F491306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1181 | 393 | 2362 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300031665|Ga0316575_10022659|Ga0316575_100226592 |
| Length | 232 |
| Sequence | MTTRKDLPTIQGLEAGADTGPPRSWLTTRIDYLVNWSRRNSIWPMPFGTACCAIEMMAAAASKYDLARFGMERFSFSPRQADLMIVAGRVSYKLAPIMRRVWDQMPQPKWCVSMGACASSGGMFDNYTIMQGIDQVVPVDVYVPGCPPRPESLIYALLMVQEKIKGESLVNPELRAENPDAVGRPNLPPEAIELVAQPFGNSTRQNRVSGAEPSGAILRPRDRLERLLEHQD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 2 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 109 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 190 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 191 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 220 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 228 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 232 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 233 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 234 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 235 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 236 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 237 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 238 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 387 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.35 |
| Nodule | 0 |
| Rhizoplane | 5.17 |
| Rhizosphere | 93.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316575_10022659 | 3300031665 | Bacteria | 2425 |
| 2 | ARCol0yngRDRAFT_1002425 | 3300000652 | Bacteria | 1407 |
| 3 | JGI24743J22301_10005078 | 3300001991 | Bacteria | 2180 |
| 4 | JGI24738J21930_10006594 | 3300002075 | Bacteria | 2709 |
| 5 | JGI24744J21845_10021288 | 3300002077 | Bacteria | 1276 |
| 6 | JGI24742J22300_10042329 | 3300002244 | Bacteria | 813 |
| 7 | JGI25406J46586_10018384 | 3300003203 | Bacteria | 2872 |
| 8 | JGI25407J50210_10012285 | 3300003373 | Bacteria | 2194 |
| 9 | Ga0058859_11627522 | 3300004798 | Bacteria | 840 |
| 10 | Ga0070658_10873762 | 3300005327 | Bacteria | 782 |
| 11 | Ga0070676_10023233 | 3300005328 | Bacteria | 3483 |
| 12 | Ga0070676_10269177 | 3300005328 | Bacteria | 1144 |
| 13 | Ga0070676_10590613 | 3300005328 | Bacteria | 800 |
| 14 | Ga0070683_100005546 | 3300005329 | Bacteria | 10542 |
| 15 | Ga0070683_100029977 | 3300005329 | Bacteria | 4933 |
| 16 | Ga0070683_100056097 | 3300005329 | Bacteria | 3658 |
| 17 | Ga0070683_100143903 | 3300005329 | Bacteria | 2259 |
| 18 | Ga0070683_100175783 | 3300005329 | Bacteria | 2032 |
| 19 | Ga0070683_100616662 | 3300005329 | Bacteria | 1038 |
| 20 | Ga0070690_100026598 | 3300005330 | Bacteria | 3570 |
| 21 | Ga0070670_100005260 | 3300005331 | Bacteria | 10898 |
| 22 | Ga0070670_100046103 | 3300005331 | Bacteria | 3748 |
| 23 | Ga0070670_100134981 | 3300005331 | Bacteria | 2132 |
| 24 | Ga0070677_10272159 | 3300005333 | Bacteria | 850 |
| 25 | Ga0070666_10247381 | 3300005335 | Bacteria | 1262 |
| 26 | Ga0070680_100018352 | 3300005336 | Bacteria | 5526 |
| 27 | Ga0070680_100221084 | 3300005336 | Bacteria | 1599 |
| 28 | Ga0070682_100032170 | 3300005337 | Bacteria | 3178 |
| 29 | Ga0070682_100062128 | 3300005337 | Bacteria | 2365 |
| 30 | Ga0070682_100512555 | 3300005337 | Bacteria | 931 |
| 31 | Ga0068868_100036772 | 3300005338 | Bacteria | 3793 |
| 32 | Ga0068868_100205820 | 3300005338 | Bacteria | 1642 |
| 33 | Ga0070660_100049813 | 3300005339 | Bacteria | 3221 |
| 34 | Ga0070660_100475826 | 3300005339 | Bacteria | 1038 |
| 35 | Ga0070660_100603847 | 3300005339 | Bacteria | 917 |
| 36 | Ga0070689_100032108 | 3300005340 | Bacteria | 3993 |
| 37 | Ga0070689_100037066 | 3300005340 | Bacteria | 3729 |
| 38 | Ga0070689_100151456 | 3300005340 | Bacteria | 1870 |
| 39 | Ga0070689_100321806 | 3300005340 | Bacteria | 1292 |
| 40 | Ga0070689_100489914 | 3300005340 | Bacteria | 1051 |
| 41 | Ga0070691_10002704 | 3300005341 | Bacteria | 7901 |
| 42 | Ga0070691_10014431 | 3300005341 | Bacteria | 3624 |
| 43 | Ga0070691_10122319 | 3300005341 | Bacteria | 1312 |
| 44 | Ga0070691_10193669 | 3300005341 | Bacteria | 1065 |
| 45 | Ga0070687_100075234 | 3300005343 | Bacteria | 1825 |
| 46 | Ga0070687_100128508 | 3300005343 | Bacteria | 1460 |
| 47 | Ga0070661_100014032 | 3300005344 | Bacteria | 5635 |
| 48 | Ga0070661_100092587 | 3300005344 | Bacteria | 2239 |
| 49 | Ga0070661_100133575 | 3300005344 | Bacteria | 1866 |
| 50 | Ga0070661_100152288 | 3300005344 | Bacteria | 1749 |
| 51 | Ga0070661_100728484 | 3300005344 | Bacteria | 809 |
| 52 | Ga0070692_10029463 | 3300005345 | Bacteria | 2736 |
| 53 | Ga0070692_10047881 | 3300005345 | Bacteria | 2213 |
| 54 | Ga0070692_10122068 | 3300005345 | Bacteria | 1454 |
| 55 | Ga0070692_10414574 | 3300005345 | Bacteria | 853 |
| 56 | Ga0070668_100012259 | 3300005347 | Bacteria | 6387 |
| 57 | Ga0070668_100275474 | 3300005347 | Bacteria | 1404 |
| 58 | Ga0070669_100479785 | 3300005353 | Bacteria | 1029 |
| 59 | Ga0070675_100010174 | 3300005354 | Bacteria | 7336 |
| 60 | Ga0070675_100029856 | 3300005354 | Bacteria | 4398 |
| 61 | Ga0070675_100032976 | 3300005354 | Bacteria | 4195 |
| 62 | Ga0070675_100053892 | 3300005354 | Bacteria | 3308 |
| 63 | Ga0070675_100201152 | 3300005354 | Bacteria | 1729 |
| 64 | Ga0070671_100091611 | 3300005355 | Bacteria | 2547 |
| 65 | Ga0070671_100159545 | 3300005355 | Bacteria | 1906 |
| 66 | Ga0070671_100301755 | 3300005355 | Bacteria | 1364 |
| 67 | Ga0070671_100414692 | 3300005355 | Bacteria | 1153 |
| 68 | Ga0070674_100015824 | 3300005356 | Bacteria | 4717 |
| 69 | Ga0070674_100019120 | 3300005356 | Bacteria | 4346 |
| 70 | Ga0070674_100019153 | 3300005356 | Bacteria | 4343 |
| 71 | Ga0070674_100043387 | 3300005356 | Bacteria | 3059 |
| 72 | Ga0070674_100142421 | 3300005356 | Bacteria | 1801 |
| 73 | Ga0070673_100062762 | 3300005364 | Bacteria | 2953 |
| 74 | Ga0070673_100211907 | 3300005364 | Bacteria | 1674 |
| 75 | Ga0070673_100922438 | 3300005364 | Bacteria | 811 |
| 76 | Ga0070688_100002799 | 3300005365 | Bacteria | 8863 |
| 77 | Ga0070688_100003836 | 3300005365 | Bacteria | 7792 |
| 78 | Ga0070688_100006907 | 3300005365 | Bacteria | 6094 |
| 79 | Ga0070688_100672043 | 3300005365 | Bacteria | 799 |
| 80 | Ga0070659_100014825 | 3300005366 | Bacteria | 5828 |
| 81 | Ga0070659_100047003 | 3300005366 | Bacteria | 3384 |
| 82 | Ga0070659_100156837 | 3300005366 | Bacteria | 1859 |
| 83 | Ga0070659_100380009 | 3300005366 | Bacteria | 1189 |
| 84 | Ga0070659_100669995 | 3300005366 | Bacteria | 895 |
| 85 | Ga0070703_10135765 | 3300005406 | Bacteria | 909 |
| 86 | Ga0070701_10013500 | 3300005438 | Bacteria | 3718 |
| 87 | Ga0070701_10017099 | 3300005438 | Bacteria | 3385 |
| 88 | Ga0070701_10048033 | 3300005438 | Bacteria | 2200 |
| 89 | Ga0070701_10078903 | 3300005438 | Bacteria | 1777 |
| 90 | Ga0070705_100040177 | 3300005440 | Bacteria | 2659 |
| 91 | Ga0070705_100265730 | 3300005440 | Bacteria | 1212 |
| 92 | Ga0070700_100036179 | 3300005441 | Bacteria | 2992 |
| 93 | Ga0070700_100055466 | 3300005441 | Bacteria | 2480 |
| 94 | Ga0070700_100131831 | 3300005441 | Bacteria | 1688 |
| 95 | Ga0070694_100714969 | 3300005444 | Bacteria | 815 |
| 96 | Ga0070678_100011153 | 3300005456 | Bacteria | 5532 |
| 97 | Ga0070678_100142667 | 3300005456 | Bacteria | 1919 |
| 98 | Ga0070678_100442723 | 3300005456 | Bacteria | 1137 |
| 99 | Ga0070678_100670693 | 3300005456 | Bacteria | 932 |
| 100 | Ga0070662_100002641 | 3300005457 | Bacteria | 11051 |
| 101 | Ga0070662_100038958 | 3300005457 | Bacteria | 3379 |
| 102 | Ga0070662_100422723 | 3300005457 | Bacteria | 1103 |
| 103 | Ga0070681_10055522 | 3300005458 | Bacteria | 3943 |
| 104 | Ga0070681_10101363 | 3300005458 | Bacteria | 2825 |
| 105 | Ga0070681_10383742 | 3300005458 | Bacteria | 1316 |
| 106 | Ga0068867_100009644 | 3300005459 | Bacteria | 6806 |
| 107 | Ga0068867_100031551 | 3300005459 | Bacteria | 3827 |
| 108 | Ga0068867_100052688 | 3300005459 | Bacteria | 3003 |
| 109 | Ga0068867_100131312 | 3300005459 | Bacteria | 1947 |
| 110 | Ga0068867_100149059 | 3300005459 | Bacteria | 1836 |
| 111 | Ga0068867_100256647 | 3300005459 | Bacteria | 1423 |
| 112 | Ga0070685_10051549 | 3300005466 | Bacteria | 2379 |
| 113 | Ga0070685_10054937 | 3300005466 | Bacteria | 2312 |
| 114 | Ga0070685_10076741 | 3300005466 | Bacteria | 1993 |
| 115 | Ga0070707_100363228 | 3300005468 | Bacteria | 1406 |
| 116 | Ga0070707_100577446 | 3300005468 | Bacteria | 1086 |
| 117 | Ga0070698_100071396 | 3300005471 | Bacteria | 3482 |
| 118 | Ga0070679_100009974 | 3300005530 | Bacteria | 8991 |
| 119 | Ga0070679_100072153 | 3300005530 | Bacteria | 3444 |
| 120 | Ga0070679_100163418 | 3300005530 | Bacteria | 2200 |
| 121 | Ga0070684_100012891 | 3300005535 | Bacteria | 6720 |
| 122 | Ga0070684_100032453 | 3300005535 | Bacteria | 4451 |
| 123 | Ga0070684_100035997 | 3300005535 | Bacteria | 4240 |
| 124 | Ga0070684_100036248 | 3300005535 | Bacteria | 4226 |
| 125 | Ga0070684_100052634 | 3300005535 | Bacteria | 3541 |
| 126 | Ga0070684_100114159 | 3300005535 | Bacteria | 2424 |
| 127 | Ga0070684_100131796 | 3300005535 | Bacteria | 2255 |
| 128 | Ga0070684_100153885 | 3300005535 | Bacteria | 2084 |
| 129 | Ga0070684_100299901 | 3300005535 | Bacteria | 1474 |
| 130 | Ga0070684_100345313 | 3300005535 | Bacteria | 1368 |
| 131 | Ga0068853_100063858 | 3300005539 | Bacteria | 3190 |
| 132 | Ga0068853_100070313 | 3300005539 | Bacteria | 3046 |
| 133 | Ga0070672_100038700 | 3300005543 | Bacteria | 3647 |
| 134 | Ga0070672_100063464 | 3300005543 | Bacteria | 2917 |
| 135 | Ga0070672_100068879 | 3300005543 | Bacteria | 2807 |
| 136 | Ga0070672_100659057 | 3300005543 | Bacteria | 914 |
| 137 | Ga0070686_100012648 | 3300005544 | Bacteria | 4812 |
| 138 | Ga0070686_100042346 | 3300005544 | Bacteria | 2852 |
| 139 | Ga0070686_100177552 | 3300005544 | Bacteria | 1511 |
| 140 | Ga0070686_100984453 | 3300005544 | Bacteria | 691 |
| 141 | Ga0070695_100020417 | 3300005545 | Bacteria | 4045 |
| 142 | Ga0070695_100049615 | 3300005545 | Bacteria | 2687 |
| 143 | Ga0070695_100134261 | 3300005545 | Bacteria | 1709 |
| 144 | Ga0070695_100440034 | 3300005545 | Bacteria | 997 |
| 145 | Ga0070696_100044339 | 3300005546 | Bacteria | 3080 |
| 146 | Ga0070696_100050831 | 3300005546 | Bacteria | 2882 |
| 147 | Ga0070696_100073026 | 3300005546 | Bacteria | 2416 |
| 148 | Ga0070696_100120356 | 3300005546 | Bacteria | 1900 |
| 149 | Ga0070696_100187549 | 3300005546 | Bacteria | 1538 |
| 150 | Ga0070693_100012465 | 3300005547 | Bacteria | 4302 |
| 151 | Ga0070693_100034757 | 3300005547 | Bacteria | 2791 |
| 152 | Ga0070693_100066309 | 3300005547 | Bacteria | 2112 |
| 153 | Ga0070693_100162485 | 3300005547 | Bacteria | 1423 |
| 154 | Ga0070693_100624574 | 3300005547 | Bacteria | 781 |
| 155 | Ga0070665_100074294 | 3300005548 | Bacteria | 3405 |
| 156 | Ga0070665_100133125 | 3300005548 | Bacteria | 2488 |
| 157 | Ga0070665_100178830 | 3300005548 | Bacteria | 2122 |
| 158 | Ga0070704_100020903 | 3300005549 | Bacteria | 4232 |
| 159 | Ga0070704_100029456 | 3300005549 | Bacteria | 3666 |
| 160 | Ga0070704_100059213 | 3300005549 | Bacteria | 2731 |
| 161 | Ga0070704_100095398 | 3300005549 | Bacteria | 2228 |
| 162 | Ga0070704_100234986 | 3300005549 | Bacteria | 1497 |
| 163 | Ga0068855_100073422 | 3300005563 | Bacteria | 3974 |
| 164 | Ga0068855_100164335 | 3300005563 | Bacteria | 2517 |
| 165 | Ga0068855_100372779 | 3300005563 | Bacteria | 1568 |
| 166 | Ga0070664_100026590 | 3300005564 | Bacteria | 4801 |
| 167 | Ga0070664_100028840 | 3300005564 | Bacteria | 4622 |
| 168 | Ga0070664_100065856 | 3300005564 | Bacteria | 3092 |
| 169 | Ga0070664_100199859 | 3300005564 | Bacteria | 1784 |
| 170 | Ga0068857_100164638 | 3300005577 | Bacteria | 2013 |
| 171 | Ga0068857_100263390 | 3300005577 | Bacteria | 1583 |
| 172 | Ga0068857_100264741 | 3300005577 | Bacteria | 1579 |
| 173 | Ga0068857_100335282 | 3300005577 | Bacteria | 1398 |
| 174 | Ga0068857_100357923 | 3300005577 | Bacteria | 1353 |
| 175 | Ga0068857_100461603 | 3300005577 | Bacteria | 1188 |
| 176 | Ga0068854_100061393 | 3300005578 | Bacteria | 2722 |
| 177 | Ga0068854_100098863 | 3300005578 | Bacteria | 2184 |
| 178 | Ga0068856_100073341 | 3300005614 | Bacteria | 3389 |
| 179 | Ga0068856_100218403 | 3300005614 | Bacteria | 1921 |
| 180 | Ga0070702_100018607 | 3300005615 | Bacteria | 3606 |
| 181 | Ga0070702_100209306 | 3300005615 | Bacteria | 1297 |
| 182 | Ga0070702_100257818 | 3300005615 | Bacteria | 1186 |
| 183 | Ga0068852_100409244 | 3300005616 | Bacteria | 1336 |
| 184 | Ga0068852_100445146 | 3300005616 | Bacteria | 1281 |
| 185 | Ga0068859_100037113 | 3300005617 | Bacteria | 4890 |
| 186 | Ga0068859_100054125 | 3300005617 | Bacteria | 4036 |
| 187 | Ga0068859_100062509 | 3300005617 | Bacteria | 3754 |
| 188 | Ga0068864_100107532 | 3300005618 | Bacteria | 2481 |
| 189 | Ga0068866_10040244 | 3300005718 | Bacteria | 2313 |
| 190 | Ga0068866_10060668 | 3300005718 | Bacteria | 1962 |
| 191 | Ga0068866_10061852 | 3300005718 | Bacteria | 1946 |
| 192 | Ga0068861_100001783 | 3300005719 | Bacteria | 13846 |
| 193 | Ga0068861_100014938 | 3300005719 | Bacteria | 5459 |
| 194 | Ga0068861_100018490 | 3300005719 | Bacteria | 4965 |
| 195 | Ga0068861_100381177 | 3300005719 | Bacteria | 1246 |
| 196 | Ga0068861_100654943 | 3300005719 | Bacteria | 971 |
| 197 | Ga0068851_10412210 | 3300005834 | Bacteria | 797 |
| 198 | Ga0068870_10013596 | 3300005840 | Bacteria | 3829 |
| 199 | Ga0068870_10018387 | 3300005840 | Bacteria | 3374 |
| 200 | Ga0068870_10248053 | 3300005840 | Bacteria | 1102 |
| 201 | Ga0068863_100031864 | 3300005841 | Bacteria | 5028 |
| 202 | Ga0068863_100167584 | 3300005841 | Bacteria | 2107 |
| 203 | Ga0068860_100033315 | 3300005843 | Bacteria | 4945 |
| 204 | Ga0068860_100268433 | 3300005843 | Bacteria | 1665 |
| 205 | Ga0068860_100507446 | 3300005843 | Bacteria | 1205 |
| 206 | Ga0068860_100815868 | 3300005843 | Bacteria | 947 |
| 207 | Ga0068862_100548509 | 3300005844 | Bacteria | 1103 |
| 208 | Ga0081455_10019559 | 3300005937 | Bacteria | 6403 |
| 209 | Ga0081455_10020013 | 3300005937 | Bacteria | 6317 |
| 210 | Ga0081455_10024399 | 3300005937 | Bacteria | 5601 |
| 211 | Ga0081455_10421009 | 3300005937 | Bacteria | 921 |
| 212 | Ga0081538_10000094 | 3300005981 | Bacteria | 86715 |
| 213 | Ga0081538_10000151 | 3300005981 | Bacteria | 72583 |
