F491306

General Info

Members Datasets Scaffolds Average Seq Length
1181 393 2362 199

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10022659|Ga0316575_100226592
Length 232
Sequence MTTRKDLPTIQGLEAGADTGPPRSWLTTRIDYLVNWSRRNSIWPMPFGTACCAIEMMAAAASKYDLARFGMERFSFSPRQADLMIVAGRVSYKLAPIMRRVWDQMPQPKWCVSMGACASSGGMFDNYTIMQGIDQVVPVDVYVPGCPPRPESLIYALLMVQEKIKGESLVNPELRAENPDAVGRPNLPPEAIELVAQPFGNSTRQNRVSGAEPSGAILRPRDRLERLLEHQD

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
109 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
228 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
234 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
235 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
236 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
237 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
238 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
304 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
305 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
387 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
388 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
389 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 5.17
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10022659 3300031665 Bacteria 2425
2 ARCol0yngRDRAFT_1002425 3300000652 Bacteria 1407
3 JGI24743J22301_10005078 3300001991 Bacteria 2180
4 JGI24738J21930_10006594 3300002075 Bacteria 2709
5 JGI24744J21845_10021288 3300002077 Bacteria 1276
6 JGI24742J22300_10042329 3300002244 Bacteria 813
7 JGI25406J46586_10018384 3300003203 Bacteria 2872
8 JGI25407J50210_10012285 3300003373 Bacteria 2194
9 Ga0058859_11627522 3300004798 Bacteria 840
10 Ga0070658_10873762 3300005327 Bacteria 782
11 Ga0070676_10023233 3300005328 Bacteria 3483
12 Ga0070676_10269177 3300005328 Bacteria 1144
13 Ga0070676_10590613 3300005328 Bacteria 800
14 Ga0070683_100005546 3300005329 Bacteria 10542
15 Ga0070683_100029977 3300005329 Bacteria 4933
16 Ga0070683_100056097 3300005329 Bacteria 3658
17 Ga0070683_100143903 3300005329 Bacteria 2259
18 Ga0070683_100175783 3300005329 Bacteria 2032
19 Ga0070683_100616662 3300005329 Bacteria 1038
20 Ga0070690_100026598 3300005330 Bacteria 3570
21 Ga0070670_100005260 3300005331 Bacteria 10898
22 Ga0070670_100046103 3300005331 Bacteria 3748
23 Ga0070670_100134981 3300005331 Bacteria 2132
24 Ga0070677_10272159 3300005333 Bacteria 850
25 Ga0070666_10247381 3300005335 Bacteria 1262
26 Ga0070680_100018352 3300005336 Bacteria 5526
27 Ga0070680_100221084 3300005336 Bacteria 1599
28 Ga0070682_100032170 3300005337 Bacteria 3178
29 Ga0070682_100062128 3300005337 Bacteria 2365
30 Ga0070682_100512555 3300005337 Bacteria 931
31 Ga0068868_100036772 3300005338 Bacteria 3793
32 Ga0068868_100205820 3300005338 Bacteria 1642
33 Ga0070660_100049813 3300005339 Bacteria 3221
34 Ga0070660_100475826 3300005339 Bacteria 1038
35 Ga0070660_100603847 3300005339 Bacteria 917
36 Ga0070689_100032108 3300005340 Bacteria 3993
37 Ga0070689_100037066 3300005340 Bacteria 3729
38 Ga0070689_100151456 3300005340 Bacteria 1870
39 Ga0070689_100321806 3300005340 Bacteria 1292
40 Ga0070689_100489914 3300005340 Bacteria 1051
41 Ga0070691_10002704 3300005341 Bacteria 7901
42 Ga0070691_10014431 3300005341 Bacteria 3624
43 Ga0070691_10122319 3300005341 Bacteria 1312
44 Ga0070691_10193669 3300005341 Bacteria 1065
45 Ga0070687_100075234 3300005343 Bacteria 1825
46 Ga0070687_100128508 3300005343 Bacteria 1460
47 Ga0070661_100014032 3300005344 Bacteria 5635
48 Ga0070661_100092587 3300005344 Bacteria 2239
49 Ga0070661_100133575 3300005344 Bacteria 1866
50 Ga0070661_100152288 3300005344 Bacteria 1749
51 Ga0070661_100728484 3300005344 Bacteria 809
52 Ga0070692_10029463 3300005345 Bacteria 2736
53 Ga0070692_10047881 3300005345 Bacteria 2213
54 Ga0070692_10122068 3300005345 Bacteria 1454
55 Ga0070692_10414574 3300005345 Bacteria 853
56 Ga0070668_100012259 3300005347 Bacteria 6387
57 Ga0070668_100275474 3300005347 Bacteria 1404
58 Ga0070669_100479785 3300005353 Bacteria 1029
59 Ga0070675_100010174 3300005354 Bacteria 7336
60 Ga0070675_100029856 3300005354 Bacteria 4398
61 Ga0070675_100032976 3300005354 Bacteria 4195
62 Ga0070675_100053892 3300005354 Bacteria 3308
63 Ga0070675_100201152 3300005354 Bacteria 1729
64 Ga0070671_100091611 3300005355 Bacteria 2547
65 Ga0070671_100159545 3300005355 Bacteria 1906
66 Ga0070671_100301755 3300005355 Bacteria 1364
67 Ga0070671_100414692 3300005355 Bacteria 1153
68 Ga0070674_100015824 3300005356 Bacteria 4717
69 Ga0070674_100019120 3300005356 Bacteria 4346
70 Ga0070674_100019153 3300005356 Bacteria 4343
71 Ga0070674_100043387 3300005356 Bacteria 3059
72 Ga0070674_100142421 3300005356 Bacteria 1801
73 Ga0070673_100062762 3300005364 Bacteria 2953
74 Ga0070673_100211907 3300005364 Bacteria 1674
75 Ga0070673_100922438 3300005364 Bacteria 811
76 Ga0070688_100002799 3300005365 Bacteria 8863
77 Ga0070688_100003836 3300005365 Bacteria 7792
78 Ga0070688_100006907 3300005365 Bacteria 6094
79 Ga0070688_100672043 3300005365 Bacteria 799
80 Ga0070659_100014825 3300005366 Bacteria 5828
81 Ga0070659_100047003 3300005366 Bacteria 3384
82 Ga0070659_100156837 3300005366 Bacteria 1859
83 Ga0070659_100380009 3300005366 Bacteria 1189
84 Ga0070659_100669995 3300005366 Bacteria 895
85 Ga0070703_10135765 3300005406 Bacteria 909
86 Ga0070701_10013500 3300005438 Bacteria 3718
87 Ga0070701_10017099 3300005438 Bacteria 3385
88 Ga0070701_10048033 3300005438 Bacteria 2200
89 Ga0070701_10078903 3300005438 Bacteria 1777
90 Ga0070705_100040177 3300005440 Bacteria 2659
91 Ga0070705_100265730 3300005440 Bacteria 1212
92 Ga0070700_100036179 3300005441 Bacteria 2992
93 Ga0070700_100055466 3300005441 Bacteria 2480
94 Ga0070700_100131831 3300005441 Bacteria 1688
95 Ga0070694_100714969 3300005444 Bacteria 815
96 Ga0070678_100011153 3300005456 Bacteria 5532
97 Ga0070678_100142667 3300005456 Bacteria 1919
98 Ga0070678_100442723 3300005456 Bacteria 1137
99 Ga0070678_100670693 3300005456 Bacteria 932
100 Ga0070662_100002641 3300005457 Bacteria 11051
101 Ga0070662_100038958 3300005457 Bacteria 3379
102 Ga0070662_100422723 3300005457 Bacteria 1103
103 Ga0070681_10055522 3300005458 Bacteria 3943
104 Ga0070681_10101363 3300005458 Bacteria 2825
105 Ga0070681_10383742 3300005458 Bacteria 1316
106 Ga0068867_100009644 3300005459 Bacteria 6806
107 Ga0068867_100031551 3300005459 Bacteria 3827
108 Ga0068867_100052688 3300005459 Bacteria 3003
109 Ga0068867_100131312 3300005459 Bacteria 1947
110 Ga0068867_100149059 3300005459 Bacteria 1836
111 Ga0068867_100256647 3300005459 Bacteria 1423
112 Ga0070685_10051549 3300005466 Bacteria 2379
113 Ga0070685_10054937 3300005466 Bacteria 2312
114 Ga0070685_10076741 3300005466 Bacteria 1993
115 Ga0070707_100363228 3300005468 Bacteria 1406
116 Ga0070707_100577446 3300005468 Bacteria 1086
117 Ga0070698_100071396 3300005471 Bacteria 3482
118 Ga0070679_100009974 3300005530 Bacteria 8991
119 Ga0070679_100072153 3300005530 Bacteria 3444
120 Ga0070679_100163418 3300005530 Bacteria 2200
121 Ga0070684_100012891 3300005535 Bacteria 6720
122 Ga0070684_100032453 3300005535 Bacteria 4451
123 Ga0070684_100035997 3300005535 Bacteria 4240
124 Ga0070684_100036248 3300005535 Bacteria 4226
125 Ga0070684_100052634 3300005535 Bacteria 3541
126 Ga0070684_100114159 3300005535 Bacteria 2424
127 Ga0070684_100131796 3300005535 Bacteria 2255
128 Ga0070684_100153885 3300005535 Bacteria 2084
129 Ga0070684_100299901 3300005535 Bacteria 1474
130 Ga0070684_100345313 3300005535 Bacteria 1368
131 Ga0068853_100063858 3300005539 Bacteria 3190
132 Ga0068853_100070313 3300005539 Bacteria 3046
133 Ga0070672_100038700 3300005543 Bacteria 3647
134 Ga0070672_100063464 3300005543 Bacteria 2917
135 Ga0070672_100068879 3300005543 Bacteria 2807
136 Ga0070672_100659057 3300005543 Bacteria 914
137 Ga0070686_100012648 3300005544 Bacteria 4812
138 Ga0070686_100042346 3300005544 Bacteria 2852
139 Ga0070686_100177552 3300005544 Bacteria 1511
140 Ga0070686_100984453 3300005544 Bacteria 691
141 Ga0070695_100020417 3300005545 Bacteria 4045
142 Ga0070695_100049615 3300005545 Bacteria 2687
143 Ga0070695_100134261 3300005545 Bacteria 1709
144 Ga0070695_100440034 3300005545 Bacteria 997
145 Ga0070696_100044339 3300005546 Bacteria 3080
146 Ga0070696_100050831 3300005546 Bacteria 2882
147 Ga0070696_100073026 3300005546 Bacteria 2416
148 Ga0070696_100120356 3300005546 Bacteria 1900
149 Ga0070696_100187549 3300005546 Bacteria 1538
150 Ga0070693_100012465 3300005547 Bacteria 4302
151 Ga0070693_100034757 3300005547 Bacteria 2791
152 Ga0070693_100066309 3300005547 Bacteria 2112
153 Ga0070693_100162485 3300005547 Bacteria 1423
154 Ga0070693_100624574 3300005547 Bacteria 781
155 Ga0070665_100074294 3300005548 Bacteria 3405
156 Ga0070665_100133125 3300005548 Bacteria 2488
157 Ga0070665_100178830 3300005548 Bacteria 2122
158 Ga0070704_100020903 3300005549 Bacteria 4232
159 Ga0070704_100029456 3300005549 Bacteria 3666
160 Ga0070704_100059213 3300005549 Bacteria 2731
161 Ga0070704_100095398 3300005549 Bacteria 2228
162 Ga0070704_100234986 3300005549 Bacteria 1497
163 Ga0068855_100073422 3300005563 Bacteria 3974
164 Ga0068855_100164335 3300005563 Bacteria 2517
165 Ga0068855_100372779 3300005563 Bacteria 1568
166 Ga0070664_100026590 3300005564 Bacteria 4801
167 Ga0070664_100028840 3300005564 Bacteria 4622
168 Ga0070664_100065856 3300005564 Bacteria 3092
169 Ga0070664_100199859 3300005564 Bacteria 1784
170 Ga0068857_100164638 3300005577 Bacteria 2013
171 Ga0068857_100263390 3300005577 Bacteria 1583
172 Ga0068857_100264741 3300005577 Bacteria 1579
173 Ga0068857_100335282 3300005577 Bacteria 1398
174 Ga0068857_100357923 3300005577 Bacteria 1353
175 Ga0068857_100461603 3300005577 Bacteria 1188
176 Ga0068854_100061393 3300005578 Bacteria 2722
177 Ga0068854_100098863 3300005578 Bacteria 2184
178 Ga0068856_100073341 3300005614 Bacteria 3389
179 Ga0068856_100218403 3300005614 Bacteria 1921
180 Ga0070702_100018607 3300005615 Bacteria 3606
181 Ga0070702_100209306 3300005615 Bacteria 1297
182 Ga0070702_100257818 3300005615 Bacteria 1186
183 Ga0068852_100409244 3300005616 Bacteria 1336
184 Ga0068852_100445146 3300005616 Bacteria 1281
185 Ga0068859_100037113 3300005617 Bacteria 4890
186 Ga0068859_100054125 3300005617 Bacteria 4036
187 Ga0068859_100062509 3300005617 Bacteria 3754
188 Ga0068864_100107532 3300005618 Bacteria 2481
189 Ga0068866_10040244 3300005718 Bacteria 2313
190 Ga0068866_10060668 3300005718 Bacteria 1962
191 Ga0068866_10061852 3300005718 Bacteria 1946
192 Ga0068861_100001783 3300005719 Bacteria 13846
193 Ga0068861_100014938 3300005719 Bacteria 5459
194 Ga0068861_100018490 3300005719 Bacteria 4965
195 Ga0068861_100381177 3300005719 Bacteria 1246
196 Ga0068861_100654943 3300005719 Bacteria 971
197 Ga0068851_10412210 3300005834 Bacteria 797
198 Ga0068870_10013596 3300005840 Bacteria 3829
199 Ga0068870_10018387 3300005840 Bacteria 3374
200 Ga0068870_10248053 3300005840 Bacteria 1102
201 Ga0068863_100031864 3300005841 Bacteria 5028
202 Ga0068863_100167584 3300005841 Bacteria 2107
