria | 910 |
| 998 | Ga0496103_0000276 | 3300048906 | Bacteria | 48842 |
| 999 | Ga0496103_0018485 | 3300048906 | Bacteria | 4180 |
| 1000 | Ga0496105_0299993 | 3300048908 | Bacteria | 1292 |
| 1001 | Ga0496105_1101040 | 3300048908 | Bacteria | 590 |
| 1002 | Ga0496107_0194813 | 3300048910 | Bacteria | 1506 |
| 1003 | Ga0496108_0008106 | 3300048911 | Bacteria | 8517 |
| 1004 | Ga0496108_0828440 | 3300048911 | Bacteria | 797 |
| 1005 | Ga0496110_0839338 | 3300048913 | Bacteria | 824 |
| 1006 | Ga0496111_1163764 | 3300048914 | Bacteria | 548 |
| 1007 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 1008 | Ga0496116_0112128 | 3300048919 | Bacteria | 1599 |
| 1009 | Ga0496116_0173431 | 3300048919 | Bacteria | 1165 |
| 1010 | Ga0496117_0000633 | 3300048920 | Bacteria | 56618 |
| 1011 | Ga0496117_0051053 | 3300048920 | Bacteria | 2927 |
| 1012 | Ga0496118_0000654 | 3300048921 | Bacteria | 56618 |
| 1013 | Ga0496118_0051401 | 3300048921 | Bacteria | 3153 |
| 1014 | Ga0496118_0101608 | 3300048921 | Bacteria | 1941 |
| 1015 | Ga0496119_0041645 | 3300048922 | Bacteria | 2922 |
| 1016 | Ga0496120_0022737 | 3300048923 | Bacteria | 3941 |
| 1017 | Ga0496120_0424117 | 3300048923 | Bacteria | 583 |
| 1018 | Ga0496121_0005190 | 3300048924 | Bacteria | 16883 |
| 1019 | Ga0496121_0040965 | 3300048924 | Bacteria | 4055 |
| 1020 | Ga0496121_0065515 | 3300048924 | Bacteria | 2955 |
| 1021 | Ga0496122_0008028 | 3300048925 | Bacteria | 11524 |
| 1022 | Ga0496122_0009631 | 3300048925 | Bacteria | 10115 |
| 1023 | Ga0496122_0253404 | 3300048925 | Bacteria | 982 |
| 1024 | Ga0496123_0003623 | 3300048926 | Bacteria | 17095 |
| 1025 | Ga0496123_0128746 | 3300048926 | Bacteria | 1407 |
| 1026 | Ga0496123_0259398 | 3300048926 | Bacteria | 852 |
| 1027 | Ga0496124_0000664 | 3300048927 | Bacteria | 56618 |
| 1028 | Ga0496124_0005247 | 3300048927 | Bacteria | 14676 |
| 1029 | Ga0496124_0068836 | 3300048927 | Bacteria | 2940 |
| 1030 | Ga0496124_0406309 | 3300048927 | Bacteria | 943 |
| 1031 | Ga0496124_0470881 | 3300048927 | Bacteria | 851 |
| 1032 | Ga0496125_0024671 | 3300048928 | Bacteria | 5523 |
| 1033 | Ga0496125_0070773 | 3300048928 | Bacteria | 2729 |
| 1034 | Ga0496125_0072995 | 3300048928 | Bacteria | 2671 |
| 1035 | Ga0496125_0129339 | 3300048928 | Bacteria | 1781 |
| 1036 | Ga0496126_0000084 | 3300048929 | Bacteria | 217111 |
| 1037 | Ga0496126_0077669 | 3300048929 | Bacteria | 2943 |
| 1038 | Ga0496126_0148093 | 3300048929 | Bacteria | 2014 |
| 1039 | Ga0496126_0954748 | 3300048929 | Bacteria | 646 |
| 1040 | Ga0501306_000053 | 3300049127 | Bacteria | 6015 |
| 1041 | Ga0501306_012159 | 3300049127 | Bacteria | 1106 |
| 1042 | Ga0501306_025058 | 3300049127 | Bacteria | 856 |
| 1043 | Ga0501306_032502 | 3300049127 | Bacteria | 781 |
| 1044 | Ga0501306_063453 | 3300049127 | Bacteria | 612 |
| 1045 | Ga0501308_057456 | 3300049128 | Bacteria | 581 |
| 1046 | Ga0501309_044663 | 3300049129 | Bacteria | 684 |
| 1047 | Ga0501310_007822 | 3300049130 | Bacteria | 1149 |
| 1048 | Ga0501304_012847 | 3300049160 | Bacteria | 759 |
| 1049 | Ga0501304_024531 | 3300049160 | Bacteria | 615 |
| 1050 | Ga0501305_001454 | 3300049161 | Bacteria | 2322 |
| 1051 | Ga0501305_064900 | 3300049161 | Bacteria | 634 |
| 1052 | Ga0501305_066351 | 3300049161 | Bacteria | 629 |
| 1053 | Ga0501307_000852 | 3300049162 | Bacteria | 2331 |
| 1054 | Ga0501307_032560 | 3300049162 | Bacteria | 729 |
| 1055 | Ga0501307_091012 | 3300049162 | Bacteria | 509 |
| 1056 | Ga0495678_085298 | 3300049459 | Bacteria | 1125 |
| 1057 | Ga0495682_0166508 | 3300049460 | Bacteria | 785 |
| 1058 | Ga0501312_007670 | 3300049528 | Bacteria | 1381 |
| 1059 | Ga0501313_004418 | 3300049529 | Bacteria | 1444 |
| 1060 | Ga0501314_000002 | 3300049530 | Bacteria | 13192 |
| 1061 | Ga0501315_043192 | 3300049531 | Bacteria | 688 |
| 1062 | Ga0501315_068769 | 3300049531 | Bacteria | 584 |
| 1063 | Ga0501315_070322 | 3300049531 | Bacteria | 580 |
| 1064 | Ga0501315_074801 | 3300049531 | Bacteria | 567 |
| 1065 | Ga0501316_030404 | 3300049532 | Bacteria | 721 |
| 1066 | Ga0501317_012033 | 3300049533 | Bacteria | 1062 |
| 1067 | Ga0501320_019698 | 3300049536 | Bacteria | 771 |
| 1068 | Ga0501321_020722 | 3300049537 | Bacteria | 815 |
| 1069 | Ga0501322_012811 | 3300049538 | Bacteria | 671 |
| 1070 | Ga0501323_086220 | 3300049539 | Bacteria | 519 |
| 1071 | Ga0501324_045614 | 3300049540 | Bacteria | 509 |
| 1072 | Ga0501325_010463 | 3300049541 | Bacteria | 841 |
| 1073 | Ga0501325_010745 | 3300049541 | Bacteria | 836 |
| 1074 | Ga0501325_018626 | 3300049541 | Bacteria | 713 |
| 1075 | Ga0501336_010484 | 3300049552 | Bacteria | 743 |
| 1076 | Ga0501337_023773 | 3300049553 | Bacteria | 509 |
| 1077 | Ga0501032_0426180 | 3300049569 | Bacteria | 851 |
| 1078 | Ga0501033_1167178 | 3300049570 | Bacteria | 511 |
| 1079 | Ga0501034_0025412 | 3300049571 | Bacteria | 6029 |
| 1080 | Ga0501036_0618656 | 3300049572 | Bacteria | 898 |
| 1081 | Ga0501040_0898140 | 3300049576 | Bacteria | 642 |
| 1082 | Ga0501040_0908845 | 3300049576 | Bacteria | 638 |
| 1083 | Ga0501043_0158164 | 3300049579 | Bacteria | 1771 |
| 1084 | Ga0501043_0933708 | 3300049579 | Bacteria | 621 |
| 1085 | Ga0501047_0050927 | 3300049581 | Bacteria | 3999 |
| 1086 | Ga0501047_0259693 | 3300049581 | Bacteria | 1585 |
| 1087 | Ga0501048_1264682 | 3300049582 | Bacteria | 531 |
| 1088 | Ga0501074_0762731 | 3300049590 | Bacteria | 682 |
| 1089 | Ga0501201_011764 | 3300049651 | Bacteria | 867 |
| 1090 | Ga0501223_000394 | 3300049663 | Bacteria | 10743 |
| 1091 | Ga0501224_000009 | 3300049664 | Bacteria | 107191 |
| 1092 | Ga0501224_000719 | 3300049664 | Bacteria | 4156 |
| 1093 | Ga0501224_027715 | 3300049664 | Bacteria | 847 |
| 1094 | Ga0501227_140768 | 3300049665 | Bacteria | 662 |
| 1095 | Ga0501233_000604 | 3300049668 | Bacteria | 5865 |
| 1096 | Ga0501235_004379 | 3300049669 | Bacteria | 3054 |
| 1097 | Ga0501239_075300 | 3300049672 | Bacteria | 532 |
| 1098 | Ga0501249_001523 | 3300049679 | Bacteria | 4750 |
| 1099 | Ga0501249_010685 | 3300049679 | Bacteria | 1923 |
| 1100 | Ga0501253_010293 | 3300049683 | Bacteria | 1404 |
| 1101 | Ga0501257_161869 | 3300049686 | Bacteria | 623 |
| 1102 | Ga0501258_023728 | 3300049687 | Bacteria | 737 |
| 1103 | Ga0501219_022019 | 3300049703 | Bacteria | 559 |
| 1104 | Ga0501221_033559 | 3300049704 | Bacteria | 1084 |
| 1105 | Ga0501225_0000094 | 3300049705 | Bacteria | 28402 |
| 1106 | Ga0501229_076171 | 3300049706 | Bacteria | 531 |