| 214 | Ga0081538_10002077 | 3300005981 | Bacteria | 19957 |
| 215 | Ga0081538_10003829 | 3300005981 | Bacteria | 14051 |
| 216 | Ga0081538_10010054 | 3300005981 | Bacteria | 7801 |
| 217 | Ga0081538_10020527 | 3300005981 | Bacteria | 4856 |
| 218 | Ga0081540_1014346 | 3300005983 | Bacteria | 5081 |
| 219 | Ga0081539_10000200 | 3300005985 | Bacteria | 139291 |
| 220 | Ga0081539_10000397 | 3300005985 | Bacteria | 93458 |
| 221 | Ga0070717_10033890 | 3300006028 | Bacteria | 4123 |
| 222 | Ga0070717_11128852 | 3300006028 | Bacteria | 714 |
| 223 | Ga0075365_10156996 | 3300006038 | Bacteria | 1584 |
| 224 | Ga0075365_10230865 | 3300006038 | Bacteria | 1299 |
| 225 | Ga0075364_10074048 | 3300006051 | Bacteria | 2245 |
| 226 | Ga0075364_10104093 | 3300006051 | Bacteria | 1891 |
| 227 | Ga0075364_10316452 | 3300006051 | Bacteria | 1063 |
| 228 | Ga0075432_10003491 | 3300006058 | Bacteria | 5320 |
| 229 | Ga0075432_10053088 | 3300006058 | Bacteria | 1433 |
| 230 | Ga0070715_10130771 | 3300006163 | Bacteria | 1208 |
| 231 | Ga0070712_100477707 | 3300006175 | Bacteria | 1041 |
| 232 | Ga0075362_10154240 | 3300006177 | Bacteria | 1103 |
| 233 | Ga0097621_100910277 | 3300006237 | Bacteria | 820 |
| 234 | Ga0068871_100359882 | 3300006358 | Bacteria | 1289 |
| 235 | Ga0068871_100370812 | 3300006358 | Bacteria | 1270 |
| 236 | Ga0075428_100037530 | 3300006844 | Bacteria | 5334 |
| 237 | Ga0075428_100180483 | 3300006844 | Bacteria | 2285 |
| 238 | Ga0075428_100299372 | 3300006844 | Bacteria | 1729 |
| 239 | Ga0075428_100331976 | 3300006844 | Bacteria | 1633 |
| 240 | Ga0075428_100455763 | 3300006844 | Bacteria | 1370 |
| 241 | Ga0075428_101045410 | 3300006844 | Bacteria | 864 |
| 242 | Ga0075428_101585647 | 3300006844 | Bacteria | 685 |
| 243 | Ga0075430_100049513 | 3300006846 | Bacteria | 3546 |
| 244 | Ga0075430_100058265 | 3300006846 | Bacteria | 3247 |
| 245 | Ga0075431_100008692 | 3300006847 | Bacteria | 10176 |
| 246 | Ga0075431_100051547 | 3300006847 | Bacteria | 4243 |
| 247 | Ga0075431_100233704 | 3300006847 | Bacteria | 1872 |
| 248 | Ga0075433_10034898 | 3300006852 | Bacteria | 4322 |
| 249 | Ga0075433_10043840 | 3300006852 | Bacteria | 3885 |
| 250 | Ga0075433_10052279 | 3300006852 | Bacteria | 3559 |
| 251 | Ga0075433_10212346 | 3300006852 | Bacteria | 1719 |
| 252 | Ga0075433_10235240 | 3300006852 | Bacteria | 1626 |
| 253 | Ga0075434_100003398 | 3300006871 | Bacteria | 14255 |
| 254 | Ga0075434_100042219 | 3300006871 | Bacteria | 4521 |
| 255 | Ga0075434_100049702 | 3300006871 | Bacteria | 4164 |
| 256 | Ga0075434_100056902 | 3300006871 | Bacteria | 3886 |
| 257 | Ga0075434_100077917 | 3300006871 | Bacteria | 3310 |
| 258 | Ga0075434_100546095 | 3300006871 | Bacteria | 1178 |
| 259 | Ga0075429_100062846 | 3300006880 | Bacteria | 3235 |
| 260 | Ga0075429_100104768 | 3300006880 | Bacteria | 2471 |
| 261 | Ga0075429_100138319 | 3300006880 | Bacteria | 2132 |
| 262 | Ga0075429_100173429 | 3300006880 | Bacteria | 1889 |
| 263 | Ga0075429_100452785 | 3300006880 | Bacteria | 1125 |
| 264 | Ga0075429_100695599 | 3300006880 | Bacteria | 891 |
| 265 | Ga0068865_100011940 | 3300006881 | Bacteria | 5453 |
| 266 | Ga0068865_100037576 | 3300006881 | Bacteria | 3270 |
| 267 | Ga0068865_100056517 | 3300006881 | Bacteria | 2734 |
| 268 | Ga0068865_100097545 | 3300006881 | Bacteria | 2145 |
| 269 | Ga0068865_100197248 | 3300006881 | Bacteria | 1561 |
| 270 | Ga0068865_100676185 | 3300006881 | Bacteria | 880 |
| 271 | Ga0075436_100059443 | 3300006914 | Bacteria | 2640 |
| 272 | Ga0075436_100522717 | 3300006914 | Bacteria | 870 |
| 273 | Ga0097620_100037113 | 3300006931 | Bacteria | 4890 |
| 274 | Ga0097620_100054125 | 3300006931 | Bacteria | 4036 |
| 275 | Ga0097620_100062508 | 3300006931 | Bacteria | 3754 |
| 276 | Ga0075435_100012793 | 3300007076 | Bacteria | 6217 |
| 277 | Ga0075435_100409045 | 3300007076 | Bacteria | 1168 |
| 278 | Ga0105240_10024285 | 3300009093 | Bacteria | 7996 |
| 279 | Ga0105240_10042861 | 3300009093 | Bacteria | 5765 |
| 280 | Ga0111539_10008714 | 3300009094 | Bacteria | 12869 |
| 281 | Ga0111539_10151517 | 3300009094 | Bacteria | 2714 |
| 282 | Ga0111539_10153773 | 3300009094 | Bacteria | 2692 |
| 283 | Ga0111539_10165941 | 3300009094 | Bacteria | 2582 |
| 284 | Ga0111539_10282661 | 3300009094 | Bacteria | 1931 |
| 285 | Ga0111539_10352157 | 3300009094 | Bacteria | 1714 |
| 286 | Ga0111539_10416492 | 3300009094 | Bacteria | 1565 |
| 287 | Ga0105245_10070989 | 3300009098 | Bacteria | 3162 |
| 288 | Ga0105245_10165862 | 3300009098 | Bacteria | 2100 |
| 289 | Ga0105245_10185696 | 3300009098 | Bacteria | 1989 |
| 290 | Ga0105245_10230601 | 3300009098 | Bacteria | 1791 |
| 291 | Ga0105245_10606230 | 3300009098 | Bacteria | 1122 |
| 292 | Ga0114129_10008166 | 3300009147 | Bacteria | 14913 |
| 293 | Ga0114129_10031268 | 3300009147 | Bacteria | 7528 |
| 294 | Ga0114129_10141390 | 3300009147 | Bacteria | 3299 |
| 295 | Ga0114129_10157426 | 3300009147 | Bacteria | 3106 |
| 296 | Ga0114129_10291515 | 3300009147 | Bacteria | 2178 |
| 297 | Ga0114129_10681671 | 3300009147 | Bacteria | 1323 |
| 298 | Ga0114129_11236421 | 3300009147 | Bacteria | 929 |
| 299 | Ga0114129_11672445 | 3300009147 | Bacteria | 777 |
| 300 | Ga0105243_10007592 | 3300009148 | Bacteria | 8337 |
| 301 | Ga0105243_10077699 | 3300009148 | Bacteria | 2700 |
| 302 | Ga0105243_10087909 | 3300009148 | Bacteria | 2552 |
| 303 | Ga0105243_10139040 | 3300009148 | Bacteria | 2070 |
| 304 | Ga0105241_10227272 | 3300009174 | Bacteria | 1572 |
| 305 | Ga0105242_10073834 | 3300009176 | Bacteria | 2837 |
| 306 | Ga0105242_10159104 | 3300009176 | Bacteria | 1975 |
| 307 | Ga0105242_10860060 | 3300009176 | Bacteria | 903 |
| 308 | Ga0105242_10864420 | 3300009176 | Bacteria | 901 |
| 309 | Ga0105248_10105467 | 3300009177 | Bacteria | 3177 |
| 310 | Ga0105248_10272386 | 3300009177 | Bacteria | 1906 |
| 311 | Ga0105248_10700432 | 3300009177 | Bacteria | 1143 |
| 312 | Ga0105238_10118379 | 3300009551 | Bacteria | 2629 |
| 313 | Ga0105238_10145128 | 3300009551 | Bacteria | 2350 |
| 314 | Ga0105238_10523943 | 3300009551 | Bacteria | 1188 |
| 315 | Ga0105249_10001703 | 3300009553 | Bacteria | 19257 |
| 316 | Ga0105249_10144708 | 3300009553 | Bacteria | 2282 |
| 317 | Ga0105030_105611 | 3300009987 | Bacteria | 1063 |
| 318 | Ga0105239_10053016 | 3300010375 | Bacteria | 4449 |
| 319 | Ga0105239_10082737 | 3300010375 | Bacteria | 3535 |
| 320 | Ga0105239_10083336 | 3300010375 | Bacteria | 3521 |
| 321 | Ga0105239_10096795 | 3300010375 | Bacteria | 3261 |
| 322 | Ga0105239_10145998 | 3300010375 | Bacteria | 2638 |
| 323 | Ga0105246_10040213 | 3300011119 | Bacteria | 3154 |
| 324 | Ga0105246_10097572 | 3300011119 | Bacteria | 2133 |
| 325 | Ga0105246_10339793 | 3300011119 | Bacteria | 1227 |
| 326 | Ga0157313_1013765 | 3300012503 | Bacteria | 738 |
| 327 | Ga0157326_1019773 | 3300012513 | Bacteria | 823 |
| 328 | Ga0157373_10454209 | 3300013100 | Bacteria | 922 |
| 329 | Ga0157371_10020304 | 3300013102 | Bacteria | 4890 |
| 330 | Ga0157371_10024782 | 3300013102 | Bacteria | 4377 |
| 331 | Ga0157371_10241373 | 3300013102 | Bacteria | 1300 |
| 332 | Ga0157370_10091450 | 3300013104 | Bacteria | 2857 |
| 333 | Ga0157370_10238397 | 3300013104 | Bacteria | 1683 |
| 334 | Ga0157369_10186118 | 3300013105 | Bacteria | 2184 |
| 335 | Ga0157369_10233037 | 3300013105 | Bacteria | 1924 |
| 336 | Ga0157369_10409251 | 3300013105 | Bacteria | 1407 |
| 337 | Ga0157378_10378108 | 3300013297 | Bacteria | 1390 |
| 338 | Ga0157378_10380363 | 3300013297 | Bacteria | 1386 |
| 339 | Ga0157378_10472205 | 3300013297 | Bacteria | 1248 |
| 340 | Ga0163162_10188658 | 3300013306 | Bacteria | 2189 |
| 341 | Ga0163162_10527246 | 3300013306 | Bacteria | 1310 |
| 342 | Ga0163162_10548075 | 3300013306 | Bacteria | 1285 |
| 343 | Ga0157372_10258409 | 3300013307 | Bacteria | 2022 |
| 344 | Ga0157372_10350676 | 3300013307 | Bacteria | 1719 |
| 345 | Ga0157372_10397006 | 3300013307 | Bacteria | 1607 |
| 346 | Ga0157375_10142125 | 3300013308 | Bacteria | 2528 |
| 347 | Ga0163163_10044422 | 3300014325 | Bacteria | 4359 |
| 348 | Ga0163163_10096782 | 3300014325 | Bacteria | 2972 |
| 349 | Ga0163163_11214996 | 3300014325 | Bacteria | 816 |
| 350 | Ga0157380_10006119 | 3300014326 | Bacteria | 8436 |
| 351 | Ga0157380_10028368 | 3300014326 | Bacteria | 4266 |
| 352 | Ga0157380_10037771 | 3300014326 | Bacteria | 3744 |
| 353 | Ga0157380_10156439 | 3300014326 | Bacteria | 1976 |
| 354 | Ga0182008_10028595 | 3300014497 | Bacteria | 2819 |
| 355 | Ga0182008_10474710 | 3300014497 | Bacteria | 684 |
| 356 | Ga0157377_10026140 | 3300014745 | Bacteria | 3121 |
| 357 | Ga0157377_10047370 | 3300014745 | Bacteria | 2408 |
| 358 | Ga0157377_10070458 | 3300014745 | Bacteria | 2020 |
| 359 | Ga0157376_10062225 | 3300014969 | Bacteria | 3140 |
| 360 | Ga0157376_10289248 | 3300014969 | Bacteria | 1546 |
| 361 | Ga0157376_10335002 | 3300014969 | Bacteria | 1443 |
| 362 | Ga0182006_1004688 | 3300015261 | Bacteria | 6695 |
| 363 | Ga0182007_10030600 | 3300015262 | Bacteria | 1838 |
| 364 | Ga0163161_10043707 | 3300017792 | Bacteria | 3226 |
| 365 | Ga0163161_10123803 | 3300017792 | Bacteria | 1945 |
| 366 | Ga0163161_10297645 | 3300017792 | Bacteria | 1270 |
| 367 | Ga0206356_10084031 | 3300020070 | Bacteria | 1914 |
| 368 | Ga0206356_11880732 | 3300020070 | Bacteria | 3149 |
| 369 | Ga0206353_10050886 | 3300020082 | Bacteria | 7987 |
| 370 | Ga0224712_10048328 | 3300022467 | Bacteria | 1642 |
| 371 | Ga0207656_10004884 | 3300025321 | Bacteria | 4705 |
| 372 | Ga0207653_10041888 | 3300025885 | Bacteria | 1505 |
| 373 | Ga0207682_10069089 | 3300025893 | Bacteria | 1493 |
| 374 | Ga0207642_10010501 | 3300025899 | Bacteria | 3267 |
| 375 | Ga0207642_10096570 | 3300025899 | Bacteria | 1473 |
| 376 | Ga0207642_10481324 | 3300025899 | Bacteria | 757 |
| 377 | Ga0207688_10008842 | 3300025901 | Bacteria | 5481 |
| 378 | Ga0207688_10009411 | 3300025901 | Bacteria | 5319 |
| 379 | Ga0207688_10087309 | 3300025901 | Bacteria | 1788 |
| 380 | Ga0207680_10392933 | 3300025903 | Bacteria | 979 |
| 381 | Ga0207645_10021117 | 3300025907 | Bacteria | 4251 |
| 382 | Ga0207645_10217501 | 3300025907 | Bacteria | 1259 |
| 383 | Ga0207645_10473928 | 3300025907 | Bacteria | 846 |
| 384 | Ga0207643_10023824 | 3300025908 | Bacteria | 3378 |
| 385 | Ga0207643_10097326 | 3300025908 | Bacteria | 1722 |
| 386 | Ga0207705_10058502 | 3300025909 | Bacteria | 2780 |
| 387 | Ga0207705_10177987 | 3300025909 | Bacteria | 1604 |
| 388 | Ga0207654_10215489 | 3300025911 | Bacteria | 1271 |
| 389 | Ga0207707_10019074 | 3300025912 | Bacteria | 5985 |
| 390 | Ga0207707_10065796 | 3300025912 | Bacteria | 3156 |
| 391 | Ga0207707_10116061 | 3300025912 | Bacteria | 2339 |
| 392 | Ga0207707_10588923 | 3300025912 | Bacteria | 942 |
| 393 | Ga0207695_10051159 | 3300025913 | Bacteria | 4340 |
| 394 | Ga0207695_10091830 | 3300025913 | Bacteria | 3049 |
| 395 | Ga0207695_10223643 | 3300025913 | Bacteria | 1789 |
| 396 | Ga0207671_10540763 | 3300025914 | Bacteria | 929 |
| 397 | Ga0207660_10051209 | 3300025917 | Bacteria | 2935 |
| 398 | Ga0207660_10062318 | 3300025917 | Bacteria | 2686 |
| 399 | Ga0207662_10001652 | 3300025918 | Bacteria | 10897 |
| 400 | Ga0207662_10049973 | 3300025918 | Bacteria | 2482 |
| 401 | Ga0207662_10157319 | 3300025918 | Bacteria | 1450 |
| 402 | Ga0207657_10047922 | 3300025919 | Bacteria | 3732 |
| 403 | Ga0207657_10062709 | 3300025919 | Bacteria | 3181 |
| 404 | Ga0207657_10351552 | 3300025919 | Bacteria | 1162 |
| 405 | Ga0207649_10034215 | 3300025920 | Bacteria | 3042 |
| 406 | Ga0207649_10036899 | 3300025920 | Bacteria | 2948 |
| 407 | Ga0207649_10207444 | 3300025920 | Bacteria | 1388 |
| 408 | Ga0207652_10091551 | 3300025921 | Bacteria | 2674 |
| 409 | Ga0207652_10120752 | 3300025921 | Bacteria | 2331 |
| 410 | Ga0207652_10128926 | 3300025921 | Bacteria | 2255 |
| 411 | Ga0207652_10531914 | 3300025921 | Bacteria | 1057 |
| 412 | Ga0207652_10541974 | 3300025921 | Bacteria | 1046 |
| 413 | Ga0207646_10297273 | 3300025922 | Bacteria | 1459 |
| 414 | Ga0207694_10068868 | 3300025924 | Bacteria | 2764 |
| 415 | Ga0207650_10116148 | 3300025925 | Bacteria | 2078 |
| 416 | Ga0207650_10336934 | 3300025925 | Bacteria | 1238 |
| 417 | Ga0207659_10035304 | 3300025926 | Bacteria | 3455 |
| 418 | Ga0207659_10038607 | 3300025926 | Bacteria | 3323 |
| 419 | Ga0207659_10176832 | 3300025926 | Bacteria | 1688 |
| 420 | Ga0207687_10021592 | 3300025927 | Bacteria | 4278 |
| 421 | Ga0207687_10052606 | 3300025927 | Bacteria | 2843 |
| 422 | Ga0207687_10094793 | 3300025927 | Bacteria | 2185 |
| 423 | Ga0207687_10285804 | 3300025927 | Bacteria | 1324 |
| 424 | Ga0207687_10503691 | 3300025927 | Bacteria | 1011 |
| 425 | Ga0207687_10651970 | 3300025927 | Bacteria | 891 |
| 426 | Ga0207687_10737837 | 3300025927 | Bacteria | 838 |
| 427 | Ga0207687_10802473 | 3300025927 | Bacteria | 803 |
| 428 | Ga0207700_10166368 | 3300025928 | Bacteria | 1835 |
| 429 | Ga0207644_10055976 | 3300025931 | Bacteria | 2845 |
| 430 | Ga0207644_10477791 | 3300025931 | Bacteria | 1026 |
| 431 | Ga0207690_10035342 | 3300025932 | Bacteria | 3227 |
| 432 | Ga0207690_10119273 | 3300025932 | Bacteria | 1913 |
| 433 | Ga0207690_10322678 | 3300025932 | Bacteria | 1214 |
| 434 | Ga0207706_10014850 | 3300025933 | Bacteria | 7051 |
| 435 | Ga0207706_10023330 | 3300025933 | Bacteria | 5557 |
| 436 | Ga0207706_10121780 | 3300025933 | Bacteria | 2294 |
| 437 | Ga0207686_10044037 | 3300025934 | Bacteria | 2738 |
| 438 | Ga0207686_10451955 | 3300025934 | Bacteria | 988 |
| 439 | Ga0207709_10045396 | 3300025935 | Bacteria | 2661 |
| 440 | Ga0207709_10239659 | 3300025935 | Bacteria | 1319 |
| 441 | Ga0207670_10000052 | 3300025936 | Bacteria | 86188 |
| 442 | Ga0207670_10000777 | 3300025936 | Bacteria | 16777 |
| 443 | Ga0207670_10025700 | 3300025936 | Bacteria | 3700 |
| 444 | Ga0207670_10135836 | 3300025936 | Bacteria | 1807 |
| 445 | Ga0207670_10433240 | 3300025936 | Bacteria | 1057 |
| 446 | Ga0207670_10564853 | 3300025936 | Bacteria | 931 |
| 447 | Ga0207669_10003761 | 3300025937 | Bacteria | 6590 |
| 448 | Ga0207669_10076033 | 3300025937 | Bacteria | 2130 |
| 449 | Ga0207669_10255242 | 3300025937 | Bacteria | 1308 |
| 450 | Ga0207669_10568350 | 3300025937 | Bacteria | 917 |