203 Ga0068860_100033315 3300005843 Bacteria 4945
204 Ga0068860_100268433 3300005843 Bacteria 1665
205 Ga0068860_100507446 3300005843 Bacteria 1205
206 Ga0068860_100815868 3300005843 Bacteria 947
207 Ga0068862_100548509 3300005844 Bacteria 1103
208 Ga0081455_10019559 3300005937 Bacteria 6403
209 Ga0081455_10020013 3300005937 Bacteria 6317
210 Ga0081455_10024399 3300005937 Bacteria 5601
211 Ga0081455_10421009 3300005937 Bacteria 921
212 Ga0081538_10000094 3300005981 Bacteria 86715
213 Ga0081538_10000151 3300005981 Bacteria 72583
214 Ga0081538_10002077 3300005981 Bacteria 19957
215 Ga0081538_10003829 3300005981 Bacteria 14051
216 Ga0081538_10010054 3300005981 Bacteria 7801
217 Ga0081538_10020527 3300005981 Bacteria 4856
218 Ga0081540_1014346 3300005983 Bacteria 5081
219 Ga0081539_10000200 3300005985 Bacteria 139291
220 Ga0081539_10000397 3300005985 Bacteria 93458
221 Ga0070717_10033890 3300006028 Bacteria 4123
222 Ga0070717_11128852 3300006028 Bacteria 714
223 Ga0075365_10156996 3300006038 Bacteria 1584
224 Ga0075365_10230865 3300006038 Bacteria 1299
225 Ga0075364_10074048 3300006051 Bacteria 2245
226 Ga0075364_10104093 3300006051 Bacteria 1891
227 Ga0075364_10316452 3300006051 Bacteria 1063
228 Ga0075432_10003491 3300006058 Bacteria 5320
229 Ga0075432_10053088 3300006058 Bacteria 1433
230 Ga0070715_10130771 3300006163 Bacteria 1208
231 Ga0070712_100477707 3300006175 Bacteria 1041
232 Ga0075362_10154240 3300006177 Bacteria 1103
233 Ga0097621_100910277 3300006237 Bacteria 820
234 Ga0068871_100359882 3300006358 Bacteria 1289
235 Ga0068871_100370812 3300006358 Bacteria 1270
236 Ga0075428_100037530 3300006844 Bacteria 5334
237 Ga0075428_100180483 3300006844 Bacteria 2285
238 Ga0075428_100299372 3300006844 Bacteria 1729
239 Ga0075428_100331976 3300006844 Bacteria 1633
240 Ga0075428_100455763 3300006844 Bacteria 1370
241 Ga0075428_101045410 3300006844 Bacteria 864
242 Ga0075428_101585647 3300006844 Bacteria 685
243 Ga0075430_100049513 3300006846 Bacteria 3546
244 Ga0075430_100058265 3300006846 Bacteria 3247
245 Ga0075431_100008692 3300006847 Bacteria 10176
246 Ga0075431_100051547 3300006847 Bacteria 4243
247 Ga0075431_100233704 3300006847 Bacteria 1872
248 Ga0075433_10034898 3300006852 Bacteria 4322
249 Ga0075433_10043840 3300006852 Bacteria 3885
250 Ga0075433_10052279 3300006852 Bacteria 3559
251 Ga0075433_10212346 3300006852 Bacteria 1719
252 Ga0075433_10235240 3300006852 Bacteria 1626
253 Ga0075434_100003398 3300006871 Bacteria 14255
254 Ga0075434_100042219 3300006871 Bacteria 4521
255 Ga0075434_100049702 3300006871 Bacteria 4164
256 Ga0075434_100056902 3300006871 Bacteria 3886
257 Ga0075434_100077917 3300006871 Bacteria 3310
258 Ga0075434_100546095 3300006871 Bacteria 1178
259 Ga0075429_100062846 3300006880 Bacteria 3235
260 Ga0075429_100104768 3300006880 Bacteria 2471
261 Ga0075429_100138319 3300006880 Bacteria 2132
262 Ga0075429_100173429 3300006880 Bacteria 1889
263 Ga0075429_100452785 3300006880 Bacteria 1125
264 Ga0075429_100695599 3300006880 Bacteria 891
265 Ga0068865_100011940 3300006881 Bacteria 5453
266 Ga0068865_100037576 3300006881 Bacteria 3270
267 Ga0068865_100056517 3300006881 Bacteria 2734
268 Ga0068865_100097545 3300006881 Bacteria 2145
269 Ga0068865_100197248 3300006881 Bacteria 1561
270 Ga0068865_100676185 3300006881 Bacteria 880
271 Ga0075436_100059443 3300006914 Bacteria 2640
272 Ga0075436_100522717 3300006914 Bacteria 870
273 Ga0097620_100037113 3300006931 Bacteria 4890
274 Ga0097620_100054125 3300006931 Bacteria 4036
275 Ga0097620_100062508 3300006931 Bacteria 3754
276 Ga0075435_100012793 3300007076 Bacteria 6217
277 Ga0075435_100409045 3300007076 Bacteria 1168
278 Ga0105240_10024285 3300009093 Bacteria 7996
279 Ga0105240_10042861 3300009093 Bacteria 5765
280 Ga0111539_10008714 3300009094 Bacteria 12869
281 Ga0111539_10151517 3300009094 Bacteria 2714
282 Ga0111539_10153773 3300009094 Bacteria 2692
283 Ga0111539_10165941 3300009094 Bacteria 2582
284 Ga0111539_10282661 3300009094 Bacteria 1931
285 Ga0111539_10352157 3300009094 Bacteria 1714
286 Ga0111539_10416492 3300009094 Bacteria 1565
287 Ga0105245_10070989 3300009098 Bacteria 3162
288 Ga0105245_10165862 3300009098 Bacteria 2100
289 Ga0105245_10185696 3300009098 Bacteria 1989
290 Ga0105245_10230601 3300009098 Bacteria 1791
291 Ga0105245_10606230 3300009098 Bacteria 1122
292 Ga0114129_10008166 3300009147 Bacteria 14913
293 Ga0114129_10031268 3300009147 Bacteria 7528
294 Ga0114129_10141390 3300009147 Bacteria 3299
295 Ga0114129_10157426 3300009147 Bacteria 3106
296 Ga0114129_10291515 3300009147 Bacteria 2178
297 Ga0114129_10681671 3300009147 Bacteria 1323
298 Ga0114129_11236421 3300009147 Bacteria 929
299 Ga0114129_11672445 3300009147 Bacteria 777
300 Ga0105243_10007592 3300009148 Bacteria 8337
301 Ga0105243_10077699 3300009148 Bacteria 2700
302 Ga0105243_10087909 3300009148 Bacteria 2552
303 Ga0105243_10139040 3300009148 Bacteria 2070
304 Ga0105241_10227272 3300009174 Bacteria 1572
305 Ga0105242_10073834 3300009176 Bacteria 2837
306 Ga0105242_10159104 3300009176 Bacteria 1975
307 Ga0105242_10860060 3300009176 Bacteria 903
308 Ga0105242_10864420 3300009176 Bacteria 901
309 Ga0105248_10105467 3300009177 Bacteria 3177
310 Ga0105248_10272386 3300009177 Bacteria 1906
311 Ga0105248_10700432 3300009177 Bacteria 1143
312 Ga0105238_10118379 3300009551 Bacteria 2629
313 Ga0105238_10145128 3300009551 Bacteria 2350
314 Ga0105238_10523943 3300009551 Bacteria 1188
315 Ga0105249_10001703 3300009553 Bacteria 19257
316 Ga0105249_10144708 3300009553 Bacteria 2282
317 Ga0105030_105611 3300009987 Bacteria 1063
318 Ga0105239_10053016 3300010375 Bacteria 4449
319 Ga0105239_10082737 3300010375 Bacteria 3535
320 Ga0105239_10083336 3300010375 Bacteria 3521
321 Ga0105239_10096795 3300010375 Bacteria 3261
322 Ga0105239_10145998 3300010375 Bacteria 2638
323 Ga0105246_10040213 3300011119 Bacteria 3154
324 Ga0105246_10097572 3300011119 Bacteria 2133
325 Ga0105246_10339793 3300011119 Bacteria 1227
326 Ga0157313_1013765 3300012503 Bacteria 738
327 Ga0157326_1019773 3300012513 Bacteria 823
328 Ga0157373_10454209 3300013100 Bacteria 922
329 Ga0157371_10020304 3300013102 Bacteria 4890
330 Ga0157371_10024782 3300013102 Bacteria 4377
331 Ga0157371_10241373 3300013102 Bacteria 1300
332 Ga0157370_10091450 3300013104 Bacteria 2857
333 Ga0157370_10238397 3300013104 Bacteria 1683
334 Ga0157369_10186118 3300013105 Bacteria 2184
335 Ga0157369_10233037 3300013105 Bacteria 1924
336 Ga0157369_10409251 3300013105 Bacteria 1407
337 Ga0157378_10378108 3300013297 Bacteria 1390
338 Ga0157378_10380363 3300013297 Bacteria 1386
339 Ga0157378_10472205 3300013297 Bacteria 1248
340 Ga0163162_10188658 3300013306 Bacteria 2189
341 Ga0163162_10527246 3300013306 Bacteria 1310
342 Ga0163162_10548075 3300013306 Bacteria 1285
343 Ga0157372_10258409 3300013307 Bacteria 2022
344 Ga0157372_10350676 3300013307 Bacteria 1719
345 Ga0157372_10397006 3300013307 Bacteria 1607
346 Ga0157375_10142125 3300013308 Bacteria 2528
347 Ga0163163_10044422 3300014325 Bacteria 4359
348 Ga0163163_10096782 3300014325 Bacteria 2972
349 Ga0163163_11214996 3300014325 Bacteria 816
350 Ga0157380_10006119 3300014326 Bacteria 8436
351 Ga0157380_10028368 3300014326 Bacteria 4266
352 Ga0157380_10037771 3300014326 Bacteria 3744
353 Ga0157380_10156439 3300014326 Bacteria 1976
354 Ga0182008_10028595 3300014497 Bacteria 2819
355 Ga0182008_10474710 3300014497 Bacteria 684
356 Ga0157377_10026140 3300014745 Bacteria 3121
357 Ga0157377_10047370 3300014745 Bacteria 2408
358 Ga0157377_10070458 3300014745 Bacteria 2020
359 Ga0157376_10062225 3300014969 Bacteria 3140
360 Ga0157376_10289248 3300014969 Bacteria 1546
361 Ga0157376_10335002 3300014969 Bacteria 1443
362 Ga0182006_1004688 3300015261 Bacteria 6695
363 Ga0182007_10030600 3300015262 Bacteria 1838
364 Ga0163161_10043707 3300017792 Bacteria 3226
365 Ga0163161_10123803 3300017792 Bacteria 1945
366 Ga0163161_10297645 3300017792 Bacteria 1270
367 Ga0206356_10084031 3300020070 Bacteria 1914
368 Ga0206356_11880732 3300020070 Bacteria 3149
369 Ga0206353_10050886 3300020082 Bacteria 7987
370 Ga0224712_10048328 3300022467 Bacteria 1642
371 Ga0207656_10004884 3300025321 Bacteria 4705
372 Ga0207653_10041888 3300025885 Bacteria 1505
373 Ga0207682_10069089 3300025893 Bacteria 1493
374 Ga0207642_10010501 3300025899 Bacteria 3267
375 Ga0207642_10096570 3300025899 Bacteria 1473
376 Ga0207642_10481324 3300025899 Bacteria 757
377 Ga0207688_10008842 3300025901 Bacteria 5481
378 Ga0207688_10009411 3300025901 Bacteria 5319
379 Ga0207688_10087309 3300025901 Bacteria 1788
380 Ga0207680_10392933 3300025903 Bacteria 979
381 Ga0207645_10021117 3300025907 Bacteria 4251
382 Ga0207645_10217501 3300025907 Bacteria 1259
383 Ga0207645_10473928 3300025907 Bacteria 846
384 Ga0207643_10023824 3300025908 Bacteria 3378
385 Ga0207643_10097326 3300025908 Bacteria 1722
386 Ga0207705_10058502 3300025909 Bacteria 2780
387 Ga0207705_10177987 3300025909 Bacteria 1604
388 Ga0207654_10215489 3300025911 Bacteria 1271
389 Ga0207707_10019074 3300025912 Bacteria 5985
390 Ga0207707_10065796 3300025912 Bacteria 3156
391 Ga0207707_10116061 3300025912 Bacteria 2339
392 Ga0207707_10588923 3300025912 Bacteria 942
393 Ga0207695_10051159 3300025913 Bacteria 4340
394 Ga0207695_10091830 3300025913 Bacteria 3049
395 Ga0207695_10223643 3300025913 Bacteria 1789
396 Ga0207671_10540763 3300025914 Bacteria 929
397 Ga0207660_10051209 3300025917 Bacteria 2935
398 Ga0207660_10062318 3300025917 Bacteria 2686
399 Ga0207662_10001652 3300025918 Bacteria 10897
400 Ga0207662_10049973 3300025918 Bacteria 2482
401 Ga0207662_10157319 3300025918 Bacteria 1450
402 Ga0207657_10047922 3300025919 Bacteria 3732
403 Ga0207657_10062709 3300025919 Bacteria 3181
404 Ga0207657_10351552 3300025919 Bacteria 1162
405 Ga0207649_10034215 3300025920 Bacteria 3042
406 Ga0207649_10036899 3300025920 Bacteria 2948
407 Ga0207649_10207444 3300025920 Bacteria 1388
408 Ga0207652_10091551 3300025921 Bacteria 2674
409 Ga0207652_10120752 3300025921 Bacteria 2331
410 Ga0207652_10128926 3300025921 Bacteria 2255
411 Ga0207652_10531914 3300025921 Bacteria 1057
412 Ga0207652_10541974 3300025921 Bacteria 1046
413 Ga0207646_10297273 3300025922 Bacteria 1459
414 Ga0207694_10068868 3300025924 Bacteria 2764
415 Ga0207650_10116148 3300025925 Bacteria 2078
416 Ga0207650_10336934 3300025925 Bacteria 1238
417 Ga0207659_10035304 3300025926 Bacteria 3455
418 Ga0207659_10038607 3300025926 Bacteria 3323
419 Ga0207659_10176832 3300025926 Bacteria 1688
420 Ga0207687_10021592 3300025927 Bacteria 4278
421 Ga0207687_10052606 3300025927 Bacteria 2843
422 Ga0207687_10094793 3300025927 Bacteria 2185
423 Ga0207687_10285804 3300025927 Bacteria 1324
424 Ga0207687_10503691 3300025927 Bacteria 1011
425 Ga0207687_10651970 3300025927 Bacteria 891
426 Ga0207687_10737837 3300025927 Bacteria 838
427 Ga0207687_10802473 3300025927 Bacteria 803
428 Ga0207700_10166368 3300025928 Bacteria 1835
429 Ga0207644_10055976 3300025931 Bacteria 2845
430 Ga0207644_10477791 3300025931 Bacteria 1026