| 1107 | Ga0501234_001131 | 3300049707 | Bacteria | 4213 |
| 1108 | Ga0501035_0370772 | 3300049822 | Bacteria | 1195 |
| 1109 | Ga0501204_061270 | 3300049850 | Bacteria | 599 |
| 1110 | Ga0501226_000076 | 3300049853 | Bacteria | 29950 |
| 1111 | nmdc:mga03683_594937_c1 | 3300050489 | Bacteria | 541 |
| 1112 | nmdc:mga00v17_3048_c1 | 3300050491 | Bacteria | 8615 |
| 1113 | nmdc:mga0k408_176220_c1 | 3300050493 | Bacteria | 1275 |
| 1114 | nmdc:mga06z11_517_c1 | 3300050494 | Bacteria | 14236 |
| 1115 | nmdc:mga06z11_814486_c1 | 3300050494 | Bacteria | 569 |
| 1116 | nmdc:mga04h51_91_c1 | 3300050495 | Bacteria | 28026 |
| 1117 | nmdc:mga07m45_164_c1 | 3300050496 | Bacteria | 26629 |
| 1118 | nmdc:mga08y16_1224882_c1 | 3300050511 | Bacteria | 720 |
| 1119 | nmdc:mga08y16_134827_c1 | 3300050511 | Bacteria | 2566 |
| 1120 | nmdc:mga08y16_693902_c1 | 3300050511 | Bacteria | 1018 |
| 1121 | nmdc:mga0sz30_167_c1 | 3300050516 | Bacteria | 24409 |
| 1122 | nmdc:mga0sz30_208022_c1 | 3300050516 | Bacteria | 869 |
| 1123 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 1124 | Ga0500643_009338 | 3300053087 | Bacteria | 3754 |
| 1125 | Ga0500643_065741 | 3300053087 | Bacteria | 1011 |
| 1126 | Ga0500643_065742 | 3300053087 | Bacteria | 1011 |
| 1127 | Ga0500643_217418 | 3300053087 | Bacteria | 513 |
| 1128 | Ga0500647_0087398 | 3300053091 | Bacteria | 1494 |
| 1129 | Ga0500562_030207 | 3300053108 | Bacteria | 1427 |
| 1130 | Ga0500592_028741 | 3300053116 | Bacteria | 896 |
| 1131 | Ga0500594_0254736 | 3300053118 | Bacteria | 584 |
| 1132 | Ga0500607_005191 | 3300053121 | Bacteria | 8593 |
| 1133 | Ga0500608_272960 | 3300053122 | Bacteria | 645 |
| 1134 | Ga0500642_0236906 | 3300053130 | Bacteria | 842 |
| 1135 | Ga0500559_0054969 | 3300053136 | Bacteria | 1764 |
| 1136 | Ga0500568_0081765 | 3300053139 | Bacteria | 1226 |
| 1137 | Ga0500577_0090467 | 3300053142 | Bacteria | 1236 |
| 1138 | Ga0500590_028297 | 3300053148 | Bacteria | 2908 |
| 1139 | Ga0500590_096832 | 3300053148 | Bacteria | 1423 |
| 1140 | Ga0500604_0076435 | 3300053151 | Bacteria | 1076 |
| 1141 | Ga0500616_0047383 | 3300053153 | Bacteria | 2282 |
| 1142 | Ga0500616_0211652 | 3300053153 | Bacteria | 851 |
| 1143 | Ga0500627_0000200 | 3300053158 | Bacteria | 17313 |
| 1144 | Ga0500637_0035961 | 3300053178 | Bacteria | 2779 |
| 1145 | Ga0500611_007703 | 3300053727 | Bacteria | 1632 |
| 1146 | Ga0500645_004674 | 3300053730 | Bacteria | 5209 |
| 1147 | Ga0590071_043319 | 3300059421 | Bacteria | 1085 |
| 1148 | Ga0590071_139620 | 3300059421 | Bacteria | 625 |
| 1149 | Ga0587090_056272 | 3300059510 | Bacteria | 734 |
| 1150 | Ga0587125_054900 | 3300059607 | Bacteria | 570 |
| 1151 | Ga0587101_016307 | 3300059623 | Bacteria | 1017 |
| 1152 | Ga0587101_144166 | 3300059623 | Bacteria | 511 |
| 1153 | Ga0587115_093744 | 3300059626 | Bacteria | 548 |
| 1154 | Ga0587128_013345 | 3300059630 | Bacteria | 1158 |
| 1155 | Ga0587128_041590 | 3300059630 | Bacteria | 806 |
| 1156 | Ga0587128_046280 | 3300059630 | Bacteria | 779 |
| 1157 | Ga0587076_042893 | 3300059645 | Bacteria | 852 |
| 1158 | Ga0587079_104329 | 3300059647 | Bacteria | 681 |
| 1159 | Ga0587107_056217 | 3300059652 | Bacteria | 682 |
| 1160 | Ga0587114_113522 | 3300059655 | Bacteria | 541 |
| 1161 | Ga0587124_013523 | 3300059660 | Bacteria | 767 |
| 1162 | Ga0587071_065086 | 3300060344 | Bacteria | 782 |
| 1163 | Ga0587071_100812 | 3300060344 | Bacteria | 668 |
| 1164 | Ga0466962_0022154 | 3300061719 | Bacteria | 3051 |
| 1165 | Ga0466962_0156175 | 3300061719 | Bacteria | 1108 |
| 1166 | 2511127736 | 2510917021 | Bacteria | 5705459 |
| 1167 | 2643729044 | 2643221541 | Bacteria | 5498788 |
| 1168 | 2644039619 | 2643221605 | Bacteria | 4772303 |
| 1169 | 2644045057 | 2643221606 | Bacteria | 5588032 |
| 1170 | 2644391230 | 2643221671 | Bacteria | 5496681 |
| 1171 | 2819552564 | 2818991438 | Bacteria | 5793701 |
| 1172 | 2830079059 | 2830075706 | Bacteria | 3855215 |
| 1173 | 2919712487 | 2919709256 | Bacteria | 4318106 |
| 1174 | 3000866851 | 3000865235 | Bacteria | 3106258 |
| 1175 | 8054304447 | 8054302542 | Bacteria | 5698134 |
| 1176 | Ga0068862_100642713 | |||
| 1177 | SwRhRL2b_contig_1707570 | |||
| 1178 | SwRhRL2b_contig_308716 | |||
| 1179 | SwRhRL2b_contig_373569 | |||
| 1180 | JGI24736J21556_1000017 | |||
| 1181 | JGI24736J21556_1000244 | |||
| 1182 | JGI24736J21556_1020976 | |||
| 1183 | JGI24736J21556_1022190 | |||
| 1184 | JGI24741J21665_1016662 | |||
| 1185 | JGI24752J21851_1000810 | |||
| 1186 | JGI24740J21852_10008905 | |||
| 1187 | JGI24740J21852_10008925 | |||
| 1188 | JGI24740J21852_10115295 | |||
| 1189 | JGI24740J21852_10142843 | |||
| 1190 | JGI24739J22299_10017509 | |||
| 1191 | JGI24739J22299_10026040 | |||
| 1192 | JGI24739J22299_10029465 | |||
| 1193 | JGI24739J22299_10065973 | |||
| 1194 | JGI24737J22298_10010075 | |||
| 1195 | JGI24737J22298_10027704 | |||
| 1196 | JGI24737J22298_10057940 | |||
| 1197 | JGI24737J22298_10092202 | |||
| 1198 | JGI24737J22298_10104394 | |||
| 1199 | JGI24737J22298_10142305 | |||
| 1200 | JGI24735J21928_10003396 | |||
| 1201 | JGI24735J21928_10022535 | |||
| 1202 | JGI24750J21931_1028129 | |||
| 1203 | JGI24738J21930_10002167 | |||
| 1204 | JGI24738J21930_10013156 | |||
| 1205 | JGI24738J21930_10035086 | |||
| 1206 | JGI24749J21850_1000052 | |||
| 1207 | JGI24749J21850_1001152 | |||
| 1208 | JGI24034J26672_10002744 | |||
| 1209 | JGI24034J26672_10009328 | |||
| 1210 | JGI24751J29686_10000325 | |||
| 1211 | Ga0055530_10027359 | |||
| 1212 | JGI25405J52794_10005009 | |||
| 1213 | Ga0058861_12019348 | |||
| 1214 | Ga0058862_12510110 | |||
| 1215 | Ga0065704_10009321 | |||
| 1216 | Ga0065704_10133643 | |||
| 1217 | Ga0065704_10158827 | |||
| 1218 | Ga0065712_10044080 | |||
| 1219 | Ga0065712_10520019 | |||
| 1220 | Ga0065715_10090134 | |||
| 1221 | Ga0065715_10392675 | |||
| 1222 | Ga0065715_10446466 | |||
| 1223 | Ga0065715_10617514 | |||
| 1224 | Ga0065707_10007537 | |||
| 1225 | Ga0065707_10108385 | |||
| 1226 | Ga0065707_10186565 | |||
| 1227 | Ga0065707_10385618 | |||
| 1228 | Ga0065707_10426403 | |||
| 1229 | Ga0070658_10000172 | |||
| 1230 | Ga0070658_10000808 | |||
| 1231 | Ga0070658_10026506 | |||
| 1232 | Ga0070658_10034387 | |||
| 1233 | Ga0070658_10147154 | |||
| 1234 | Ga0070658_10151735 | |||
| 1235 | Ga0070658_10181443 | |||
| 1236 | Ga0070658_10414802 | |||
| 1237 | Ga0070658_10660111 | |||
| 1238 | Ga0070658_10693818 | |||
| 1239 | Ga0070658_10747047 | |||
| 1240 | Ga0070658_10772191 | |||