| 451 | Ga0207704_10019975 | 3300025938 | Bacteria | 3533 |
| 452 | Ga0207704_10136732 | 3300025938 | Bacteria | 1707 |
| 453 | Ga0207704_10238284 | 3300025938 | Bacteria | 1357 |
| 454 | Ga0207704_10532197 | 3300025938 | Bacteria | 952 |
| 455 | Ga0207665_10244925 | 3300025939 | Bacteria | 1322 |
| 456 | Ga0207691_10019105 | 3300025940 | Bacteria | 6489 |
| 457 | Ga0207691_10029091 | 3300025940 | Bacteria | 5168 |
| 458 | Ga0207691_10228596 | 3300025940 | Bacteria | 1611 |
| 459 | Ga0207711_10555238 | 3300025941 | Bacteria | 1071 |
| 460 | Ga0207711_10594829 | 3300025941 | Bacteria | 1032 |
| 461 | Ga0207689_10082876 | 3300025942 | Bacteria | 2637 |
| 462 | Ga0207689_10156467 | 3300025942 | Bacteria | 1879 |
| 463 | Ga0207661_10008048 | 3300025944 | Bacteria | 7513 |
| 464 | Ga0207661_10011136 | 3300025944 | Bacteria | 6503 |
| 465 | Ga0207661_10067021 | 3300025944 | Bacteria | 2918 |
| 466 | Ga0207661_10123849 | 3300025944 | Bacteria | 2205 |
| 467 | Ga0207661_10143474 | 3300025944 | Bacteria | 2057 |
| 468 | Ga0207661_10197640 | 3300025944 | Bacteria | 1766 |
| 469 | Ga0207661_10233264 | 3300025944 | Bacteria | 1630 |
| 470 | Ga0207661_10239136 | 3300025944 | Bacteria | 1610 |
| 471 | Ga0207679_10063384 | 3300025945 | Bacteria | 2759 |
| 472 | Ga0207712_10210894 | 3300025961 | Bacteria | 1547 |
| 473 | Ga0207668_10228891 | 3300025972 | Bacteria | 1497 |
| 474 | Ga0207640_10057756 | 3300025981 | Bacteria | 2554 |
| 475 | Ga0207640_10076561 | 3300025981 | Bacteria | 2271 |
| 476 | Ga0207677_10064996 | 3300026023 | Bacteria | 2543 |
| 477 | Ga0207703_10130773 | 3300026035 | Bacteria | 2167 |
| 478 | Ga0207639_10026202 | 3300026041 | Bacteria | 4236 |
| 479 | Ga0207639_10701097 | 3300026041 | Bacteria | 939 |
| 480 | Ga0207639_11171886 | 3300026041 | Bacteria | 721 |
| 481 | Ga0207678_10027460 | 3300026067 | Bacteria | 4965 |
| 482 | Ga0207708_10016026 | 3300026075 | Bacteria | 5629 |
| 483 | Ga0207708_10018968 | 3300026075 | Bacteria | 5180 |
| 484 | Ga0207708_10149854 | 3300026075 | Bacteria | 1835 |
| 485 | Ga0207708_10160573 | 3300026075 | Bacteria | 1775 |
| 486 | Ga0207702_10002686 | 3300026078 | Bacteria | 16700 |
| 487 | Ga0207702_10111718 | 3300026078 | Bacteria | 2431 |
| 488 | Ga0207702_10223196 | 3300026078 | Bacteria | 1757 |
| 489 | Ga0207702_10262571 | 3300026078 | Bacteria | 1626 |
| 490 | Ga0207702_10367529 | 3300026078 | Bacteria | 1380 |
| 491 | Ga0207641_10510158 | 3300026088 | Bacteria | 1169 |
| 492 | Ga0207641_10514303 | 3300026088 | Bacteria | 1164 |
| 493 | Ga0207641_10592034 | 3300026088 | Bacteria | 1085 |
| 494 | Ga0207648_10020479 | 3300026089 | Bacteria | 5955 |
| 495 | Ga0207648_10024817 | 3300026089 | Bacteria | 5347 |
| 496 | Ga0207648_10148217 | 3300026089 | Bacteria | 2070 |
| 497 | Ga0207648_10894249 | 3300026089 | Bacteria | 829 |
| 498 | Ga0207676_10495474 | 3300026095 | Bacteria | 1159 |
| 499 | Ga0207674_10018407 | 3300026116 | Bacteria | 7593 |
| 500 | Ga0207674_10244635 | 3300026116 | Bacteria | 1741 |
| 501 | Ga0207674_10342728 | 3300026116 | Bacteria | 1445 |
| 502 | Ga0207675_100094141 | 3300026118 | Bacteria | 2818 |
| 503 | Ga0207675_100235336 | 3300026118 | Bacteria | 1768 |
| 504 | Ga0207675_100550530 | 3300026118 | Bacteria | 1153 |
| 505 | Ga0207683_10102758 | 3300026121 | Bacteria | 2552 |
| 506 | Ga0207683_10192287 | 3300026121 | Bacteria | 1853 |
| 507 | Ga0207683_10266846 | 3300026121 | Bacteria | 1563 |
| 508 | Ga0207683_10611988 | 3300026121 | Bacteria | 1008 |
| 509 | Ga0207698_10370522 | 3300026142 | Bacteria | 1359 |
| 510 | Ga0207698_10399380 | 3300026142 | Bacteria | 1313 |
| 511 | Ga0209966_1022570 | 3300027695 | Bacteria | 1232 |
| 512 | Ga0207428_10000244 | 3300027907 | Bacteria | 74209 |
| 513 | Ga0207428_10002045 | 3300027907 | Bacteria | 20377 |
| 514 | Ga0207428_10024681 | 3300027907 | Bacteria | 5047 |
| 515 | Ga0207428_10152785 | 3300027907 | Bacteria | 1756 |
| 516 | Ga0207428_10261848 | 3300027907 | Bacteria | 1288 |
| 517 | Ga0207428_10295653 | 3300027907 | Bacteria | 1199 |
| 518 | Ga0207428_10339465 | 3300027907 | Bacteria | 1107 |
| 519 | Ga0268266_10184650 | 3300028379 | Bacteria | 1901 |
| 520 | Ga0268264_10034622 | 3300028381 | Bacteria | 4156 |
| 521 | Ga0268264_10154438 | 3300028381 | Bacteria | 2061 |
| 522 | Ga0268264_10473808 | 3300028381 | Bacteria | 1217 |
| 523 | Ga0265318_10118696 | 3300028577 | Bacteria | 972 |
| 524 | Ga0307408_100173813 | 3300031548 | Bacteria | 1722 |
| 525 | Ga0316579_10026338 | 3300031691 | Bacteria | 2632 |
| 526 | Ga0316576_10030962 | 3300031727 | Bacteria | 3793 |
| 527 | Ga0316576_10083098 | 3300031727 | Bacteria | 2378 |
| 528 | Ga0316577_10070157 | 3300031733 | Bacteria | 1956 |
| 529 | Ga0307406_10184411 | 3300031901 | Bacteria | 1522 |
| 530 | Ga0307406_10259522 | 3300031901 | Bacteria | 1314 |
| 531 | Ga0307409_100113545 | 3300031995 | Bacteria | 2277 |
| 532 | Ga0307409_100382576 | 3300031995 | Bacteria | 1338 |
| 533 | Ga0307409_100388677 | 3300031995 | Bacteria | 1329 |
| 534 | Ga0307416_100018953 | 3300032002 | Bacteria | 4864 |
| 535 | Ga0307416_100089230 | 3300032002 | Bacteria | 2639 |
| 536 | Ga0307416_100159843 | 3300032002 | Bacteria | 2081 |
| 537 | Ga0307416_100300479 | 3300032002 | Bacteria | 1595 |
| 538 | Ga0307416_100875152 | 3300032002 | Bacteria | 997 |
| 539 | Ga0307415_100010159 | 3300032126 | Bacteria | 5317 |
| 540 | Ga0307415_100221916 | 3300032126 | Bacteria | 1516 |
| 541 | Ga0307415_100405872 | 3300032126 | Bacteria | 1165 |
| 542 | Ga0316583_10016988 | 3300032133 | Bacteria | 2618 |
| 543 | Ga0373926_0002828 | 3300035083 | Bacteria | 5551 |
| 544 | Ga0373934_0004376 | 3300035086 | Bacteria | 5216 |
| 545 | Ga0373951_0158762 | 3300035091 | Bacteria | 638 |
| 546 | Ga0373923_0044557 | 3300035111 | Bacteria | 1839 |
| 547 | Ga0373932_0077724 | 3300035112 | Bacteria | 1042 |
| 548 | Ga0373936_0010863 | 3300035113 | Bacteria | 3440 |
| 549 | Ga0373936_0033664 | 3300035113 | Bacteria | 2032 |
| 550 | Ga0373945_0007197 | 3300035116 | Bacteria | 3602 |
| 551 | Ga0373953_0009792 | 3300035117 | Bacteria | 3313 |
| 552 | Ga0373954_0045875 | 3300035118 | Bacteria | 2042 |
| 553 | Ga0373957_0023325 | 3300035120 | Bacteria | 2212 |
| 554 | Ga0373960_0086460 | 3300035121 | Bacteria | 996 |
| 555 | Ga0373943_0009843 | 3300035170 | Bacteria | 4280 |
| 556 | Ga0373955_0068140 | 3300035172 | Bacteria | 1982 |
| 557 | Ga0373955_0201197 | 3300035172 | Bacteria | 1186 |
| 558 | Ga0373961_0016184 | 3300035241 | Bacteria | 1918 |
| 559 | Ga0316574_0027625 | 3300035398 | Bacteria | 3418 |
| 560 | Ga0373924_0101064 | 3300035410 | Bacteria | 1241 |
| 561 | Ga0373931_0171421 | 3300035691 | Bacteria | 1279 |
| 562 | Ga0373935_0004795 | 3300035692 | Bacteria | 7951 |
| 563 | Ga0373927_0040183 | 3300035695 | Bacteria | 3036 |
| 564 | Ga0373933_0126517 | 3300035724 | Bacteria | 1604 |
| 565 | Ga0373947_0013853 | 3300035725 | Bacteria | 4622 |
| 566 | Ga0373937_0475269 | 3300036401 | Bacteria | 1187 |
| 567 | Ga0373937_0716547 | 3300036401 | Bacteria | 947 |
| 568 | Ga0316582_0079478 | 3300036647 | Bacteria | 2138 |
| 569 | Ga0316584_0038711 | 3300036712 | Bacteria | 3548 |
| 570 | Ga0373925_0009138 | 3300037068 | Bacteria | 7211 |
| 571 | Ga0373925_0411666 | 3300037068 | Bacteria | 1104 |
| 572 | Ga0395899_0006920 | 3300037312 | Bacteria | 8784 |
| 573 | Ga0395899_0053365 | 3300037312 | Bacteria | 2993 |
| 574 | Ga0395899_0060250 | 3300037312 | Bacteria | 2796 |
| 575 | Ga0395899_0072888 | 3300037312 | Bacteria | 2512 |
| 576 | Ga0395899_0179523 | 3300037312 | Bacteria | 1487 |
| 577 | Ga0395900_0003521 | 3300037418 | Bacteria | 16884 |
| 578 | Ga0395900_0007081 | 3300037418 | Bacteria | 11617 |
| 579 | Ga0395900_0025290 | 3300037418 | Bacteria | 6078 |
| 580 | Ga0395900_0068849 | 3300037418 | Bacteria | 3637 |
| 581 | Ga0395900_0076480 | 3300037418 | Bacteria | 3440 |
| 582 | Ga0395900_0077244 | 3300037418 | Bacteria | 3421 |
| 583 | Ga0395900_0131987 | 3300037418 | Bacteria | 2559 |
| 584 | Ga0395900_0147983 | 3300037418 | Bacteria | 2401 |
| 585 | Ga0395900_0149858 | 3300037418 | Bacteria | 2383 |
| 586 | Ga0395900_0171873 | 3300037418 | Bacteria | 2205 |
| 587 | Ga0395900_0264495 | 3300037418 | Bacteria | 1716 |
| 588 | Ga0395900_0791248 | 3300037418 | Bacteria | 877 |
| 589 | Ga0395898_0001875 | 3300037466 | Bacteria | 26866 |
| 590 | Ga0395898_0003526 | 3300037466 | Bacteria | 17447 |
| 591 | Ga0395898_0010231 | 3300037466 | Bacteria | 9821 |
| 592 | Ga0395898_0043221 | 3300037466 | Bacteria | 4441 |
| 593 | Ga0395898_0076766 | 3300037466 | Bacteria | 3225 |
| 594 | Ga0395898_0155222 | 3300037466 | Bacteria | 2189 |
| 595 | Ga0395898_0256253 | 3300037466 | Bacteria | 1668 |
| 596 | Ga0395905_0009915 | 3300037471 | Bacteria | 9283 |
| 597 | Ga0395905_0018552 | 3300037471 | Bacteria | 6603 |
| 598 | Ga0395905_0021602 | 3300037471 | Bacteria | 6086 |
| 599 | Ga0395905_0031768 | 3300037471 | Bacteria | 4968 |
| 600 | Ga0395905_0174934 | 3300037471 | Bacteria | 2016 |
| 601 | Ga0395905_0189838 | 3300037471 | Bacteria | 1927 |
| 602 | Ga0395905_0235815 | 3300037471 | Bacteria | 1710 |
| 603 | Ga0395905_0250761 | 3300037471 | Bacteria | 1653 |
| 604 | Ga0395905_0530987 | 3300037471 | Bacteria | 1077 |
| 605 | Ga0395901_0005796 | 3300038443 | Bacteria | 12517 |
| 606 | Ga0395901_0012794 | 3300038443 | Bacteria | 8510 |
| 607 | Ga0395901_0019001 | 3300038443 | Bacteria | 7025 |
| 608 | Ga0395901_0033883 | 3300038443 | Bacteria | 5274 |
| 609 | Ga0395901_0039047 | 3300038443 | Bacteria | 4911 |
| 610 | Ga0395901_0049656 | 3300038443 | Bacteria | 4359 |
| 611 | Ga0395901_0110917 | 3300038443 | Bacteria | 2881 |
| 612 | Ga0395901_0131367 | 3300038443 | Bacteria | 2631 |
| 613 | Ga0395901_0161010 | 3300038443 | Bacteria | 2357 |
| 614 | Ga0395901_0175304 | 3300038443 | Bacteria | 2249 |
| 615 | Ga0395901_0291492 | 3300038443 | Bacteria | 1693 |
| 616 | Ga0395901_0517645 | 3300038443 | Bacteria | 1212 |
| 617 | Ga0395901_1265605 | 3300038443 | Bacteria | 701 |
| 618 | Ga0439439_0036238 | 3300041406 | Bacteria | 1269 |
| 619 | Ga0439453_0010973 | 3300041408 | Bacteria | 1503 |
| 620 | Ga0439453_0035155 | 3300041408 | Bacteria | 964 |
| 621 | Ga0439461_0075232 | 3300041410 | Bacteria | 788 |
| 622 | Ga0439465_0138089 | 3300041413 | Bacteria | 864 |
| 623 | Ga0451833_0318449 | 3300041491 | Bacteria | 655 |
| 624 | Ga0439448_0016418 | 3300042005 | Bacteria | 2253 |
| 625 | Ga0439448_0022619 | 3300042005 | Bacteria | 1956 |
| 626 | Ga0439451_006592 | 3300042009 | Bacteria | 2373 |
| 627 | Ga0439454_012450 | 3300042011 | Bacteria | 1154 |
| 628 | Ga0439455_0086155 | 3300042012 | Bacteria | 858 |
| 629 | Ga0450917_009464 | 3300042120 | Bacteria | 764 |
| 630 | Ga0450920_002965 | 3300042122 | Bacteria | 2922 |
| 631 | Ga0450908_012972 | 3300042184 | Bacteria | 1505 |
| 632 | Ga0439434_0002257 | 3300042435 | Bacteria | 5594 |
| 633 | Ga0439434_0005571 | 3300042435 | Bacteria | 3678 |
| 634 | Ga0451577_0082678 | 3300042876 | Bacteria | 2864 |
| 635 | Ga0439440_0066013 | 3300042993 | Bacteria | 933 |
| 636 | Ga0453683_0313693 | 3300044673 | Bacteria | 1004 |
| 637 | Ga0466961_0136624 | 3300044693 | Bacteria | 1536 |
| 638 | Ga0466963_0004083 | 3300044694 | Bacteria | 8447 |
| 639 | Ga0466963_0007021 | 3300044694 | Bacteria | 6705 |
| 640 | Ga0466964_0003226 | 3300044706 | Bacteria | 5936 |
| 641 | Ga0466964_0018741 | 3300044706 | Bacteria | 2658 |
| 642 | Ga0466971_0100910 | 3300044719 | Bacteria | 1326 |
| 643 | Ga0466957_0037743 | 3300044842 | Bacteria | 2909 |
| 644 | Ga0466959_0126321 | 3300045049 | Bacteria | 1815 |
| 645 | Ga0466959_0129058 | 3300045049 | Bacteria | 1792 |
| 646 | Ga0466959_0459360 | 3300045049 | Bacteria | 863 |
| 647 | Ga0451576_0036687 | 3300045051 | Bacteria | 5195 |
| 648 | Ga0451576_0207766 | 3300045051 | Bacteria | 2044 |
| 649 | Ga0451576_0610396 | 3300045051 | Bacteria | 1147 |
| 650 | Ga0466958_0016722 | 3300045836 | Bacteria | 4229 |
| 651 | Ga0466958_0018150 | 3300045836 | Bacteria | 4078 |
| 652 | Ga0466958_0100734 | 3300045836 | Bacteria | 1796 |
| 653 | Ga0466958_0115111 | 3300045836 | Bacteria | 1680 |
| 654 | Ga0466967_0001509 | 3300045976 | Bacteria | 13591 |
| 655 | Ga0466967_0005611 | 3300045976 | Bacteria | 8726 |
| 656 | Ga0466967_0019707 | 3300045976 | Bacteria | 5430 |
| 657 | Ga0466967_0030118 | 3300045976 | Bacteria | 4551 |
| 658 | Ga0466967_0085632 | 3300045976 | Bacteria | 2853 |
| 659 | Ga0466967_0109832 | 3300045976 | Bacteria | 2532 |
| 660 | Ga0466967_0172737 | 3300045976 | Bacteria | 2034 |
| 661 | Ga0495592_0030764 | 3300046454 | Bacteria | 4060 |
| 662 | Ga0495592_0083751 | 3300046454 | Bacteria | 2302 |
| 663 | Ga0495603_0001553 | 3300046455 | Bacteria | 13437 |
| 664 | Ga0495603_0056192 | 3300046455 | Bacteria | 2331 |
| 665 | Ga0495629_0015834 | 3300046459 | Bacteria | 5416 |
| 666 | Ga0495629_0017118 | 3300046459 | Bacteria | 5199 |
| 667 | Ga0495641_0006144 | 3300046461 | Bacteria | 7856 |
| 668 | Ga0495641_0018268 | 3300046461 | Bacteria | 3622 |
| 669 | Ga0495641_0055031 | 3300046461 | Bacteria | 1807 |
| 670 | Ga0495651_0075246 | 3300046462 | Bacteria | 2560 |
| 671 | Ga0495653_0071927 | 3300046463 | Bacteria | 2584 |
| 672 | Ga0495653_0076872 | 3300046463 | Bacteria | 2480 |
| 673 | Ga0495653_0312923 | 3300046463 | Bacteria | 1020 |
| 674 | Ga0495580_0040825 | 3300046472 | Bacteria | 3312 |
| 675 | Ga0495582_0019456 | 3300046473 | Bacteria | 3712 |
| 676 | Ga0495582_0095964 | 3300046473 | Bacteria | 1657 |
| 677 | Ga0495582_0116151 | 3300046473 | Bacteria | 1505 |
| 678 | Ga0495639_0000940 | 3300046475 | Bacteria | 13166 |
| 679 | Ga0495662_0003702 | 3300046476 | Bacteria | 7707 |
| 680 | Ga0495662_0122714 | 3300046476 | Bacteria | 1276 |
| 681 | Ga0495662_0140224 | 3300046476 | Bacteria | 1190 |
| 682 | Ga0495664_0002895 | 3300046477 | Bacteria | 9252 |
| 683 | Ga0495584_0261278 | 3300046491 | Bacteria | 880 |
| 684 | Ga0495585_0071464 | 3300046492 | Bacteria | 1892 |
| 685 | Ga0495585_0245198 | 3300046492 | Bacteria | 896 |
| 686 | Ga0495594_0026783 | 3300046499 | Bacteria | 3104 |
| 687 | Ga0495594_0554544 | 3300046499 | Bacteria | 652 |
| 688 | Ga0495596_0063221 | 3300046500 | Bacteria | 1440 |
| 689 | Ga0495607_0019928 | 3300046501 | Bacteria | 4249 |
| 690 | Ga0495607_0094681 | 3300046501 | Bacteria | 1611 |