431 Ga0207690_10035342 3300025932 Bacteria 3227
432 Ga0207690_10119273 3300025932 Bacteria 1913
433 Ga0207690_10322678 3300025932 Bacteria 1214
434 Ga0207706_10014850 3300025933 Bacteria 7051
435 Ga0207706_10023330 3300025933 Bacteria 5557
436 Ga0207706_10121780 3300025933 Bacteria 2294
437 Ga0207686_10044037 3300025934 Bacteria 2738
438 Ga0207686_10451955 3300025934 Bacteria 988
439 Ga0207709_10045396 3300025935 Bacteria 2661
440 Ga0207709_10239659 3300025935 Bacteria 1319
441 Ga0207670_10000052 3300025936 Bacteria 86188
442 Ga0207670_10000777 3300025936 Bacteria 16777
443 Ga0207670_10025700 3300025936 Bacteria 3700
444 Ga0207670_10135836 3300025936 Bacteria 1807
445 Ga0207670_10433240 3300025936 Bacteria 1057
446 Ga0207670_10564853 3300025936 Bacteria 931
447 Ga0207669_10003761 3300025937 Bacteria 6590
448 Ga0207669_10076033 3300025937 Bacteria 2130
449 Ga0207669_10255242 3300025937 Bacteria 1308
450 Ga0207669_10568350 3300025937 Bacteria 917
451 Ga0207704_10019975 3300025938 Bacteria 3533
452 Ga0207704_10136732 3300025938 Bacteria 1707
453 Ga0207704_10238284 3300025938 Bacteria 1357
454 Ga0207704_10532197 3300025938 Bacteria 952
455 Ga0207665_10244925 3300025939 Bacteria 1322
456 Ga0207691_10019105 3300025940 Bacteria 6489
457 Ga0207691_10029091 3300025940 Bacteria 5168
458 Ga0207691_10228596 3300025940 Bacteria 1611
459 Ga0207711_10555238 3300025941 Bacteria 1071
460 Ga0207711_10594829 3300025941 Bacteria 1032
461 Ga0207689_10082876 3300025942 Bacteria 2637
462 Ga0207689_10156467 3300025942 Bacteria 1879
463 Ga0207661_10008048 3300025944 Bacteria 7513
464 Ga0207661_10011136 3300025944 Bacteria 6503
465 Ga0207661_10067021 3300025944 Bacteria 2918
466 Ga0207661_10123849 3300025944 Bacteria 2205
467 Ga0207661_10143474 3300025944 Bacteria 2057
468 Ga0207661_10197640 3300025944 Bacteria 1766
469 Ga0207661_10233264 3300025944 Bacteria 1630
470 Ga0207661_10239136 3300025944 Bacteria 1610
471 Ga0207679_10063384 3300025945 Bacteria 2759
472 Ga0207712_10210894 3300025961 Bacteria 1547
473 Ga0207668_10228891 3300025972 Bacteria 1497
474 Ga0207640_10057756 3300025981 Bacteria 2554
475 Ga0207640_10076561 3300025981 Bacteria 2271
476 Ga0207677_10064996 3300026023 Bacteria 2543
477 Ga0207703_10130773 3300026035 Bacteria 2167
478 Ga0207639_10026202 3300026041 Bacteria 4236
479 Ga0207639_10701097 3300026041 Bacteria 939
480 Ga0207639_11171886 3300026041 Bacteria 721
481 Ga0207678_10027460 3300026067 Bacteria 4965
482 Ga0207708_10016026 3300026075 Bacteria 5629
483 Ga0207708_10018968 3300026075 Bacteria 5180
484 Ga0207708_10149854 3300026075 Bacteria 1835
485 Ga0207708_10160573 3300026075 Bacteria 1775
486 Ga0207702_10002686 3300026078 Bacteria 16700
487 Ga0207702_10111718 3300026078 Bacteria 2431
488 Ga0207702_10223196 3300026078 Bacteria 1757
489 Ga0207702_10262571 3300026078 Bacteria 1626
490 Ga0207702_10367529 3300026078 Bacteria 1380
491 Ga0207641_10510158 3300026088 Bacteria 1169
492 Ga0207641_10514303 3300026088 Bacteria 1164
493 Ga0207641_10592034 3300026088 Bacteria 1085
494 Ga0207648_10020479 3300026089 Bacteria 5955
495 Ga0207648_10024817 3300026089 Bacteria 5347
496 Ga0207648_10148217 3300026089 Bacteria 2070
497 Ga0207648_10894249 3300026089 Bacteria 829
498 Ga0207676_10495474 3300026095 Bacteria 1159
499 Ga0207674_10018407 3300026116 Bacteria 7593
500 Ga0207674_10244635 3300026116 Bacteria 1741
501 Ga0207674_10342728 3300026116 Bacteria 1445
502 Ga0207675_100094141 3300026118 Bacteria 2818
503 Ga0207675_100235336 3300026118 Bacteria 1768
504 Ga0207675_100550530 3300026118 Bacteria 1153
505 Ga0207683_10102758 3300026121 Bacteria 2552
506 Ga0207683_10192287 3300026121 Bacteria 1853
507 Ga0207683_10266846 3300026121 Bacteria 1563
508 Ga0207683_10611988 3300026121 Bacteria 1008
509 Ga0207698_10370522 3300026142 Bacteria 1359
510 Ga0207698_10399380 3300026142 Bacteria 1313
511 Ga0209966_1022570 3300027695 Bacteria 1232
512 Ga0207428_10000244 3300027907 Bacteria 74209
513 Ga0207428_10002045 3300027907 Bacteria 20377
514 Ga0207428_10024681 3300027907 Bacteria 5047
515 Ga0207428_10152785 3300027907 Bacteria 1756
516 Ga0207428_10261848 3300027907 Bacteria 1288
517 Ga0207428_10295653 3300027907 Bacteria 1199
518 Ga0207428_10339465 3300027907 Bacteria 1107
519 Ga0268266_10184650 3300028379 Bacteria 1901
520 Ga0268264_10034622 3300028381 Bacteria 4156
521 Ga0268264_10154438 3300028381 Bacteria 2061
522 Ga0268264_10473808 3300028381 Bacteria 1217
523 Ga0265318_10118696 3300028577 Bacteria 972
524 Ga0307408_100173813 3300031548 Bacteria 1722
525 Ga0316579_10026338 3300031691 Bacteria 2632
526 Ga0316576_10030962 3300031727 Bacteria 3793
527 Ga0316576_10083098 3300031727 Bacteria 2378
528 Ga0316577_10070157 3300031733 Bacteria 1956
529 Ga0307406_10184411 3300031901 Bacteria 1522
530 Ga0307406_10259522 3300031901 Bacteria 1314
531 Ga0307409_100113545 3300031995 Bacteria 2277
532 Ga0307409_100382576 3300031995 Bacteria 1338
533 Ga0307409_100388677 3300031995 Bacteria 1329
534 Ga0307416_100018953 3300032002 Bacteria 4864
535 Ga0307416_100089230 3300032002 Bacteria 2639
536 Ga0307416_100159843 3300032002 Bacteria 2081
537 Ga0307416_100300479 3300032002 Bacteria 1595
538 Ga0307416_100875152 3300032002 Bacteria 997
539 Ga0307415_100010159 3300032126 Bacteria 5317
540 Ga0307415_100221916 3300032126 Bacteria 1516
541 Ga0307415_100405872 3300032126 Bacteria 1165
542 Ga0316583_10016988 3300032133 Bacteria 2618
543 Ga0373926_0002828 3300035083 Bacteria 5551
544 Ga0373934_0004376 3300035086 Bacteria 5216
545 Ga0373951_0158762 3300035091 Bacteria 638
546 Ga0373923_0044557 3300035111 Bacteria 1839
547 Ga0373932_0077724 3300035112 Bacteria 1042
548 Ga0373936_0010863 3300035113 Bacteria 3440
549 Ga0373936_0033664 3300035113 Bacteria 2032
550 Ga0373945_0007197 3300035116 Bacteria 3602
551 Ga0373953_0009792 3300035117 Bacteria 3313
552 Ga0373954_0045875 3300035118 Bacteria 2042
553 Ga0373957_0023325 3300035120 Bacteria 2212
554 Ga0373960_0086460 3300035121 Bacteria 996
555 Ga0373943_0009843 3300035170 Bacteria 4280
556 Ga0373955_0068140 3300035172 Bacteria 1982
557 Ga0373955_0201197 3300035172 Bacteria 1186
558 Ga0373961_0016184 3300035241 Bacteria 1918
559 Ga0316574_0027625 3300035398 Bacteria 3418
560 Ga0373924_0101064 3300035410 Bacteria 1241
561 Ga0373931_0171421 3300035691 Bacteria 1279
562 Ga0373935_0004795 3300035692 Bacteria 7951
563 Ga0373927_0040183 3300035695 Bacteria 3036
564 Ga0373933_0126517 3300035724 Bacteria 1604
565 Ga0373947_0013853 3300035725 Bacteria 4622
566 Ga0373937_0475269 3300036401 Bacteria 1187
567 Ga0373937_0716547 3300036401 Bacteria 947
568 Ga0316582_0079478 3300036647 Bacteria 2138
569 Ga0316584_0038711 3300036712 Bacteria 3548
570 Ga0373925_0009138 3300037068 Bacteria 7211
571 Ga0373925_0411666 3300037068 Bacteria 1104
572 Ga0395899_0006920 3300037312 Bacteria 8784
573 Ga0395899_0053365 3300037312 Bacteria 2993
574 Ga0395899_0060250 3300037312 Bacteria 2796
575 Ga0395899_0072888 3300037312 Bacteria 2512
576 Ga0395899_0179523 3300037312 Bacteria 1487
577 Ga0395900_0003521 3300037418 Bacteria 16884
578 Ga0395900_0007081 3300037418 Bacteria 11617
579 Ga0395900_0025290 3300037418 Bacteria 6078
580 Ga0395900_0068849 3300037418 Bacteria 3637
581 Ga0395900_0076480 3300037418 Bacteria 3440
582 Ga0395900_0077244 3300037418 Bacteria 3421
583 Ga0395900_0131987 3300037418 Bacteria 2559
584 Ga0395900_0147983 3300037418 Bacteria 2401
585 Ga0395900_0149858 3300037418 Bacteria 2383
586 Ga0395900_0171873 3300037418 Bacteria 2205
587 Ga0395900_0264495 3300037418 Bacteria 1716
588 Ga0395900_0791248 3300037418 Bacteria 877
589 Ga0395898_0001875 3300037466 Bacteria 26866
590 Ga0395898_0003526 3300037466 Bacteria 17447
591 Ga0395898_0010231 3300037466 Bacteria 9821
592 Ga0395898_0043221 3300037466 Bacteria 4441
593 Ga0395898_0076766 3300037466 Bacteria 3225
594 Ga0395898_0155222 3300037466 Bacteria 2189
595 Ga0395898_0256253 3300037466 Bacteria 1668
596 Ga0395905_0009915 3300037471 Bacteria 9283
597 Ga0395905_0018552 3300037471 Bacteria 6603
598 Ga0395905_0021602 3300037471 Bacteria 6086
599 Ga0395905_0031768 3300037471 Bacteria 4968
600 Ga0395905_0174934 3300037471 Bacteria 2016
601 Ga0395905_0189838 3300037471 Bacteria 1927
602 Ga0395905_0235815 3300037471 Bacteria 1710
603 Ga0395905_0250761 3300037471 Bacteria 1653
604 Ga0395905_0530987 3300037471 Bacteria 1077
605 Ga0395901_0005796 3300038443 Bacteria 12517
606 Ga0395901_0012794 3300038443 Bacteria 8510
607 Ga0395901_0019001 3300038443 Bacteria 7025
608 Ga0395901_0033883 3300038443 Bacteria 5274
609 Ga0395901_0039047 3300038443 Bacteria 4911
610 Ga0395901_0049656 3300038443 Bacteria 4359
611 Ga0395901_0110917 3300038443 Bacteria 2881
612 Ga0395901_0131367 3300038443 Bacteria 2631
613 Ga0395901_0161010 3300038443 Bacteria 2357
614 Ga0395901_0175304 3300038443 Bacteria 2249
615 Ga0395901_0291492 3300038443 Bacteria 1693
616 Ga0395901_0517645 3300038443 Bacteria 1212
617 Ga0395901_1265605 3300038443 Bacteria 701
618 Ga0439439_0036238 3300041406 Bacteria 1269
619 Ga0439453_0010973 3300041408 Bacteria 1503
620 Ga0439453_0035155 3300041408 Bacteria 964
621 Ga0439461_0075232 3300041410 Bacteria 788
622 Ga0439465_0138089 3300041413 Bacteria 864
623 Ga0451833_0318449 3300041491 Bacteria 655
624 Ga0439448_0016418 3300042005 Bacteria 2253
625 Ga0439448_0022619 3300042005 Bacteria 1956
626 Ga0439451_006592 3300042009 Bacteria 2373
627 Ga0439454_012450 3300042011 Bacteria 1154
628 Ga0439455_0086155 3300042012 Bacteria 858
629 Ga0450917_009464 3300042120 Bacteria 764
630 Ga0450920_002965 3300042122 Bacteria 2922
631 Ga0450908_012972 3300042184 Bacteria 1505
632 Ga0439434_0002257 3300042435 Bacteria 5594
633 Ga0439434_0005571 3300042435 Bacteria 3678
634 Ga0451577_0082678 3300042876 Bacteria 2864
635 Ga0439440_0066013 3300042993 Bacteria 933
636 Ga0453683_0313693 3300044673 Bacteria 1004
637 Ga0466961_0136624 3300044693 Bacteria 1536
638 Ga0466963_0004083 3300044694 Bacteria 8447
639 Ga0466963_0007021 3300044694 Bacteria 6705
640 Ga0466964_0003226 3300044706 Bacteria 5936
641 Ga0466964_0018741 3300044706 Bacteria 2658
642 Ga0466971_0100910 3300044719 Bacteria 1326
643 Ga0466957_0037743 3300044842 Bacteria 2909
644 Ga0466959_0126321 3300045049 Bacteria 1815
645 Ga0466959_0129058 3300045049 Bacteria 1792
646 Ga0466959_0459360 3300045049 Bacteria 863
647 Ga0451576_0036687 3300045051 Bacteria 5195
648 Ga0451576_0207766 3300045051 Bacteria 2044
649 Ga0451576_0610396 3300045051 Bacteria 1147
650 Ga0466958_0016722 3300045836 Bacteria 4229
651 Ga0466958_0018150 3300045836 Bacteria 4078
652 Ga0466958_0100734 3300045836 Bacteria 1796
653 Ga0466958_0115111 3300045836 Bacteria 1680
654 Ga0466967_0001509 3300045976 Bacteria 13591
655 Ga0466967_0005611 3300045976 Bacteria 8726
656 Ga0466967_0019707 3300045976 Bacteria 5430
657 Ga0466967_0030118 3300045976 Bacteria 4551
658 Ga0466967_0085632 3300045976 Bacteria 2853
659 Ga0466967_0109832 3300045976 Bacteria 2532
660 Ga0466967_0172737 3300045976 Bacteria 2034
661 Ga0495592_0030764 3300046454 Bacteria 4060