| 1241 | Ga0070676_10056397 | |||
| 1242 | Ga0070683_100222804 | |||
| 1243 | Ga0070683_100711606 | |||
| 1244 | Ga0070690_101245132 | |||
| 1245 | Ga0070670_100002763 | |||
| 1246 | Ga0070670_100024275 | |||
| 1247 | Ga0070670_100077325 | |||
| 1248 | Ga0070670_100214326 | |||
| 1249 | Ga0070670_100289018 | |||
| 1250 | Ga0070670_100714672 | |||
| 1251 | Ga0070670_100938123 | |||
| 1252 | Ga0070670_101076645 | |||
| 1253 | Ga0070677_10012449 | |||
| 1254 | Ga0070677_10216068 | |||
| 1255 | Ga0070677_10486318 | |||
| 1256 | Ga0068869_100534986 | |||
| 1257 | Ga0068869_102104140 | |||
| 1258 | Ga0070666_10001221 | |||
| 1259 | Ga0070666_10141818 | |||
| 1260 | Ga0070680_100033523 | |||
| 1261 | Ga0070680_100069525 | |||
| 1262 | Ga0070680_100284036 | |||
| 1263 | Ga0070680_100666478 | |||
| 1264 | Ga0070682_100708565 | |||
| 1265 | Ga0070682_101045239 | |||
| 1266 | Ga0070682_102089921 | |||
| 1267 | Ga0068868_100063445 | |||
| 1268 | Ga0070660_100023993 | |||
| 1269 | Ga0070660_100028806 | |||
| 1270 | Ga0070660_100038292 | |||
| 1271 | Ga0070660_100057901 | |||
| 1272 | Ga0070660_100060466 | |||
| 1273 | Ga0070660_100076515 | |||
| 1274 | Ga0070660_100307521 | |||
| 1275 | Ga0070660_101878046 | |||
| 1276 | Ga0070691_10670371 | |||
| 1277 | Ga0070661_100016703 | |||
| 1278 | Ga0070661_100041801 | |||
| 1279 | Ga0070661_100083669 | |||
| 1280 | Ga0070661_100156151 | |||
| 1281 | Ga0070661_100185779 | |||
| 1282 | Ga0070661_100267229 | |||
| 1283 | Ga0070661_100281828 | |||
| 1284 | Ga0070661_100485118 | |||
| 1285 | Ga0070661_100960141 | |||
| 1286 | Ga0070661_101572159 | |||
| 1287 | Ga0070692_10038561 | |||
| 1288 | Ga0070692_10050904 | |||
| 1289 | Ga0070692_10224230 | |||
| 1290 | Ga0070668_100000831 | |||
| 1291 | Ga0070668_100046306 | |||
| 1292 | Ga0070668_100051441 | |||
| 1293 | Ga0070668_100143128 | |||
| 1294 | Ga0070668_101096050 | |||
| 1295 | Ga0070669_100000096 | |||
| 1296 | Ga0070669_100002856 | |||
| 1297 | Ga0070669_100033975 | |||
| 1298 | Ga0070669_100268035 | |||
| 1299 | Ga0070669_100497699 | |||
| 1300 | Ga0070669_101999198 | |||
| 1301 | Ga0070675_100021317 | |||
| 1302 | Ga0070675_100069477 | |||
| 1303 | Ga0070675_101077801 | |||
| 1304 | Ga0070671_100000045 | |||
| 1305 | Ga0070671_100002671 | |||
| 1306 | Ga0070671_100075015 | |||
| 1307 | Ga0070671_100089401 | |||
| 1308 | Ga0070671_100222605 | |||
| 1309 | Ga0070674_100070716 | |||
| 1310 | Ga0070673_100034662 | |||
| 1311 | Ga0070673_100948209 | |||
| 1312 | Ga0070673_101360880 | |||
| 1313 | Ga0070659_100016977 | |||
| 1314 | Ga0070659_100024658 | |||
| 1315 | Ga0070659_100121318 | |||
| 1316 | Ga0070659_100166032 | |||
| 1317 | Ga0070659_100331646 | |||
| 1318 | Ga0070659_100606645 | |||
| 1319 | Ga0070659_100808624 | |||
| 1320 | Ga0070659_100830908 | |||
| 1321 | Ga0070659_101866823 | |||
| 1322 | Ga0070659_102134472 | |||
| 1323 | Ga0070667_100003534 | |||
| 1324 | Ga0070667_100052979 | |||
| 1325 | Ga0070667_100092578 | |||
| 1326 | Ga0070667_100125062 | |||
| 1327 | Ga0070667_100305375 | |||
| 1328 | Ga0070701_10139054 | |||
| 1329 | Ga0070701_10953549 | |||
| 1330 | Ga0070705_100025314 | |||
| 1331 | Ga0070705_100127772 | |||
| 1332 | Ga0070700_100559087 | |||
| 1333 | Ga0070708_100101983 | |||
| 1334 | Ga0070663_100058865 | |||
| 1335 | Ga0070663_100063578 | |||
| 1336 | Ga0070663_100253556 | |||
| 1337 | Ga0070663_100380493 | |||
| 1338 | Ga0070663_100388964 | |||
| 1339 | Ga0070663_100838437 | |||
| 1340 | Ga0070678_100042212 | |||
| 1341 | Ga0070662_100005957 | |||
| 1342 | Ga0070662_100138242 | |||
| 1343 | Ga0070662_100163343 | |||
| 1344 | Ga0070662_100188525 | |||
| 1345 | Ga0070662_100373351 | |||
| 1346 | Ga0070662_100472094 | |||
| 1347 | Ga0070662_100496502 | |||
| 1348 | Ga0070662_101107281 | |||
| 1349 | Ga0070662_101213121 | |||
| 1350 | Ga0070681_10088688 | |||
| 1351 | Ga0070681_10177121 | |||
| 1352 | Ga0070681_11264566 | |||
| 1353 | Ga0068867_100088936 | |||
| 1354 | Ga0070685_10338871 | |||
| 1355 | Ga0070679_100000873 | |||
| 1356 | Ga0070679_100272454 | |||
| 1357 | Ga0070679_100464363 | |||
| 1358 | Ga0070679_100500972 | |||
| 1359 | Ga0070679_100542586 | |||
| 1360 | Ga0070679_100559293 | |||
| 1361 | Ga0070679_100732699 | |||
| 1362 | Ga0070684_100279436 | |||
| 1363 | Ga0070684_101940564 | |||
| 1364 | Ga0068853_100000960 | |||
| 1365 | Ga0068853_100075015 | |||
| 1366 | Ga0068853_100107432 | |||
| 1367 | Ga0068853_100404879 | |||
| 1368 | Ga0068853_101643023 | |||
| 1369 | Ga0070672_100034217 | |||
| 1370 | Ga0070672_100089112 | |||
| 1371 | Ga0070672_100623524 | |||
| 1372 | Ga0070695_101717119 | |||
| 1373 | Ga0070665_100001143 | |||
| 1374 | Ga0070665_100277766 | |||
| 1375 | Ga0070665_102140465 | |||
| 1376 | Ga0068855_100116496 | |||
| 1377 | Ga0068855_100367274 | |||
| 1378 | Ga0068855_100378198 | |||
| 1379 | Ga0068855_101604438 | |||
| 1380 | Ga0068855_101834455 | |||
| 1381 | Ga0070664_100071016 | |||
| 1382 | Ga0070664_100288384 | |||
| 1383 | Ga0070664_100498178 | |||
| 1384 | Ga0070664_100616986 | |||
| 1385 | Ga0070664_100919590 | |||
| 1386 | Ga0070664_100944155 | |||
| 1387 | Ga0070664_101361903 | |||
| 1388 | Ga0070664_102386190 | |||
| 1389 | Ga0068857_100128809 | |||
| 1390 | Ga0068857_100222421 | |||
| 1391 | Ga0068857_100232146 | |||
| 1392 | Ga0068857_100234824 | |||
| 1393 | Ga0068857_100755108 | |||
| 1394 | Ga0068857_101036775 | |||
| 1395 | Ga0068857_101125820 | |||
| 1396 | Ga0068854_100290859 | |||
| 1397 | Ga0068854_100315773 | |||
| 1398 | Ga0068854_100440919 | |||
| 1399 | Ga0068854_101826752 | |||
| 1400 | Ga0068856_100272871 | |||
| 1401 | Ga0068856_100450706 | |||
| 1402 | Ga0068856_100464472 | |||
| 1403 | Ga0068856_100527026 | |||
| 1404 | Ga0068856_100975530 | |||
| 1405 | Ga0070702_100249413 | |||
| 1406 | Ga0070702_100808329 | |||
| 1407 | Ga0068852_100085271 | |||
| 1408 | Ga0068852_100090864 | |||
| 1409 | Ga0068852_100384355 | |||
| 1410 | Ga0068852_100435529 | |||
| 1411 | Ga0068852_100446513 | |||
| 1412 | Ga0068852_100458987 | |||
| 1413 | Ga0068852_100602980 | |||
| 1414 | Ga0068852_101611652 | |||
| 1415 | Ga0068852_101731395 | |||
| 1416 | Ga0068852_101943250 | |||
| 1417 | Ga0068852_101974323 | |||
| 1418 | Ga0068852_102017798 | |||
| 1419 | Ga0068859_100000162 | |||
| 1420 | Ga0068859_100003314 | |||
| 1421 | Ga0068859_100006387 | |||
| 1422 | Ga0068859_100056194 | |||
| 1423 | Ga0068859_100197558 | |||
| 1424 | Ga0068859_100355516 | |||
| 1425 | Ga0068864_100000677 | |||
| 1426 | Ga0068864_100002491 | |||