| 691 | Ga0495583_0078167 | 3300046506 | Bacteria | 1442 |
| 692 | Ga0495608_0026855 | 3300046511 | Bacteria | 3922 |
| 693 | Ga0495608_0526550 | 3300046511 | Bacteria | 714 |
| 694 | Ga0495618_0018778 | 3300046514 | Bacteria | 4247 |
| 695 | Ga0495618_0220062 | 3300046514 | Bacteria | 1198 |
| 696 | Ga0495620_0111986 | 3300046515 | Bacteria | 1081 |
| 697 | Ga0495628_0002036 | 3300046516 | Bacteria | 18318 |
| 698 | Ga0495628_0422590 | 3300046516 | Bacteria | 971 |
| 699 | Ga0495630_0006996 | 3300046517 | Bacteria | 8040 |
| 700 | Ga0495630_0161658 | 3300046517 | Bacteria | 1705 |
| 701 | Ga0495630_0510023 | 3300046517 | Bacteria | 922 |
| 702 | Ga0495631_0065169 | 3300046518 | Bacteria | 1577 |
| 703 | Ga0495631_0100357 | 3300046518 | Bacteria | 1246 |
| 704 | Ga0495632_0106660 | 3300046519 | Bacteria | 1318 |
| 705 | Ga0495643_0104599 | 3300046522 | Bacteria | 1447 |
| 706 | Ga0495644_0007305 | 3300046523 | Bacteria | 4267 |
| 707 | Ga0495644_0028436 | 3300046523 | Bacteria | 2116 |
| 708 | Ga0495644_0054087 | 3300046523 | Bacteria | 1508 |
| 709 | Ga0495663_0009173 | 3300046525 | Bacteria | 2743 |
| 710 | Ga0495663_0036115 | 3300046525 | Bacteria | 1486 |
| 711 | Ga0495663_0046973 | 3300046525 | Bacteria | 1328 |
| 712 | Ga0495642_0014764 | 3300046528 | Bacteria | 3030 |
| 713 | Ga0495652_0013477 | 3300046529 | Bacteria | 7359 |
| 714 | Ga0495652_0536426 | 3300046529 | Bacteria | 806 |
| 715 | Ga0495665_0008331 | 3300046531 | Bacteria | 5620 |
| 716 | Ga0495665_0126695 | 3300046531 | Bacteria | 1337 |
| 717 | Ga0495640_0280278 | 3300046533 | Bacteria | 1038 |
| 718 | Ga0495586_0160449 | 3300046535 | Bacteria | 1268 |
| 719 | Ga0495587_0008664 | 3300046536 | Bacteria | 6535 |
| 720 | Ga0495598_0040133 | 3300046537 | Bacteria | 1364 |
| 721 | Ga0495598_0277942 | 3300046537 | Bacteria | 628 |
| 722 | Ga0495609_0173616 | 3300046538 | Bacteria | 909 |
| 723 | Ga0495645_0146772 | 3300046543 | Bacteria | 1642 |
| 724 | Ga0495622_0217704 | 3300046557 | Bacteria | 847 |
| 725 | Ga0495633_0109201 | 3300046558 | Bacteria | 1283 |
| 726 | Ga0495633_0326841 | 3300046558 | Bacteria | 696 |
| 727 | Ga0495667_0053928 | 3300046559 | Bacteria | 2647 |
| 728 | Ga0495656_0023330 | 3300046615 | Bacteria | 2434 |
| 729 | Ga0495656_0143687 | 3300046615 | Bacteria | 1146 |
| 730 | Ga0495656_0321457 | 3300046615 | Bacteria | 797 |
| 731 | Ga0495668_0079107 | 3300046616 | Bacteria | 1805 |
| 732 | Ga0495668_0124740 | 3300046616 | Bacteria | 1409 |
| 733 | Ga0495634_0056818 | 3300046642 | Bacteria | 2614 |
| 734 | Ga0495634_0072110 | 3300046642 | Bacteria | 2272 |
| 735 | Ga0495611_0321477 | 3300046648 | Bacteria | 712 |
| 736 | Ga0495635_0114065 | 3300046663 | Bacteria | 1845 |
| 737 | Ga0495659_0049711 | 3300046664 | Bacteria | 1523 |
| 738 | Ga0495588_0020546 | 3300046674 | Bacteria | 3248 |
| 739 | Ga0495588_0082313 | 3300046674 | Bacteria | 1681 |
| 740 | Ga0495588_0278713 | 3300046674 | Bacteria | 881 |
| 741 | Ga0495657_0028530 | 3300046675 | Bacteria | 3924 |
| 742 | Ga0495599_0005910 | 3300046678 | Bacteria | 7355 |
| 743 | Ga0495599_0068382 | 3300046678 | Bacteria | 2217 |
| 744 | Ga0495646_0048008 | 3300046680 | Bacteria | 2596 |
| 745 | Ga0495647_0001137 | 3300046681 | Bacteria | 8161 |
| 746 | Ga0495647_0172560 | 3300046681 | Bacteria | 937 |
| 747 | Ga0495647_0304322 | 3300046681 | Bacteria | 719 |
| 748 | Ga0495658_0013456 | 3300046683 | Bacteria | 4164 |
| 749 | Ga0495658_0157670 | 3300046683 | Bacteria | 1398 |
| 750 | Ga0495658_0492201 | 3300046683 | Bacteria | 784 |
| 751 | Ga0495669_0164862 | 3300046684 | Bacteria | 1053 |
| 752 | Ga0495613_0030077 | 3300046689 | Bacteria | 4034 |
| 753 | Ga0495613_0191383 | 3300046689 | Bacteria | 1445 |
| 754 | Ga0495613_0519700 | 3300046689 | Bacteria | 800 |
| 755 | Ga0495624_0023432 | 3300046690 | Bacteria | 4070 |
| 756 | Ga0495624_0115042 | 3300046690 | Bacteria | 1653 |
| 757 | Ga0495670_0104413 | 3300046691 | Bacteria | 1462 |
| 758 | Ga0495670_0361764 | 3300046691 | Bacteria | 782 |
| 759 | Ga0495671_0103718 | 3300046692 | Bacteria | 1389 |
| 760 | Ga0495671_0215173 | 3300046692 | Bacteria | 931 |
| 761 | Ga0495671_0374920 | 3300046692 | Bacteria | 682 |
| 762 | Ga0495649_0086044 | 3300046694 | Bacteria | 1678 |
| 763 | Ga0495589_0009382 | 3300046794 | Bacteria | 5089 |
| 764 | Ga0495600_0002357 | 3300046809 | Bacteria | 10790 |
| 765 | Ga0495600_0036004 | 3300046809 | Bacteria | 3216 |
| 766 | Ga0495600_0071657 | 3300046809 | Bacteria | 2264 |
| 767 | Ga0495600_0194137 | 3300046809 | Bacteria | 1305 |
| 768 | Ga0495581_0005927 | 3300047315 | Bacteria | 7085 |
| 769 | Ga0495581_0021131 | 3300047315 | Bacteria | 3775 |
| 770 | Ga0495581_0242385 | 3300047315 | Bacteria | 1054 |
| 771 | Ga0495674_0008898 | 3300047319 | Bacteria | 9548 |
| 772 | Ga0495676_0012449 | 3300047321 | Bacteria | 7662 |
| 773 | Ga0495676_0017472 | 3300047321 | Bacteria | 6342 |
| 774 | Ga0495676_0091963 | 3300047321 | Bacteria | 2265 |
| 775 | Ga0495676_0213757 | 3300047321 | Bacteria | 1333 |
| 776 | Ga0495680_0011101 | 3300047322 | Bacteria | 7996 |
| 777 | Ga0495680_0047141 | 3300047322 | Bacteria | 3392 |
| 778 | Ga0495680_0112992 | 3300047322 | Bacteria | 2011 |
| 779 | Ga0495680_0117346 | 3300047322 | Bacteria | 1967 |
| 780 | Ga0495680_0208155 | 3300047322 | Bacteria | 1401 |
| 781 | Ga0495680_0449852 | 3300047322 | Bacteria | 882 |
| 782 | Ga0495675_0000882 | 3300047444 | Bacteria | 18342 |
| 783 | Ga0495684_0098366 | 3300047471 | Bacteria | 2212 |
| 784 | Ga0495686_0000011 | 3300047472 | Bacteria | 514750 |
| 785 | Ga0495686_0002398 | 3300047472 | Bacteria | 17807 |
| 786 | Ga0495686_0167016 | 3300047472 | Bacteria | 1282 |
| 787 | Ga0495593_0002580 | 3300047673 | Bacteria | 10883 |
| 788 | Ga0495593_0123439 | 3300047673 | Bacteria | 1317 |
| 789 | Ga0495614_0000773 | 3300048089 | Bacteria | 13540 |
| 790 | Ga0496100_0196817 | 3300048903 | Bacteria | 1466 |
| 791 | Ga0496100_0690036 | 3300048903 | Bacteria | 796 |
| 792 | Ga0496100_0715685 | 3300048903 | Bacteria | 782 |
| 793 | Ga0496101_0101553 | 3300048904 | Bacteria | 2154 |
| 794 | Ga0496101_0153693 | 3300048904 | Bacteria | 1761 |
| 795 | Ga0496101_0180949 | 3300048904 | Bacteria | 1623 |
| 796 | Ga0496101_0328634 | 3300048904 | Bacteria | 1200 |
| 797 | Ga0496101_0569098 | 3300048904 | Bacteria | 896 |
| 798 | Ga0496102_0113361 | 3300048905 | Bacteria | 2529 |
| 799 | Ga0496102_0146780 | 3300048905 | Bacteria | 2214 |
| 800 | Ga0496102_0152760 | 3300048905 | Bacteria | 2170 |
| 801 | Ga0496102_0248176 | 3300048905 | Bacteria | 1678 |
| 802 | Ga0496102_0339508 | 3300048905 | Bacteria | 1415 |
| 803 | Ga0496102_0364792 | 3300048905 | Bacteria | 1360 |
| 804 | Ga0496102_0520467 | 3300048905 | Bacteria | 1112 |
| 805 | Ga0496103_0156516 | 3300048906 | Bacteria | 1461 |
| 806 | Ga0496104_0000557 | 3300048907 | Bacteria | 31776 |
| 807 | Ga0496104_0071520 | 3300048907 | Bacteria | 3298 |
| 808 | Ga0496104_0084121 | 3300048907 | Bacteria | 3035 |
| 809 | Ga0496104_0086130 | 3300048907 | Bacteria | 2999 |
| 810 | Ga0496104_0201139 | 3300048907 | Bacteria | 1904 |
| 811 | Ga0496104_0439610 | 3300048907 | Bacteria | 1216 |
| 812 | Ga0496105_0000609 | 3300048908 | Bacteria | 23924 |
| 813 | Ga0496105_0043045 | 3300048908 | Bacteria | 3724 |
| 814 | Ga0496105_0516419 | 3300048908 | Bacteria | 936 |
| 815 | Ga0496106_0168578 | 3300048909 | Bacteria | 1734 |
| 816 | Ga0496107_0049877 | 3300048910 | Bacteria | 3017 |
| 817 | Ga0496107_0146436 | 3300048910 | Bacteria | 1746 |
| 818 | Ga0496108_0000612 | 3300048911 | Bacteria | 27959 |
| 819 | Ga0496108_0100392 | 3300048911 | Bacteria | 2468 |
| 820 | Ga0496108_0154710 | 3300048911 | Bacteria | 1980 |
| 821 | Ga0496108_0164172 | 3300048911 | Bacteria | 1920 |
| 822 | Ga0496108_0287868 | 3300048911 | Bacteria | 1430 |
| 823 | Ga0496109_0004344 | 3300048912 | Bacteria | 11842 |
| 824 | Ga0496109_0042682 | 3300048912 | Bacteria | 4109 |
| 825 | Ga0496109_0148163 | 3300048912 | Bacteria | 2196 |
| 826 | Ga0496109_0236149 | 3300048912 | Bacteria | 1720 |
| 827 | Ga0496109_0246642 | 3300048912 | Bacteria | 1681 |
| 828 | Ga0496109_0294044 | 3300048912 | Bacteria | 1531 |
| 829 | Ga0496109_0522370 | 3300048912 | Bacteria | 1120 |
| 830 | Ga0496110_0000564 | 3300048913 | Bacteria | 25354 |
| 831 | Ga0496110_0016135 | 3300048913 | Bacteria | 6228 |
| 832 | Ga0496110_0026242 | 3300048913 | Bacteria | 4983 |
| 833 | Ga0496110_0034287 | 3300048913 | Bacteria | 4396 |
| 834 | Ga0496110_0037242 | 3300048913 | Bacteria | 4228 |
| 835 | Ga0496110_0058251 | 3300048913 | Bacteria | 3402 |
| 836 | Ga0496110_0255732 | 3300048913 | Bacteria | 1594 |
| 837 | Ga0496111_0000294 | 3300048914 | Bacteria | 24345 |
| 838 | Ga0496111_0008012 | 3300048914 | Bacteria | 6968 |
| 839 | Ga0496111_0026530 | 3300048914 | Bacteria | 4093 |
| 840 | Ga0496111_0181090 | 3300048914 | Bacteria | 1566 |
| 841 | Ga0496111_0253641 | 3300048914 | Bacteria | 1305 |
| 842 | Ga0496112_0004854 | 3300048915 | Bacteria | 11487 |
| 843 | Ga0496112_0039578 | 3300048915 | Bacteria | 4608 |
| 844 | Ga0496112_0051852 | 3300048915 | Bacteria | 4025 |
| 845 | Ga0496112_0502471 | 3300048915 | Bacteria | 1148 |
| 846 | Ga0496112_0588531 | 3300048915 | Bacteria | 1045 |
| 847 | Ga0496113_0000414 | 3300048916 | Bacteria | 20698 |
| 848 | Ga0496113_0039715 | 3300048916 | Bacteria | 3465 |
| 849 | Ga0496114_0064338 | 3300048917 | Bacteria | 3071 |
| 850 | Ga0496115_0004631 | 3300048918 | Bacteria | 9950 |
| 851 | Ga0495678_077501 | 3300049459 | Bacteria | 1202 |
| 852 | Ga0501031_0000033 | 3300049568 | Bacteria | 76506 |
| 853 | Ga0501031_0074697 | 3300049568 | Bacteria | 2207 |
| 854 | Ga0501031_0118904 | 3300049568 | Bacteria | 1726 |
| 855 | Ga0501031_0344194 | 3300049568 | Bacteria | 965 |
| 856 | Ga0501032_0002047 | 3300049569 | Bacteria | 15929 |
| 857 | Ga0501032_0058120 | 3300049569 | Bacteria | 2597 |
| 858 | Ga0501033_0000388 | 3300049570 | Bacteria | 42262 |
| 859 | Ga0501033_0031359 | 3300049570 | Bacteria | 3994 |
| 860 | Ga0501033_0034644 | 3300049570 | Bacteria | 3786 |
| 861 | Ga0501033_0077541 | 3300049570 | Bacteria | 2438 |
| 862 | Ga0501033_0084392 | 3300049570 | Bacteria | 2328 |
| 863 | Ga0501034_0003854 | 3300049571 | Bacteria | 16899 |
| 864 | Ga0501034_0034552 | 3300049571 | Bacteria | 5125 |
| 865 | Ga0501034_0074710 | 3300049571 | Bacteria | 3397 |
| 866 | Ga0501034_0176576 | 3300049571 | Bacteria | 2102 |
| 867 | Ga0501036_0000462 | 3300049572 | Bacteria | 29122 |
| 868 | Ga0501036_0010142 | 3300049572 | Bacteria | 7765 |
| 869 | Ga0501036_0013657 | 3300049572 | Bacteria | 6752 |
| 870 | Ga0501036_0053869 | 3300049572 | Bacteria | 3405 |
| 871 | Ga0501036_0096199 | 3300049572 | Bacteria | 2503 |
| 872 | Ga0501036_0405892 | 3300049572 | Bacteria | 1136 |
| 873 | Ga0501036_0461168 | 3300049572 | Bacteria | 1058 |
| 874 | Ga0501037_0000915 | 3300049573 | Bacteria | 21941 |
| 875 | Ga0501037_0018448 | 3300049573 | Bacteria | 5144 |
| 876 | Ga0501037_0020177 | 3300049573 | Bacteria | 4921 |
| 877 | Ga0501037_0033954 | 3300049573 | Bacteria | 3767 |
| 878 | Ga0501038_0001345 | 3300049574 | Bacteria | 22388 |
| 879 | Ga0501038_0003559 | 3300049574 | Bacteria | 14496 |
| 880 | Ga0501038_0017214 | 3300049574 | Bacteria | 6535 |
| 881 | Ga0501038_0474452 | 3300049574 | Bacteria | 959 |
| 882 | Ga0501038_0584200 | 3300049574 | Bacteria | 847 |
| 883 | Ga0501039_0000528 | 3300049575 | Bacteria | 27658 |
| 884 | Ga0501039_0002890 | 3300049575 | Bacteria | 12850 |
| 885 | Ga0501039_0004144 | 3300049575 | Bacteria | 10909 |
| 886 | Ga0501039_0009715 | 3300049575 | Bacteria | 7332 |
| 887 | Ga0501039_0048266 | 3300049575 | Bacteria | 3291 |
| 888 | Ga0501039_0389578 | 3300049575 | Bacteria | 1094 |
| 889 | Ga0501039_0842826 | 3300049575 | Bacteria | 714 |
| 890 | Ga0501040_0000234 | 3300049576 | Bacteria | 32549 |
| 891 | Ga0501040_0001857 | 3300049576 | Bacteria | 13550 |
| 892 | Ga0501040_0063098 | 3300049576 | Bacteria | 2549 |
| 893 | Ga0501040_0063793 | 3300049576 | Bacteria | 2535 |
| 894 | Ga0501040_0086026 | 3300049576 | Bacteria | 2182 |
| 895 | Ga0501040_0289973 | 3300049576 | Bacteria | 1169 |
| 896 | Ga0501041_0000176 | 3300049577 | Bacteria | 28688 |
| 897 | Ga0501041_0001613 | 3300049577 | Bacteria | 12589 |
| 898 | Ga0501041_0001653 | 3300049577 | Bacteria | 12471 |
| 899 | Ga0501041_0001903 | 3300049577 | Bacteria | 11701 |
| 900 | Ga0501041_0004551 | 3300049577 | Bacteria | 8045 |
| 901 | Ga0501041_0022657 | 3300049577 | Bacteria | 3761 |
| 902 | Ga0501041_0061510 | 3300049577 | Bacteria | 2299 |
| 903 | Ga0501041_0064517 | 3300049577 | Bacteria | 2243 |
| 904 | Ga0501041_0097119 | 3300049577 | Bacteria | 1821 |
| 905 | Ga0501042_0001051 | 3300049578 | Bacteria | 15754 |
| 906 | Ga0501042_0002112 | 3300049578 | Bacteria | 12048 |
| 907 | Ga0501042_0002211 | 3300049578 | Bacteria | 11863 |
| 908 | Ga0501042_0005399 | 3300049578 | Bacteria | 8227 |
| 909 | Ga0501042_0012515 | 3300049578 | Bacteria | 5750 |
| 910 | Ga0501042_0101799 | 3300049578 | Bacteria | 2066 |
| 911 | Ga0501042_0212790 | 3300049578 | Bacteria | 1394 |
| 912 | Ga0501043_0000798 | 3300049579 | Bacteria | 27990 |
| 913 | Ga0501043_0010457 | 3300049579 | Bacteria | 7271 |
| 914 | Ga0501043_0010678 | 3300049579 | Bacteria | 7193 |
| 915 | Ga0501043_0034434 | 3300049579 | Bacteria | 3983 |
| 916 | Ga0501043_0101721 | 3300049579 | Bacteria | 2258 |
| 917 | Ga0501043_0320369 | 3300049579 | Bacteria | 1182 |
| 918 | Ga0501046_0000577 | 3300049580 | Bacteria | 36233 |
| 919 | Ga0501046_0001998 | 3300049580 | Bacteria | 19348 |
| 920 | Ga0501046_0016228 | 3300049580 | Bacteria | 6243 |
| 921 | Ga0501046_0028735 | 3300049580 | Bacteria | 4526 |
| 922 | Ga0501046_0044538 | 3300049580 | Bacteria | 3529 |
| 923 | Ga0501046_0236750 | 3300049580 | Bacteria | 1347 |
| 924 | Ga0501047_0001088 | 3300049581 | Bacteria | 27110 |
| 925 | Ga0501047_0237539 | 3300049581 | Bacteria | 1674 |
| 926 | Ga0501048_0000440 | 3300049582 | Bacteria | 29199 |
| 927 | Ga0501048_0012920 | 3300049582 | Bacteria | 6202 |
| 928 | Ga0501048_0032679 | 3300049582 | Bacteria | 3760 |
| 929 | Ga0501048_0038723 | 3300049582 | Bacteria | 3421 |
| 930 | Ga0501048_0057132 | 3300049582 | Bacteria | 2767 |
| 931 | Ga0501048_0066465 | 3300049582 | Bacteria | 2549 |
| 932 | Ga0501048_0066490 | 3300049582 | Bacteria | 2548 |