662 Ga0495592_0083751 3300046454 Bacteria 2302
663 Ga0495603_0001553 3300046455 Bacteria 13437
664 Ga0495603_0056192 3300046455 Bacteria 2331
665 Ga0495629_0015834 3300046459 Bacteria 5416
666 Ga0495629_0017118 3300046459 Bacteria 5199
667 Ga0495641_0006144 3300046461 Bacteria 7856
668 Ga0495641_0018268 3300046461 Bacteria 3622
669 Ga0495641_0055031 3300046461 Bacteria 1807
670 Ga0495651_0075246 3300046462 Bacteria 2560
671 Ga0495653_0071927 3300046463 Bacteria 2584
672 Ga0495653_0076872 3300046463 Bacteria 2480
673 Ga0495653_0312923 3300046463 Bacteria 1020
674 Ga0495580_0040825 3300046472 Bacteria 3312
675 Ga0495582_0019456 3300046473 Bacteria 3712
676 Ga0495582_0095964 3300046473 Bacteria 1657
677 Ga0495582_0116151 3300046473 Bacteria 1505
678 Ga0495639_0000940 3300046475 Bacteria 13166
679 Ga0495662_0003702 3300046476 Bacteria 7707
680 Ga0495662_0122714 3300046476 Bacteria 1276
681 Ga0495662_0140224 3300046476 Bacteria 1190
682 Ga0495664_0002895 3300046477 Bacteria 9252
683 Ga0495584_0261278 3300046491 Bacteria 880
684 Ga0495585_0071464 3300046492 Bacteria 1892
685 Ga0495585_0245198 3300046492 Bacteria 896
686 Ga0495594_0026783 3300046499 Bacteria 3104
687 Ga0495594_0554544 3300046499 Bacteria 652
688 Ga0495596_0063221 3300046500 Bacteria 1440
689 Ga0495607_0019928 3300046501 Bacteria 4249
690 Ga0495607_0094681 3300046501 Bacteria 1611
691 Ga0495583_0078167 3300046506 Bacteria 1442
692 Ga0495608_0026855 3300046511 Bacteria 3922
693 Ga0495608_0526550 3300046511 Bacteria 714
694 Ga0495618_0018778 3300046514 Bacteria 4247
695 Ga0495618_0220062 3300046514 Bacteria 1198
696 Ga0495620_0111986 3300046515 Bacteria 1081
697 Ga0495628_0002036 3300046516 Bacteria 18318
698 Ga0495628_0422590 3300046516 Bacteria 971
699 Ga0495630_0006996 3300046517 Bacteria 8040
700 Ga0495630_0161658 3300046517 Bacteria 1705
701 Ga0495630_0510023 3300046517 Bacteria 922
702 Ga0495631_0065169 3300046518 Bacteria 1577
703 Ga0495631_0100357 3300046518 Bacteria 1246
704 Ga0495632_0106660 3300046519 Bacteria 1318
705 Ga0495643_0104599 3300046522 Bacteria 1447
706 Ga0495644_0007305 3300046523 Bacteria 4267
707 Ga0495644_0028436 3300046523 Bacteria 2116
708 Ga0495644_0054087 3300046523 Bacteria 1508
709 Ga0495663_0009173 3300046525 Bacteria 2743
710 Ga0495663_0036115 3300046525 Bacteria 1486
711 Ga0495663_0046973 3300046525 Bacteria 1328
712 Ga0495642_0014764 3300046528 Bacteria 3030
713 Ga0495652_0013477 3300046529 Bacteria 7359
714 Ga0495652_0536426 3300046529 Bacteria 806
715 Ga0495665_0008331 3300046531 Bacteria 5620
716 Ga0495665_0126695 3300046531 Bacteria 1337
717 Ga0495640_0280278 3300046533 Bacteria 1038
718 Ga0495586_0160449 3300046535 Bacteria 1268
719 Ga0495587_0008664 3300046536 Bacteria 6535
720 Ga0495598_0040133 3300046537 Bacteria 1364
721 Ga0495598_0277942 3300046537 Bacteria 628
722 Ga0495609_0173616 3300046538 Bacteria 909
723 Ga0495645_0146772 3300046543 Bacteria 1642
724 Ga0495622_0217704 3300046557 Bacteria 847
725 Ga0495633_0109201 3300046558 Bacteria 1283
726 Ga0495633_0326841 3300046558 Bacteria 696
727 Ga0495667_0053928 3300046559 Bacteria 2647
728 Ga0495656_0023330 3300046615 Bacteria 2434
729 Ga0495656_0143687 3300046615 Bacteria 1146
730 Ga0495656_0321457 3300046615 Bacteria 797
731 Ga0495668_0079107 3300046616 Bacteria 1805
732 Ga0495668_0124740 3300046616 Bacteria 1409
733 Ga0495634_0056818 3300046642 Bacteria 2614
734 Ga0495634_0072110 3300046642 Bacteria 2272
735 Ga0495611_0321477 3300046648 Bacteria 712
736 Ga0495635_0114065 3300046663 Bacteria 1845
737 Ga0495659_0049711 3300046664 Bacteria 1523
738 Ga0495588_0020546 3300046674 Bacteria 3248
739 Ga0495588_0082313 3300046674 Bacteria 1681
740 Ga0495588_0278713 3300046674 Bacteria 881
741 Ga0495657_0028530 3300046675 Bacteria 3924
742 Ga0495599_0005910 3300046678 Bacteria 7355
743 Ga0495599_0068382 3300046678 Bacteria 2217
744 Ga0495646_0048008 3300046680 Bacteria 2596
745 Ga0495647_0001137 3300046681 Bacteria 8161
746 Ga0495647_0172560 3300046681 Bacteria 937
747 Ga0495647_0304322 3300046681 Bacteria 719
748 Ga0495658_0013456 3300046683 Bacteria 4164
749 Ga0495658_0157670 3300046683 Bacteria 1398
750 Ga0495658_0492201 3300046683 Bacteria 784
751 Ga0495669_0164862 3300046684 Bacteria 1053
752 Ga0495613_0030077 3300046689 Bacteria 4034
753 Ga0495613_0191383 3300046689 Bacteria 1445
754 Ga0495613_0519700 3300046689 Bacteria 800
755 Ga0495624_0023432 3300046690 Bacteria 4070
756 Ga0495624_0115042 3300046690 Bacteria 1653
757 Ga0495670_0104413 3300046691 Bacteria 1462
758 Ga0495670_0361764 3300046691 Bacteria 782
759 Ga0495671_0103718 3300046692 Bacteria 1389
760 Ga0495671_0215173 3300046692 Bacteria 931
761 Ga0495671_0374920 3300046692 Bacteria 682
762 Ga0495649_0086044 3300046694 Bacteria 1678
763 Ga0495589_0009382 3300046794 Bacteria 5089
764 Ga0495600_0002357 3300046809 Bacteria 10790
765 Ga0495600_0036004 3300046809 Bacteria 3216
766 Ga0495600_0071657 3300046809 Bacteria 2264
767 Ga0495600_0194137 3300046809 Bacteria 1305
768 Ga0495581_0005927 3300047315 Bacteria 7085
769 Ga0495581_0021131 3300047315 Bacteria 3775
770 Ga0495581_0242385 3300047315 Bacteria 1054
771 Ga0495674_0008898 3300047319 Bacteria 9548
772 Ga0495676_0012449 3300047321 Bacteria 7662
773 Ga0495676_0017472 3300047321 Bacteria 6342
774 Ga0495676_0091963 3300047321 Bacteria 2265
775 Ga0495676_0213757 3300047321 Bacteria 1333
776 Ga0495680_0011101 3300047322 Bacteria 7996
777 Ga0495680_0047141 3300047322 Bacteria 3392
778 Ga0495680_0112992 3300047322 Bacteria 2011
779 Ga0495680_0117346 3300047322 Bacteria 1967
780 Ga0495680_0208155 3300047322 Bacteria 1401
781 Ga0495680_0449852 3300047322 Bacteria 882
782 Ga0495675_0000882 3300047444 Bacteria 18342
783 Ga0495684_0098366 3300047471 Bacteria 2212
784 Ga0495686_0000011 3300047472 Bacteria 514750
785 Ga0495686_0002398 3300047472 Bacteria 17807
786 Ga0495686_0167016 3300047472 Bacteria 1282
787 Ga0495593_0002580 3300047673 Bacteria 10883
788 Ga0495593_0123439 3300047673 Bacteria 1317
789 Ga0495614_0000773 3300048089 Bacteria 13540
790 Ga0496100_0196817 3300048903 Bacteria 1466
791 Ga0496100_0690036 3300048903 Bacteria 796
792 Ga0496100_0715685 3300048903 Bacteria 782
793 Ga0496101_0101553 3300048904 Bacteria 2154
794 Ga0496101_0153693 3300048904 Bacteria 1761
795 Ga0496101_0180949 3300048904 Bacteria 1623
796 Ga0496101_0328634 3300048904 Bacteria 1200
797 Ga0496101_0569098 3300048904 Bacteria 896
798 Ga0496102_0113361 3300048905 Bacteria 2529
799 Ga0496102_0146780 3300048905 Bacteria 2214
800 Ga0496102_0152760 3300048905 Bacteria 2170
801 Ga0496102_0248176 3300048905 Bacteria 1678
802 Ga0496102_0339508 3300048905 Bacteria 1415
803 Ga0496102_0364792 3300048905 Bacteria 1360
804 Ga0496102_0520467 3300048905 Bacteria 1112
805 Ga0496103_0156516 3300048906 Bacteria 1461
806 Ga0496104_0000557 3300048907 Bacteria 31776
807 Ga0496104_0071520 3300048907 Bacteria 3298
808 Ga0496104_0084121 3300048907 Bacteria 3035
809 Ga0496104_0086130 3300048907 Bacteria 2999
810 Ga0496104_0201139 3300048907 Bacteria 1904
811 Ga0496104_0439610 3300048907 Bacteria 1216
812 Ga0496105_0000609 3300048908 Bacteria 23924
813 Ga0496105_0043045 3300048908 Bacteria 3724
814 Ga0496105_0516419 3300048908 Bacteria 936
815 Ga0496106_0168578 3300048909 Bacteria 1734
816 Ga0496107_0049877 3300048910 Bacteria 3017
817 Ga0496107_0146436 3300048910 Bacteria 1746
818 Ga0496108_0000612 3300048911 Bacteria 27959
819 Ga0496108_0100392 3300048911 Bacteria 2468
820 Ga0496108_0154710 3300048911 Bacteria 1980
821 Ga0496108_0164172 3300048911 Bacteria 1920
822 Ga0496108_0287868 3300048911 Bacteria 1430
823 Ga0496109_0004344 3300048912 Bacteria 11842
824 Ga0496109_0042682 3300048912 Bacteria 4109
825 Ga0496109_0148163 3300048912 Bacteria 2196
826 Ga0496109_0236149 3300048912 Bacteria 1720
827 Ga0496109_0246642 3300048912 Bacteria 1681
828 Ga0496109_0294044 3300048912 Bacteria 1531
829 Ga0496109_0522370 3300048912 Bacteria 1120
830 Ga0496110_0000564 3300048913 Bacteria 25354
831 Ga0496110_0016135 3300048913 Bacteria 6228
832 Ga0496110_0026242 3300048913 Bacteria 4983
833 Ga0496110_0034287 3300048913 Bacteria 4396
834 Ga0496110_0037242 3300048913 Bacteria 4228
835 Ga0496110_0058251 3300048913 Bacteria 3402
836 Ga0496110_0255732 3300048913 Bacteria 1594
837 Ga0496111_0000294 3300048914 Bacteria 24345
838 Ga0496111_0008012 3300048914 Bacteria 6968
839 Ga0496111_0026530 3300048914 Bacteria 4093
840 Ga0496111_0181090 3300048914 Bacteria 1566
841 Ga0496111_0253641 3300048914 Bacteria 1305
842 Ga0496112_0004854 3300048915 Bacteria 11487
843 Ga0496112_0039578 3300048915 Bacteria 4608
844 Ga0496112_0051852 3300048915 Bacteria 4025
845 Ga0496112_0502471 3300048915 Bacteria 1148
846 Ga0496112_0588531 3300048915 Bacteria 1045
847 Ga0496113_0000414 3300048916 Bacteria 20698
848 Ga0496113_0039715 3300048916 Bacteria 3465
849 Ga0496114_0064338 3300048917 Bacteria 3071
850 Ga0496115_0004631 3300048918 Bacteria 9950
851 Ga0495678_077501 3300049459 Bacteria 1202
852 Ga0501031_0000033 3300049568 Bacteria 76506
853 Ga0501031_0074697 3300049568 Bacteria 2207
854 Ga0501031_0118904 3300049568 Bacteria 1726
855 Ga0501031_0344194 3300049568 Bacteria 965
856 Ga0501032_0002047 3300049569 Bacteria 15929
857 Ga0501032_0058120 3300049569 Bacteria 2597
858 Ga0501033_0000388 3300049570 Bacteria 42262
859 Ga0501033_0031359 3300049570 Bacteria 3994
860 Ga0501033_0034644 3300049570 Bacteria 3786
861 Ga0501033_0077541 3300049570 Bacteria 2438
862 Ga0501033_0084392 3300049570 Bacteria 2328
863 Ga0501034_0003854 3300049571 Bacteria 16899
864 Ga0501034_0034552 3300049571 Bacteria 5125
865 Ga0501034_0074710 3300049571 Bacteria 3397
866 Ga0501034_0176576 3300049571 Bacteria 2102
867 Ga0501036_0000462 3300049572 Bacteria 29122
868 Ga0501036_0010142 3300049572 Bacteria 7765
869 Ga0501036_0013657 3300049572 Bacteria 6752
870 Ga0501036_0053869 3300049572 Bacteria 3405
871 Ga0501036_0096199 3300049572 Bacteria 2503
872 Ga0501036_0405892 3300049572 Bacteria 1136
873 Ga0501036_0461168 3300049572 Bacteria 1058
874 Ga0501037_0000915 3300049573 Bacteria 21941
875 Ga0501037_0018448 3300049573 Bacteria 5144
876 Ga0501037_0020177 3300049573 Bacteria 4921
877 Ga0501037_0033954 3300049573 Bacteria 3767
878 Ga0501038_0001345 3300049574 Bacteria 22388
879 Ga0501038_0003559 3300049574 Bacteria 14496
880 Ga0501038_0017214 3300049574 Bacteria 6535
881 Ga0501038_0474452 3300049574 Bacteria 959
882 Ga0501038_0584200 3300049574 Bacteria 847
883 Ga0501039_0000528 3300049575 Bacteria 27658
884 Ga0501039_0002890 3300049575 Bacteria 12850
885 Ga0501039_0004144 3300049575 Bacteria 10909
886 Ga0501039_0009715 3300049575 Bacteria 7332
887 Ga0501039_0048266 3300049575 Bacteria 3291
888 Ga0501039_0389578 3300049575 Bacteria 1094
889 Ga0501039_0842826 3300049575 Bacteria 714
890 Ga0501040_0000234 3300049576 Bacteria 32549
891 Ga0501040_0001857 3300049576 Bacteria 13550
892 Ga0501040_0063098 3300049576 Bacteria 2549
893 Ga0501040_0063793 3300049576 Bacteria 2535
894 Ga0501040_0086026 3300049576 Bacteria 2182