| 1427 | Ga0068864_100014199 | |||
| 1428 | Ga0068864_100188944 | |||
| 1429 | Ga0068864_102418338 | |||
| 1430 | Ga0068866_10990043 | |||
| 1431 | Ga0068866_11025973 | |||
| 1432 | Ga0068861_100001385 | |||
| 1433 | Ga0068861_100002700 | |||
| 1434 | Ga0068861_100248927 | |||
| 1435 | Ga0068861_101504408 | |||
| 1436 | Ga0068870_10187152 | |||
| 1437 | Ga0068863_100000017 | |||
| 1438 | Ga0068863_100000784 | |||
| 1439 | Ga0068863_100021286 | |||
| 1440 | Ga0068863_100084537 | |||
| 1441 | Ga0068863_100109631 | |||
| 1442 | Ga0068858_100004068 | |||
| 1443 | Ga0068858_100363754 | |||
| 1444 | Ga0068858_100488747 | |||
| 1445 | Ga0068858_101405465 | |||
| 1446 | Ga0068860_100028664 | |||
| 1447 | Ga0068860_100059055 | |||
| 1448 | Ga0068860_100159782 | |||
| 1449 | Ga0068860_100307284 | |||
| 1450 | Ga0068860_100309619 | |||
| 1451 | Ga0068862_100000032 | |||
| 1452 | Ga0068862_100000126 | |||
| 1453 | Ga0068862_100001411 | |||
| 1454 | Ga0068862_100037303 | |||
| 1455 | Ga0068862_100183079 | |||
| 1456 | Ga0068862_100254494 | |||
| 1457 | Ga0068862_100403349 | |||
| 1458 | Ga0068862_100517794 | |||
| 1459 | Ga0068862_100740357 | |||
| 1460 | Ga0081455_10000215 | |||
| 1461 | Ga0081539_10024226 | |||
| 1462 | Ga0075363_100000592 | |||
| 1463 | Ga0075364_10039797 | |||
| 1464 | Ga0075362_10000383 | |||
| 1465 | Ga0075367_10034804 | |||
| 1466 | Ga0075369_10007430 | |||
| 1467 | Ga0075369_10207627 | |||
| 1468 | Ga0075366_10044214 | |||
| 1469 | Ga0075366_10251147 | |||
| 1470 | Ga0075366_10482922 | |||
| 1471 | Ga0075370_10385755 | |||
| 1472 | Ga0068871_101615763 | |||
| 1473 | Ga0075429_101202087 | |||
| 1474 | Ga0068865_101513032 | |||
| 1475 | Ga0097620_100000162 | |||
| 1476 | Ga0097620_100003314 | |||
| 1477 | Ga0097620_100006388 | |||
| 1478 | Ga0097620_100056192 | |||
| 1479 | Ga0097620_100197562 | |||
| 1480 | Ga0097620_100355530 | |||
| 1481 | Ga0079104_1061406 | |||
| 1482 | Ga0099826_10515445 | |||
| 1483 | Ga0105251_10119144 | |||
| 1484 | Ga0105250_10006758 | |||
| 1485 | Ga0105250_10090725 | |||
| 1486 | Ga0105240_10183433 | |||
| 1487 | Ga0105240_10327247 | |||
| 1488 | Ga0105240_10663942 | |||
| 1489 | Ga0105240_11725974 | |||
| 1490 | Ga0105240_11889769 | |||
| 1491 | Ga0111539_10400226 | |||
| 1492 | Ga0111539_10675436 | |||
| 1493 | Ga0111539_12147524 | |||
| 1494 | Ga0105247_10030286 | |||
| 1495 | Ga0105247_10832572 | |||
| 1496 | Ga0105247_11057356 | |||
| 1497 | Ga0114129_12365235 | |||
| 1498 | Ga0105243_10078256 | |||
| 1499 | Ga0105241_10189845 | |||
| 1500 | Ga0105241_10739862 | |||
| 1501 | Ga0105241_10858753 | |||
| 1502 | Ga0105241_11100455 | |||
| 1503 | Ga0105248_10012645 | |||
| 1504 | Ga0105248_10052852 | |||
| 1505 | Ga0105248_10065663 | |||
| 1506 | Ga0105248_10293477 | |||
| 1507 | Ga0105248_10434374 | |||
| 1508 | Ga0105248_11342716 | |||
| 1509 | Ga0105248_11346039 | |||
| 1510 | Ga0105248_12240059 | |||
| 1511 | Ga0105237_10136651 | |||
| 1512 | Ga0105238_10200701 | |||
| 1513 | Ga0105238_10324005 | |||
| 1514 | Ga0105238_10461795 | |||
| 1515 | Ga0105238_10512303 | |||
| 1516 | Ga0105238_11085613 | |||
| 1517 | Ga0105238_11187354 | |||
| 1518 | Ga0105238_11405512 | |||
| 1519 | Ga0105238_11623408 | |||
| 1520 | Ga0105249_10000017 | |||
| 1521 | Ga0105249_10001061 | |||
| 1522 | Ga0105249_10198131 | |||
| 1523 | Ga0105249_10295869 | |||
| 1524 | Ga0105249_10829669 | |||
| 1525 | Ga0105249_13066452 | |||
| 1526 | Ga0105239_10643434 | |||
| 1527 | Ga0105239_11355486 | |||
| 1528 | Ga0105239_11583216 | |||
| 1529 | Ga0105239_12209445 | |||
| 1530 | Ga0105246_10903991 | |||
| 1531 | Ga0157373_10025892 | |||
| 1532 | Ga0157373_10094244 | |||
| 1533 | Ga0157373_10227442 | |||
| 1534 | Ga0157373_10435491 | |||
| 1535 | Ga0157373_10447762 | |||
| 1536 | Ga0157373_11176786 | |||
| 1537 | Ga0157371_10004539 | |||
| 1538 | Ga0157371_10028673 | |||
| 1539 | Ga0157371_10137992 | |||
| 1540 | Ga0157371_10547722 | |||
| 1541 | Ga0157371_10553536 | |||
| 1542 | Ga0157371_10875025 | |||
| 1543 | Ga0157371_11409624 | |||
| 1544 | Ga0157370_10029812 | |||
| 1545 | Ga0157370_10362128 | |||
| 1546 | Ga0157370_10477761 | |||
| 1547 | Ga0157370_10662166 | |||
| 1548 | Ga0157370_11042690 | |||
| 1549 | Ga0157370_11208062 | |||
| 1550 | Ga0157370_11379634 | |||
| 1551 | Ga0157370_11485467 | |||
| 1552 | Ga0157369_10006198 | |||
| 1553 | Ga0157369_10060072 | |||
| 1554 | Ga0157369_10224608 | |||
| 1555 | Ga0157369_10226825 | |||
| 1556 | Ga0157369_10238577 | |||
| 1557 | Ga0157369_10888629 | |||
| 1558 | Ga0157369_10915875 | |||
| 1559 | Ga0157369_12509251 | |||
| 1560 | Ga0157374_10010551 | |||
| 1561 | Ga0157374_10367864 | |||
| 1562 | Ga0157374_10604380 | |||
| 1563 | Ga0157374_10645116 | |||
| 1564 | Ga0157378_10974112 | |||
| 1565 | Ga0157378_11672718 | |||
| 1566 | Ga0163162_10553296 | |||
| 1567 | Ga0163162_11009033 | |||
| 1568 | Ga0163162_12754800 | |||
| 1569 | Ga0157372_10078683 | |||
| 1570 | Ga0157372_10166269 | |||
| 1571 | Ga0157372_10544908 | |||
| 1572 | Ga0157372_11342906 | |||
| 1573 | Ga0157372_11835532 | |||
| 1574 | Ga0157375_10583570 | |||
| 1575 | Ga0157375_12141176 | |||
| 1576 | Ga0163163_10007592 | |||
| 1577 | Ga0163163_10058122 | |||
| 1578 | Ga0163163_10093123 | |||
| 1579 | Ga0163163_10840836 | |||
| 1580 | Ga0157380_10015607 | |||
| 1581 | Ga0157380_10032640 | |||
| 1582 | Ga0157380_10274963 | |||
| 1583 | Ga0157380_11840572 | |||
| 1584 | Ga0157380_12216059 | |||
| 1585 | Ga0157380_12435952 | |||
| 1586 | Ga0182008_10915337 | |||
| 1587 | Ga0157379_10191534 | |||
| 1588 | Ga0157379_10489365 | |||
| 1589 | Ga0182006_1319469 | |||
| 1590 | Ga0163161_10318399 | |||
| 1591 | Ga0163161_10342924 | |||
| 1592 | Ga0163161_10386121 | |||
| 1593 | Ga0163161_10568245 | |||
| 1594 | Ga0163161_10977395 | |||
| 1595 | Ga0163161_11528167 | |||
| 1596 | Ga0197907_10242937 | |||
| 1597 | Ga0206355_1520041 | |||
| 1598 | Ga0206351_10800997 | |||
| 1599 | Ga0206350_10783216 | |||
| 1600 | Ga0206350_11209014 | |||
| 1601 | Ga0206353_10409967 | |||
| 1602 | Ga0213873_10000021 | |||
| 1603 | Ga0213876_10000050 | |||
| 1604 | Ga0213876_10012794 | |||
| 1605 | Ga0213875_10009078 | |||
| 1606 | Ga0224712_10370067 | |||
| 1607 | Ga0209147_100666 | |||
| 1608 | Ga0207673_1052737 | |||
| 1609 | Ga0209050_1001064 | |||
| 1610 | Ga0207697_10000357 | |||
| 1611 | Ga0207697_10009568 | |||
| 1612 | Ga0207656_10006798 | |||
| 1613 | Ga0207696_1044417 | |||
| 1614 | Ga0207696_1051971 | |||
| 1615 | Ga0207713_1023315 | |||