| 933 | Ga0501048_0214312 | 3300049582 | Bacteria | 1366 |
| 934 | Ga0501048_0230035 | 3300049582 | Bacteria | 1316 |
| 935 | Ga0501067_0008570 | 3300049583 | Bacteria | 5671 |
| 936 | Ga0501067_0039241 | 3300049583 | Bacteria | 2629 |
| 937 | Ga0501068_0000344 | 3300049584 | Bacteria | 23396 |
| 938 | Ga0501068_0001607 | 3300049584 | Bacteria | 12031 |
| 939 | Ga0501068_0002038 | 3300049584 | Bacteria | 10773 |
| 940 | Ga0501068_0014068 | 3300049584 | Bacteria | 4568 |
| 941 | Ga0501068_0022595 | 3300049584 | Bacteria | 3678 |
| 942 | Ga0501068_0078854 | 3300049584 | Bacteria | 2019 |
| 943 | Ga0501068_0153938 | 3300049584 | Bacteria | 1446 |
| 944 | Ga0501068_0302637 | 3300049584 | Bacteria | 1024 |
| 945 | Ga0501068_0441195 | 3300049584 | Bacteria | 842 |
| 946 | Ga0501069_0000870 | 3300049585 | Bacteria | 14363 |
| 947 | Ga0501069_0018237 | 3300049585 | Bacteria | 3786 |
| 948 | Ga0501069_0022470 | 3300049585 | Bacteria | 3431 |
| 949 | Ga0501069_0028662 | 3300049585 | Bacteria | 3053 |
| 950 | Ga0501069_0066883 | 3300049585 | Bacteria | 2010 |
| 951 | Ga0501069_0101498 | 3300049585 | Bacteria | 1633 |
| 952 | Ga0501069_0219852 | 3300049585 | Bacteria | 1103 |
| 953 | Ga0501069_0295513 | 3300049585 | Bacteria | 949 |
| 954 | Ga0501070_0001864 | 3300049586 | Bacteria | 18631 |
| 955 | Ga0501070_0002078 | 3300049586 | Bacteria | 17588 |
| 956 | Ga0501070_0029634 | 3300049586 | Bacteria | 4587 |
| 957 | Ga0501070_0048740 | 3300049586 | Bacteria | 3518 |
| 958 | Ga0501070_0111746 | 3300049586 | Bacteria | 2258 |
| 959 | Ga0501070_0323214 | 3300049586 | Bacteria | 1254 |
| 960 | Ga0501070_0454328 | 3300049586 | Bacteria | 1033 |
| 961 | Ga0501070_0906242 | 3300049586 | Bacteria | 688 |
| 962 | Ga0501071_0000054 | 3300049587 | Bacteria | 38443 |
| 963 | Ga0501071_0003445 | 3300049587 | Bacteria | 9881 |
| 964 | Ga0501071_0035122 | 3300049587 | Bacteria | 3570 |
| 965 | Ga0501071_0037155 | 3300049587 | Bacteria | 3476 |
| 966 | Ga0501071_0052443 | 3300049587 | Bacteria | 2941 |
| 967 | Ga0501071_0052886 | 3300049587 | Bacteria | 2928 |
| 968 | Ga0501071_0079638 | 3300049587 | Bacteria | 2395 |
| 969 | Ga0501072_0001204 | 3300049588 | Bacteria | 19296 |
| 970 | Ga0501072_0019896 | 3300049588 | Bacteria | 5195 |
| 971 | Ga0501072_0020451 | 3300049588 | Bacteria | 5129 |
| 972 | Ga0501072_0023725 | 3300049588 | Bacteria | 4765 |
| 973 | Ga0501072_0045774 | 3300049588 | Bacteria | 3441 |
| 974 | Ga0501072_0056675 | 3300049588 | Bacteria | 3087 |
| 975 | Ga0501072_0059776 | 3300049588 | Bacteria | 3005 |
| 976 | Ga0501072_0122676 | 3300049588 | Bacteria | 2070 |
| 977 | Ga0501072_0186257 | 3300049588 | Bacteria | 1656 |
| 978 | Ga0501072_0235721 | 3300049588 | Bacteria | 1457 |
| 979 | Ga0501072_0266086 | 3300049588 | Bacteria | 1364 |
| 980 | Ga0501073_0004823 | 3300049589 | Bacteria | 10126 |
| 981 | Ga0501073_0017301 | 3300049589 | Bacteria | 5222 |
| 982 | Ga0501073_0031345 | 3300049589 | Bacteria | 3793 |
| 983 | Ga0501073_0086505 | 3300049589 | Bacteria | 2180 |
| 984 | Ga0501073_0134345 | 3300049589 | Bacteria | 1714 |
| 985 | Ga0501073_0209372 | 3300049589 | Bacteria | 1347 |
| 986 | Ga0501073_0425647 | 3300049589 | Bacteria | 917 |
| 987 | Ga0501074_0000008 | 3300049590 | Bacteria | 105048 |
| 988 | Ga0501074_0002959 | 3300049590 | Bacteria | 11940 |
| 989 | Ga0501074_0025270 | 3300049590 | Bacteria | 4314 |
| 990 | Ga0501074_0032984 | 3300049590 | Bacteria | 3752 |
| 991 | Ga0501074_0048547 | 3300049590 | Bacteria | 3066 |
| 992 | Ga0501074_0282191 | 3300049590 | Bacteria | 1181 |
| 993 | Ga0501075_0000096 | 3300049591 | Bacteria | 40796 |
| 994 | Ga0501075_0000800 | 3300049591 | Bacteria | 19695 |
| 995 | Ga0501075_0005557 | 3300049591 | Bacteria | 8627 |
| 996 | Ga0501075_0010477 | 3300049591 | Bacteria | 6513 |
| 997 | Ga0501075_0078516 | 3300049591 | Bacteria | 2498 |
| 998 | Ga0501075_0100780 | 3300049591 | Bacteria | 2193 |
| 999 | Ga0501075_0243314 | 3300049591 | Bacteria | 1371 |
| 1000 | Ga0501075_0511208 | 3300049591 | Bacteria | 916 |
| 1001 | Ga0501076_0000020 | 3300049592 | Bacteria | 86221 |
| 1002 | Ga0501076_0000459 | 3300049592 | Bacteria | 25828 |
| 1003 | Ga0501076_0005733 | 3300049592 | Bacteria | 8952 |
| 1004 | Ga0501076_0015181 | 3300049592 | Bacteria | 5817 |
| 1005 | Ga0501076_0029367 | 3300049592 | Bacteria | 4276 |
| 1006 | Ga0501076_0049904 | 3300049592 | Bacteria | 3310 |
| 1007 | Ga0501076_0076849 | 3300049592 | Bacteria | 2678 |
| 1008 | Ga0501076_0100399 | 3300049592 | Bacteria | 2331 |
| 1009 | Ga0501076_0193454 | 3300049592 | Bacteria | 1660 |
| 1010 | Ga0501076_0199076 | 3300049592 | Bacteria | 1635 |
| 1011 | Ga0501076_0548262 | 3300049592 | Bacteria | 953 |
| 1012 | Ga0501077_0000624 | 3300049593 | Bacteria | 21474 |
| 1013 | Ga0501077_0001221 | 3300049593 | Bacteria | 15525 |
| 1014 | Ga0501077_0001720 | 3300049593 | Bacteria | 13181 |
| 1015 | Ga0501077_0007219 | 3300049593 | Bacteria | 6854 |
| 1016 | Ga0501077_0022760 | 3300049593 | Bacteria | 3971 |
| 1017 | Ga0501077_0081356 | 3300049593 | Bacteria | 2052 |
| 1018 | Ga0501077_0098445 | 3300049593 | Bacteria | 1853 |
| 1019 | Ga0501077_0137586 | 3300049593 | Bacteria | 1549 |
| 1020 | Ga0501077_0317482 | 3300049593 | Bacteria | 993 |
| 1021 | Ga0501207_042868 | 3300049654 | Bacteria | 791 |
| 1022 | Ga0501079_0000001 | 3300049741 | Bacteria | 121247 |
| 1023 | Ga0501079_0003968 | 3300049741 | Bacteria | 10931 |
| 1024 | Ga0501079_0006300 | 3300049741 | Bacteria | 8897 |
| 1025 | Ga0501079_0026049 | 3300049741 | Bacteria | 4484 |
| 1026 | Ga0501079_0040476 | 3300049741 | Bacteria | 3594 |
| 1027 | Ga0501079_0042195 | 3300049741 | Bacteria | 3523 |
| 1028 | Ga0501079_0057533 | 3300049741 | Bacteria | 3000 |
| 1029 | Ga0501079_0066096 | 3300049741 | Bacteria | 2790 |
| 1030 | Ga0501079_0103045 | 3300049741 | Bacteria | 2213 |
| 1031 | Ga0501079_0120970 | 3300049741 | Bacteria | 2036 |
| 1032 | Ga0501079_0184354 | 3300049741 | Bacteria | 1629 |
| 1033 | Ga0501079_0212946 | 3300049741 | Bacteria | 1509 |
| 1034 | Ga0501079_0406266 | 3300049741 | Bacteria | 1068 |
| 1035 | Ga0501079_0452806 | 3300049741 | Bacteria | 1008 |
| 1036 | Ga0501079_0539624 | 3300049741 | Bacteria | 917 |
| 1037 | Ga0501079_0623383 | 3300049741 | Bacteria | 849 |
| 1038 | Ga0501080_0002158 | 3300049742 | Bacteria | 17095 |
| 1039 | Ga0501080_0003585 | 3300049742 | Bacteria | 13670 |
| 1040 | Ga0501080_0019482 | 3300049742 | Bacteria | 6284 |
| 1041 | Ga0501080_0029846 | 3300049742 | Bacteria | 5075 |
| 1042 | Ga0501080_0032227 | 3300049742 | Bacteria | 4886 |
| 1043 | Ga0501080_0062453 | 3300049742 | Bacteria | 3467 |
| 1044 | Ga0501080_0161578 | 3300049742 | Bacteria | 2069 |
| 1045 | Ga0501080_0382006 | 3300049742 | Bacteria | 1269 |
| 1046 | Ga0501081_0000001 | 3300049743 | Bacteria | 115059 |
| 1047 | Ga0501081_0001766 | 3300049743 | Bacteria | 13416 |
| 1048 | Ga0501081_0001842 | 3300049743 | Bacteria | 13150 |
| 1049 | Ga0501081_0003476 | 3300049743 | Bacteria | 10064 |
| 1050 | Ga0501081_0038771 | 3300049743 | Bacteria | 3257 |
| 1051 | Ga0501081_0047263 | 3300049743 | Bacteria | 2961 |
| 1052 | Ga0501081_0052606 | 3300049743 | Bacteria | 2811 |
| 1053 | Ga0501081_0055915 | 3300049743 | Bacteria | 2726 |
| 1054 | Ga0501081_0075138 | 3300049743 | Bacteria | 2358 |
| 1055 | Ga0501081_0097627 | 3300049743 | Bacteria | 2073 |
| 1056 | Ga0501081_0123263 | 3300049743 | Bacteria | 1848 |
| 1057 | Ga0501081_0139443 | 3300049743 | Bacteria | 1737 |
| 1058 | Ga0501083_0002293 | 3300049744 | Bacteria | 13098 |
| 1059 | Ga0501083_0002761 | 3300049744 | Bacteria | 12131 |
| 1060 | Ga0501083_0006339 | 3300049744 | Bacteria | 8383 |
| 1061 | Ga0501083_0208135 | 3300049744 | Bacteria | 1275 |
| 1062 | Ga0501083_0534820 | 3300049744 | Bacteria | 763 |
| 1063 | Ga0501035_0001281 | 3300049822 | Bacteria | 25975 |
| 1064 | Ga0501035_0014419 | 3300049822 | Bacteria | 7295 |
| 1065 | Ga0501035_0014843 | 3300049822 | Bacteria | 7191 |
| 1066 | Ga0501035_0056842 | 3300049822 | Bacteria | 3489 |
| 1067 | Ga0501035_0114552 | 3300049822 | Bacteria | 2361 |
| 1068 | Ga0501035_0330099 | 3300049822 | Bacteria | 1280 |
| 1069 | Ga0501044_0004690 | 3300049823 | Bacteria | 15285 |
| 1070 | Ga0501044_0089591 | 3300049823 | Bacteria | 3105 |
| 1071 | Ga0501044_0107913 | 3300049823 | Bacteria | 2795 |
| 1072 | Ga0501044_0271630 | 3300049823 | Bacteria | 1631 |
| 1073 | Ga0501045_0000641 | 3300049824 | Bacteria | 22097 |
| 1074 | Ga0501045_0000928 | 3300049824 | Bacteria | 19139 |
| 1075 | Ga0501045_0026066 | 3300049824 | Bacteria | 4202 |
| 1076 | Ga0501045_0028467 | 3300049824 | Bacteria | 4030 |
| 1077 | Ga0501045_0032587 | 3300049824 | Bacteria | 3776 |
| 1078 | Ga0501045_0049326 | 3300049824 | Bacteria | 3069 |
| 1079 | Ga0501045_0049599 | 3300049824 | Bacteria | 3061 |
| 1080 | Ga0501045_0632509 | 3300049824 | Bacteria | 791 |
| 1081 | Ga0501045_0720874 | 3300049824 | Bacteria | 735 |
| 1082 | nmdc:mga03683_92568_c1 | 3300050489 | Bacteria | 1320 |
| 1083 | nmdc:mga00v17_188513_c1 | 3300050491 | Bacteria | 1331 |
| 1084 | nmdc:mga00v17_23947_c1 | 3300050491 | Bacteria | 3537 |
| 1085 | nmdc:mga0yw44_10226_c1 | 3300050492 | Bacteria | 4609 |
| 1086 | nmdc:mga0yw44_127669_c1 | 3300050492 | Bacteria | 1643 |
| 1087 | nmdc:mga0yw44_15187_c1 | 3300050492 | Bacteria | 2306 |
| 1088 | nmdc:mga0yw44_443870_c1 | 3300050492 | Bacteria | 879 |
| 1089 | nmdc:mga06z11_91359_c1 | 3300050494 | Bacteria | 1653 |
| 1090 | nmdc:mga05p37_182900_c1 | 3300050507 | Bacteria | 2549 |
| 1091 | nmdc:mga05p37_190055_c1 | 3300050507 | Bacteria | 2494 |
| 1092 | nmdc:mga05p37_2318_c1 | 3300050507 | Bacteria | 22162 |
| 1093 | nmdc:mga05p37_250690_c1 | 3300050507 | Bacteria | 2124 |
| 1094 | nmdc:mga05p37_308161_c1 | 3300050507 | Bacteria | 1878 |
| 1095 | nmdc:mga05p37_416991_c1 | 3300050507 | Bacteria | 1563 |
| 1096 | nmdc:mga05p37_565805_c1 | 3300050507 | Bacteria | 1291 |
| 1097 | nmdc:mga05p37_6607_c1 | 3300050507 | Bacteria | 13670 |
| 1098 | nmdc:mga05p37_946759_c1 | 3300050507 | Bacteria | 922 |
| 1099 | nmdc:mga09592_1034835_c1 | 3300050508 | Bacteria | 685 |
| 1100 | nmdc:mga09592_13265_c1 | 3300050508 | Bacteria | 6728 |
| 1101 | nmdc:mga09592_2473_c1 | 3300050508 | Bacteria | 14915 |
| 1102 | nmdc:mga09592_52444_c1 | 3300050508 | Bacteria | 3443 |
| 1103 | nmdc:mga09592_664301_c1 | 3300050508 | Bacteria | 889 |
| 1104 | nmdc:mga09592_92614_c1 | 3300050508 | Bacteria | 2584 |
| 1105 | nmdc:mga09592_93274_c1 | 3300050508 | Bacteria | 2574 |
| 1106 | nmdc:mga0qj67_111978_c1 | 3300050509 | Bacteria | 2204 |
| 1107 | nmdc:mga0qj67_151171_c1 | 3300050509 | Bacteria | 1884 |
| 1108 | nmdc:mga0qj67_242283_c1 | 3300050509 | Bacteria | 1463 |
| 1109 | nmdc:mga0qj67_344340_c1 | 3300050509 | Bacteria | 1205 |
| 1110 | nmdc:mga0qj67_56792_c1 | 3300050509 | Bacteria | 3104 |
| 1111 | nmdc:mga06r32_43044_c1 | 3300050510 | Bacteria | 4296 |
| 1112 | nmdc:mga06r32_51930_c1 | 3300050510 | Bacteria | 3925 |
| 1113 | nmdc:mga08y16_108558_c1 | 3300050511 | Bacteria | 2889 |
| 1114 | nmdc:mga08y16_11412_c1 | 3300050511 | Bacteria | 9336 |
| 1115 | nmdc:mga08y16_143557_c1 | 3300050511 | Bacteria | 2482 |
| 1116 | nmdc:mga08y16_149061_c1 | 3300050511 | Bacteria | 2432 |
| 1117 | nmdc:mga08y16_178948_c1 | 3300050511 | Bacteria | 2202 |
| 1118 | nmdc:mga08y16_378288_c1 | 3300050511 | Bacteria | 1452 |
| 1119 | nmdc:mga0n895_169144_c1 | 3300050512 | Bacteria | 2218 |
| 1120 | nmdc:mga0n895_430832_c1 | 3300050512 | Bacteria | 1333 |
| 1121 | nmdc:mga0n895_66062_c1 | 3300050512 | Bacteria | 3582 |
| 1122 | nmdc:mga0n895_8817_c1 | 3300050512 | Bacteria | 8775 |
| 1123 | nmdc:mga0rr50_24310_c1 | 3300050513 | Bacteria | 4195 |
| 1124 | nmdc:mga0rr50_319866_c1 | 3300050513 | Bacteria | 1301 |
| 1125 | nmdc:mga0rr50_446113_c1 | 3300050513 | Bacteria | 1097 |
| 1126 | nmdc:mga08x19_428330_c1 | 3300050514 | Bacteria | 930 |
| 1127 | nmdc:mga08x19_73607_c1 | 3300050514 | Bacteria | 2231 |
| 1128 | nmdc:mga0a205_21186_c1 | 3300050515 | Bacteria | 6148 |
| 1129 | nmdc:mga0a205_2601_c1 | 3300050515 | Bacteria | 15940 |
| 1130 | nmdc:mga0a205_47499_c1 | 3300050515 | Bacteria | 4142 |
| 1131 | nmdc:mga0a205_50263_c1 | 3300050515 | Bacteria | 4025 |
| 1132 | nmdc:mga0a205_56483_c1 | 3300050515 | Bacteria | 3790 |
| 1133 | nmdc:mga0a205_596722_c1 | 3300050515 | Bacteria | 958 |
| 1134 | Ga0495601_0020842 | 3300053077 | Bacteria | 4007 |
| 1135 | Ga0495601_0287043 | 3300053077 | Bacteria | 1073 |
| 1136 | Ga0495601_0428063 | 3300053077 | Bacteria | 857 |
| 1137 | Ga0495612_0001298 | 3300053078 | Bacteria | 10315 |
| 1138 | Ga0495612_0143853 | 3300053078 | Bacteria | 1035 |
| 1139 | Ga0500635_0123228 | 3300053080 | Bacteria | 972 |
| 1140 | Ga0495595_0002166 | 3300053084 | Bacteria | 7630 |
| 1141 | Ga0495619_0035341 | 3300053085 | Bacteria | 3249 |
| 1142 | Ga0495619_0040721 | 3300053085 | Bacteria | 3037 |
| 1143 | Ga0495619_0126382 | 3300053085 | Bacteria | 1755 |
| 1144 | Ga0500566_0025639 | 3300053094 | Bacteria | 3454 |
| 1145 | Ga0501084_0000283 | 3300054114 | Bacteria | 38382 |
| 1146 | Ga0501084_0000615 | 3300054114 | Bacteria | 27138 |
| 1147 | Ga0501084_0033540 | 3300054114 | Bacteria | 4295 |
| 1148 | Ga0501084_0040610 | 3300054114 | Bacteria | 3892 |
| 1149 | Ga0501084_0070017 | 3300054114 | Bacteria | 2937 |
| 1150 | Ga0501084_0089455 | 3300054114 | Bacteria | 2584 |
| 1151 | Ga0501084_0091221 | 3300054114 | Bacteria | 2558 |
| 1152 | Ga0501084_0120105 | 3300054114 | Bacteria | 2210 |
| 1153 | Ga0501084_0145344 | 3300054114 | Bacteria | 1997 |
| 1154 | Ga0501084_0165212 | 3300054114 | Bacteria | 1868 |
| 1155 | Ga0501084_0170553 | 3300054114 | Bacteria | 1837 |
| 1156 | Ga0501084_0211281 | 3300054114 | Bacteria | 1637 |
| 1157 | Ga0501084_0248953 | 3300054114 | Bacteria | 1500 |
| 1158 | Ga0501084_0397381 | 3300054114 | Bacteria | 1165 |
| 1159 | Ga0501084_0603640 | 3300054114 | Bacteria | 927 |
| 1160 | Ga0590075_070898 | 3300059424 | Bacteria | 900 |
| 1161 | Ga0501082_0000620 | 3300060353 | Bacteria | 31200 |
| 1162 | Ga0501082_0002904 | 3300060353 | Bacteria | 14943 |
| 1163 | Ga0501082_0018541 | 3300060353 | Bacteria | 5997 |
| 1164 | Ga0501082_0018734 | 3300060353 | Bacteria | 5964 |
| 1165 | Ga0501082_0051205 | 3300060353 | Bacteria | 3559 |