895 Ga0501040_0289973 3300049576 Bacteria 1169
896 Ga0501041_0000176 3300049577 Bacteria 28688
897 Ga0501041_0001613 3300049577 Bacteria 12589
898 Ga0501041_0001653 3300049577 Bacteria 12471
899 Ga0501041_0001903 3300049577 Bacteria 11701
900 Ga0501041_0004551 3300049577 Bacteria 8045
901 Ga0501041_0022657 3300049577 Bacteria 3761
902 Ga0501041_0061510 3300049577 Bacteria 2299
903 Ga0501041_0064517 3300049577 Bacteria 2243
904 Ga0501041_0097119 3300049577 Bacteria 1821
905 Ga0501042_0001051 3300049578 Bacteria 15754
906 Ga0501042_0002112 3300049578 Bacteria 12048
907 Ga0501042_0002211 3300049578 Bacteria 11863
908 Ga0501042_0005399 3300049578 Bacteria 8227
909 Ga0501042_0012515 3300049578 Bacteria 5750
910 Ga0501042_0101799 3300049578 Bacteria 2066
911 Ga0501042_0212790 3300049578 Bacteria 1394
912 Ga0501043_0000798 3300049579 Bacteria 27990
913 Ga0501043_0010457 3300049579 Bacteria 7271
914 Ga0501043_0010678 3300049579 Bacteria 7193
915 Ga0501043_0034434 3300049579 Bacteria 3983
916 Ga0501043_0101721 3300049579 Bacteria 2258
917 Ga0501043_0320369 3300049579 Bacteria 1182
918 Ga0501046_0000577 3300049580 Bacteria 36233
919 Ga0501046_0001998 3300049580 Bacteria 19348
920 Ga0501046_0016228 3300049580 Bacteria 6243
921 Ga0501046_0028735 3300049580 Bacteria 4526
922 Ga0501046_0044538 3300049580 Bacteria 3529
923 Ga0501046_0236750 3300049580 Bacteria 1347
924 Ga0501047_0001088 3300049581 Bacteria 27110
925 Ga0501047_0237539 3300049581 Bacteria 1674
926 Ga0501048_0000440 3300049582 Bacteria 29199
927 Ga0501048_0012920 3300049582 Bacteria 6202
928 Ga0501048_0032679 3300049582 Bacteria 3760
929 Ga0501048_0038723 3300049582 Bacteria 3421
930 Ga0501048_0057132 3300049582 Bacteria 2767
931 Ga0501048_0066465 3300049582 Bacteria 2549
932 Ga0501048_0066490 3300049582 Bacteria 2548
933 Ga0501048_0214312 3300049582 Bacteria 1366
934 Ga0501048_0230035 3300049582 Bacteria 1316
935 Ga0501067_0008570 3300049583 Bacteria 5671
936 Ga0501067_0039241 3300049583 Bacteria 2629
937 Ga0501068_0000344 3300049584 Bacteria 23396
938 Ga0501068_0001607 3300049584 Bacteria 12031
939 Ga0501068_0002038 3300049584 Bacteria 10773
940 Ga0501068_0014068 3300049584 Bacteria 4568
941 Ga0501068_0022595 3300049584 Bacteria 3678
942 Ga0501068_0078854 3300049584 Bacteria 2019
943 Ga0501068_0153938 3300049584 Bacteria 1446
944 Ga0501068_0302637 3300049584 Bacteria 1024
945 Ga0501068_0441195 3300049584 Bacteria 842
946 Ga0501069_0000870 3300049585 Bacteria 14363
947 Ga0501069_0018237 3300049585 Bacteria 3786
948 Ga0501069_0022470 3300049585 Bacteria 3431
949 Ga0501069_0028662 3300049585 Bacteria 3053
950 Ga0501069_0066883 3300049585 Bacteria 2010
951 Ga0501069_0101498 3300049585 Bacteria 1633
952 Ga0501069_0219852 3300049585 Bacteria 1103
953 Ga0501069_0295513 3300049585 Bacteria 949
954 Ga0501070_0001864 3300049586 Bacteria 18631
955 Ga0501070_0002078 3300049586 Bacteria 17588
956 Ga0501070_0029634 3300049586 Bacteria 4587
957 Ga0501070_0048740 3300049586 Bacteria 3518
958 Ga0501070_0111746 3300049586 Bacteria 2258
959 Ga0501070_0323214 3300049586 Bacteria 1254
960 Ga0501070_0454328 3300049586 Bacteria 1033
961 Ga0501070_0906242 3300049586 Bacteria 688
962 Ga0501071_0000054 3300049587 Bacteria 38443
963 Ga0501071_0003445 3300049587 Bacteria 9881
964 Ga0501071_0035122 3300049587 Bacteria 3570
965 Ga0501071_0037155 3300049587 Bacteria 3476
966 Ga0501071_0052443 3300049587 Bacteria 2941
967 Ga0501071_0052886 3300049587 Bacteria 2928
968 Ga0501071_0079638 3300049587 Bacteria 2395
969 Ga0501072_0001204 3300049588 Bacteria 19296
970 Ga0501072_0019896 3300049588 Bacteria 5195
971 Ga0501072_0020451 3300049588 Bacteria 5129
972 Ga0501072_0023725 3300049588 Bacteria 4765
973 Ga0501072_0045774 3300049588 Bacteria 3441
974 Ga0501072_0056675 3300049588 Bacteria 3087
975 Ga0501072_0059776 3300049588 Bacteria 3005
976 Ga0501072_0122676 3300049588 Bacteria 2070
977 Ga0501072_0186257 3300049588 Bacteria 1656
978 Ga0501072_0235721 3300049588 Bacteria 1457
979 Ga0501072_0266086 3300049588 Bacteria 1364
980 Ga0501073_0004823 3300049589 Bacteria 10126
981 Ga0501073_0017301 3300049589 Bacteria 5222
982 Ga0501073_0031345 3300049589 Bacteria 3793
983 Ga0501073_0086505 3300049589 Bacteria 2180
984 Ga0501073_0134345 3300049589 Bacteria 1714
985 Ga0501073_0209372 3300049589 Bacteria 1347
986 Ga0501073_0425647 3300049589 Bacteria 917
987 Ga0501074_0000008 3300049590 Bacteria 105048
988 Ga0501074_0002959 3300049590 Bacteria 11940
989 Ga0501074_0025270 3300049590 Bacteria 4314
990 Ga0501074_0032984 3300049590 Bacteria 3752
991 Ga0501074_0048547 3300049590 Bacteria 3066
992 Ga0501074_0282191 3300049590 Bacteria 1181
993 Ga0501075_0000096 3300049591 Bacteria 40796
994 Ga0501075_0000800 3300049591 Bacteria 19695
995 Ga0501075_0005557 3300049591 Bacteria 8627
996 Ga0501075_0010477 3300049591 Bacteria 6513
997 Ga0501075_0078516 3300049591 Bacteria 2498
998 Ga0501075_0100780 3300049591 Bacteria 2193
999 Ga0501075_0243314 3300049591 Bacteria 1371
1000 Ga0501075_0511208 3300049591 Bacteria 916
1001 Ga0501076_0000020 3300049592 Bacteria 86221
1002 Ga0501076_0000459 3300049592 Bacteria 25828
1003 Ga0501076_0005733 3300049592 Bacteria 8952
1004 Ga0501076_0015181 3300049592 Bacteria 5817
1005 Ga0501076_0029367 3300049592 Bacteria 4276
1006 Ga0501076_0049904 3300049592 Bacteria 3310
1007 Ga0501076_0076849 3300049592 Bacteria 2678
1008 Ga0501076_0100399 3300049592 Bacteria 2331
1009 Ga0501076_0193454 3300049592 Bacteria 1660
1010 Ga0501076_0199076 3300049592 Bacteria 1635
1011 Ga0501076_0548262 3300049592 Bacteria 953
1012 Ga0501077_0000624 3300049593 Bacteria 21474
1013 Ga0501077_0001221 3300049593 Bacteria 15525
1014 Ga0501077_0001720 3300049593 Bacteria 13181
1015 Ga0501077_0007219 3300049593 Bacteria 6854
1016 Ga0501077_0022760 3300049593 Bacteria 3971
1017 Ga0501077_0081356 3300049593 Bacteria 2052
1018 Ga0501077_0098445 3300049593 Bacteria 1853
1019 Ga0501077_0137586 3300049593 Bacteria 1549
1020 Ga0501077_0317482 3300049593 Bacteria 993
1021 Ga0501207_042868 3300049654 Bacteria 791
1022 Ga0501079_0000001 3300049741 Bacteria 121247
1023 Ga0501079_0003968 3300049741 Bacteria 10931
1024 Ga0501079_0006300 3300049741 Bacteria 8897
1025 Ga0501079_0026049 3300049741 Bacteria 4484
1026 Ga0501079_0040476 3300049741 Bacteria 3594
1027 Ga0501079_0042195 3300049741 Bacteria 3523
1028 Ga0501079_0057533 3300049741 Bacteria 3000
1029 Ga0501079_0066096 3300049741 Bacteria 2790
1030 Ga0501079_0103045 3300049741 Bacteria 2213
1031 Ga0501079_0120970 3300049741 Bacteria 2036
1032 Ga0501079_0184354 3300049741 Bacteria 1629
1033 Ga0501079_0212946 3300049741 Bacteria 1509
1034 Ga0501079_0406266 3300049741 Bacteria 1068
1035 Ga0501079_0452806 3300049741 Bacteria 1008
1036 Ga0501079_0539624 3300049741 Bacteria 917
1037 Ga0501079_0623383 3300049741 Bacteria 849
1038 Ga0501080_0002158 3300049742 Bacteria 17095
1039 Ga0501080_0003585 3300049742 Bacteria 13670
1040 Ga0501080_0019482 3300049742 Bacteria 6284
1041 Ga0501080_0029846 3300049742 Bacteria 5075
1042 Ga0501080_0032227 3300049742 Bacteria 4886
1043 Ga0501080_0062453 3300049742 Bacteria 3467
1044 Ga0501080_0161578 3300049742 Bacteria 2069
1045 Ga0501080_0382006 3300049742 Bacteria 1269
1046 Ga0501081_0000001 3300049743 Bacteria 115059
1047 Ga0501081_0001766 3300049743 Bacteria 13416
1048 Ga0501081_0001842 3300049743 Bacteria 13150
1049 Ga0501081_0003476 3300049743 Bacteria 10064
1050 Ga0501081_0038771 3300049743 Bacteria 3257
1051 Ga0501081_0047263 3300049743 Bacteria 2961
1052 Ga0501081_0052606 3300049743 Bacteria 2811
1053 Ga0501081_0055915 3300049743 Bacteria 2726
1054 Ga0501081_0075138 3300049743 Bacteria 2358
1055 Ga0501081_0097627 3300049743 Bacteria 2073
1056 Ga0501081_0123263 3300049743 Bacteria 1848
1057 Ga0501081_0139443 3300049743 Bacteria 1737
1058 Ga0501083_0002293 3300049744 Bacteria 13098
1059 Ga0501083_0002761 3300049744 Bacteria 12131
1060 Ga0501083_0006339 3300049744 Bacteria 8383
1061 Ga0501083_0208135 3300049744 Bacteria 1275
1062 Ga0501083_0534820 3300049744 Bacteria 763
1063 Ga0501035_0001281 3300049822 Bacteria 25975
1064 Ga0501035_0014419 3300049822 Bacteria 7295
1065 Ga0501035_0014843 3300049822 Bacteria 7191
1066 Ga0501035_0056842 3300049822 Bacteria 3489
1067 Ga0501035_0114552 3300049822 Bacteria 2361
1068 Ga0501035_0330099 3300049822 Bacteria 1280
1069 Ga0501044_0004690 3300049823 Bacteria 15285
1070 Ga0501044_0089591 3300049823 Bacteria 3105
1071 Ga0501044_0107913 3300049823 Bacteria 2795
1072 Ga0501044_0271630 3300049823 Bacteria 1631
1073 Ga0501045_0000641 3300049824 Bacteria 22097
1074 Ga0501045_0000928 3300049824 Bacteria 19139
1075 Ga0501045_0026066 3300049824 Bacteria 4202
1076 Ga0501045_0028467 3300049824 Bacteria 4030
1077 Ga0501045_0032587 3300049824 Bacteria 3776
1078 Ga0501045_0049326 3300049824 Bacteria 3069
1079 Ga0501045_0049599 3300049824 Bacteria 3061
1080 Ga0501045_0632509 3300049824 Bacteria 791
1081 Ga0501045_0720874 3300049824 Bacteria 735
1082 nmdc:mga03683_92568_c1 3300050489 Bacteria 1320
1083 nmdc:mga00v17_188513_c1 3300050491 Bacteria 1331
1084 nmdc:mga00v17_23947_c1 3300050491 Bacteria 3537
1085 nmdc:mga0yw44_10226_c1 3300050492 Bacteria 4609
1086 nmdc:mga0yw44_127669_c1 3300050492 Bacteria 1643
1087 nmdc:mga0yw44_15187_c1 3300050492 Bacteria 2306
1088 nmdc:mga0yw44_443870_c1 3300050492 Bacteria 879
1089 nmdc:mga06z11_91359_c1 3300050494 Bacteria 1653
1090 nmdc:mga05p37_182900_c1 3300050507 Bacteria 2549
1091 nmdc:mga05p37_190055_c1 3300050507 Bacteria 2494
1092 nmdc:mga05p37_2318_c1 3300050507 Bacteria 22162
1093 nmdc:mga05p37_250690_c1 3300050507 Bacteria 2124
1094 nmdc:mga05p37_308161_c1 3300050507 Bacteria 1878
1095 nmdc:mga05p37_416991_c1 3300050507 Bacteria 1563
1096 nmdc:mga05p37_565805_c1 3300050507 Bacteria 1291
1097 nmdc:mga05p37_6607_c1 3300050507 Bacteria 13670
1098 nmdc:mga05p37_946759_c1 3300050507 Bacteria 922
1099 nmdc:mga09592_1034835_c1 3300050508 Bacteria 685
1100 nmdc:mga09592_13265_c1 3300050508 Bacteria 6728
1101 nmdc:mga09592_2473_c1 3300050508 Bacteria 14915
1102 nmdc:mga09592_52444_c1 3300050508 Bacteria 3443
1103 nmdc:mga09592_664301_c1 3300050508 Bacteria 889
1104 nmdc:mga09592_92614_c1 3300050508 Bacteria 2584
1105 nmdc:mga09592_93274_c1 3300050508 Bacteria 2574
1106 nmdc:mga0qj67_111978_c1 3300050509 Bacteria 2204
1107 nmdc:mga0qj67_151171_c1 3300050509 Bacteria 1884
1108 nmdc:mga0qj67_242283_c1 3300050509 Bacteria 1463
1109 nmdc:mga0qj67_344340_c1 3300050509 Bacteria 1205
1110 nmdc:mga0qj67_56792_c1 3300050509 Bacteria 3104
1111 nmdc:mga06r32_43044_c1 3300050510 Bacteria 4296
1112 nmdc:mga06r32_51930_c1 3300050510 Bacteria 3925
1113 nmdc:mga08y16_108558_c1 3300050511 Bacteria 2889
1114 nmdc:mga08y16_11412_c1 3300050511 Bacteria 9336
1115 nmdc:mga08y16_143557_c1 3300050511 Bacteria 2482
1116 nmdc:mga08y16_149061_c1 3300050511 Bacteria 2432
1117 nmdc:mga08y16_178948_c1 3300050511 Bacteria 2202
1118 nmdc:mga08y16_378288_c1 3300050511 Bacteria 1452
1119 nmdc:mga0n895_169144_c1 3300050512 Bacteria 2218
1120 nmdc:mga0n895_430832_c1 3300050512 Bacteria 1333