| 1616 | Ga0207713_1120151 | |||
| 1617 | Ga0207682_10004483 | |||
| 1618 | Ga0207682_10056719 | |||
| 1619 | Ga0207682_10132618 | |||
| 1620 | Ga0207682_10220696 | |||
| 1621 | Ga0207642_10696797 | |||
| 1622 | Ga0207710_10030890 | |||
| 1623 | Ga0207710_10587716 | |||
| 1624 | Ga0207688_10121879 | |||
| 1625 | Ga0207688_10492005 | |||
| 1626 | Ga0207680_10000156 | |||
| 1627 | Ga0207680_10218378 | |||
| 1628 | Ga0207647_10008472 | |||
| 1629 | Ga0207647_10009694 | |||
| 1630 | Ga0207647_10137863 | |||
| 1631 | Ga0207647_10249901 | |||
| 1632 | Ga0207647_10282856 | |||
| 1633 | Ga0207647_10339741 | |||
| 1634 | Ga0207647_10387483 | |||
| 1635 | Ga0207647_10612732 | |||
| 1636 | Ga0207647_10614215 | |||
| 1637 | Ga0207645_10703103 | |||
| 1638 | Ga0207643_10134237 | |||
| 1639 | Ga0207705_10000002 | |||
| 1640 | Ga0207705_10000009 | |||
| 1641 | Ga0207705_10000059 | |||
| 1642 | Ga0207705_10000648 | |||
| 1643 | Ga0207705_10007902 | |||
| 1644 | Ga0207705_10043522 | |||
| 1645 | Ga0207705_10058249 | |||
| 1646 | Ga0207705_10243893 | |||
| 1647 | Ga0207705_10467741 | |||
| 1648 | Ga0207705_10877927 | |||
| 1649 | Ga0207705_11445779 | |||
| 1650 | Ga0207654_10000796 | |||
| 1651 | Ga0207654_10240018 | |||
| 1652 | Ga0207707_10099833 | |||
| 1653 | Ga0207695_10006167 | |||
| 1654 | Ga0207695_10049127 | |||
| 1655 | Ga0207695_10155268 | |||
| 1656 | Ga0207695_10254886 | |||
| 1657 | Ga0207671_10003173 | |||
| 1658 | Ga0207671_10688793 | |||
| 1659 | Ga0207660_10011674 | |||
| 1660 | Ga0207660_10235666 | |||
| 1661 | Ga0207660_10643598 | |||
| 1662 | Ga0207660_11578567 | |||
| 1663 | Ga0207657_10025646 | |||
| 1664 | Ga0207657_10035454 | |||
| 1665 | Ga0207657_10047199 | |||
| 1666 | Ga0207657_10051890 | |||
| 1667 | Ga0207657_10068579 | |||
| 1668 | Ga0207657_10178187 | |||
| 1669 | Ga0207657_10213574 | |||
| 1670 | Ga0207657_10256142 | |||
| 1671 | Ga0207657_10377056 | |||
| 1672 | Ga0207657_10822361 | |||
| 1673 | Ga0207649_10000089 | |||
| 1674 | Ga0207649_10000785 | |||
| 1675 | Ga0207649_10208905 | |||
| 1676 | Ga0207649_10387534 | |||
| 1677 | Ga0207649_10568364 | |||
| 1678 | Ga0207649_10592923 | |||
| 1679 | Ga0207652_10000008 | |||
| 1680 | Ga0207652_10196206 | |||
| 1681 | Ga0207652_10579214 | |||
| 1682 | Ga0207652_11495349 | |||
| 1683 | Ga0207652_11660720 | |||
| 1684 | Ga0207681_10000005 | |||
| 1685 | Ga0207681_10000030 | |||
| 1686 | Ga0207681_10024920 | |||
| 1687 | Ga0207681_10237408 | |||
| 1688 | Ga0207681_10438802 | |||
| 1689 | Ga0207681_10744080 | |||
| 1690 | Ga0207681_10896019 | |||
| 1691 | Ga0207681_10896977 | |||
| 1692 | Ga0207681_11251936 | |||
| 1693 | Ga0207694_10002782 | |||
| 1694 | Ga0207694_10017336 | |||
| 1695 | Ga0207694_10042554 | |||
| 1696 | Ga0207694_10461078 | |||
| 1697 | Ga0207694_10691263 | |||
| 1698 | Ga0207650_10000004 | |||
| 1699 | Ga0207650_10003319 | |||
| 1700 | Ga0207650_10129317 | |||
| 1701 | Ga0207650_10252160 | |||
| 1702 | Ga0207650_10376453 | |||
| 1703 | Ga0207650_10590891 | |||
| 1704 | Ga0207650_10601662 | |||
| 1705 | Ga0207659_10143155 | |||
| 1706 | Ga0207659_10411697 | |||
| 1707 | Ga0207664_10592174 | |||
| 1708 | Ga0207664_11354761 | |||
| 1709 | Ga0207644_10000017 | |||
| 1710 | Ga0207644_10000145 | |||
| 1711 | Ga0207644_10002200 | |||
| 1712 | Ga0207644_10035625 | |||
| 1713 | Ga0207644_10103807 | |||
| 1714 | Ga0207690_10004087 | |||
| 1715 | Ga0207690_10010225 | |||
| 1716 | Ga0207690_10018583 | |||
| 1717 | Ga0207690_10301811 | |||
| 1718 | Ga0207690_10319063 | |||
| 1719 | Ga0207690_10898366 | |||
| 1720 | Ga0207690_11006847 | |||
| 1721 | Ga0207690_11517323 | |||
| 1722 | Ga0207690_11567916 | |||
| 1723 | Ga0207690_11689146 | |||
| 1724 | Ga0207706_10006766 | |||
| 1725 | Ga0207706_10018915 | |||
| 1726 | Ga0207706_10059527 | |||
| 1727 | Ga0207706_10091353 | |||
| 1728 | Ga0207706_10470622 | |||
| 1729 | Ga0207706_10667366 | |||
| 1730 | Ga0207706_11243318 | |||
| 1731 | Ga0207706_11564719 | |||
| 1732 | Ga0207709_10340059 | |||
| 1733 | Ga0207669_10012728 | |||
| 1734 | Ga0207669_10819468 | |||
| 1735 | Ga0207665_10592010 | |||
| 1736 | Ga0207691_10017921 | |||
| 1737 | Ga0207691_10112431 | |||
| 1738 | Ga0207691_10154274 | |||
| 1739 | Ga0207691_10190926 | |||
| 1740 | Ga0207691_10217168 | |||
| 1741 | Ga0207691_10597300 | |||
| 1742 | Ga0207711_10000187 | |||
| 1743 | Ga0207711_10001472 | |||
| 1744 | Ga0207711_10042359 | |||
| 1745 | Ga0207711_10502944 | |||
| 1746 | Ga0207711_10716462 | |||
| 1747 | Ga0207711_11890537 | |||
| 1748 | Ga0207689_10177884 | |||
| 1749 | Ga0207689_10288547 | |||
| 1750 | Ga0207689_10610737 | |||
| 1751 | Ga0207661_10040411 | |||
| 1752 | Ga0207661_10809183 | |||
| 1753 | Ga0207661_11558456 | |||
| 1754 | Ga0207679_10141657 | |||
| 1755 | Ga0207679_10356505 | |||
| 1756 | Ga0207679_10637693 | |||
| 1757 | Ga0207679_10732276 | |||
| 1758 | Ga0207679_10775286 | |||
| 1759 | Ga0207667_10004183 | |||
| 1760 | Ga0207667_10009258 | |||
| 1761 | Ga0207667_10016050 | |||
| 1762 | Ga0207667_10038060 | |||
| 1763 | Ga0207667_10198387 | |||
| 1764 | Ga0207667_10441448 | |||
| 1765 | Ga0207667_10555556 | |||
| 1766 | Ga0207667_10857485 | |||
| 1767 | Ga0207651_10061277 | |||
| 1768 | Ga0207651_10704852 | |||
| 1769 | Ga0207651_11385965 | |||
| 1770 | Ga0207712_10000012 | |||
| 1771 | Ga0207712_10028639 | |||
| 1772 | Ga0207712_10063646 | |||
| 1773 | Ga0207712_10106755 | |||
| 1774 | Ga0207712_10259357 | |||
| 1775 | Ga0207712_11603027 | |||
| 1776 | Ga0207668_10000113 | |||
| 1777 | Ga0207668_10001639 | |||
| 1778 | Ga0207668_10038990 | |||
| 1779 | Ga0207668_10097003 | |||
| 1780 | Ga0207668_10123359 | |||
| 1781 | Ga0207668_10225229 | |||
| 1782 | Ga0207668_10384373 | |||
| 1783 | Ga0207640_10014726 | |||
| 1784 | Ga0207640_10159500 | |||
| 1785 | Ga0207640_11190624 | |||
| 1786 | Ga0207640_11543698 | |||
| 1787 | Ga0207658_10002550 | |||
| 1788 | Ga0207658_10005381 | |||
| 1789 | Ga0207658_10009479 | |||
| 1790 | Ga0207658_10086347 | |||
| 1791 | Ga0207658_10130025 | |||
| 1792 | Ga0207658_10195774 | |||
| 1793 | Ga0207677_10173486 | |||
| 1794 | Ga0207703_10001977 | |||
| 1795 | Ga0207703_10109804 | |||
| 1796 | Ga0207703_10540822 | |||
| 1797 | Ga0207639_10089225 | |||
| 1798 | Ga0207639_10438956 | |||
| 1799 | Ga0207639_11445655 | |||
| 1800 | Ga0207678_10014182 | |||
| 1801 | Ga0207678_10062609 | |||
| 1802 | Ga0207678_10081076 | |||
| 1803 | Ga0207678_10086490 | |||
| 1804 | Ga0207678_10361305 | |||
| 1805 | Ga0207678_10361306 | |||
| 1806 | Ga0207678_10368645 | |||