| 1166 | Ga0501082_0124480 | 3300060353 | Bacteria | 2235 |
| 1167 | Ga0501082_0280780 | 3300060353 | Bacteria | 1449 |
| 1168 | Ga0501082_0519774 | 3300060353 | Bacteria | 1040 |
| 1169 | Ga0501082_0962516 | 3300060353 | Bacteria | 746 |
| 1170 | Ga0530510_0001002 | 3300061734 | Bacteria | 18761 |
| 1171 | Ga0530510_0001060 | 3300061734 | Bacteria | 18252 |
| 1172 | Ga0530510_0043921 | 3300061734 | Bacteria | 3229 |
| 1173 | Ga0530510_0049390 | 3300061734 | Bacteria | 3040 |
| 1174 | Ga0530510_0063846 | 3300061734 | Bacteria | 2666 |
| 1175 | Ga0530510_0080283 | 3300061734 | Bacteria | 2373 |
| 1176 | Ga0530510_0084038 | 3300061734 | Bacteria | 2318 |
| 1177 | Ga0530510_0091685 | 3300061734 | Bacteria | 2217 |
| 1178 | Ga0530510_0100951 | 3300061734 | Bacteria | 2110 |
| 1179 | Ga0530510_0130786 | 3300061734 | Bacteria | 1846 |
| 1180 | Ga0530510_0246756 | 3300061734 | Bacteria | 1330 |
| 1181 | Ga0530510_0369931 | 3300061734 | Bacteria | 1078 |
| 1182 | Ga0316575_10022659 | |||
| 1183 | ARCol0yngRDRAFT_1002425 | |||
| 1184 | JGI24743J22301_10005078 | |||
| 1185 | JGI24738J21930_10006594 | |||
| 1186 | JGI24744J21845_10021288 | |||
| 1187 | JGI24742J22300_10042329 | |||
| 1188 | JGI25406J46586_10018384 | |||
| 1189 | JGI25407J50210_10012285 | |||
| 1190 | Ga0058859_11627522 | |||
| 1191 | Ga0070658_10873762 | |||
| 1192 | Ga0070676_10023233 | |||
| 1193 | Ga0070676_10269177 | |||
| 1194 | Ga0070676_10590613 | |||
| 1195 | Ga0070683_100005546 | |||
| 1196 | Ga0070683_100029977 | |||
| 1197 | Ga0070683_100056097 | |||
| 1198 | Ga0070683_100143903 | |||
| 1199 | Ga0070683_100175783 | |||
| 1200 | Ga0070683_100616662 | |||
| 1201 | Ga0070690_100026598 | |||
| 1202 | Ga0070670_100005260 | |||
| 1203 | Ga0070670_100046103 | |||
| 1204 | Ga0070670_100134981 | |||
| 1205 | Ga0070677_10272159 | |||
| 1206 | Ga0070666_10247381 | |||
| 1207 | Ga0070680_100018352 | |||
| 1208 | Ga0070680_100221084 | |||
| 1209 | Ga0070682_100032170 | |||
| 1210 | Ga0070682_100062128 | |||
| 1211 | Ga0070682_100512555 | |||
| 1212 | Ga0068868_100036772 | |||
| 1213 | Ga0068868_100205820 | |||
| 1214 | Ga0070660_100049813 | |||
| 1215 | Ga0070660_100475826 | |||
| 1216 | Ga0070660_100603847 | |||
| 1217 | Ga0070689_100032108 | |||
| 1218 | Ga0070689_100037066 | |||
| 1219 | Ga0070689_100151456 | |||
| 1220 | Ga0070689_100321806 | |||
| 1221 | Ga0070689_100489914 | |||
| 1222 | Ga0070691_10002704 | |||
| 1223 | Ga0070691_10014431 | |||
| 1224 | Ga0070691_10122319 | |||
| 1225 | Ga0070691_10193669 | |||
| 1226 | Ga0070687_100075234 | |||
| 1227 | Ga0070687_100128508 | |||
| 1228 | Ga0070661_100014032 | |||
| 1229 | Ga0070661_100092587 | |||
| 1230 | Ga0070661_100133575 | |||
| 1231 | Ga0070661_100152288 | |||
| 1232 | Ga0070661_100728484 | |||
| 1233 | Ga0070692_10029463 | |||
| 1234 | Ga0070692_10047881 | |||
| 1235 | Ga0070692_10122068 | |||
| 1236 | Ga0070692_10414574 | |||
| 1237 | Ga0070668_100012259 | |||
| 1238 | Ga0070668_100275474 | |||
| 1239 | Ga0070669_100479785 | |||
| 1240 | Ga0070675_100010174 | |||
| 1241 | Ga0070675_100029856 | |||
| 1242 | Ga0070675_100032976 | |||
| 1243 | Ga0070675_100053892 | |||
| 1244 | Ga0070675_100201152 | |||
| 1245 | Ga0070671_100091611 | |||
| 1246 | Ga0070671_100159545 | |||
| 1247 | Ga0070671_100301755 | |||
| 1248 | Ga0070671_100414692 | |||
| 1249 | Ga0070674_100015824 | |||
| 1250 | Ga0070674_100019120 | |||
| 1251 | Ga0070674_100019153 | |||
| 1252 | Ga0070674_100043387 | |||
| 1253 | Ga0070674_100142421 | |||
| 1254 | Ga0070673_100062762 | |||
| 1255 | Ga0070673_100211907 | |||
| 1256 | Ga0070673_100922438 | |||
| 1257 | Ga0070688_100002799 | |||
| 1258 | Ga0070688_100003836 | |||
| 1259 | Ga0070688_100006907 | |||
| 1260 | Ga0070688_100672043 | |||
| 1261 | Ga0070659_100014825 | |||
| 1262 | Ga0070659_100047003 | |||
| 1263 | Ga0070659_100156837 | |||
| 1264 | Ga0070659_100380009 | |||
| 1265 | Ga0070659_100669995 | |||
| 1266 | Ga0070703_10135765 | |||
| 1267 | Ga0070701_10013500 | |||
| 1268 | Ga0070701_10017099 | |||
| 1269 | Ga0070701_10048033 | |||
| 1270 | Ga0070701_10078903 | |||
| 1271 | Ga0070705_100040177 | |||
| 1272 | Ga0070705_100265730 | |||
| 1273 | Ga0070700_100036179 | |||
| 1274 | Ga0070700_100055466 | |||
| 1275 | Ga0070700_100131831 | |||
| 1276 | Ga0070694_100714969 | |||
| 1277 | Ga0070678_100011153 | |||
| 1278 | Ga0070678_100142667 | |||
| 1279 | Ga0070678_100442723 | |||
| 1280 | Ga0070678_100670693 | |||
| 1281 | Ga0070662_100002641 | |||
| 1282 | Ga0070662_100038958 | |||
| 1283 | Ga0070662_100422723 | |||
| 1284 | Ga0070681_10055522 | |||
| 1285 | Ga0070681_10101363 | |||
| 1286 | Ga0070681_10383742 | |||
| 1287 | Ga0068867_100009644 | |||
| 1288 | Ga0068867_100031551 | |||
| 1289 | Ga0068867_100052688 | |||
| 1290 | Ga0068867_100131312 | |||
| 1291 | Ga0068867_100149059 | |||
| 1292 | Ga0068867_100256647 | |||
| 1293 | Ga0070685_10051549 | |||
| 1294 | Ga0070685_10054937 | |||
| 1295 | Ga0070685_10076741 | |||
| 1296 | Ga0070707_100363228 | |||
| 1297 | Ga0070707_100577446 | |||
| 1298 | Ga0070698_100071396 | |||
| 1299 | Ga0070679_100009974 | |||
| 1300 | Ga0070679_100072153 | |||
| 1301 | Ga0070679_100163418 | |||
| 1302 | Ga0070684_100012891 | |||
| 1303 | Ga0070684_100032453 | |||
| 1304 | Ga0070684_100035997 | |||
| 1305 | Ga0070684_100036248 | |||
| 1306 | Ga0070684_100052634 | |||
| 1307 | Ga0070684_100114159 | |||
| 1308 | Ga0070684_100131796 | |||
| 1309 | Ga0070684_100153885 | |||
| 1310 | Ga0070684_100299901 | |||
| 1311 | Ga0070684_100345313 | |||
| 1312 | Ga0068853_100063858 | |||
| 1313 | Ga0068853_100070313 | |||
| 1314 | Ga0070672_100038700 | |||
| 1315 | Ga0070672_100063464 | |||
| 1316 | Ga0070672_100068879 | |||
| 1317 | Ga0070672_100659057 | |||
| 1318 | Ga0070686_100012648 | |||
| 1319 | Ga0070686_100042346 | |||
| 1320 | Ga0070686_100177552 | |||
| 1321 | Ga0070686_100984453 | |||
| 1322 | Ga0070695_100020417 | |||
| 1323 | Ga0070695_100049615 | |||
| 1324 | Ga0070695_100134261 | |||
| 1325 | Ga0070695_100440034 | |||
| 1326 | Ga0070696_100044339 | |||
| 1327 | Ga0070696_100050831 | |||
| 1328 | Ga0070696_100073026 | |||
| 1329 | Ga0070696_100120356 | |||
| 1330 | Ga0070696_100187549 | |||
| 1331 | Ga0070693_100012465 | |||
| 1332 | Ga0070693_100034757 | |||
| 1333 | Ga0070693_100066309 | |||
| 1334 | Ga0070693_100162485 | |||
| 1335 | Ga0070693_100624574 | |||
| 1336 | Ga0070665_100074294 | |||
| 1337 | Ga0070665_100133125 | |||
| 1338 | Ga0070665_100178830 | |||
| 1339 | Ga0070704_100020903 | |||
| 1340 | Ga0070704_100029456 | |||
| 1341 | Ga0070704_100059213 | |||
| 1342 | Ga0070704_100095398 | |||
| 1343 | Ga0070704_100234986 | |||
| 1344 | Ga0068855_100073422 | |||
| 1345 | Ga0068855_100164335 | |||
| 1346 | Ga0068855_100372779 | |||
| 1347 | Ga0070664_100026590 | |||
| 1348 | Ga0070664_100028840 | |||
| 1349 | Ga0070664_100065856 | |||
| 1350 | Ga0070664_100199859 | |||
| 1351 | Ga0068857_100164638 | |||
| 1352 | Ga0068857_100263390 | |||
| 1353 | Ga0068857_100264741 | |||
| 1354 | Ga0068857_100335282 | |||
| 1355 | Ga0068857_100357923 | |||
| 1356 | Ga0068857_100461603 | |||
| 1357 | Ga0068854_100061393 | |||
| 1358 | Ga0068854_100098863 | |||
| 1359 | Ga0068856_100073341 | |||
| 1360 | Ga0068856_100218403 | |||
| 1361 | Ga0070702_100018607 | |||
| 1362 | Ga0070702_100209306 | |||
| 1363 | Ga0070702_100257818 | |||
| 1364 | Ga0068852_100409244 | |||
| 1365 | Ga0068852_100445146 | |||
| 1366 | Ga0068859_100037113 | |||
| 1367 | Ga0068859_100054125 | |||
| 1368 | Ga0068859_100062509 | |||
| 1369 | Ga0068864_100107532 | |||
| 1370 | Ga0068866_10040244 | |||
| 1371 | Ga0068866_10060668 | |||
| 1372 | Ga0068866_10061852 | |||
| 1373 | Ga0068861_100001783 | |||
| 1374 | Ga0068861_100014938 | |||
| 1375 | Ga0068861_100018490 | |||
| 1376 | Ga0068861_100381177 | |||
| 1377 | Ga0068861_100654943 | |||
| 1378 | Ga0068851_10412210 | |||
| 1379 | Ga0068870_10013596 | |||
| 1380 | Ga0068870_10018387 | |||
| 1381 | Ga0068870_10248053 | |||
| 1382 | Ga0068863_100031864 | |||
| 1383 | Ga0068863_100167584 | |||
| 1384 | Ga0068860_100033315 | |||
| 1385 | Ga0068860_100268433 | |||
| 1386 | Ga0068860_100507446 | |||
| 1387 | Ga0068860_100815868 | |||
| 1388 | Ga0068862_100548509 | |||
| 1389 | Ga0081455_10019559 | |||
| 1390 | Ga0081455_10020013 | |||
| 1391 | Ga0081455_10024399 | |||
| 1392 | Ga0081455_10421009 | |||
| 1393 | Ga0081538_10000094 | |||
| 1394 | Ga0081538_10000151 | |||
| 1395 | Ga0081538_10002077 | |||
| 1396 | Ga0081538_10003829 | |||
| 1397 | Ga0081538_10010054 | |||
| 1398 | Ga0081538_10020527 | |||
| 1399 | Ga0081540_1014346 | |||
| 1400 | Ga0081539_10000200 | |||
| 1401 | Ga0081539_10000397 | |||
| 1402 | Ga0070717_10033890 | |||
| 1403 | Ga0070717_11128852 | |||
| 1404 | Ga0075365_10156996 | |||
| 1405 | Ga0075365_10230865 | |||
| 1406 | Ga0075364_10074048 | |||
| 1407 | Ga0075364_10104093 | |||
| 1408 | Ga0075364_10316452 | |||
| 1409 | Ga0075432_10003491 | |||
| 1410 | Ga0075432_10053088 | |||
| 1411 | Ga0070715_10130771 | |||
| 1412 | Ga0070712_100477707 | |||
| 1413 | Ga0075362_10154240 | |||
| 1414 | Ga0097621_100910277 | |||
| 1415 | Ga0068871_100359882 | |||
| 1416 | Ga0068871_100370812 | |||
| 1417 | Ga0075428_100037530 | |||
| 1418 | Ga0075428_100180483 | |||
| 1419 | Ga0075428_100299372 | |||
| 1420 | Ga0075428_100331976 | |||
| 1421 | Ga0075428_100455763 | |||
| 1422 | Ga0075428_101045410 | |||
| 1423 | Ga0075428_101585647 | |||
| 1424 | Ga0075430_100049513 | |||
| 1425 | Ga0075430_100058265 | |||
| 1426 | Ga0075431_100008692 | |||
| 1427 | Ga0075431_100051547 | |||
| 1428 | Ga0075431_100233704 | |||
| 1429 | Ga0075433_10034898 | |||
| 1430 | Ga0075433_10043840 | |||
| 1431 | Ga0075433_10052279 | |||
| 1432 | Ga0075433_10212346 | |||
| 1433 | Ga0075433_10235240 | |||
| 1434 | Ga0075434_100003398 | |||
| 1435 | Ga0075434_100042219 | |||
| 1436 | Ga0075434_100049702 | |||
| 1437 | Ga0075434_100056902 | |||
| 1438 | Ga0075434_100077917 | |||
| 1439 | Ga0075434_100546095 | |||
| 1440 | Ga0075429_100062846 | |||
| 1441 | Ga0075429_100104768 | |||
| 1442 | Ga0075429_100138319 | |||
| 1443 | Ga0075429_100173429 | |||
| 1444 | Ga0075429_100452785 | |||
| 1445 | Ga0075429_100695599 | |||
| 1446 | Ga0068865_100011940 | |||
| 1447 | Ga0068865_100037576 | |||
| 1448 | Ga0068865_100056517 | |||
| 1449 | Ga0068865_100097545 | |||
| 1450 | Ga0068865_100197248 | |||
| 1451 | Ga0068865_100676185 | |||
| 1452 | Ga0075436_100059443 | |||
| 1453 | Ga0075436_100522717 | |||
| 1454 | Ga0097620_100037113 | |||
| 1455 | Ga0097620_100054125 | |||
| 1456 | Ga0097620_100062508 | |||
| 1457 | Ga0075435_100012793 | |||
| 1458 | Ga0075435_100409045 | |||
| 1459 | Ga0105240_10024285 | |||
| 1460 | Ga0105240_10042861 | |||
| 1461 | Ga0111539_10008714 | |||
| 1462 | Ga0111539_10151517 | |||
| 1463 | Ga0111539_10153773 | |||
| 1464 | Ga0111539_10165941 | |||
| 1465 | Ga0111539_10282661 | |||
| 1466 | Ga0111539_10352157 | |||
| 1467 | Ga0111539_10416492 | |||
| 1468 | Ga0105245_10070989 | |||
| 1469 | Ga0105245_10165862 | |||
| 1470 | Ga0105245_10185696 | |||
| 1471 | Ga0105245_10230601 | |||
| 1472 | Ga0105245_10606230 | |||
| 1473 | Ga0114129_10008166 | |||
| 1474 | Ga0114129_10031268 | |||
| 1475 | Ga0114129_10141390 | |||
| 1476 | Ga0114129_10157426 | |||
| 1477 | Ga0114129_10291515 | |||
| 1478 | Ga0114129_10681671 | |||
| 1479 | Ga0114129_11236421 | |||
| 1480 | Ga0114129_11672445 | |||
| 1481 | Ga0105243_10007592 | |||
| 1482 | Ga0105243_10077699 | |||
| 1483 | Ga0105243_10087909 | |||
| 1484 | Ga0105243_10139040 | |||
| 1485 | Ga0105241_10227272 | |||
| 1486 | Ga0105242_10073834 | |||
| 1487 | Ga0105242_10159104 | |||
| 1488 | Ga0105242_10860060 | |||
| 1489 | Ga0105242_10864420 | |||
| 1490 | Ga0105248_10105467 | |||
| 1491 | Ga0105248_10272386 | |||
| 1492 | Ga0105248_10700432 | |||
| 1493 | Ga0105238_10118379 | |||
| 1494 | Ga0105238_10145128 | |||
| 1495 | Ga0105238_10523943 | |||
| 1496 | Ga0105249_10001703 | |||
| 1497 | Ga0105249_10144708 | |||
| 1498 | Ga0105030_105611 | |||
| 1499 | Ga0105239_10053016 | |||
| 1500 | Ga0105239_10082737 | |||
| 1501 | Ga0105239_10083336 | |||
| 1502 | Ga0105239_10096795 | |||
| 1503 | Ga0105239_10145998 | |||
| 1504 | Ga0105246_10040213 | |||
| 1505 | Ga0105246_10097572 | |||
| 1506 | Ga0105246_10339793 | |||
| 1507 | Ga0157313_1013765 | |||
| 1508 | Ga0157326_1019773 | |||
| 1509 | Ga0157373_10454209 | |||
| 1510 | Ga0157371_10020304 | |||
| 1511 | Ga0157371_10024782 | |||
| 1512 | Ga0157371_10241373 | |||
| 1513 | Ga0157370_10091450 | |||
| 1514 | Ga0157370_10238397 | |||
| 1515 | Ga0157369_10186118 | |||
| 1516 | Ga0157369_10233037 | |||
| 1517 | Ga0157369_10409251 | |||
| 1518 | Ga0157378_10378108 | |||
| 1519 | Ga0157378_10380363 | |||
| 1520 | Ga0157378_10472205 | |||
| 1521 | Ga0163162_10188658 | |||
| 1522 | Ga0163162_10527246 | |||
| 1523 | Ga0163162_10548075 | |||
| 1524 | Ga0157372_10258409 | |||
| 1525 | Ga0157372_10350676 | |||
| 1526 | Ga0157372_10397006 | |||
| 1527 | Ga0157375_10142125 | |||
| 1528 | Ga0163163_10044422 | |||
| 1529 | Ga0163163_10096782 | |||
| 1530 | Ga0163163_11214996 | |||
| 1531 | Ga0157380_10006119 | |||
| 1532 | Ga0157380_10028368 | |||
| 1533 | Ga0157380_10037771 | |||
| 1534 | Ga0157380_10156439 | |||
| 1535 | Ga0182008_10028595 | |||
| 1536 | Ga0182008_10474710 | |||
| 1537 | Ga0157377_10026140 | |||
| 1538 | Ga0157377_10047370 | |||
| 1539 | Ga0157377_10070458 | |||
| 1540 | Ga0157376_10062225 | |||
| 1541 | Ga0157376_10289248 | |||
| 1542 | Ga0157376_10335002 | |||
| 1543 | Ga0182006_1004688 | |||
| 1544 | Ga0182007_10030600 | |||
| 1545 | Ga0163161_10043707 | |||
| 1546 | Ga0163161_10123803 | |||
| 1547 | Ga0163161_10297645 | |||
| 1548 | Ga0206356_10084031 | |||
| 1549 | Ga0206356_11880732 | |||
| 1550 | Ga0206353_10050886 | |||
| 1551 | Ga0224712_10048328 | |||
| 1552 | Ga0207656_10004884 | |||
| 1553 | Ga0207653_10041888 | |||
| 1554 | Ga0207682_10069089 | |||
| 1555 | Ga0207642_10010501 | |||
| 1556 | Ga0207642_10096570 | |||
| 1557 | Ga0207642_10481324 | |||
| 1558 | Ga0207688_10008842 | |||
| 1559 | Ga0207688_10009411 | |||
| 1560 | Ga0207688_10087309 | |||
| 1561 | Ga0207680_10392933 | |||
| 1562 | Ga0207645_10021117 | |||
| 1563 | Ga0207645_10217501 | |||
| 1564 | Ga0207645_10473928 | |||
| 1565 | Ga0207643_10023824 | |||