1121 nmdc:mga0n895_66062_c1 3300050512 Bacteria 3582
1122 nmdc:mga0n895_8817_c1 3300050512 Bacteria 8775
1123 nmdc:mga0rr50_24310_c1 3300050513 Bacteria 4195
1124 nmdc:mga0rr50_319866_c1 3300050513 Bacteria 1301
1125 nmdc:mga0rr50_446113_c1 3300050513 Bacteria 1097
1126 nmdc:mga08x19_428330_c1 3300050514 Bacteria 930
1127 nmdc:mga08x19_73607_c1 3300050514 Bacteria 2231
1128 nmdc:mga0a205_21186_c1 3300050515 Bacteria 6148
1129 nmdc:mga0a205_2601_c1 3300050515 Bacteria 15940
1130 nmdc:mga0a205_47499_c1 3300050515 Bacteria 4142
1131 nmdc:mga0a205_50263_c1 3300050515 Bacteria 4025
1132 nmdc:mga0a205_56483_c1 3300050515 Bacteria 3790
1133 nmdc:mga0a205_596722_c1 3300050515 Bacteria 958
1134 Ga0495601_0020842 3300053077 Bacteria 4007
1135 Ga0495601_0287043 3300053077 Bacteria 1073
1136 Ga0495601_0428063 3300053077 Bacteria 857
1137 Ga0495612_0001298 3300053078 Bacteria 10315
1138 Ga0495612_0143853 3300053078 Bacteria 1035
1139 Ga0500635_0123228 3300053080 Bacteria 972
1140 Ga0495595_0002166 3300053084 Bacteria 7630
1141 Ga0495619_0035341 3300053085 Bacteria 3249
1142 Ga0495619_0040721 3300053085 Bacteria 3037
1143 Ga0495619_0126382 3300053085 Bacteria 1755
1144 Ga0500566_0025639 3300053094 Bacteria 3454
1145 Ga0501084_0000283 3300054114 Bacteria 38382
1146 Ga0501084_0000615 3300054114 Bacteria 27138
1147 Ga0501084_0033540 3300054114 Bacteria 4295
1148 Ga0501084_0040610 3300054114 Bacteria 3892
1149 Ga0501084_0070017 3300054114 Bacteria 2937
1150 Ga0501084_0089455 3300054114 Bacteria 2584
1151 Ga0501084_0091221 3300054114 Bacteria 2558
1152 Ga0501084_0120105 3300054114 Bacteria 2210
1153 Ga0501084_0145344 3300054114 Bacteria 1997
1154 Ga0501084_0165212 3300054114 Bacteria 1868
1155 Ga0501084_0170553 3300054114 Bacteria 1837
1156 Ga0501084_0211281 3300054114 Bacteria 1637
1157 Ga0501084_0248953 3300054114 Bacteria 1500
1158 Ga0501084_0397381 3300054114 Bacteria 1165
1159 Ga0501084_0603640 3300054114 Bacteria 927
1160 Ga0590075_070898 3300059424 Bacteria 900
1161 Ga0501082_0000620 3300060353 Bacteria 31200
1162 Ga0501082_0002904 3300060353 Bacteria 14943
1163 Ga0501082_0018541 3300060353 Bacteria 5997
1164 Ga0501082_0018734 3300060353 Bacteria 5964
1165 Ga0501082_0051205 3300060353 Bacteria 3559
1166 Ga0501082_0124480 3300060353 Bacteria 2235
1167 Ga0501082_0280780 3300060353 Bacteria 1449
1168 Ga0501082_0519774 3300060353 Bacteria 1040
1169 Ga0501082_0962516 3300060353 Bacteria 746
1170 Ga0530510_0001002 3300061734 Bacteria 18761
1171 Ga0530510_0001060 3300061734 Bacteria 18252
1172 Ga0530510_0043921 3300061734 Bacteria 3229
1173 Ga0530510_0049390 3300061734 Bacteria 3040
1174 Ga0530510_0063846 3300061734 Bacteria 2666
1175 Ga0530510_0080283 3300061734 Bacteria 2373
1176 Ga0530510_0084038 3300061734 Bacteria 2318
1177 Ga0530510_0091685 3300061734 Bacteria 2217
1178 Ga0530510_0100951 3300061734 Bacteria 2110
1179 Ga0530510_0130786 3300061734 Bacteria 1846
1180 Ga0530510_0246756 3300061734 Bacteria 1330
1181 Ga0530510_0369931 3300061734 Bacteria 1078
1182 Ga0316575_10022659
1183 ARCol0yngRDRAFT_1002425
1184 JGI24743J22301_10005078
1185 JGI24738J21930_10006594
1186 JGI24744J21845_10021288
1187 JGI24742J22300_10042329
1188 JGI25406J46586_10018384
1189 JGI25407J50210_10012285
1190 Ga0058859_11627522
1191 Ga0070658_10873762
1192 Ga0070676_10023233
1193 Ga0070676_10269177
1194 Ga0070676_10590613
1195 Ga0070683_100005546
1196 Ga0070683_100029977
1197 Ga0070683_100056097
1198 Ga0070683_100143903
1199 Ga0070683_100175783
1200 Ga0070683_100616662
1201 Ga0070690_100026598
1202 Ga0070670_100005260
1203 Ga0070670_100046103
1204 Ga0070670_100134981
1205 Ga0070677_10272159
1206 Ga0070666_10247381
1207 Ga0070680_100018352
1208 Ga0070680_100221084
1209 Ga0070682_100032170
1210 Ga0070682_100062128
1211 Ga0070682_100512555
1212 Ga0068868_100036772
1213 Ga0068868_100205820
1214 Ga0070660_100049813
1215 Ga0070660_100475826
1216 Ga0070660_100603847
1217 Ga0070689_100032108
1218 Ga0070689_100037066
1219 Ga0070689_100151456
1220 Ga0070689_100321806
1221 Ga0070689_100489914
1222 Ga0070691_10002704
1223 Ga0070691_10014431
1224 Ga0070691_10122319
1225 Ga0070691_10193669
1226 Ga0070687_100075234
1227 Ga0070687_100128508
1228 Ga0070661_100014032
1229 Ga0070661_100092587
1230 Ga0070661_100133575
1231 Ga0070661_100152288
1232 Ga0070661_100728484
1233 Ga0070692_10029463
1234 Ga0070692_10047881
1235 Ga0070692_10122068
1236 Ga0070692_10414574
1237 Ga0070668_100012259
1238 Ga0070668_100275474
1239 Ga0070669_100479785
1240 Ga0070675_100010174
1241 Ga0070675_100029856
1242 Ga0070675_100032976
1243 Ga0070675_100053892
1244 Ga0070675_100201152
1245 Ga0070671_100091611
1246 Ga0070671_100159545
1247 Ga0070671_100301755
1248 Ga0070671_100414692
1249 Ga0070674_100015824
1250 Ga0070674_100019120
1251 Ga0070674_100019153
1252 Ga0070674_100043387
1253 Ga0070674_100142421
1254 Ga0070673_100062762
1255 Ga0070673_100211907
1256 Ga0070673_100922438
1257 Ga0070688_100002799
1258 Ga0070688_100003836
1259 Ga0070688_100006907
1260 Ga0070688_100672043
1261 Ga0070659_100014825
1262 Ga0070659_100047003
1263 Ga0070659_100156837
1264 Ga0070659_100380009
1265 Ga0070659_100669995
1266 Ga0070703_10135765
1267 Ga0070701_10013500
1268 Ga0070701_10017099
1269 Ga0070701_10048033
1270 Ga0070701_10078903
1271 Ga0070705_100040177
1272 Ga0070705_100265730
1273 Ga0070700_100036179
1274 Ga0070700_100055466
1275 Ga0070700_100131831
1276 Ga0070694_100714969
1277 Ga0070678_100011153
1278 Ga0070678_100142667
1279 Ga0070678_100442723
1280 Ga0070678_100670693
1281 Ga0070662_100002641
1282 Ga0070662_100038958
1283 Ga0070662_100422723
1284 Ga0070681_10055522
1285 Ga0070681_10101363
1286 Ga0070681_10383742
1287 Ga0068867_100009644
1288 Ga0068867_100031551
1289 Ga0068867_100052688
1290 Ga0068867_100131312
1291 Ga0068867_100149059
1292 Ga0068867_100256647
1293 Ga0070685_10051549
1294 Ga0070685_10054937
1295 Ga0070685_10076741
1296 Ga0070707_100363228
1297 Ga0070707_100577446
1298 Ga0070698_100071396
1299 Ga0070679_100009974
1300 Ga0070679_100072153
1301 Ga0070679_100163418
1302 Ga0070684_100012891
1303 Ga0070684_100032453
1304 Ga0070684_100035997
1305 Ga0070684_100036248
1306 Ga0070684_100052634
1307 Ga0070684_100114159
1308 Ga0070684_100131796
1309 Ga0070684_100153885
1310 Ga0070684_100299901
1311 Ga0070684_100345313
1312 Ga0068853_100063858
1313 Ga0068853_100070313
1314 Ga0070672_100038700
1315 Ga0070672_100063464
1316 Ga0070672_100068879
1317 Ga0070672_100659057
1318 Ga0070686_100012648
1319 Ga0070686_100042346
1320 Ga0070686_100177552
1321 Ga0070686_100984453
1322 Ga0070695_100020417
1323 Ga0070695_100049615
1324 Ga0070695_100134261
1325 Ga0070695_100440034
1326 Ga0070696_100044339
1327 Ga0070696_100050831
1328 Ga0070696_100073026
1329 Ga0070696_100120356
1330 Ga0070696_100187549
1331 Ga0070693_100012465
1332 Ga0070693_100034757
1333 Ga0070693_100066309
1334 Ga0070693_100162485
1335 Ga0070693_100624574
1336 Ga0070665_100074294
1337 Ga0070665_100133125
1338 Ga0070665_100178830
1339 Ga0070704_100020903
1340 Ga0070704_100029456
1341 Ga0070704_100059213
1342 Ga0070704_100095398
1343 Ga0070704_100234986
1344 Ga0068855_100073422
1345 Ga0068855_100164335
1346 Ga0068855_100372779
1347 Ga0070664_100026590
1348 Ga0070664_100028840
1349 Ga0070664_100065856
1350 Ga0070664_100199859
1351 Ga0068857_100164638
1352 Ga0068857_100263390
1353 Ga0068857_100264741
1354 Ga0068857_100335282
1355 Ga0068857_100357923
1356 Ga0068857_100461603
1357 Ga0068854_100061393
1358 Ga0068854_100098863
1359 Ga0068856_100073341
1360 Ga0068856_100218403
1361 Ga0070702_100018607
1362 Ga0070702_100209306
1363 Ga0070702_100257818
1364 Ga0068852_100409244
1365 Ga0068852_100445146
1366 Ga0068859_100037113
1367 Ga0068859_100054125
1368 Ga0068859_100062509
1369 Ga0068864_100107532
1370 Ga0068866_10040244
1371 Ga0068866_10060668
1372 Ga0068866_10061852
1373 Ga0068861_100001783
1374 Ga0068861_100014938
1375 Ga0068861_100018490
1376 Ga0068861_100381177
1377 Ga0068861_100654943
1378 Ga0068851_10412210
1379 Ga0068870_10013596
1380 Ga0068870_10018387
1381 Ga0068870_10248053
1382 Ga0068863_100031864
1383 Ga0068863_100167584
1384 Ga0068860_100033315
1385 Ga0068860_100268433
1386 Ga0068860_100507446
1387 Ga0068860_100815868
1388 Ga0068862_100548509
1389 Ga0081455_10019559
1390 Ga0081455_10020013
1391 Ga0081455_10024399
1392 Ga0081455_10421009
1393 Ga0081538_10000094
1394 Ga0081538_10000151
1395 Ga0081538_10002077
1396 Ga0081538_10003829
1397 Ga0081538_10010054
1398 Ga0081538_10020527
1399 Ga0081540_1014346
1400 Ga0081539_10000200
1401 Ga0081539_10000397
1402 Ga0070717_10033890
1403 Ga0070717_11128852
1404 Ga0075365_10156996
1405 Ga0075365_10230865
1406 Ga0075364_10074048
1407 Ga0075364_10104093
1408 Ga0075364_10316452
1409 Ga0075432_10003491
1410 Ga0075432_10053088
1411 Ga0070715_10130771
1412 Ga0070712_100477707
1413 Ga0075362_10154240
1414 Ga0097621_100910277
1415 Ga0068871_100359882
1416 Ga0068871_100370812
1417 Ga0075428_100037530
1418 Ga0075428_100180483
1419 Ga0075428_100299372
1420 Ga0075428_100331976
1421 Ga0075428_100455763
1422 Ga0075428_101045410
1423 Ga0075428_101585647
1424 Ga0075430_100049513
1425 Ga0075430_100058265
1426 Ga0075431_100008692
1427 Ga0075431_100051547
1428 Ga0075431_100233704
1429 Ga0075433_10034898
1430 Ga0075433_10043840
1431 Ga0075433_10052279
1432 Ga0075433_10212346
1433 Ga0075433_10235240
1434 Ga0075434_100003398
1435 Ga0075434_100042219
1436 Ga0075434_100049702
1437 Ga0075434_100056902
1438 Ga0075434_100077917
1439 Ga0075434_100546095
1440 Ga0075429_100062846
1441 Ga0075429_100104768
1442 Ga0075429_100138319
1443 Ga0075429_100173429
1444 Ga0075429_100452785
1445 Ga0075429_100695599
1446 Ga0068865_100011940
1447 Ga0068865_100037576
1448 Ga0068865_100056517
1449 Ga0068865_100097545
1450 Ga0068865_100197248
1451 Ga0068865_100676185
1452 Ga0075436_100059443
1453 Ga0075436_100522717
1454 Ga0097620_100037113
1455 Ga0097620_100054125
1456 Ga0097620_100062508
1457 Ga0075435_100012793
1458 Ga0075435_100409045
1459 Ga0105240_10024285
1460 Ga0105240_10042861
1461 Ga0111539_10008714
1462 Ga0111539_10151517
1463 Ga0111539_10153773
1464 Ga0111539_10165941
1465 Ga0111539_10282661
1466 Ga0111539_10352157
1467 Ga0111539_10416492
1468 Ga0105245_10070989
1469 Ga0105245_10165862
1470 Ga0105245_10185696
1471 Ga0105245_10230601
1472 Ga0105245_10606230
1473 Ga0114129_10008166
1474 Ga0114129_10031268
1475 Ga0114129_10141390
1476 Ga0114129_10157426
1477 Ga0114129_10291515
1478 Ga0114129_10681671
1479 Ga0114129_11236421
1480 Ga0114129_11672445
1481 Ga0105243_10007592
1482 Ga0105243_10077699
1483 Ga0105243_10087909
1484 Ga0105243_10139040
1485 Ga0105241_10227272
1486 Ga0105242_10073834
1487 Ga0105242_10159104
1488 Ga0105242_10860060
1489 Ga0105242_10864420
1490 Ga0105248_10105467
1491 Ga0105248_10272386
1492 Ga0105248_10700432
1493 Ga0105238_10118379
1494 Ga0105238_10145128
1495 Ga0105238_10523943
1496 Ga0105249_10001703
1497 Ga0105249_10144708
1498 Ga0105030_105611
1499 Ga0105239_10053016
1500 Ga0105239_10082737
1501 Ga0105239_10083336
1502 Ga0105239_10096795
1503 Ga0105239_10145998