| 1807 | Ga0207678_10481879 | |||
| 1808 | Ga0207678_10752877 | |||
| 1809 | Ga0207708_10516679 | |||
| 1810 | Ga0207708_11724839 | |||
| 1811 | Ga0207702_10003021 | |||
| 1812 | Ga0207702_10034722 | |||
| 1813 | Ga0207702_10082689 | |||
| 1814 | Ga0207702_10182476 | |||
| 1815 | Ga0207702_10280373 | |||
| 1816 | Ga0207641_10000036 | |||
| 1817 | Ga0207641_10001914 | |||
| 1818 | Ga0207641_10002919 | |||
| 1819 | Ga0207641_10026844 | |||
| 1820 | Ga0207641_10047020 | |||
| 1821 | Ga0207641_10383474 | |||
| 1822 | Ga0207648_10384132 | |||
| 1823 | Ga0207676_10000006 | |||
| 1824 | Ga0207676_10000887 | |||
| 1825 | Ga0207676_10004014 | |||
| 1826 | Ga0207676_10136112 | |||
| 1827 | Ga0207676_11012475 | |||
| 1828 | Ga0207674_10037223 | |||
| 1829 | Ga0207674_10122043 | |||
| 1830 | Ga0207674_10152816 | |||
| 1831 | Ga0207674_10374507 | |||
| 1832 | Ga0207674_10480318 | |||
| 1833 | Ga0207674_10531816 | |||
| 1834 | Ga0207674_11701258 | |||
| 1835 | Ga0207675_100000221 | |||
| 1836 | Ga0207675_100001117 | |||
| 1837 | Ga0207675_100097949 | |||
| 1838 | Ga0207675_100564088 | |||
| 1839 | Ga0207683_10056958 | |||
| 1840 | Ga0207683_11333115 | |||
| 1841 | Ga0207683_12148952 | |||
| 1842 | Ga0207698_10001088 | |||
| 1843 | Ga0207698_10001432 | |||
| 1844 | Ga0207698_10016673 | |||
| 1845 | Ga0207698_10587584 | |||
| 1846 | Ga0209281_1042455 | |||
| 1847 | Ga0210002_1056761 | |||
| 1848 | Ga0209966_1099655 | |||
| 1849 | Ga0209998_10186520 | |||
| 1850 | Ga0209813_10000047 | |||
| 1851 | Ga0209974_10064225 | |||
| 1852 | Ga0268266_10000879 | |||
| 1853 | Ga0268266_10039920 | |||
| 1854 | Ga0268266_10175097 | |||
| 1855 | Ga0268266_11724146 | |||
| 1856 | Ga0268266_11870774 | |||
| 1857 | Ga0268265_10000001 | |||
| 1858 | Ga0268265_10000125 | |||
| 1859 | Ga0268265_10011465 | |||
| 1860 | Ga0268265_10051345 | |||
| 1861 | Ga0268265_10076395 | |||
| 1862 | Ga0268265_10430560 | |||
| 1863 | Ga0268265_11032239 | |||
| 1864 | Ga0268265_11922987 | |||
| 1865 | Ga0268264_10000347 | |||
| 1866 | Ga0268264_10005218 | |||
| 1867 | Ga0268264_10012633 | |||
| 1868 | Ga0268264_10062575 | |||
| 1869 | Ga0268264_10103721 | |||
| 1870 | Ga0268264_10133809 | |||
| 1871 | Ga0268264_12404327 | |||
| 1872 | Ga0265338_10366206 | |||
| 1873 | Ga0316180_1068718 | |||
| 1874 | Ga0307513_10044306 | |||
| 1875 | Ga0307408_100023913 | |||
| 1876 | Ga0307408_100247980 | |||
| 1877 | Ga0307408_100373128 | |||
| 1878 | Ga0307408_100634340 | |||
| 1879 | Ga0307408_101461325 | |||
| 1880 | Ga0307408_101902476 | |||
| 1881 | Ga0307408_101945598 | |||
| 1882 | Ga0307408_102466309 | |||
| 1883 | Ga0307405_10069109 | |||
| 1884 | Ga0307405_10086456 | |||
| 1885 | Ga0307405_10115978 | |||
| 1886 | Ga0307405_10163033 | |||
| 1887 | Ga0307405_10187789 | |||
| 1888 | Ga0307405_10194213 | |||
| 1889 | Ga0307405_10196596 | |||
| 1890 | Ga0307405_10963409 | |||
| 1891 | Ga0307405_11048792 | |||
| 1892 | Ga0307405_11731923 | |||
| 1893 | Ga0307413_10030876 | |||
| 1894 | Ga0307413_10043026 | |||
| 1895 | Ga0307413_10195307 | |||
| 1896 | Ga0307413_10210075 | |||
| 1897 | Ga0307413_10235334 | |||
| 1898 | Ga0307413_10285628 | |||
| 1899 | Ga0307413_10486341 | |||
| 1900 | Ga0307413_11042587 | |||
| 1901 | Ga0307413_11426460 | |||
| 1902 | Ga0307413_12053999 | |||
| 1903 | Ga0307410_10004670 | |||
| 1904 | Ga0307410_10039465 | |||
| 1905 | Ga0307410_10308422 | |||
| 1906 | Ga0307410_10314938 | |||
| 1907 | Ga0307410_10380325 | |||
| 1908 | Ga0307410_10685354 | |||
| 1909 | Ga0307410_11530911 | |||
| 1910 | Ga0307406_10074475 | |||
| 1911 | Ga0307406_10301492 | |||
| 1912 | Ga0307406_10389877 | |||
| 1913 | Ga0307406_10629288 | |||
| 1914 | Ga0307406_10672756 | |||
| 1915 | Ga0307406_10838775 | |||
| 1916 | Ga0307406_10867521 | |||
| 1917 | Ga0307406_11267540 | |||
| 1918 | Ga0307406_11587672 | |||
| 1919 | Ga0307406_11705939 | |||
| 1920 | Ga0307407_10074906 | |||
| 1921 | Ga0307407_10092921 | |||
| 1922 | Ga0307407_10150545 | |||
| 1923 | Ga0307407_10179491 | |||
| 1924 | Ga0307407_10272175 | |||
| 1925 | Ga0307407_10628125 | |||
| 1926 | Ga0307412_10000330 | |||
| 1927 | Ga0307412_10077051 | |||
| 1928 | Ga0307412_10110217 | |||
| 1929 | Ga0307412_10423101 | |||
| 1930 | Ga0307412_10505142 | |||
| 1931 | Ga0307412_10800071 | |||
| 1932 | Ga0307412_11054315 | |||
| 1933 | Ga0307412_11119425 | |||
| 1934 | Ga0307412_11316391 | |||
| 1935 | Ga0307412_11406462 | |||
| 1936 | Ga0307412_11943653 | |||
| 1937 | Ga0307412_11985012 | |||
| 1938 | Ga0307412_12194471 | |||
| 1939 | Ga0307409_100071909 | |||
| 1940 | Ga0307409_100115383 | |||
| 1941 | Ga0307409_100127526 | |||
| 1942 | Ga0307409_100136560 | |||
| 1943 | Ga0307409_100165191 | |||
| 1944 | Ga0307409_100601111 | |||
| 1945 | Ga0307409_102415976 | |||
| 1946 | Ga0307416_100030267 | |||
| 1947 | Ga0307416_100222558 | |||
| 1948 | Ga0307416_100877262 | |||
| 1949 | Ga0307416_101601608 | |||
| 1950 | Ga0307416_101747416 | |||
| 1951 | Ga0307416_101822002 | |||
| 1952 | Ga0307416_102722320 | |||
| 1953 | Ga0307416_103475503 | |||
| 1954 | Ga0307414_10000117 | |||
| 1955 | Ga0307414_10033711 | |||
| 1956 | Ga0307414_10075940 | |||
| 1957 | Ga0307414_10094751 | |||
| 1958 | Ga0307414_10154782 | |||
| 1959 | Ga0307414_10995308 | |||
| 1960 | Ga0307414_11024731 | |||
| 1961 | Ga0307414_11075915 | |||
| 1962 | Ga0307414_11312136 | |||
| 1963 | Ga0307411_10034694 | |||
| 1964 | Ga0307411_10046564 | |||
| 1965 | Ga0307411_10051008 | |||
| 1966 | Ga0307411_10628963 | |||
| 1967 | Ga0307411_10634356 | |||
| 1968 | Ga0307411_10807471 | |||
| 1969 | Ga0307411_11679718 | |||
| 1970 | Ga0307415_100050700 | |||
| 1971 | Ga0307415_100154075 | |||
| 1972 | Ga0307415_100329418 | |||
| 1973 | Ga0307415_100394269 | |||
| 1974 | Ga0307415_100848306 | |||
| 1975 | Ga0307415_101208521 | |||
| 1976 | Ga0307415_101265530 | |||
| 1977 | Ga0307415_101357190 | |||
| 1978 | Ga0307415_101829157 | |||
| 1979 | Ga0316583_10099043 | |||
| 1980 | Ga0316593_10146762 | |||
| 1981 | Ga0373940_0155251 | |||
| 1982 | Ga0373932_0021465 | |||
| 1983 | Ga0373953_0113089 | |||
| 1984 | Ga0373954_0089363 | |||
| 1985 | Ga0373956_0024664 | |||
| 1986 | Ga0373957_0027492 | |||
| 1987 | Ga0373955_0008414 | |||
| 1988 | Ga0373931_0322058 | |||
| 1989 | Ga0373933_0056561 | |||
| 1990 | Ga0373937_0004874 | |||
| 1991 | Ga0316582_0007349 | |||
| 1992 | Ga0316582_0575591 | |||
| 1993 | Ga0316584_0206101 | |||
| 1994 | Ga0395899_0021762 | |||
| 1995 | Ga0395899_0044175 | |||
| 1996 | Ga0395899_0100756 | |||