| 1566 | Ga0207643_10097326 | |||
| 1567 | Ga0207705_10058502 | |||
| 1568 | Ga0207705_10177987 | |||
| 1569 | Ga0207654_10215489 | |||
| 1570 | Ga0207707_10019074 | |||
| 1571 | Ga0207707_10065796 | |||
| 1572 | Ga0207707_10116061 | |||
| 1573 | Ga0207707_10588923 | |||
| 1574 | Ga0207695_10051159 | |||
| 1575 | Ga0207695_10091830 | |||
| 1576 | Ga0207695_10223643 | |||
| 1577 | Ga0207671_10540763 | |||
| 1578 | Ga0207660_10051209 | |||
| 1579 | Ga0207660_10062318 | |||
| 1580 | Ga0207662_10001652 | |||
| 1581 | Ga0207662_10049973 | |||
| 1582 | Ga0207662_10157319 | |||
| 1583 | Ga0207657_10047922 | |||
| 1584 | Ga0207657_10062709 | |||
| 1585 | Ga0207657_10351552 | |||
| 1586 | Ga0207649_10034215 | |||
| 1587 | Ga0207649_10036899 | |||
| 1588 | Ga0207649_10207444 | |||
| 1589 | Ga0207652_10091551 | |||
| 1590 | Ga0207652_10120752 | |||
| 1591 | Ga0207652_10128926 | |||
| 1592 | Ga0207652_10531914 | |||
| 1593 | Ga0207652_10541974 | |||
| 1594 | Ga0207646_10297273 | |||
| 1595 | Ga0207694_10068868 | |||
| 1596 | Ga0207650_10116148 | |||
| 1597 | Ga0207650_10336934 | |||
| 1598 | Ga0207659_10035304 | |||
| 1599 | Ga0207659_10038607 | |||
| 1600 | Ga0207659_10176832 | |||
| 1601 | Ga0207687_10021592 | |||
| 1602 | Ga0207687_10052606 | |||
| 1603 | Ga0207687_10094793 | |||
| 1604 | Ga0207687_10285804 | |||
| 1605 | Ga0207687_10503691 | |||
| 1606 | Ga0207687_10651970 | |||
| 1607 | Ga0207687_10737837 | |||
| 1608 | Ga0207687_10802473 | |||
| 1609 | Ga0207700_10166368 | |||
| 1610 | Ga0207644_10055976 | |||
| 1611 | Ga0207644_10477791 | |||
| 1612 | Ga0207690_10035342 | |||
| 1613 | Ga0207690_10119273 | |||
| 1614 | Ga0207690_10322678 | |||
| 1615 | Ga0207706_10014850 | |||
| 1616 | Ga0207706_10023330 | |||
| 1617 | Ga0207706_10121780 | |||
| 1618 | Ga0207686_10044037 | |||
| 1619 | Ga0207686_10451955 | |||
| 1620 | Ga0207709_10045396 | |||
| 1621 | Ga0207709_10239659 | |||
| 1622 | Ga0207670_10000052 | |||
| 1623 | Ga0207670_10000777 | |||
| 1624 | Ga0207670_10025700 | |||
| 1625 | Ga0207670_10135836 | |||
| 1626 | Ga0207670_10433240 | |||
| 1627 | Ga0207670_10564853 | |||
| 1628 | Ga0207669_10003761 | |||
| 1629 | Ga0207669_10076033 | |||
| 1630 | Ga0207669_10255242 | |||
| 1631 | Ga0207669_10568350 | |||
| 1632 | Ga0207704_10019975 | |||
| 1633 | Ga0207704_10136732 | |||
| 1634 | Ga0207704_10238284 | |||
| 1635 | Ga0207704_10532197 | |||
| 1636 | Ga0207665_10244925 | |||
| 1637 | Ga0207691_10019105 | |||
| 1638 | Ga0207691_10029091 | |||
| 1639 | Ga0207691_10228596 | |||
| 1640 | Ga0207711_10555238 | |||
| 1641 | Ga0207711_10594829 | |||
| 1642 | Ga0207689_10082876 | |||
| 1643 | Ga0207689_10156467 | |||
| 1644 | Ga0207661_10008048 | |||
| 1645 | Ga0207661_10011136 | |||
| 1646 | Ga0207661_10067021 | |||
| 1647 | Ga0207661_10123849 | |||
| 1648 | Ga0207661_10143474 | |||
| 1649 | Ga0207661_10197640 | |||
| 1650 | Ga0207661_10233264 | |||
| 1651 | Ga0207661_10239136 | |||
| 1652 | Ga0207679_10063384 | |||
| 1653 | Ga0207712_10210894 | |||
| 1654 | Ga0207668_10228891 | |||
| 1655 | Ga0207640_10057756 | |||
| 1656 | Ga0207640_10076561 | |||
| 1657 | Ga0207677_10064996 | |||
| 1658 | Ga0207703_10130773 | |||
| 1659 | Ga0207639_10026202 | |||
| 1660 | Ga0207639_10701097 | |||
| 1661 | Ga0207639_11171886 | |||
| 1662 | Ga0207678_10027460 | |||
| 1663 | Ga0207708_10016026 | |||
| 1664 | Ga0207708_10018968 | |||
| 1665 | Ga0207708_10149854 | |||
| 1666 | Ga0207708_10160573 | |||
| 1667 | Ga0207702_10002686 | |||
| 1668 | Ga0207702_10111718 | |||
| 1669 | Ga0207702_10223196 | |||
| 1670 | Ga0207702_10262571 | |||
| 1671 | Ga0207702_10367529 | |||
| 1672 | Ga0207641_10510158 | |||
| 1673 | Ga0207641_10514303 | |||
| 1674 | Ga0207641_10592034 | |||
| 1675 | Ga0207648_10020479 | |||
| 1676 | Ga0207648_10024817 | |||
| 1677 | Ga0207648_10148217 | |||
| 1678 | Ga0207648_10894249 | |||
| 1679 | Ga0207676_10495474 | |||
| 1680 | Ga0207674_10018407 | |||
| 1681 | Ga0207674_10244635 | |||
| 1682 | Ga0207674_10342728 | |||
| 1683 | Ga0207675_100094141 | |||
| 1684 | Ga0207675_100235336 | |||
| 1685 | Ga0207675_100550530 | |||
| 1686 | Ga0207683_10102758 | |||
| 1687 | Ga0207683_10192287 | |||
| 1688 | Ga0207683_10266846 | |||
| 1689 | Ga0207683_10611988 | |||
| 1690 | Ga0207698_10370522 | |||
| 1691 | Ga0207698_10399380 | |||
| 1692 | Ga0209966_1022570 | |||
| 1693 | Ga0207428_10000244 | |||
| 1694 | Ga0207428_10002045 | |||
| 1695 | Ga0207428_10024681 | |||
| 1696 | Ga0207428_10152785 | |||
| 1697 | Ga0207428_10261848 | |||
| 1698 | Ga0207428_10295653 | |||
| 1699 | Ga0207428_10339465 | |||
| 1700 | Ga0268266_10184650 | |||
| 1701 | Ga0268264_10034622 | |||
| 1702 | Ga0268264_10154438 | |||
| 1703 | Ga0268264_10473808 | |||
| 1704 | Ga0265318_10118696 | |||
| 1705 | Ga0307408_100173813 | |||
| 1706 | Ga0316579_10026338 | |||
| 1707 | Ga0316576_10030962 | |||
| 1708 | Ga0316576_10083098 | |||
| 1709 | Ga0316577_10070157 | |||
| 1710 | Ga0307406_10184411 | |||
| 1711 | Ga0307406_10259522 | |||
| 1712 | Ga0307409_100113545 | |||
| 1713 | Ga0307409_100382576 | |||
| 1714 | Ga0307409_100388677 | |||
| 1715 | Ga0307416_100018953 | |||
| 1716 | Ga0307416_100089230 | |||
| 1717 | Ga0307416_100159843 | |||
| 1718 | Ga0307416_100300479 | |||
| 1719 | Ga0307416_100875152 | |||
| 1720 | Ga0307415_100010159 | |||
| 1721 | Ga0307415_100221916 | |||
| 1722 | Ga0307415_100405872 | |||
| 1723 | Ga0316583_10016988 | |||
| 1724 | Ga0373926_0002828 | |||
| 1725 | Ga0373934_0004376 | |||
| 1726 | Ga0373951_0158762 | |||
| 1727 | Ga0373923_0044557 | |||
| 1728 | Ga0373932_0077724 | |||
| 1729 | Ga0373936_0010863 | |||
| 1730 | Ga0373936_0033664 | |||
| 1731 | Ga0373945_0007197 | |||
| 1732 | Ga0373953_0009792 | |||
| 1733 | Ga0373954_0045875 | |||
| 1734 | Ga0373957_0023325 | |||
| 1735 | Ga0373960_0086460 | |||
| 1736 | Ga0373943_0009843 | |||
| 1737 | Ga0373955_0068140 | |||
| 1738 | Ga0373955_0201197 | |||
| 1739 | Ga0373961_0016184 | |||
| 1740 | Ga0316574_0027625 | |||
| 1741 | Ga0373924_0101064 | |||
| 1742 | Ga0373931_0171421 | |||
| 1743 | Ga0373935_0004795 | |||
| 1744 | Ga0373927_0040183 | |||
| 1745 | Ga0373933_0126517 | |||
| 1746 | Ga0373947_0013853 | |||
| 1747 | Ga0373937_0475269 | |||
| 1748 | Ga0373937_0716547 | |||
| 1749 | Ga0316582_0079478 | |||
| 1750 | Ga0316584_0038711 | |||
| 1751 | Ga0373925_0009138 | |||
| 1752 | Ga0373925_0411666 | |||
| 1753 | Ga0395899_0006920 | |||
| 1754 | Ga0395899_0053365 | |||
| 1755 | Ga0395899_0060250 | |||
| 1756 | Ga0395899_0072888 | |||
| 1757 | Ga0395899_0179523 | |||
| 1758 | Ga0395900_0003521 | |||
| 1759 | Ga0395900_0007081 | |||
| 1760 | Ga0395900_0025290 | |||
| 1761 | Ga0395900_0068849 | |||
| 1762 | Ga0395900_0076480 | |||
| 1763 | Ga0395900_0077244 | |||
| 1764 | Ga0395900_0131987 | |||
| 1765 | Ga0395900_0147983 | |||
| 1766 | Ga0395900_0149858 | |||
| 1767 | Ga0395900_0171873 | |||
| 1768 | Ga0395900_0264495 | |||
| 1769 | Ga0395900_0791248 | |||
| 1770 | Ga0395898_0001875 | |||
| 1771 | Ga0395898_0003526 | |||
| 1772 | Ga0395898_0010231 | |||
| 1773 | Ga0395898_0043221 | |||
| 1774 | Ga0395898_0076766 | |||
| 1775 | Ga0395898_0155222 | |||
| 1776 | Ga0395898_0256253 | |||
| 1777 | Ga0395905_0009915 | |||
| 1778 | Ga0395905_0018552 | |||
| 1779 | Ga0395905_0021602 | |||
| 1780 | Ga0395905_0031768 | |||
| 1781 | Ga0395905_0174934 | |||
| 1782 | Ga0395905_0189838 | |||
| 1783 | Ga0395905_0235815 | |||
| 1784 | Ga0395905_0250761 | |||
| 1785 | Ga0395905_0530987 | |||
| 1786 | Ga0395901_0005796 | |||
| 1787 | Ga0395901_0012794 | |||
| 1788 | Ga0395901_0019001 | |||
| 1789 | Ga0395901_0033883 | |||
| 1790 | Ga0395901_0039047 | |||
| 1791 | Ga0395901_0049656 | |||
| 1792 | Ga0395901_0110917 | |||
| 1793 | Ga0395901_0131367 | |||
| 1794 | Ga0395901_0161010 | |||
| 1795 | Ga0395901_0175304 | |||
| 1796 | Ga0395901_0291492 | |||
| 1797 | Ga0395901_0517645 | |||
| 1798 | Ga0395901_1265605 | |||
| 1799 | Ga0439439_0036238 | |||
| 1800 | Ga0439453_0010973 | |||
| 1801 | Ga0439453_0035155 | |||
| 1802 | Ga0439461_0075232 | |||
| 1803 | Ga0439465_0138089 | |||
| 1804 | Ga0451833_0318449 | |||
| 1805 | Ga0439448_0016418 | |||
| 1806 | Ga0439448_0022619 | |||
| 1807 | Ga0439451_006592 | |||
| 1808 | Ga0439454_012450 | |||
| 1809 | Ga0439455_0086155 | |||
| 1810 | Ga0450917_009464 | |||
| 1811 | Ga0450920_002965 | |||
| 1812 | Ga0450908_012972 | |||
| 1813 | Ga0439434_0002257 | |||
| 1814 | Ga0439434_0005571 | |||
| 1815 | Ga0451577_0082678 | |||
| 1816 | Ga0439440_0066013 | |||
| 1817 | Ga0453683_0313693 | |||
| 1818 | Ga0466961_0136624 | |||
| 1819 | Ga0466963_0004083 | |||
| 1820 | Ga0466963_0007021 | |||
| 1821 | Ga0466964_0003226 | |||
| 1822 | Ga0466964_0018741 | |||
| 1823 | Ga0466971_0100910 | |||
| 1824 | Ga0466957_0037743 | |||
| 1825 | Ga0466959_0126321 | |||
| 1826 | Ga0466959_0129058 | |||
| 1827 | Ga0466959_0459360 | |||
| 1828 | Ga0451576_0036687 | |||
| 1829 | Ga0451576_0207766 | |||
| 1830 | Ga0451576_0610396 | |||
| 1831 | Ga0466958_0016722 | |||
| 1832 | Ga0466958_0018150 | |||
| 1833 | Ga0466958_0100734 | |||
| 1834 | Ga0466958_0115111 | |||
| 1835 | Ga0466967_0001509 | |||
| 1836 | Ga0466967_0005611 | |||
| 1837 | Ga0466967_0019707 | |||
| 1838 | Ga0466967_0030118 | |||
| 1839 | Ga0466967_0085632 | |||
| 1840 | Ga0466967_0109832 | |||
| 1841 | Ga0466967_0172737 | |||
| 1842 | Ga0495592_0030764 | |||
| 1843 | Ga0495592_0083751 | |||
| 1844 | Ga0495603_0001553 | |||
| 1845 | Ga0495603_0056192 | |||
| 1846 | Ga0495629_0015834 | |||
| 1847 | Ga0495629_0017118 | |||
| 1848 | Ga0495641_0006144 | |||
| 1849 | Ga0495641_0018268 | |||
| 1850 | Ga0495641_0055031 | |||
| 1851 | Ga0495651_0075246 | |||
| 1852 | Ga0495653_0071927 | |||
| 1853 | Ga0495653_0076872 | |||
| 1854 | Ga0495653_0312923 | |||
| 1855 | Ga0495580_0040825 | |||
| 1856 | Ga0495582_0019456 | |||
| 1857 | Ga0495582_0095964 | |||
| 1858 | Ga0495582_0116151 | |||
| 1859 | Ga0495639_0000940 | |||
| 1860 | Ga0495662_0003702 | |||
| 1861 | Ga0495662_0122714 | |||
| 1862 | Ga0495662_0140224 | |||
| 1863 | Ga0495664_0002895 | |||
| 1864 | Ga0495584_0261278 | |||
| 1865 | Ga0495585_0071464 | |||
| 1866 | Ga0495585_0245198 | |||
| 1867 | Ga0495594_0026783 | |||
| 1868 | Ga0495594_0554544 | |||
| 1869 | Ga0495596_0063221 | |||
| 1870 | Ga0495607_0019928 | |||
| 1871 | Ga0495607_0094681 | |||
| 1872 | Ga0495583_0078167 | |||
| 1873 | Ga0495608_0026855 | |||
| 1874 | Ga0495608_0526550 | |||
| 1875 | Ga0495618_0018778 | |||
| 1876 | Ga0495618_0220062 | |||
| 1877 | Ga0495620_0111986 | |||
| 1878 | Ga0495628_0002036 | |||
| 1879 | Ga0495628_0422590 | |||
| 1880 | Ga0495630_0006996 | |||
| 1881 | Ga0495630_0161658 | |||
| 1882 | Ga0495630_0510023 | |||
| 1883 | Ga0495631_0065169 | |||
| 1884 | Ga0495631_0100357 | |||
| 1885 | Ga0495632_0106660 | |||
| 1886 | Ga0495643_0104599 | |||
| 1887 | Ga0495644_0007305 | |||
| 1888 | Ga0495644_0028436 | |||
| 1889 | Ga0495644_0054087 | |||
| 1890 | Ga0495663_0009173 | |||
| 1891 | Ga0495663_0036115 | |||
| 1892 | Ga0495663_0046973 | |||
| 1893 | Ga0495642_0014764 | |||
| 1894 | Ga0495652_0013477 | |||
| 1895 | Ga0495652_0536426 | |||
| 1896 | Ga0495665_0008331 | |||
| 1897 | Ga0495665_0126695 | |||
| 1898 | Ga0495640_0280278 | |||
| 1899 | Ga0495586_0160449 | |||
| 1900 | Ga0495587_0008664 | |||
| 1901 | Ga0495598_0040133 | |||
| 1902 | Ga0495598_0277942 | |||
| 1903 | Ga0495609_0173616 | |||
| 1904 | Ga0495645_0146772 | |||
| 1905 | Ga0495622_0217704 | |||
| 1906 | Ga0495633_0109201 | |||
| 1907 | Ga0495633_0326841 | |||
| 1908 | Ga0495667_0053928 | |||
| 1909 | Ga0495656_0023330 | |||
| 1910 | Ga0495656_0143687 | |||
| 1911 | Ga0495656_0321457 | |||
| 1912 | Ga0495668_0079107 | |||
| 1913 | Ga0495668_0124740 | |||
| 1914 | Ga0495634_0056818 | |||
| 1915 | Ga0495634_0072110 | |||
| 1916 | Ga0495611_0321477 | |||
| 1917 | Ga0495635_0114065 | |||
| 1918 | Ga0495659_0049711 | |||
| 1919 | Ga0495588_0020546 | |||
| 1920 | Ga0495588_0082313 | |||
| 1921 | Ga0495588_0278713 | |||
| 1922 | Ga0495657_0028530 | |||
| 1923 | Ga0495599_0005910 | |||
| 1924 | Ga0495599_0068382 | |||
| 1925 | Ga0495646_0048008 | |||
| 1926 | Ga0495647_0001137 | |||
| 1927 | Ga0495647_0172560 | |||
| 1928 | Ga0495647_0304322 | |||
| 1929 | Ga0495658_0013456 | |||
| 1930 | Ga0495658_0157670 | |||
| 1931 | Ga0495658_0492201 | |||
| 1932 | Ga0495669_0164862 | |||
| 1933 | Ga0495613_0030077 | |||
| 1934 | Ga0495613_0191383 | |||
| 1935 | Ga0495613_0519700 | |||
| 1936 | Ga0495624_0023432 | |||
| 1937 | Ga0495624_0115042 | |||
| 1938 | Ga0495670_0104413 | |||
| 1939 | Ga0495670_0361764 | |||
| 1940 | Ga0495671_0103718 | |||
| 1941 | Ga0495671_0215173 | |||
| 1942 | Ga0495671_0374920 | |||
| 1943 | Ga0495649_0086044 | |||
| 1944 | Ga0495589_0009382 | |||
| 1945 | Ga0495600_0002357 | |||
| 1946 | Ga0495600_0036004 | |||
| 1947 | Ga0495600_0071657 | |||
| 1948 | Ga0495600_0194137 | |||
| 1949 | Ga0495581_0005927 | |||
| 1950 | Ga0495581_0021131 | |||
| 1951 | Ga0495581_0242385 | |||
| 1952 | Ga0495674_0008898 | |||
| 1953 | Ga0495676_0012449 | |||
| 1954 | Ga0495676_0017472 | |||
| 1955 | Ga0495676_0091963 | |||
| 1956 | Ga0495676_0213757 | |||
| 1957 | Ga0495680_0011101 | |||
| 1958 | Ga0495680_0047141 | |||
| 1959 | Ga0495680_0112992 | |||
| 1960 | Ga0495680_0117346 | |||
| 1961 | Ga0495680_0208155 | |||
| 1962 | Ga0495680_0449852 | |||
| 1963 | Ga0495675_0000882 | |||
| 1964 | Ga0495684_0098366 | |||
| 1965 | Ga0495686_0000011 | |||
| 1966 | Ga0495686_0002398 | |||
| 1967 | Ga0495686_0167016 | |||
| 1968 | Ga0495593_0002580 | |||
| 1969 | Ga0495593_0123439 | |||
| 1970 | Ga0495614_0000773 | |||
| 1971 | Ga0496100_0196817 | |||
| 1972 | Ga0496100_0690036 | |||
| 1973 | Ga0496100_0715685 | |||
| 1974 | Ga0496101_0101553 | |||
| 1975 | Ga0496101_0153693 | |||
| 1976 | Ga0496101_0180949 | |||
| 1977 | Ga0496101_0328634 | |||
| 1978 | Ga0496101_0569098 | |||
| 1979 | Ga0496102_0113361 | |||
| 1980 | Ga0496102_0146780 | |||
| 1981 | Ga0496102_0152760 | |||
| 1982 | Ga0496102_0248176 | |||
| 1983 | Ga0496102_0339508 | |||
| 1984 | Ga0496102_0364792 | |||
| 1985 | Ga0496102_0520467 | |||
| 1986 | Ga0496103_0156516 | |||
| 1987 | Ga0496104_0000557 | |||
| 1988 | Ga0496104_0071520 | |||
| 1989 | Ga0496104_0084121 | |||
| 1990 | Ga0496104_0086130 | |||
| 1991 | Ga0496104_0201139 | |||
| 1992 | Ga0496104_0439610 | |||