1504 Ga0105246_10040213
1505 Ga0105246_10097572
1506 Ga0105246_10339793
1507 Ga0157313_1013765
1508 Ga0157326_1019773
1509 Ga0157373_10454209
1510 Ga0157371_10020304
1511 Ga0157371_10024782
1512 Ga0157371_10241373
1513 Ga0157370_10091450
1514 Ga0157370_10238397
1515 Ga0157369_10186118
1516 Ga0157369_10233037
1517 Ga0157369_10409251
1518 Ga0157378_10378108
1519 Ga0157378_10380363
1520 Ga0157378_10472205
1521 Ga0163162_10188658
1522 Ga0163162_10527246
1523 Ga0163162_10548075
1524 Ga0157372_10258409
1525 Ga0157372_10350676
1526 Ga0157372_10397006
1527 Ga0157375_10142125
1528 Ga0163163_10044422
1529 Ga0163163_10096782
1530 Ga0163163_11214996
1531 Ga0157380_10006119
1532 Ga0157380_10028368
1533 Ga0157380_10037771
1534 Ga0157380_10156439
1535 Ga0182008_10028595
1536 Ga0182008_10474710
1537 Ga0157377_10026140
1538 Ga0157377_10047370
1539 Ga0157377_10070458
1540 Ga0157376_10062225
1541 Ga0157376_10289248
1542 Ga0157376_10335002
1543 Ga0182006_1004688
1544 Ga0182007_10030600
1545 Ga0163161_10043707
1546 Ga0163161_10123803
1547 Ga0163161_10297645
1548 Ga0206356_10084031
1549 Ga0206356_11880732
1550 Ga0206353_10050886
1551 Ga0224712_10048328
1552 Ga0207656_10004884
1553 Ga0207653_10041888
1554 Ga0207682_10069089
1555 Ga0207642_10010501
1556 Ga0207642_10096570
1557 Ga0207642_10481324
1558 Ga0207688_10008842
1559 Ga0207688_10009411
1560 Ga0207688_10087309
1561 Ga0207680_10392933
1562 Ga0207645_10021117
1563 Ga0207645_10217501
1564 Ga0207645_10473928
1565 Ga0207643_10023824
1566 Ga0207643_10097326
1567 Ga0207705_10058502
1568 Ga0207705_10177987
1569 Ga0207654_10215489
1570 Ga0207707_10019074
1571 Ga0207707_10065796
1572 Ga0207707_10116061
1573 Ga0207707_10588923
1574 Ga0207695_10051159
1575 Ga0207695_10091830
1576 Ga0207695_10223643
1577 Ga0207671_10540763
1578 Ga0207660_10051209
1579 Ga0207660_10062318
1580 Ga0207662_10001652
1581 Ga0207662_10049973
1582 Ga0207662_10157319
1583 Ga0207657_10047922
1584 Ga0207657_10062709
1585 Ga0207657_10351552
1586 Ga0207649_10034215
1587 Ga0207649_10036899
1588 Ga0207649_10207444
1589 Ga0207652_10091551
1590 Ga0207652_10120752
1591 Ga0207652_10128926
1592 Ga0207652_10531914
1593 Ga0207652_10541974
1594 Ga0207646_10297273
1595 Ga0207694_10068868
1596 Ga0207650_10116148
1597 Ga0207650_10336934
1598 Ga0207659_10035304
1599 Ga0207659_10038607
1600 Ga0207659_10176832
1601 Ga0207687_10021592
1602 Ga0207687_10052606
1603 Ga0207687_10094793
1604 Ga0207687_10285804
1605 Ga0207687_10503691
1606 Ga0207687_10651970
1607 Ga0207687_10737837
1608 Ga0207687_10802473
1609 Ga0207700_10166368
1610 Ga0207644_10055976
1611 Ga0207644_10477791
1612 Ga0207690_10035342
1613 Ga0207690_10119273
1614 Ga0207690_10322678
1615 Ga0207706_10014850
1616 Ga0207706_10023330
1617 Ga0207706_10121780
1618 Ga0207686_10044037
1619 Ga0207686_10451955
1620 Ga0207709_10045396
1621 Ga0207709_10239659
1622 Ga0207670_10000052
1623 Ga0207670_10000777
1624 Ga0207670_10025700
1625 Ga0207670_10135836
1626 Ga0207670_10433240
1627 Ga0207670_10564853
1628 Ga0207669_10003761
1629 Ga0207669_10076033
1630 Ga0207669_10255242
1631 Ga0207669_10568350
1632 Ga0207704_10019975
1633 Ga0207704_10136732
1634 Ga0207704_10238284
1635 Ga0207704_10532197
1636 Ga0207665_10244925
1637 Ga0207691_10019105
1638 Ga0207691_10029091
1639 Ga0207691_10228596
1640 Ga0207711_10555238
1641 Ga0207711_10594829
1642 Ga0207689_10082876
1643 Ga0207689_10156467
1644 Ga0207661_10008048
1645 Ga0207661_10011136
1646 Ga0207661_10067021
1647 Ga0207661_10123849
1648 Ga0207661_10143474
1649 Ga0207661_10197640
1650 Ga0207661_10233264
1651 Ga0207661_10239136
1652 Ga0207679_10063384
1653 Ga0207712_10210894
1654 Ga0207668_10228891
1655 Ga0207640_10057756
1656 Ga0207640_10076561
1657 Ga0207677_10064996
1658 Ga0207703_10130773
1659 Ga0207639_10026202
1660 Ga0207639_10701097
1661 Ga0207639_11171886
1662 Ga0207678_10027460
1663 Ga0207708_10016026
1664 Ga0207708_10018968
1665 Ga0207708_10149854
1666 Ga0207708_10160573
1667 Ga0207702_10002686
1668 Ga0207702_10111718
1669 Ga0207702_10223196
1670 Ga0207702_10262571
1671 Ga0207702_10367529
1672 Ga0207641_10510158
1673 Ga0207641_10514303
1674 Ga0207641_10592034
1675 Ga0207648_10020479
1676 Ga0207648_10024817
1677 Ga0207648_10148217
1678 Ga0207648_10894249
1679 Ga0207676_10495474
1680 Ga0207674_10018407
1681 Ga0207674_10244635
1682 Ga0207674_10342728
1683 Ga0207675_100094141
1684 Ga0207675_100235336
1685 Ga0207675_100550530
1686 Ga0207683_10102758
1687 Ga0207683_10192287
1688 Ga0207683_10266846
1689 Ga0207683_10611988
1690 Ga0207698_10370522
1691 Ga0207698_10399380
1692 Ga0209966_1022570
1693 Ga0207428_10000244
1694 Ga0207428_10002045
1695 Ga0207428_10024681
1696 Ga0207428_10152785
1697 Ga0207428_10261848
1698 Ga0207428_10295653
1699 Ga0207428_10339465
1700 Ga0268266_10184650
1701 Ga0268264_10034622
1702 Ga0268264_10154438
1703 Ga0268264_10473808
1704 Ga0265318_10118696
1705 Ga0307408_100173813
1706 Ga0316579_10026338
1707 Ga0316576_10030962
1708 Ga0316576_10083098
1709 Ga0316577_10070157
1710 Ga0307406_10184411
1711 Ga0307406_10259522
1712 Ga0307409_100113545
1713 Ga0307409_100382576
1714 Ga0307409_100388677
1715 Ga0307416_100018953
1716 Ga0307416_100089230
1717 Ga0307416_100159843
1718 Ga0307416_100300479
1719 Ga0307416_100875152
1720 Ga0307415_100010159
1721 Ga0307415_100221916
1722 Ga0307415_100405872
1723 Ga0316583_10016988
1724 Ga0373926_0002828
1725 Ga0373934_0004376
1726 Ga0373951_0158762
1727 Ga0373923_0044557
1728 Ga0373932_0077724
1729 Ga0373936_0010863
1730 Ga0373936_0033664
1731 Ga0373945_0007197
1732 Ga0373953_0009792
1733 Ga0373954_0045875
1734 Ga0373957_0023325
1735 Ga0373960_0086460
1736 Ga0373943_0009843
1737 Ga0373955_0068140
1738 Ga0373955_0201197
1739 Ga0373961_0016184
1740 Ga0316574_0027625
1741 Ga0373924_0101064
1742 Ga0373931_0171421
1743 Ga0373935_0004795
1744 Ga0373927_0040183
1745 Ga0373933_0126517
1746 Ga0373947_0013853
1747 Ga0373937_0475269
1748 Ga0373937_0716547
1749 Ga0316582_0079478
1750 Ga0316584_0038711
1751 Ga0373925_0009138
1752 Ga0373925_0411666
1753 Ga0395899_0006920
1754 Ga0395899_0053365
1755 Ga0395899_0060250
1756 Ga0395899_0072888
1757 Ga0395899_0179523
1758 Ga0395900_0003521
1759 Ga0395900_0007081
1760 Ga0395900_0025290
1761 Ga0395900_0068849
1762 Ga0395900_0076480
1763 Ga0395900_0077244
1764 Ga0395900_0131987
1765 Ga0395900_0147983
1766 Ga0395900_0149858
1767 Ga0395900_0171873
1768 Ga0395900_0264495
1769 Ga0395900_0791248
1770 Ga0395898_0001875
1771 Ga0395898_0003526
1772 Ga0395898_0010231
1773 Ga0395898_0043221
1774 Ga0395898_0076766
1775 Ga0395898_0155222
1776 Ga0395898_0256253
1777 Ga0395905_0009915
1778 Ga0395905_0018552
1779 Ga0395905_0021602
1780 Ga0395905_0031768
1781 Ga0395905_0174934
1782 Ga0395905_0189838
1783 Ga0395905_0235815
1784 Ga0395905_0250761
1785 Ga0395905_0530987
1786 Ga0395901_0005796
1787 Ga0395901_0012794
1788 Ga0395901_0019001
1789 Ga0395901_0033883
1790 Ga0395901_0039047
1791 Ga0395901_0049656
1792 Ga0395901_0110917
1793 Ga0395901_0131367
1794 Ga0395901_0161010
1795 Ga0395901_0175304
1796 Ga0395901_0291492
1797 Ga0395901_0517645
1798 Ga0395901_1265605
1799 Ga0439439_0036238
1800 Ga0439453_0010973
1801 Ga0439453_0035155
1802 Ga0439461_0075232
1803 Ga0439465_0138089
1804 Ga0451833_0318449
1805 Ga0439448_0016418
1806 Ga0439448_0022619
1807 Ga0439451_006592
1808 Ga0439454_012450
1809 Ga0439455_0086155
1810 Ga0450917_009464
1811 Ga0450920_002965
1812 Ga0450908_012972
1813 Ga0439434_0002257
1814 Ga0439434_0005571
1815 Ga0451577_0082678
1816 Ga0439440_0066013
1817 Ga0453683_0313693
1818 Ga0466961_0136624
1819 Ga0466963_0004083
1820 Ga0466963_0007021
1821 Ga0466964_0003226
1822 Ga0466964_0018741
1823 Ga0466971_0100910
1824 Ga0466957_0037743
1825 Ga0466959_0126321
1826 Ga0466959_0129058
1827 Ga0466959_0459360
1828 Ga0451576_0036687
1829 Ga0451576_0207766
1830 Ga0451576_0610396
1831 Ga0466958_0016722
1832 Ga0466958_0018150
1833 Ga0466958_0100734
1834 Ga0466958_0115111
1835 Ga0466967_0001509
1836 Ga0466967_0005611
1837 Ga0466967_0019707
1838 Ga0466967_0030118
1839 Ga0466967_0085632
1840 Ga0466967_0109832
1841 Ga0466967_0172737
1842 Ga0495592_0030764
1843 Ga0495592_0083751
1844 Ga0495603_0001553
1845 Ga0495603_0056192
1846 Ga0495629_0015834
1847 Ga0495629_0017118
1848 Ga0495641_0006144
1849 Ga0495641_0018268
1850 Ga0495641_0055031
1851 Ga0495651_0075246
1852 Ga0495653_0071927
1853 Ga0495653_0076872
1854 Ga0495653_0312923
1855 Ga0495580_0040825
1856 Ga0495582_0019456
1857 Ga0495582_0095964
1858 Ga0495582_0116151
1859 Ga0495639_0000940
1860 Ga0495662_0003702
1861 Ga0495662_0122714
1862 Ga0495662_0140224
1863 Ga0495664_0002895
1864 Ga0495584_0261278
1865 Ga0495585_0071464
1866 Ga0495585_0245198
1867 Ga0495594_0026783
1868 Ga0495594_0554544
1869 Ga0495596_0063221
1870 Ga0495607_0019928
1871 Ga0495607_0094681
1872 Ga0495583_0078167
1873 Ga0495608_0026855
1874 Ga0495608_0526550
1875 Ga0495618_0018778
1876 Ga0495618_0220062
1877 Ga0495620_0111986
1878 Ga0495628_0002036
1879 Ga0495628_0422590
1880 Ga0495630_0006996
1881 Ga0495630_0161658
1882 Ga0495630_0510023
1883 Ga0495631_0065169
1884 Ga0495631_0100357
1885 Ga0495632_0106660
1886 Ga0495643_0104599
1887 Ga0495644_0007305
1888 Ga0495644_0028436
1889 Ga0495644_0054087
1890 Ga0495663_0009173
1891 Ga0495663_0036115
1892 Ga0495663_0046973
1893 Ga0495642_0014764
1894 Ga0495652_0013477
1895 Ga0495652_0536426
1896 Ga0495665_0008331
1897 Ga0495665_0126695
1898 Ga0495640_0280278
1899 Ga0495586_0160449
1900 Ga0495587_0008664
1901 Ga0495598_0040133
1902 Ga0495598_0277942
1903 Ga0495609_0173616
1904 Ga0495645_0146772
1905 Ga0495622_0217704
1906 Ga0495633_0109201
1907 Ga0495633_0326841
1908 Ga0495667_0053928
1909 Ga0495656_0023330
1910 Ga0495656_0143687
1911 Ga0495656_0321457
1912 Ga0495668_0079107
1913 Ga0495668_0124740
1914 Ga0495634_0056818
1915 Ga0495634_0072110
1916 Ga0495611_0321477
1917 Ga0495635_0114065
1918 Ga0495659_0049711
1919 Ga0495588_0020546
1920 Ga0495588_0082313
1921 Ga0495588_0278713
1922 Ga0495657_0028530
1923 Ga0495599_0005910
1924 Ga0495599_0068382
1925 Ga0495646_0048008
1926 Ga0495647_0001137
1927 Ga0495647_0172560
1928 Ga0495647_0304322
1929 Ga0495658_0013456
1930 Ga0495658_0157670
1931 Ga0495658_0492201
1932 Ga0495669_0164862
1933 Ga0495613_0030077
1934 Ga0495613_0191383
1935 Ga0495613_0519700
1936 Ga0495624_0023432
1937 Ga0495624_0115042
1938 Ga0495670_0104413
1939 Ga0495670_0361764
1940 Ga0495671_0103718
1941 Ga0495671_0215173
1942 Ga0495671_0374920
1943 Ga0495649_0086044
1944 Ga0495589_0009382
1945 Ga0495600_0002357
1946 Ga0495600_0036004
1947 Ga0495600_0071657
1948 Ga0495600_0194137
1949 Ga0495581_0005927
1950 Ga0495581_0021131
1951 Ga0495581_0242385
1952 Ga0495674_0008898
1953 Ga0495676_0012449
1954 Ga0495676_0017472
1955 Ga0495676_0091963
1956 Ga0495676_0213757
1957 Ga0495680_0011101
1958 Ga0495680_0047141
1959 Ga0495680_0112992
1960 Ga0495680_0117346
1961 Ga0495680_0208155
1962 Ga0495680_0449852
1963 Ga0495675_0000882
1964 Ga0495684_0098366
1965 Ga0495686_0000011
1966 Ga0495686_0002398
1967 Ga0495686_0167016
1968 Ga0495593_0002580
1969 Ga0495593_0123439
1970 Ga0495614_0000773
1971 Ga0496100_0196817