| 1997 | Ga0395899_0140215 | |||
| 1998 | Ga0395899_0153650 | |||
| 1999 | Ga0395899_0199433 | |||
| 2000 | Ga0395900_0000129 | |||
| 2001 | Ga0395900_0037171 | |||
| 2002 | Ga0395900_0086699 | |||
| 2003 | Ga0395900_0107296 | |||
| 2004 | Ga0395900_0114419 | |||
| 2005 | Ga0395900_0146188 | |||
| 2006 | Ga0395900_0459933 | |||
| 2007 | Ga0395900_0518365 | |||
| 2008 | Ga0395900_0531213 | |||
| 2009 | Ga0395900_0921487 | |||
| 2010 | Ga0395900_1290340 | |||
| 2011 | Ga0395898_0037825 | |||
| 2012 | Ga0395898_0064833 | |||
| 2013 | Ga0395898_0295219 | |||
| 2014 | Ga0395898_0386003 | |||
| 2015 | Ga0395898_0640393 | |||
| 2016 | Ga0395898_0722819 | |||
| 2017 | Ga0395898_1637197 | |||
| 2018 | Ga0395905_0025750 | |||
| 2019 | Ga0395905_0046000 | |||
| 2020 | Ga0395905_0130100 | |||
| 2021 | Ga0395905_0155152 | |||
| 2022 | Ga0395905_0352456 | |||
| 2023 | Ga0395905_0597559 | |||
| 2024 | Ga0395905_1415085 | |||
| 2025 | Ga0436364_0191800 | |||
| 2026 | Ga0436364_0684712 | |||
| 2027 | Ga0395901_0002264 | |||
| 2028 | Ga0395901_0068560 | |||
| 2029 | Ga0395901_0142895 | |||
| 2030 | Ga0395901_0147369 | |||
| 2031 | Ga0395901_0162228 | |||
| 2032 | Ga0395901_0351773 | |||
| 2033 | Ga0395901_0578985 | |||
| 2034 | Ga0395901_0997622 | |||
| 2035 | Ga0395901_1275939 | |||
| 2036 | Ga0436365_0184497 | |||
| 2037 | Ga0436365_0450653 | |||
| 2038 | Ga0436365_0580131 | |||
| 2039 | Ga0436365_1244318 | |||
| 2040 | Ga0436363_0358357 | |||
| 2041 | Ga0436362_0385235 | |||
| 2042 | Ga0439465_0334775 | |||
| 2043 | Ga0451790_28622 | |||
| 2044 | Ga0451807_0011806 | |||
| 2045 | Ga0451837_0351521 | |||
| 2046 | Ga0451839_1304614 | |||
| 2047 | Ga0451846_69758 | |||
| 2048 | Ga0451849_0595459 | |||
| 2049 | Ga0451843_0138888 | |||
| 2050 | Ga0451843_1021534 | |||
| 2051 | Ga0451853_3234207 | |||
| 2052 | Ga0451853_3599086 | |||
| 2053 | Ga0451853_3947895 | |||
| 2054 | Ga0439445_0003060 | |||
| 2055 | Ga0439445_0279442 | |||
| 2056 | Ga0439448_0008621 | |||
| 2057 | Ga0439448_0022837 | |||
| 2058 | Ga0439450_083826 | |||
| 2059 | Ga0439455_0033721 | |||
| 2060 | Ga0450919_027172 | |||
| 2061 | Ga0450922_024105 | |||
| 2062 | Ga0450896_035742 | |||
| 2063 | Ga0450902_057117 | |||
| 2064 | Ga0439446_0344644 | |||
| 2065 | Ga0439458_0001304 | |||
| 2066 | Ga0439458_0079831 | |||
| 2067 | Ga0450909_036264 | |||
| 2068 | Ga0450893_0022040 | |||
| 2069 | Ga0466969_0223310 | |||
| 2070 | Ga0466972_0013424 | |||
| 2071 | Ga0466973_0608614 | |||
| 2072 | Ga0466965_0309790 | |||
| 2073 | Ga0466966_0000003 | |||
| 2074 | Ga0466966_0002392 | |||
| 2075 | Ga0466966_0369278 | |||
| 2076 | Ga0466961_0098457 | |||
| 2077 | Ga0466963_0026446 | |||
| 2078 | Ga0466963_0211997 | |||
| 2079 | Ga0466964_0055158 | |||
| 2080 | Ga0466971_0016839 | |||
| 2081 | Ga0466971_0135148 | |||
| 2082 | Ga0466968_0070572 | |||
| 2083 | Ga0466970_0271138 | |||
| 2084 | Ga0466970_0422565 | |||
| 2085 | Ga0466957_0006798 | |||
| 2086 | Ga0466957_0015092 | |||
| 2087 | Ga0466957_0559603 | |||
| 2088 | Ga0466957_0799164 | |||
| 2089 | Ga0466960_0036448 | |||
| 2090 | Ga0466960_0147435 | |||
| 2091 | Ga0466960_0455960 | |||
| 2092 | Ga0466959_0101644 | |||
| 2093 | Ga0466959_0252297 | |||
| 2094 | Ga0466958_0014358 | |||
| 2095 | Ga0466967_0070609 | |||
| 2096 | Ga0466967_1578940 | |||
| 2097 | Ga0495627_000259 | |||
| 2098 | Ga0495627_001182 | |||
| 2099 | Ga0495629_1128117 | |||
| 2100 | Ga0495638_0151783 | |||
| 2101 | Ga0495638_0163241 | |||
| 2102 | Ga0495638_0241159 | |||
| 2103 | Ga0495650_0018352 | |||
| 2104 | Ga0495650_0242389 | |||
| 2105 | Ga0495584_0069703 | |||
| 2106 | Ga0495584_0595530 | |||
| 2107 | Ga0495585_0124421 | |||
| 2108 | Ga0495585_0212795 | |||
| 2109 | Ga0495596_0000054 | |||
| 2110 | Ga0495596_0007788 | |||
| 2111 | Ga0495607_0211118 | |||
| 2112 | Ga0495583_0164366 | |||
| 2113 | Ga0495606_0131411 | |||
| 2114 | Ga0495606_0133485 | |||
| 2115 | Ga0495606_0363718 | |||
| 2116 | Ga0495606_0428674 | |||
| 2117 | Ga0495610_0002336 | |||
| 2118 | Ga0495610_0107757 | |||
| 2119 | Ga0495620_0016521 | |||
| 2120 | Ga0495620_0047476 | |||
| 2121 | Ga0495620_0052278 | |||
| 2122 | Ga0495631_0113666 | |||
| 2123 | Ga0495632_0000095 | |||
| 2124 | Ga0495632_0111602 | |||
| 2125 | Ga0495637_0010393 | |||
| 2126 | Ga0495637_0291324 | |||
| 2127 | Ga0495643_0000038 | |||
| 2128 | Ga0495643_0018247 | |||
| 2129 | Ga0495648_0015595 | |||
| 2130 | Ga0495663_0000028 | |||
| 2131 | Ga0495663_0113344 | |||
| 2132 | Ga0495663_0135747 | |||
| 2133 | Ga0495654_0013841 | |||
| 2134 | Ga0495654_0114493 | |||
| 2135 | Ga0495598_0189653 | |||
| 2136 | Ga0495609_0078741 | |||
| 2137 | Ga0495609_0463555 | |||
| 2138 | Ga0495621_0083657 | |||
| 2139 | Ga0495633_0002760 | |||
| 2140 | Ga0495633_0032405 | |||
| 2141 | Ga0495668_0014797 | |||
| 2142 | Ga0495668_0055513 | |||
| 2143 | Ga0495668_0080044 | |||
| 2144 | Ga0495668_0283224 | |||
| 2145 | Ga0495625_0067721 | |||
| 2146 | Ga0495625_0068887 | |||
| 2147 | Ga0495625_0599845 | |||
| 2148 | Ga0495659_0221508 | |||
| 2149 | Ga0495669_0043715 | |||
| 2150 | Ga0495669_0088257 | |||
| 2151 | Ga0495670_0147361 | |||
| 2152 | Ga0495671_0000027 | |||
| 2153 | Ga0495671_0038864 | |||
| 2154 | Ga0495671_0526141 | |||
| 2155 | Ga0495589_0442145 | |||
| 2156 | Ga0495683_0233532 | |||
| 2157 | Ga0495677_0039987 | |||
| 2158 | Ga0495673_0056682 | |||
| 2159 | Ga0495673_0064355 | |||
| 2160 | Ga0495681_0000360 | |||
| 2161 | Ga0495681_0007198 | |||
| 2162 | Ga0495686_0210647 | |||
| 2163 | Ga0495686_0458233 | |||
| 2164 | Ga0495602_0018419 | |||
| 2165 | Ga0495615_0000152 | |||
| 2166 | Ga0495615_0116664 | |||
| 2167 | Ga0495626_0000356 | |||
| 2168 | Ga0496100_0970557 | |||
| 2169 | Ga0496101_1160668 | |||
| 2170 | Ga0496102_0000345 | |||
| 2171 | Ga0496102_0299968 | |||
| 2172 | Ga0496102_0734907 | |||
| 2173 | Ga0496103_0000276 | |||
| 2174 | Ga0496103_0018485 | |||
| 2175 | Ga0496105_0299993 | |||
| 2176 | Ga0496105_1101040 | |||
| 2177 | Ga0496107_0194813 | |||
| 2178 | Ga0496108_0008106 | |||
| 2179 | Ga0496108_0828440 | |||
| 2180 | Ga0496110_0839338 | |||
| 2181 | Ga0496111_1163764 | |||
| 2182 | Ga0496116_0000035 | |||
| 2183 | Ga0496116_0112128 | |||
| 2184 | Ga0496116_0173431 | |||
| 2185 | Ga0496117_0000633 | |||
| 2186 | Ga0496117_0051053 | |||
| 2187 | Ga0496118_0000654 | |||
| 2188 | Ga0496118_0051401 | |||
| 2189 | Ga0496118_0101608 | |||
| 2190 | Ga0496119_0041645 | |||
| 2191 | Ga0496120_0022737 | |||
| 2192 | Ga0496120_0424117 | |||
| 2193 | Ga0496121_0005190 | |||