| 1993 | Ga0496105_0000609 | |||
| 1994 | Ga0496105_0043045 | |||
| 1995 | Ga0496105_0516419 | |||
| 1996 | Ga0496106_0168578 | |||
| 1997 | Ga0496107_0049877 | |||
| 1998 | Ga0496107_0146436 | |||
| 1999 | Ga0496108_0000612 | |||
| 2000 | Ga0496108_0100392 | |||
| 2001 | Ga0496108_0154710 | |||
| 2002 | Ga0496108_0164172 | |||
| 2003 | Ga0496108_0287868 | |||
| 2004 | Ga0496109_0004344 | |||
| 2005 | Ga0496109_0042682 | |||
| 2006 | Ga0496109_0148163 | |||
| 2007 | Ga0496109_0236149 | |||
| 2008 | Ga0496109_0246642 | |||
| 2009 | Ga0496109_0294044 | |||
| 2010 | Ga0496109_0522370 | |||
| 2011 | Ga0496110_0000564 | |||
| 2012 | Ga0496110_0016135 | |||
| 2013 | Ga0496110_0026242 | |||
| 2014 | Ga0496110_0034287 | |||
| 2015 | Ga0496110_0037242 | |||
| 2016 | Ga0496110_0058251 | |||
| 2017 | Ga0496110_0255732 | |||
| 2018 | Ga0496111_0000294 | |||
| 2019 | Ga0496111_0008012 | |||
| 2020 | Ga0496111_0026530 | |||
| 2021 | Ga0496111_0181090 | |||
| 2022 | Ga0496111_0253641 | |||
| 2023 | Ga0496112_0004854 | |||
| 2024 | Ga0496112_0039578 | |||
| 2025 | Ga0496112_0051852 | |||
| 2026 | Ga0496112_0502471 | |||
| 2027 | Ga0496112_0588531 | |||
| 2028 | Ga0496113_0000414 | |||
| 2029 | Ga0496113_0039715 | |||
| 2030 | Ga0496114_0064338 | |||
| 2031 | Ga0496115_0004631 | |||
| 2032 | Ga0495678_077501 | |||
| 2033 | Ga0501031_0000033 | |||
| 2034 | Ga0501031_0074697 | |||
| 2035 | Ga0501031_0118904 | |||
| 2036 | Ga0501031_0344194 | |||
| 2037 | Ga0501032_0002047 | |||
| 2038 | Ga0501032_0058120 | |||
| 2039 | Ga0501033_0000388 | |||
| 2040 | Ga0501033_0031359 | |||
| 2041 | Ga0501033_0034644 | |||
| 2042 | Ga0501033_0077541 | |||
| 2043 | Ga0501033_0084392 | |||
| 2044 | Ga0501034_0003854 | |||
| 2045 | Ga0501034_0034552 | |||
| 2046 | Ga0501034_0074710 | |||
| 2047 | Ga0501034_0176576 | |||
| 2048 | Ga0501036_0000462 | |||
| 2049 | Ga0501036_0010142 | |||
| 2050 | Ga0501036_0013657 | |||
| 2051 | Ga0501036_0053869 | |||
| 2052 | Ga0501036_0096199 | |||
| 2053 | Ga0501036_0405892 | |||
| 2054 | Ga0501036_0461168 | |||
| 2055 | Ga0501037_0000915 | |||
| 2056 | Ga0501037_0018448 | |||
| 2057 | Ga0501037_0020177 | |||
| 2058 | Ga0501037_0033954 | |||
| 2059 | Ga0501038_0001345 | |||
| 2060 | Ga0501038_0003559 | |||
| 2061 | Ga0501038_0017214 | |||
| 2062 | Ga0501038_0474452 | |||
| 2063 | Ga0501038_0584200 | |||
| 2064 | Ga0501039_0000528 | |||
| 2065 | Ga0501039_0002890 | |||
| 2066 | Ga0501039_0004144 | |||
| 2067 | Ga0501039_0009715 | |||
| 2068 | Ga0501039_0048266 | |||
| 2069 | Ga0501039_0389578 | |||
| 2070 | Ga0501039_0842826 | |||
| 2071 | Ga0501040_0000234 | |||
| 2072 | Ga0501040_0001857 | |||
| 2073 | Ga0501040_0063098 | |||
| 2074 | Ga0501040_0063793 | |||
| 2075 | Ga0501040_0086026 | |||
| 2076 | Ga0501040_0289973 | |||
| 2077 | Ga0501041_0000176 | |||
| 2078 | Ga0501041_0001613 | |||
| 2079 | Ga0501041_0001653 | |||
| 2080 | Ga0501041_0001903 | |||
| 2081 | Ga0501041_0004551 | |||
| 2082 | Ga0501041_0022657 | |||
| 2083 | Ga0501041_0061510 | |||
| 2084 | Ga0501041_0064517 | |||
| 2085 | Ga0501041_0097119 | |||
| 2086 | Ga0501042_0001051 | |||
| 2087 | Ga0501042_0002112 | |||
| 2088 | Ga0501042_0002211 | |||
| 2089 | Ga0501042_0005399 | |||
| 2090 | Ga0501042_0012515 | |||
| 2091 | Ga0501042_0101799 | |||
| 2092 | Ga0501042_0212790 | |||
| 2093 | Ga0501043_0000798 | |||
| 2094 | Ga0501043_0010457 | |||
| 2095 | Ga0501043_0010678 | |||
| 2096 | Ga0501043_0034434 | |||
| 2097 | Ga0501043_0101721 | |||
| 2098 | Ga0501043_0320369 | |||
| 2099 | Ga0501046_0000577 | |||
| 2100 | Ga0501046_0001998 | |||
| 2101 | Ga0501046_0016228 | |||
| 2102 | Ga0501046_0028735 | |||
| 2103 | Ga0501046_0044538 | |||
| 2104 | Ga0501046_0236750 | |||
| 2105 | Ga0501047_0001088 | |||
| 2106 | Ga0501047_0237539 | |||
| 2107 | Ga0501048_0000440 | |||
| 2108 | Ga0501048_0012920 | |||
| 2109 | Ga0501048_0032679 | |||
| 2110 | Ga0501048_0038723 | |||
| 2111 | Ga0501048_0057132 | |||
| 2112 | Ga0501048_0066465 | |||
| 2113 | Ga0501048_0066490 | |||
| 2114 | Ga0501048_0214312 | |||
| 2115 | Ga0501048_0230035 | |||
| 2116 | Ga0501067_0008570 | |||
| 2117 | Ga0501067_0039241 | |||
| 2118 | Ga0501068_0000344 | |||
| 2119 | Ga0501068_0001607 | |||
| 2120 | Ga0501068_0002038 | |||
| 2121 | Ga0501068_0014068 | |||
| 2122 | Ga0501068_0022595 | |||
| 2123 | Ga0501068_0078854 | |||
| 2124 | Ga0501068_0153938 | |||
| 2125 | Ga0501068_0302637 | |||
| 2126 | Ga0501068_0441195 | |||
| 2127 | Ga0501069_0000870 | |||
| 2128 | Ga0501069_0018237 | |||
| 2129 | Ga0501069_0022470 | |||
| 2130 | Ga0501069_0028662 | |||
| 2131 | Ga0501069_0066883 | |||
| 2132 | Ga0501069_0101498 | |||
| 2133 | Ga0501069_0219852 | |||
| 2134 | Ga0501069_0295513 | |||
| 2135 | Ga0501070_0001864 | |||
| 2136 | Ga0501070_0002078 | |||
| 2137 | Ga0501070_0029634 | |||
| 2138 | Ga0501070_0048740 | |||
| 2139 | Ga0501070_0111746 | |||
| 2140 | Ga0501070_0323214 | |||
| 2141 | Ga0501070_0454328 | |||
| 2142 | Ga0501070_0906242 | |||
| 2143 | Ga0501071_0000054 | |||
| 2144 | Ga0501071_0003445 | |||
| 2145 | Ga0501071_0035122 | |||
| 2146 | Ga0501071_0037155 | |||
| 2147 | Ga0501071_0052443 | |||
| 2148 | Ga0501071_0052886 | |||
| 2149 | Ga0501071_0079638 | |||
| 2150 | Ga0501072_0001204 | |||
| 2151 | Ga0501072_0019896 | |||
| 2152 | Ga0501072_0020451 | |||
| 2153 | Ga0501072_0023725 | |||
| 2154 | Ga0501072_0045774 | |||
| 2155 | Ga0501072_0056675 | |||
| 2156 | Ga0501072_0059776 | |||
| 2157 | Ga0501072_0122676 | |||
| 2158 | Ga0501072_0186257 | |||
| 2159 | Ga0501072_0235721 | |||
| 2160 | Ga0501072_0266086 | |||
| 2161 | Ga0501073_0004823 | |||
| 2162 | Ga0501073_0017301 | |||
| 2163 | Ga0501073_0031345 | |||
| 2164 | Ga0501073_0086505 | |||
| 2165 | Ga0501073_0134345 | |||
| 2166 | Ga0501073_0209372 | |||
| 2167 | Ga0501073_0425647 | |||
| 2168 | Ga0501074_0000008 | |||
| 2169 | Ga0501074_0002959 | |||
| 2170 | Ga0501074_0025270 | |||
| 2171 | Ga0501074_0032984 | |||
| 2172 | Ga0501074_0048547 | |||
| 2173 | Ga0501074_0282191 | |||
| 2174 | Ga0501075_0000096 | |||
| 2175 | Ga0501075_0000800 | |||
| 2176 | Ga0501075_0005557 | |||
| 2177 | Ga0501075_0010477 | |||
| 2178 | Ga0501075_0078516 | |||
| 2179 | Ga0501075_0100780 | |||
| 2180 | Ga0501075_0243314 | |||
| 2181 | Ga0501075_0511208 | |||
| 2182 | Ga0501076_0000020 | |||
| 2183 | Ga0501076_0000459 | |||
| 2184 | Ga0501076_0005733 | |||
| 2185 | Ga0501076_0015181 | |||
| 2186 | Ga0501076_0029367 | |||
| 2187 | Ga0501076_0049904 | |||
| 2188 | Ga0501076_0076849 | |||
| 2189 | Ga0501076_0100399 | |||
| 2190 | Ga0501076_0193454 | |||
| 2191 | Ga0501076_0199076 | |||
| 2192 | Ga0501076_0548262 | |||
| 2193 | Ga0501077_0000624 | |||
| 2194 | Ga0501077_0001221 | |||
| 2195 | Ga0501077_0001720 | |||
| 2196 | Ga0501077_0007219 | |||
| 2197 | Ga0501077_0022760 | |||
| 2198 | Ga0501077_0081356 | |||
| 2199 | Ga0501077_0098445 | |||
| 2200 | Ga0501077_0137586 | |||
| 2201 | Ga0501077_0317482 | |||
| 2202 | Ga0501207_042868 | |||
| 2203 | Ga0501079_0000001 | |||
| 2204 | Ga0501079_0003968 | |||
| 2205 | Ga0501079_0006300 | |||
| 2206 | Ga0501079_0026049 | |||
| 2207 | Ga0501079_0040476 | |||
| 2208 | Ga0501079_0042195 | |||
| 2209 | Ga0501079_0057533 | |||
| 2210 | Ga0501079_0066096 | |||
| 2211 | Ga0501079_0103045 | |||
| 2212 | Ga0501079_0120970 | |||
| 2213 | Ga0501079_0184354 | |||
| 2214 | Ga0501079_0212946 | |||
| 2215 | Ga0501079_0406266 | |||
| 2216 | Ga0501079_0452806 | |||
| 2217 | Ga0501079_0539624 | |||
| 2218 | Ga0501079_0623383 | |||
| 2219 | Ga0501080_0002158 | |||
| 2220 | Ga0501080_0003585 | |||
| 2221 | Ga0501080_0019482 | |||
| 2222 | Ga0501080_0029846 | |||
| 2223 | Ga0501080_0032227 | |||
| 2224 | Ga0501080_0062453 | |||
| 2225 | Ga0501080_0161578 | |||
| 2226 | Ga0501080_0382006 | |||
| 2227 | Ga0501081_0000001 | |||
| 2228 | Ga0501081_0001766 | |||
| 2229 | Ga0501081_0001842 | |||
| 2230 | Ga0501081_0003476 | |||
| 2231 | Ga0501081_0038771 | |||
| 2232 | Ga0501081_0047263 | |||
| 2233 | Ga0501081_0052606 | |||
| 2234 | Ga0501081_0055915 | |||
| 2235 | Ga0501081_0075138 | |||
| 2236 | Ga0501081_0097627 | |||
| 2237 | Ga0501081_0123263 | |||
| 2238 | Ga0501081_0139443 | |||
| 2239 | Ga0501083_0002293 | |||
| 2240 | Ga0501083_0002761 | |||
| 2241 | Ga0501083_0006339 | |||
| 2242 | Ga0501083_0208135 | |||
| 2243 | Ga0501083_0534820 | |||
| 2244 | Ga0501035_0001281 | |||
| 2245 | Ga0501035_0014419 | |||
| 2246 | Ga0501035_0014843 | |||
| 2247 | Ga0501035_0056842 | |||
| 2248 | Ga0501035_0114552 | |||
| 2249 | Ga0501035_0330099 | |||
| 2250 | Ga0501044_0004690 | |||
| 2251 | Ga0501044_0089591 | |||
| 2252 | Ga0501044_0107913 | |||
| 2253 | Ga0501044_0271630 | |||
| 2254 | Ga0501045_0000641 | |||
| 2255 | Ga0501045_0000928 | |||
| 2256 | Ga0501045_0026066 | |||
| 2257 | Ga0501045_0028467 | |||
| 2258 | Ga0501045_0032587 | |||
| 2259 | Ga0501045_0049326 | |||
| 2260 | Ga0501045_0049599 | |||
| 2261 | Ga0501045_0632509 | |||
| 2262 | Ga0501045_0720874 | |||
| 2263 | nmdc:mga03683_92568_c1 | |||
| 2264 | nmdc:mga00v17_188513_c1 | |||
| 2265 | nmdc:mga00v17_23947_c1 | |||
| 2266 | nmdc:mga0yw44_10226_c1 | |||
| 2267 | nmdc:mga0yw44_127669_c1 | |||
| 2268 | nmdc:mga0yw44_15187_c1 | |||
| 2269 | nmdc:mga0yw44_443870_c1 | |||
| 2270 | nmdc:mga06z11_91359_c1 | |||
| 2271 | nmdc:mga05p37_182900_c1 | |||
| 2272 | nmdc:mga05p37_190055_c1 | |||
| 2273 | nmdc:mga05p37_2318_c1 | |||
| 2274 | nmdc:mga05p37_250690_c1 | |||
| 2275 | nmdc:mga05p37_308161_c1 | |||
| 2276 | nmdc:mga05p37_416991_c1 | |||
| 2277 | nmdc:mga05p37_565805_c1 | |||
| 2278 | nmdc:mga05p37_6607_c1 | |||
| 2279 | nmdc:mga05p37_946759_c1 | |||
| 2280 | nmdc:mga09592_1034835_c1 | |||
| 2281 | nmdc:mga09592_13265_c1 | |||
| 2282 | nmdc:mga09592_2473_c1 | |||
| 2283 | nmdc:mga09592_52444_c1 | |||
| 2284 | nmdc:mga09592_664301_c1 | |||
| 2285 | nmdc:mga09592_92614_c1 | |||
| 2286 | nmdc:mga09592_93274_c1 | |||
| 2287 | nmdc:mga0qj67_111978_c1 | |||
| 2288 | nmdc:mga0qj67_151171_c1 | |||
| 2289 | nmdc:mga0qj67_242283_c1 | |||
| 2290 | nmdc:mga0qj67_344340_c1 | |||
| 2291 | nmdc:mga0qj67_56792_c1 | |||
| 2292 | nmdc:mga06r32_43044_c1 | |||
| 2293 | nmdc:mga06r32_51930_c1 | |||
| 2294 | nmdc:mga08y16_108558_c1 | |||
| 2295 | nmdc:mga08y16_11412_c1 | |||
| 2296 | nmdc:mga08y16_143557_c1 | |||
| 2297 | nmdc:mga08y16_149061_c1 | |||
| 2298 | nmdc:mga08y16_178948_c1 | |||
| 2299 | nmdc:mga08y16_378288_c1 | |||
| 2300 | nmdc:mga0n895_169144_c1 | |||
| 2301 | nmdc:mga0n895_430832_c1 | |||
| 2302 | nmdc:mga0n895_66062_c1 | |||
| 2303 | nmdc:mga0n895_8817_c1 | |||
| 2304 | nmdc:mga0rr50_24310_c1 | |||
| 2305 | nmdc:mga0rr50_319866_c1 | |||
| 2306 | nmdc:mga0rr50_446113_c1 | |||
| 2307 | nmdc:mga08x19_428330_c1 | |||
| 2308 | nmdc:mga08x19_73607_c1 | |||
| 2309 | nmdc:mga0a205_21186_c1 | |||
| 2310 | nmdc:mga0a205_2601_c1 | |||
| 2311 | nmdc:mga0a205_47499_c1 | |||
| 2312 | nmdc:mga0a205_50263_c1 | |||
| 2313 | nmdc:mga0a205_56483_c1 | |||
| 2314 | nmdc:mga0a205_596722_c1 | |||
| 2315 | Ga0495601_0020842 | |||
| 2316 | Ga0495601_0287043 | |||
| 2317 | Ga0495601_0428063 | |||
| 2318 | Ga0495612_0001298 | |||
| 2319 | Ga0495612_0143853 | |||
| 2320 | Ga0500635_0123228 | |||
| 2321 | Ga0495595_0002166 | |||
| 2322 | Ga0495619_0035341 | |||
| 2323 | Ga0495619_0040721 | |||
| 2324 | Ga0495619_0126382 | |||
| 2325 | Ga0500566_0025639 | |||
| 2326 | Ga0501084_0000283 | |||
| 2327 | Ga0501084_0000615 | |||
| 2328 | Ga0501084_0033540 | |||
| 2329 | Ga0501084_0040610 | |||
| 2330 | Ga0501084_0070017 | |||
| 2331 | Ga0501084_0089455 | |||
| 2332 | Ga0501084_0091221 | |||
| 2333 | Ga0501084_0120105 | |||
| 2334 | Ga0501084_0145344 | |||
| 2335 | Ga0501084_0165212 | |||
| 2336 | Ga0501084_0170553 | |||
| 2337 | Ga0501084_0211281 | |||
| 2338 | Ga0501084_0248953 | |||
| 2339 | Ga0501084_0397381 | |||
| 2340 | Ga0501084_0603640 | |||
| 2341 | Ga0590075_070898 | |||
| 2342 | Ga0501082_0000620 | |||
| 2343 | Ga0501082_0002904 | |||
| 2344 | Ga0501082_0018541 | |||
| 2345 | Ga0501082_0018734 | |||
| 2346 | Ga0501082_0051205 | |||
| 2347 | Ga0501082_0124480 | |||
| 2348 | Ga0501082_0280780 | |||
| 2349 | Ga0501082_0519774 | |||
| 2350 | Ga0501082_0962516 | |||
| 2351 | Ga0530510_0001002 | |||
| 2352 | Ga0530510_0001060 | |||
| 2353 | Ga0530510_0043921 | |||
| 2354 | Ga0530510_0049390 | |||
| 2355 | Ga0530510_0063846 | |||
| 2356 | Ga0530510_0080283 | |||
| 2357 | Ga0530510_0084038 | |||
| 2358 | Ga0530510_0091685 | |||
| 2359 | Ga0530510_0100951 | |||
| 2360 | Ga0530510_0130786 | |||
| 2361 | Ga0530510_0246756 | |||
| 2362 | Ga0530510_0369931 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oiz-assembly1.cif.gz_A | crystal structure of antisigma-factor antagonist, stas domain from rhodobacter sphaeroides | 0.6655 | 90 | 136 |
| 3fg6-assembly2.cif.gz_C | structure of the c-terminus of adseverin | 0.659 | 89 | 136 |
| 3fg6-assembly4.cif.gz_E | structure of the c-terminus of adseverin | 0.6338 | 89 | 136 |
| 3lkl-assembly2.cif.gz_A | crystal structure of the c-terminal domain of anti-sigma factor antagonist stas from rhodobacter sphaeroides | 0.6176 | 90 | 142 |
| 3dtt-assembly1.cif.gz_B | crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution | 0.551 | 104 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0G2L6S5_4_245_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.6735 | 89 | 136 | 3.60.10.10 |
| af_A0A0R0FAV2_1_102_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6236 | 104 | 159 | 3.40.50.300 |
| af_A0A1D6HUB6_203_292_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.5992 | 88 | 135 | 3.40.630.30 |
| af_K7N1N6_1_170_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.5563 | 90 | 136 | 3.60.10.10 |
| af_A0A0R0JAC1_523_741_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.5555 | 84 | 136 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5P2B2V3-F1-model_v4 | Anti-sigma factor antagonist | 0.6612 | 81 | 136 |
GO:0043856
|
| AF-A0A839RWW1-F1-model_v4 | Anti-sigma factor antagonist | 0.6007 | 87 | 134 |
GO:0043856
|
| AF-A0A7J9VDQ0-F1-model_v4 | Anti-sigma factor antagonist | 0.5888 | 87 | 134 |
GO:0043856
|
| AF-A0A0G0AVG7-F1-model_v4 | Polymerase beta nucleotidyltransferase domain-containing protein | 0.5862 | 92 | 136 |
|
| AF-A0A520EQJ6-F1-model_v4 | carbonic anhydrase (EC 4.2.1.1) | 0.5715 | 74 | 136 |
GO:0004089
GO:0008270 GO:0015976 GO:0016020 GO:0055085 |