1972 Ga0496100_0690036
1973 Ga0496100_0715685
1974 Ga0496101_0101553
1975 Ga0496101_0153693
1976 Ga0496101_0180949
1977 Ga0496101_0328634
1978 Ga0496101_0569098
1979 Ga0496102_0113361
1980 Ga0496102_0146780
1981 Ga0496102_0152760
1982 Ga0496102_0248176
1983 Ga0496102_0339508
1984 Ga0496102_0364792
1985 Ga0496102_0520467
1986 Ga0496103_0156516
1987 Ga0496104_0000557
1988 Ga0496104_0071520
1989 Ga0496104_0084121
1990 Ga0496104_0086130
1991 Ga0496104_0201139
1992 Ga0496104_0439610
1993 Ga0496105_0000609
1994 Ga0496105_0043045
1995 Ga0496105_0516419
1996 Ga0496106_0168578
1997 Ga0496107_0049877
1998 Ga0496107_0146436
1999 Ga0496108_0000612
2000 Ga0496108_0100392
2001 Ga0496108_0154710
2002 Ga0496108_0164172
2003 Ga0496108_0287868
2004 Ga0496109_0004344
2005 Ga0496109_0042682
2006 Ga0496109_0148163
2007 Ga0496109_0236149
2008 Ga0496109_0246642
2009 Ga0496109_0294044
2010 Ga0496109_0522370
2011 Ga0496110_0000564
2012 Ga0496110_0016135
2013 Ga0496110_0026242
2014 Ga0496110_0034287
2015 Ga0496110_0037242
2016 Ga0496110_0058251
2017 Ga0496110_0255732
2018 Ga0496111_0000294
2019 Ga0496111_0008012
2020 Ga0496111_0026530
2021 Ga0496111_0181090
2022 Ga0496111_0253641
2023 Ga0496112_0004854
2024 Ga0496112_0039578
2025 Ga0496112_0051852
2026 Ga0496112_0502471
2027 Ga0496112_0588531
2028 Ga0496113_0000414
2029 Ga0496113_0039715
2030 Ga0496114_0064338
2031 Ga0496115_0004631
2032 Ga0495678_077501
2033 Ga0501031_0000033
2034 Ga0501031_0074697
2035 Ga0501031_0118904
2036 Ga0501031_0344194
2037 Ga0501032_0002047
2038 Ga0501032_0058120
2039 Ga0501033_0000388
2040 Ga0501033_0031359
2041 Ga0501033_0034644
2042 Ga0501033_0077541
2043 Ga0501033_0084392
2044 Ga0501034_0003854
2045 Ga0501034_0034552
2046 Ga0501034_0074710
2047 Ga0501034_0176576
2048 Ga0501036_0000462
2049 Ga0501036_0010142
2050 Ga0501036_0013657
2051 Ga0501036_0053869
2052 Ga0501036_0096199
2053 Ga0501036_0405892
2054 Ga0501036_0461168
2055 Ga0501037_0000915
2056 Ga0501037_0018448
2057 Ga0501037_0020177
2058 Ga0501037_0033954
2059 Ga0501038_0001345
2060 Ga0501038_0003559
2061 Ga0501038_0017214
2062 Ga0501038_0474452
2063 Ga0501038_0584200
2064 Ga0501039_0000528
2065 Ga0501039_0002890
2066 Ga0501039_0004144
2067 Ga0501039_0009715
2068 Ga0501039_0048266
2069 Ga0501039_0389578
2070 Ga0501039_0842826
2071 Ga0501040_0000234
2072 Ga0501040_0001857
2073 Ga0501040_0063098
2074 Ga0501040_0063793
2075 Ga0501040_0086026
2076 Ga0501040_0289973
2077 Ga0501041_0000176
2078 Ga0501041_0001613
2079 Ga0501041_0001653
2080 Ga0501041_0001903
2081 Ga0501041_0004551
2082 Ga0501041_0022657
2083 Ga0501041_0061510
2084 Ga0501041_0064517
2085 Ga0501041_0097119
2086 Ga0501042_0001051
2087 Ga0501042_0002112
2088 Ga0501042_0002211
2089 Ga0501042_0005399
2090 Ga0501042_0012515
2091 Ga0501042_0101799
2092 Ga0501042_0212790
2093 Ga0501043_0000798
2094 Ga0501043_0010457
2095 Ga0501043_0010678
2096 Ga0501043_0034434
2097 Ga0501043_0101721
2098 Ga0501043_0320369
2099 Ga0501046_0000577
2100 Ga0501046_0001998
2101 Ga0501046_0016228
2102 Ga0501046_0028735
2103 Ga0501046_0044538
2104 Ga0501046_0236750
2105 Ga0501047_0001088
2106 Ga0501047_0237539
2107 Ga0501048_0000440
2108 Ga0501048_0012920
2109 Ga0501048_0032679
2110 Ga0501048_0038723
2111 Ga0501048_0057132
2112 Ga0501048_0066465
2113 Ga0501048_0066490
2114 Ga0501048_0214312
2115 Ga0501048_0230035
2116 Ga0501067_0008570
2117 Ga0501067_0039241
2118 Ga0501068_0000344
2119 Ga0501068_0001607
2120 Ga0501068_0002038
2121 Ga0501068_0014068
2122 Ga0501068_0022595
2123 Ga0501068_0078854
2124 Ga0501068_0153938
2125 Ga0501068_0302637
2126 Ga0501068_0441195
2127 Ga0501069_0000870
2128 Ga0501069_0018237
2129 Ga0501069_0022470
2130 Ga0501069_0028662
2131 Ga0501069_0066883
2132 Ga0501069_0101498
2133 Ga0501069_0219852
2134 Ga0501069_0295513
2135 Ga0501070_0001864
2136 Ga0501070_0002078
2137 Ga0501070_0029634
2138 Ga0501070_0048740
2139 Ga0501070_0111746
2140 Ga0501070_0323214
2141 Ga0501070_0454328
2142 Ga0501070_0906242
2143 Ga0501071_0000054
2144 Ga0501071_0003445
2145 Ga0501071_0035122
2146 Ga0501071_0037155
2147 Ga0501071_0052443
2148 Ga0501071_0052886
2149 Ga0501071_0079638
2150 Ga0501072_0001204
2151 Ga0501072_0019896
2152 Ga0501072_0020451
2153 Ga0501072_0023725
2154 Ga0501072_0045774
2155 Ga0501072_0056675
2156 Ga0501072_0059776
2157 Ga0501072_0122676
2158 Ga0501072_0186257
2159 Ga0501072_0235721
2160 Ga0501072_0266086
2161 Ga0501073_0004823
2162 Ga0501073_0017301
2163 Ga0501073_0031345
2164 Ga0501073_0086505
2165 Ga0501073_0134345
2166 Ga0501073_0209372
2167 Ga0501073_0425647
2168 Ga0501074_0000008
2169 Ga0501074_0002959
2170 Ga0501074_0025270
2171 Ga0501074_0032984
2172 Ga0501074_0048547
2173 Ga0501074_0282191
2174 Ga0501075_0000096
2175 Ga0501075_0000800
2176 Ga0501075_0005557
2177 Ga0501075_0010477
2178 Ga0501075_0078516
2179 Ga0501075_0100780
2180 Ga0501075_0243314
2181 Ga0501075_0511208
2182 Ga0501076_0000020
2183 Ga0501076_0000459
2184 Ga0501076_0005733
2185 Ga0501076_0015181
2186 Ga0501076_0029367
2187 Ga0501076_0049904
2188 Ga0501076_0076849
2189 Ga0501076_0100399
2190 Ga0501076_0193454
2191 Ga0501076_0199076
2192 Ga0501076_0548262
2193 Ga0501077_0000624
2194 Ga0501077_0001221
2195 Ga0501077_0001720
2196 Ga0501077_0007219
2197 Ga0501077_0022760
2198 Ga0501077_0081356
2199 Ga0501077_0098445
2200 Ga0501077_0137586
2201 Ga0501077_0317482
2202 Ga0501207_042868
2203 Ga0501079_0000001
2204 Ga0501079_0003968
2205 Ga0501079_0006300
2206 Ga0501079_0026049
2207 Ga0501079_0040476
2208 Ga0501079_0042195
2209 Ga0501079_0057533
2210 Ga0501079_0066096
2211 Ga0501079_0103045
2212 Ga0501079_0120970
2213 Ga0501079_0184354
2214 Ga0501079_0212946
2215 Ga0501079_0406266
2216 Ga0501079_0452806
2217 Ga0501079_0539624
2218 Ga0501079_0623383
2219 Ga0501080_0002158
2220 Ga0501080_0003585
2221 Ga0501080_0019482
2222 Ga0501080_0029846
2223 Ga0501080_0032227
2224 Ga0501080_0062453
2225 Ga0501080_0161578
2226 Ga0501080_0382006
2227 Ga0501081_0000001
2228 Ga0501081_0001766
2229 Ga0501081_0001842
2230 Ga0501081_0003476
2231 Ga0501081_0038771
2232 Ga0501081_0047263
2233 Ga0501081_0052606
2234 Ga0501081_0055915
2235 Ga0501081_0075138
2236 Ga0501081_0097627
2237 Ga0501081_0123263
2238 Ga0501081_0139443
2239 Ga0501083_0002293
2240 Ga0501083_0002761
2241 Ga0501083_0006339
2242 Ga0501083_0208135
2243 Ga0501083_0534820
2244 Ga0501035_0001281
2245 Ga0501035_0014419
2246 Ga0501035_0014843
2247 Ga0501035_0056842
2248 Ga0501035_0114552
2249 Ga0501035_0330099
2250 Ga0501044_0004690
2251 Ga0501044_0089591
2252 Ga0501044_0107913
2253 Ga0501044_0271630
2254 Ga0501045_0000641
2255 Ga0501045_0000928
2256 Ga0501045_0026066
2257 Ga0501045_0028467
2258 Ga0501045_0032587
2259 Ga0501045_0049326
2260 Ga0501045_0049599
2261 Ga0501045_0632509
2262 Ga0501045_0720874
2263 nmdc:mga03683_92568_c1
2264 nmdc:mga00v17_188513_c1
2265 nmdc:mga00v17_23947_c1
2266 nmdc:mga0yw44_10226_c1
2267 nmdc:mga0yw44_127669_c1
2268 nmdc:mga0yw44_15187_c1
2269 nmdc:mga0yw44_443870_c1
2270 nmdc:mga06z11_91359_c1
2271 nmdc:mga05p37_182900_c1
2272 nmdc:mga05p37_190055_c1
2273 nmdc:mga05p37_2318_c1
2274 nmdc:mga05p37_250690_c1
2275 nmdc:mga05p37_308161_c1
2276 nmdc:mga05p37_416991_c1
2277 nmdc:mga05p37_565805_c1
2278 nmdc:mga05p37_6607_c1
2279 nmdc:mga05p37_946759_c1
2280 nmdc:mga09592_1034835_c1
2281 nmdc:mga09592_13265_c1
2282 nmdc:mga09592_2473_c1
2283 nmdc:mga09592_52444_c1
2284 nmdc:mga09592_664301_c1
2285 nmdc:mga09592_92614_c1
2286 nmdc:mga09592_93274_c1
2287 nmdc:mga0qj67_111978_c1
2288 nmdc:mga0qj67_151171_c1
2289 nmdc:mga0qj67_242283_c1
2290 nmdc:mga0qj67_344340_c1
2291 nmdc:mga0qj67_56792_c1
2292 nmdc:mga06r32_43044_c1
2293 nmdc:mga06r32_51930_c1
2294 nmdc:mga08y16_108558_c1
2295 nmdc:mga08y16_11412_c1
2296 nmdc:mga08y16_143557_c1
2297 nmdc:mga08y16_149061_c1
2298 nmdc:mga08y16_178948_c1
2299 nmdc:mga08y16_378288_c1
2300 nmdc:mga0n895_169144_c1
2301 nmdc:mga0n895_430832_c1
2302 nmdc:mga0n895_66062_c1
2303 nmdc:mga0n895_8817_c1
2304 nmdc:mga0rr50_24310_c1
2305 nmdc:mga0rr50_319866_c1
2306 nmdc:mga0rr50_446113_c1
2307 nmdc:mga08x19_428330_c1
2308 nmdc:mga08x19_73607_c1
2309 nmdc:mga0a205_21186_c1
2310 nmdc:mga0a205_2601_c1
2311 nmdc:mga0a205_47499_c1
2312 nmdc:mga0a205_50263_c1
2313 nmdc:mga0a205_56483_c1
2314 nmdc:mga0a205_596722_c1
2315 Ga0495601_0020842
2316 Ga0495601_0287043
2317 Ga0495601_0428063
2318 Ga0495612_0001298
2319 Ga0495612_0143853
2320 Ga0500635_0123228
2321 Ga0495595_0002166
2322 Ga0495619_0035341
2323 Ga0495619_0040721
2324 Ga0495619_0126382
2325 Ga0500566_0025639
2326 Ga0501084_0000283
2327 Ga0501084_0000615
2328 Ga0501084_0033540
2329 Ga0501084_0040610
2330 Ga0501084_0070017
2331 Ga0501084_0089455
2332 Ga0501084_0091221
2333 Ga0501084_0120105
2334 Ga0501084_0145344
2335 Ga0501084_0165212
2336 Ga0501084_0170553
2337 Ga0501084_0211281
2338 Ga0501084_0248953
2339 Ga0501084_0397381
2340 Ga0501084_0603640
2341 Ga0590075_070898
2342 Ga0501082_0000620
2343 Ga0501082_0002904
2344 Ga0501082_0018541
2345 Ga0501082_0018734
2346 Ga0501082_0051205
2347 Ga0501082_0124480
2348 Ga0501082_0280780
2349 Ga0501082_0519774
2350 Ga0501082_0962516
2351 Ga0530510_0001002
2352 Ga0530510_0001060
2353 Ga0530510_0043921
2354 Ga0530510_0049390
2355 Ga0530510_0063846
2356 Ga0530510_0080283
2357 Ga0530510_0084038
2358 Ga0530510_0091685
2359 Ga0530510_0100951
2360 Ga0530510_0130786
2361 Ga0530510_0246756
2362 Ga0530510_0369931

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

50

160

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oiz-assembly1.cif.gz_A crystal structure of antisigma-factor antagonist, stas domain from rhodobacter sphaeroides 0.6655 90 136
3fg6-assembly2.cif.gz_C structure of the c-terminus of adseverin 0.659 89 136
3fg6-assembly4.cif.gz_E structure of the c-terminus of adseverin 0.6338 89 136
3lkl-assembly2.cif.gz_A crystal structure of the c-terminal domain of anti-sigma factor antagonist stas from rhodobacter sphaeroides 0.6176 90 142
3dtt-assembly1.cif.gz_B crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.551 104 136
ID Description Score Start End Superfamily
af_A0A0G2L6S5_4_245_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.6735 89 136 3.60.10.10
af_A0A0R0FAV2_1_102_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6236 104 159 3.40.50.300
af_A0A1D6HUB6_203_292_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5992 88 135 3.40.630.30
af_K7N1N6_1_170_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.5563 90 136 3.60.10.10
af_A0A0R0JAC1_523_741_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.5555 84 136 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A5P2B2V3-F1-model_v4 Anti-sigma factor antagonist 0.6612 81 136 GO:0043856
AF-A0A839RWW1-F1-model_v4 Anti-sigma factor antagonist 0.6007 87 134 GO:0043856
AF-A0A7J9VDQ0-F1-model_v4 Anti-sigma factor antagonist 0.5888 87 134 GO:0043856
AF-A0A0G0AVG7-F1-model_v4 Polymerase beta nucleotidyltransferase domain-containing protein 0.5862 92 136
AF-A0A520EQJ6-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.5715 74 136 GO:0004089
GO:0008270
GO:0015976
GO:0016020
GO:0055085

Map