| 2194 | Ga0496121_0040965 | |||
| 2195 | Ga0496121_0065515 | |||
| 2196 | Ga0496122_0008028 | |||
| 2197 | Ga0496122_0009631 | |||
| 2198 | Ga0496122_0253404 | |||
| 2199 | Ga0496123_0003623 | |||
| 2200 | Ga0496123_0128746 | |||
| 2201 | Ga0496123_0259398 | |||
| 2202 | Ga0496124_0000664 | |||
| 2203 | Ga0496124_0005247 | |||
| 2204 | Ga0496124_0068836 | |||
| 2205 | Ga0496124_0406309 | |||
| 2206 | Ga0496124_0470881 | |||
| 2207 | Ga0496125_0024671 | |||
| 2208 | Ga0496125_0070773 | |||
| 2209 | Ga0496125_0072995 | |||
| 2210 | Ga0496125_0129339 | |||
| 2211 | Ga0496126_0000084 | |||
| 2212 | Ga0496126_0077669 | |||
| 2213 | Ga0496126_0148093 | |||
| 2214 | Ga0496126_0954748 | |||
| 2215 | Ga0501306_000053 | |||
| 2216 | Ga0501306_012159 | |||
| 2217 | Ga0501306_025058 | |||
| 2218 | Ga0501306_032502 | |||
| 2219 | Ga0501306_063453 | |||
| 2220 | Ga0501308_057456 | |||
| 2221 | Ga0501309_044663 | |||
| 2222 | Ga0501310_007822 | |||
| 2223 | Ga0501304_012847 | |||
| 2224 | Ga0501304_024531 | |||
| 2225 | Ga0501305_001454 | |||
| 2226 | Ga0501305_064900 | |||
| 2227 | Ga0501305_066351 | |||
| 2228 | Ga0501307_000852 | |||
| 2229 | Ga0501307_032560 | |||
| 2230 | Ga0501307_091012 | |||
| 2231 | Ga0495678_085298 | |||
| 2232 | Ga0495682_0166508 | |||
| 2233 | Ga0501312_007670 | |||
| 2234 | Ga0501313_004418 | |||
| 2235 | Ga0501314_000002 | |||
| 2236 | Ga0501315_043192 | |||
| 2237 | Ga0501315_068769 | |||
| 2238 | Ga0501315_070322 | |||
| 2239 | Ga0501315_074801 | |||
| 2240 | Ga0501316_030404 | |||
| 2241 | Ga0501317_012033 | |||
| 2242 | Ga0501320_019698 | |||
| 2243 | Ga0501321_020722 | |||
| 2244 | Ga0501322_012811 | |||
| 2245 | Ga0501323_086220 | |||
| 2246 | Ga0501324_045614 | |||
| 2247 | Ga0501325_010463 | |||
| 2248 | Ga0501325_010745 | |||
| 2249 | Ga0501325_018626 | |||
| 2250 | Ga0501336_010484 | |||
| 2251 | Ga0501337_023773 | |||
| 2252 | Ga0501032_0426180 | |||
| 2253 | Ga0501033_1167178 | |||
| 2254 | Ga0501034_0025412 | |||
| 2255 | Ga0501036_0618656 | |||
| 2256 | Ga0501040_0898140 | |||
| 2257 | Ga0501040_0908845 | |||
| 2258 | Ga0501043_0158164 | |||
| 2259 | Ga0501043_0933708 | |||
| 2260 | Ga0501047_0050927 | |||
| 2261 | Ga0501047_0259693 | |||
| 2262 | Ga0501048_1264682 | |||
| 2263 | Ga0501074_0762731 | |||
| 2264 | Ga0501201_011764 | |||
| 2265 | Ga0501223_000394 | |||
| 2266 | Ga0501224_000009 | |||
| 2267 | Ga0501224_000719 | |||
| 2268 | Ga0501224_027715 | |||
| 2269 | Ga0501227_140768 | |||
| 2270 | Ga0501233_000604 | |||
| 2271 | Ga0501235_004379 | |||
| 2272 | Ga0501239_075300 | |||
| 2273 | Ga0501249_001523 | |||
| 2274 | Ga0501249_010685 | |||
| 2275 | Ga0501253_010293 | |||
| 2276 | Ga0501257_161869 | |||
| 2277 | Ga0501258_023728 | |||
| 2278 | Ga0501219_022019 | |||
| 2279 | Ga0501221_033559 | |||
| 2280 | Ga0501225_0000094 | |||
| 2281 | Ga0501229_076171 | |||
| 2282 | Ga0501234_001131 | |||
| 2283 | Ga0501035_0370772 | |||
| 2284 | Ga0501204_061270 | |||
| 2285 | Ga0501226_000076 | |||
| 2286 | nmdc:mga03683_594937_c1 | |||
| 2287 | nmdc:mga00v17_3048_c1 | |||
| 2288 | nmdc:mga0k408_176220_c1 | |||
| 2289 | nmdc:mga06z11_517_c1 | |||
| 2290 | nmdc:mga06z11_814486_c1 | |||
| 2291 | nmdc:mga04h51_91_c1 | |||
| 2292 | nmdc:mga07m45_164_c1 | |||
| 2293 | nmdc:mga08y16_1224882_c1 | |||
| 2294 | nmdc:mga08y16_134827_c1 | |||
| 2295 | nmdc:mga08y16_693902_c1 | |||
| 2296 | nmdc:mga0sz30_167_c1 | |||
| 2297 | nmdc:mga0sz30_208022_c1 | |||
| 2298 | Ga0500643_000004 | |||
| 2299 | Ga0500643_009338 | |||
| 2300 | Ga0500643_065741 | |||
| 2301 | Ga0500643_065742 | |||
| 2302 | Ga0500643_217418 | |||
| 2303 | Ga0500647_0087398 | |||
| 2304 | Ga0500562_030207 | |||
| 2305 | Ga0500592_028741 | |||
| 2306 | Ga0500594_0254736 | |||
| 2307 | Ga0500607_005191 | |||
| 2308 | Ga0500608_272960 | |||
| 2309 | Ga0500642_0236906 | |||
| 2310 | Ga0500559_0054969 | |||
| 2311 | Ga0500568_0081765 | |||
| 2312 | Ga0500577_0090467 | |||
| 2313 | Ga0500590_028297 | |||
| 2314 | Ga0500590_096832 | |||
| 2315 | Ga0500604_0076435 | |||
| 2316 | Ga0500616_0047383 | |||
| 2317 | Ga0500616_0211652 | |||
| 2318 | Ga0500627_0000200 | |||
| 2319 | Ga0500637_0035961 | |||
| 2320 | Ga0500611_007703 | |||
| 2321 | Ga0500645_004674 | |||
| 2322 | Ga0590071_043319 | |||
| 2323 | Ga0590071_139620 | |||
| 2324 | Ga0587090_056272 | |||
| 2325 | Ga0587125_054900 | |||
| 2326 | Ga0587101_016307 | |||
| 2327 | Ga0587101_144166 | |||
| 2328 | Ga0587115_093744 | |||
| 2329 | Ga0587128_013345 | |||
| 2330 | Ga0587128_041590 | |||
| 2331 | Ga0587128_046280 | |||
| 2332 | Ga0587076_042893 | |||
| 2333 | Ga0587079_104329 | |||
| 2334 | Ga0587107_056217 | |||
| 2335 | Ga0587114_113522 | |||
| 2336 | Ga0587124_013523 | |||
| 2337 | Ga0587071_065086 | |||
| 2338 | Ga0587071_100812 | |||
| 2339 | Ga0466962_0022154 | |||
| 2340 | Ga0466962_0156175 | |||
| 2341 | 2511127736 | |||
| 2342 | 2643729044 | |||
| 2343 | 2644039619 | |||
| 2344 | 2644045057 | |||
| 2345 | 2644391230 | |||
| 2346 | 2819552564 | |||
| 2347 | 2830079059 | |||
| 2348 | 2919712487 | |||
| 2349 | 3000866851 | |||
| 2350 | 8054304447 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9284 | 14 | 95 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9223 | 15 | 102 |
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9213 | 14 | 99 |
| 6spb-assembly1.cif.gz_T | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9205 | 13 | 101 |
| 6enj-assembly1.cif.gz_T | polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) | 0.9138 | 11 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8947 | 14 | 100 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8923 | 15 | 101 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8892 | 12 | 100 | 3.30.70.330 |
| af_P54016_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8667 | 15 | 99 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8554 | 15 | 101 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G0GSI5-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9494 | 15 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E1VV25-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9434 | 15 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G2LBI1-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9434 | 18 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1V6G130-F1-model_v4 | deleted | 0.9433 | 15 | 102 |
|
| AF-A0A1U7NLE2-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9423 | 15 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |